1WH0A

Solution structure of the cs domain of human usp19
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
134
structure length
134
Chain Sequence
GSSGSSGVDEPESMVNLAFVKNDSYEKGPDSVVVHVYVKEICRDTSRVLFREQDFTLIFQTRDGNFLRLHPGCGPHTTFRWQVKLRNLIEPEQCTFCFTASRIDICLRKRQSQRWGGLEAPAARVGGASGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquitin carboxyl-terminal hydrolase 19
publication title Solution structure of the CS domain of human USP19
rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 15
structure length 134
sequence length 134
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2004-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04969 CS CS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.790 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1wh0A01
4YLCA 4MJHA 2XCMC 4JUSA 4M5SA 2JKIS 3Q9PA 3IGFA 3W1ZA 4ELDA 3L1FA 2WJ5A 4M5TA 1SHSA 4RZKA 4YLBA 2K8QA 3L1GA 3N3EA 3GLAA 2KMWA 2O30A 3J07A 1EJFA 3GT6A 2CG9X 2MNWA 1X5MA 3AABA 3QORC 5DS1A 5DS2A 1WFIA 1WGVA 2CR0A 3VQMA 4FEIA 2Y22A 4YL9A 3QORD 2BOLA 2WJ7A 3QORB 1GMEA 2RH0A 4JUTA 1WH0A 2Y1ZA 3AACA 3L1EA 4PCKA 4YDZA 2N3JA 5LUMA 2KLRA 3QORA 2Y1YA 4YE0A 3VQLA 2N0KA 3GUFA 4ZJ9A 1RL1A 3EUDA 4PBDA 3Q9QA 4I88A
chains in the Genus database with same CATH superfamily
2QSTA 1MVYA 2ICCA 2VR5A 4KO7A 1ADQA 4CNIB 4D8OA 1HHHA 3U30B 2F7RA 2GAZB 4OQTL 4ZMVA 1UB5A 4X7CC 5I0ZA 1SXAA 1R75A 4ZX5A 2R0KH 3AQXA 5DO2C 3WLBA 3GRWH 2L04A 3MNMA 2O5YH 2VXVH 5I1GL 3BSHA 1KXHA 4I2XB 1G7HA 4HUKB 4FG4A 2WB7A 2HYMA 4DZBB 1Q9OB 4HH9B 3ETTA 4IBQA 1LEGA 1TMQA 3E3QC 3D69B 5IK3A 1C12B 1KF9B 5JXED 2NW2A 1A65A 3S4SG 3V0GA 4FTDA 3EH5B 2EEFA 2DIEA 2AXFA 4QTIL 2D7PA 4GP4B 4JO3H 2R1YB 1EZVX 5IROD 5JUEL 1J0KA 1XMEB 1XX9C 2NDFA 1A6AB 3CE1A 4UT6L 4HGKC 2OYKA 4M1GL 1PBYA 1GGBL 2BRRH 3HPJB 4J8QA 2M2DA 1HE8A 4NWUL 3KPQB 5JQIB 5L88H 1ZE3H 1NLBL 1KIRA 2MWCA 1OIOA 1ND0A 2Y1VA 1B4JH 2A0LD 3JWNG 3ZDYF 2G5BA 1DJXA 1GY2A 1TJIH 3H3PL 4HK3N 3GHBH 1OCZB 5JXAL 2FR4A 4R4ND 3MLUL 4P3WA 3IRZA 4QTFA 1IBFA 1M7IB 1PY0A 2VQ1A 4O51B 1HEZB 3FT0A 3MLSL 4KROC 3KPNB 4X8CA 4FHBD 4F7PA 4URKA 2XDHA 3H85A 1PG7H 1XO8A 1QWNA 3KPMB 4QRRA 2P8LB 3O3DA 5C0AB 1FGNH 4GI9A 3P02A 4OJFL 1QFPA 3L6FA 4DPRA 1WAAA 2CHXA 4HWEL 2R15A 1LO0H 2DKUA 1U8MA 2WXPA 3RKDD 2JTYA 2J6WA 2Z8RA 4N85A 4JX0A 5E56A 1JRHH 4ACTA 2PYEA 4CJ1A 1S6NA 4K3JL 3P2TA 1QR1B 1FRGL 3MNVB 1GA2A 1THAA 1DQQA 2YN5A 3TN0B 1I7RB 3JV6A 3Q5YA 4U2YA 1QPXA 3ULUC 4XP6H 4KKNA 3NGBB 5F3BA 4ZYKB 1RLWA 2CKNA 1DQKA 2YPLD 2F8IA 4G6MH 3A67H 4KK8C 3TBSB 1BMZA 2WLIA 3WI9A 3DDFA 5HHOB 4FD0A 1NUFA 8FABB 4ANXA 4JKNA 4U1GC 1UA3A 4UAOB 1SF5A 1F3JB 3GJFA 5IT2H 1KEGL 5SX4H 3VMPA 4C57C 2D3NA 2DYPB 4QNPE 4XOAA 1KMGA 2IDFA 3BQUC 1T1XB 1JFQH 3QXAB 3KGUA 5MP6H 5CHNA 1X5KA 1MF2L 4FNLH 4M8QA 3LTVA 4OIBA 2VLLB 3ESNA 4UM9B 1X6NA 4PJBA 3BUYA 3G3LA 4I1NB 1MRDL 4MXVF 1QSFD 3C2AH 1H5BC 1WT5A 4KY1H 4DP5X 1B6DA 1KENH 2JCCF 1IX2A 4G8FA 5C7XL 2XC8A 4AZ8B 5EC2B 4G6FB 2Y2WA 4HPYL 4HG4K 3QJSB 1RFDH 2FBOJ 3MOQA 4LF3A 2D3JA 3UAFA 4JL1A 4I3GA 1HOCB 2DJSA 1Z6JT 3NEEA 2MNWA 3F3HA 4XPBL 5EEUA 4PWJA 3T4AA 5IW1B 4KNSA 1DDHA 1YYLH 2VWEE 4WFED 5EF0A 3X12A 2YPLE 4MQTB 1ZGLP 3U30C 4P23D 3V5HA 2XHNA 4I0KA 5H37A 3HPLA 3SGDH 4PRHA 3RVXC 4TN9A 4L29B 5LB1A 5IVZA 1N6VA 4TOYH 1XXDC 3ZKMD 3DMMA 2YEQA 3I6LD 3ELQA 4LMQE 3HMWL 4BZ1A 4H1LB 2B39A 1W0YT 3EGDB 4DZ8B 2A74C 3L45A 4XTRC 5F9OH 4HUWB 1R3IL 1CTMA 3CBJB 3D25B 4ILDA 4P07A 3JYCA 5GS2D 3RRQA 1QHPA 3EDDA 2AANA 1FH5L 2GKIA 3UL4A 1M05A 4GAGH 5GGQH 5I1IL 4ODXB 4XNYL 1QSFE 4FF9A 4G1MA 4K3HA 2PETA 4PP2B 4RQQB 1RH8A 1GZQB 1TOXA 5JYLA 1RURH 1FYTD 3R06B 4P5TD 4B0MM 2COQA 4PTTA 4GQRA 1HHGB 5AALA 4L8CB 2BERA 2KS0A 3DVNA 2OSLB 5C86A 2WXFA 2Z35A 1KLGA 4OU3A 1AGDA 5EO1A 2VR8A 4FI6A 3L1GA 3B9DA 3C60D 2EH7L 1QUNA 3D30A 4PV8A 4IRSB 2VDQH 2YPVH 1QW8A 3C6SA 3LPWA 4YOKA 4WFEE 5DI8B 5I1EL 2NZIA 1QO3A 5HVWA 4WSGA 4QHLA 4NQVA 5HJ3A 1KTDB 4AG4H 4YHML 1QYGL 3EO9H 1IAIL 4ZSOA 1BEYH 1NIEA 3OKDA 2XV0A 3RL2B 4F7CB 3I6LE 5DMJB 2AC0A 5T8IA 4PMEA 3ZMRA 3O8XD 1JGEA 4L23A 5K9OA 2F8VA 5HYFA 2XN9B 3RPBA 1PZSA 3GMLB 3QHTC 4PS4H 2Q87A 3TN0C 2VH5H 4A2LA 2B4CH 4MJ6A 3O0RH 4YSTA 2Q8AH 4RWYH 5EOTA 4GXVH 4Q0XL 4QXVA 1XSKA 5B3JF 4QKTA 1NBVL 3UPRB 1FYTE 4GRWH 1TUPA 3HE7C 4PJEA 3APNA 4DPCX 4DTGH 8CGTA 5KAQF 3FN3A 4LLMB 5DZJA 1MCNA 3RWGA 1OY3B 4NKQB 2R2HA 4UAOC 2IALA 1SEQL 2EDLA 3MRJB 3T04D 2A9MH 2A6KA 2Z4QA 2XVLA 3UEZA 3TFKC 4F2MB 5L9DH 1LILA 3SPJA 4LLWB 3MTXA 2DWDA 3FPYA 1XD0A 4WWKB 4FG6C 3B1TA 3CPLA 2J44A 4BFRA 4E9XA 1KFAH 4LCUA 4PJIB 1TJHH 4E9TA 5BMFH 4HIIA 3NJVA 2PPAA 4ODWB 5D7IF 3JWNH 5IM7B 3SDXB 1E4WH 4ZFOL 5FB8B 6CGTA 3EJQA 4HHAA 2JKSA 2GVYA 3THML 2BP3A 4XBGA 3TP4A 4XMUA 3VSVA 4X42A 5A2FA 2FT7A 2JKIS 4L1SA 5TDOB 1B4RA 4L4VB 3EFDH 3RFZB 2DJUA 3HS0B 5SWSB 5SWZA 1DBMH 4ZD3H 3D87B 3BDBA 3UTSB 3BDXA 3WKQA 2Q7YA 3REWB 3QHZL 2LOEA 5GSVA 4D9LH 4FLOA 3TASA 1J8RA 3VVWA 4IRJB 4M3KB 4YDZA 3K1DA 3ZX1A 3OGCA 3GLZA 1AKJB 4JDEA 1CUOA 4N0CD 3LZFH 4PY8J 4MJJA 3V4PA 1QLEB 4LIQL 3L9EA 1BIHA 1QSZA 2ZXEB 5I1HH 4Z3HA 5M7QA 3WN5A 1FL3A 4FA8A 1ZK5A 2QV2A 1D5BB 3BWAA 2GYSA 3R1GL 1HJBC 2FR4B 2YKKA 5D93B 4GH7B 1SOKA 1TPXB 4RRPM 5DUPH 2EE2A 3RAJH 2AV1A 3R8BB 4XBPB 5JR1H 2ZUUA 4YO0A 3AJ7A 5E1GA 5F0LB 4HWZB 4OW6A 5F0PB 5EU6B 1I3GL 1S78D 5K33A 1WLHA 2VMDA 5CP3H 1T0NB 5FC9A 3GUTB 1S7UA 2YOCA 2K4WA 4F37K 3G5YB 4UDUB 2YR3A 5DFVC 1KN4H 5KOMC 3VFWA 1NOLA 2HFGL 4UANA 3ZPDA 2QPUA 3K72A 3EBIA 2TSAA 1OAUH 3V4VL 5F6IB 1HZLA 3BFOA 4N2FA 1F58L 5B1KA 2Z7WA 3I9PA 3BVVA 4J3WA 2ZWSA 3G6AA 3KGSA 1B4LA 4OQTH 3JV6B 4JKKA 1UH3A 2XY1A 4HKXA 5EH1A 1J0ZA 3JV0A 3ARDA 2GT9A 2PXYA 3S3BB 1KJ2A 4P99A 4WI4A 1XCQA 5I1GH 4KNTA 2DQ6A 2R69L 2KZWA 3FONB 2WLIB 4AENA 3MZTA 4GBXD 4MXWL 2I24N 4WY7L 3SDAD 1JZ7A 1RJZA 1FVDB 1K2DB 4IBSA 4G5ZL 2C1OA 4JRYA 4LCCB 4FC3E 2AABH 1PSKL 1RZJH 4BQ9A 4DERA 4RZCA 4WW2F 2X41A 5DUBA 3LZOA 5E2VL 5IMOB 2W9LA 4FNSA 5MEOA 4QTIH 5KSAA 4KVNH 2JI2A 1RLBA 4Q9QH 5T5NG 4LCWB 2CK2A 4UT6H 5D7KD 1QLFA 4M1GH 1VFBB 3WO4B 5EIQA 2GCYB 4A6YL 4KK9D 3RIFF 1QZ1A 3BVXA 3E7JA 4WU5B 1NLBH 2VXTL 5FKPA 3BKCH 5IG7B 4HV8B 4OB5L 3CSYA 2PKDA 1CL7H 5JXAH 4PJ5D 3MLUH 3SDCC 1XEDA 3QNYA 1E28B 4HWNA 2JSFA 1NCCL 1OQXA 5LG1A 5GGVL 3VGDA 5TQ0H 1MW2A 4U1HA 3QQ3B 4FXKC 3KL3A 2QR0A 2DQIH 5AUMA 3O3EA 3ULUF 3LV3A 3F6JA 4GO6B 3EO1B 1G6VK 3OKMA 3OAWA 4XMVA 2MSPA 1H3PH 4QRSB 3NCMA 1J8SA 3Q43A 5G5DB 3SY0B 3HPLB 1NPJA 1QAWA 5DHYA 5D6DC 1JZDC 3ZDYE 2C9XA 3QULA 1FRGH 4HUCA 3SOTA 4NERA 3RFZC 4YBQC 4PBDA 4H25A 4XNQA 3CZEA 4EDXA 3CU1A 1OPGH 3FCTA 1KT2B 2GI7A 3MO1A 3CQQA 3G08A 4AQ8A 4MXQD 3VXNA 2BIIA 4R4FH 2QV4A 5D7KE 3ARPA 2D03H 3TA3A 3BFQG 1WCQA 2MOGA 3N06B 2LU4A 1M05B 1BV8A 1JGUL 3I02B 3NP4A 4HUMB 1E3ZA 3GSNA 3L3KB 4IRJC 3T4YB 3T0DA 2MIZA 2EC9U 1KEGH 3MFGB 2V7HA 4PJ5E 3PG2A 5DC2A 1T0MB 3BKJL 3D18A 5LCVL 1JHTA 2PABA 1MF2H 2AF2A 4ICWA 3FAWA 3K6OA 1B3IA 4UT7L 5FHBH 2NYYD 2ZXAA 3K91A 5CZRA 1BDYA 2FJFA 4ORGB 2ZOUA 1MRDH 5DJXA 3C6SB 5E2JA 1OLZA 5D2NA 5C7XH 2Z92B 1J1XH 4NNYB 3QEQB 4HPYH 3ZN6A 3BZFB 2X38A 3IXTB 5D7EA 3UBXG 4JM2A 5I5RA 1Z0MA 2NUTA 4PSPA 3U46B 4ZSOB 4GPVA 3P73A 4IBUA 3NJNA 3QI9A 3TTSA 4XNXL 5AVXB 5DUJA 4ETQB 2AEQL 2ATPB 2ZOKB 4XPBH 5F6IC 3D4GA 3PP4L 4FKKA 5H35B 5I0DA 4UIKL 4FLQA 5CGTA 3P2DA 4WO4A 1NCWL 3ECBA 4U1NB 3C6LC 1KTRL 1A4KB 2WCGA 5GRUH 2EAEA 2UZIH 4ABWA 4BHUI 4CVUA 3QUXD 3VTMA 4MXVE 1UVQB 4F80A 3D12B 2WZAA 3T3PB 2JCCE 1JK9A 4I1PA 2X6MA 5TE7L 1DQDL 4HUUA 2G9HA 2FYYB 3FRPB 4A55A 1AIFA 2VDPB 4J7RA 3CN1A 3ZDXB 1P7KA 1MCFA 2HVKA 1OOWA 1B0RA 3CFMA 3ESVF 4I18B 3SE4A 8PAZA 1FH5H 4WWPA 2IBBA 1JWSB 2MCPH 1BXVA 4X98A 5I1IH 4NQCA 1E9PA 3OR6A 4BKSC 5HHPB 3TBVA 1EZUA 3RJDA 3CDYA 3DX7B 3SCMB 4ZFQA 3SE9L 1JPTH 1CE1L 1E8WA 1A3ZA 4HEME 3WO4C 5JQ6H 4UOZA 3QUMB 4LCUB 3ZGHA 1YNLH 1WC7A 1JAEA 4FNRA 1VA9A 1HILA 3DC0A 3VFTB 4X6EA 4XB7A 1TKWB 2HCZX 2VLJB 1A1OA 4ADJA 4QF1A 4LLDA 1FYHB 3W5NA 2P26A 5KJRL 3DO4A 1WHOA 1NCAL 2NY6C 5I1EH 1T89C 2YD8A 1YDPA 43CAA 2VABB 4NS0A 4ZQTA 2V0AA 2E74C 4NQDB 2JKXA 1SJVA 4YHMH 1SN2A 4TXVB 4GG6F 2APWA 1DUYA 2GBUA 3QFJD 3F84A 1Q1JL 5D1ZD 2F19L 2Y36L 4O02H 1KB9K 2BWQA 2G2RB 5IR1B 2HJKA 2WP3O 1UT9A 4Q9CA 5GSVB 5KVFH 5FGSA 4XMKL 2J3SA 1R19A 4FABL 5C3IA 1H9VA 5I8OL 2CDEB 5GGSY 2XWJB 1RPKA 4XPTL 3EKCA 3ECWA 3MROA 5E2UL 3V4PB 4Q0XH 2VMEA 4DHLA 4P3DA 4MNQD 3WXWH 1NBVH 1YJDL 4MCNA 4XMPL 4CMHB 5BPPA 2DQUL 3KL5A 1WSST 4W6YB 5ALBH 1I1FB 4H20L 3GI9L 4EVNB 5F7AA 3VDAA 3IMVA 5T1KA 3S88L 1NC4A 4RMWA 3WFBH 3MLTB 3VWKB 4UU9B 1OZUA 3NPSC 5E00A 1OCRB 1KTJA 2KLTA 1OM3L 3C5ZA 1FGVL 1RJYB 1JNLL 2QQLL 4F8OA 4QOKA 4OZFH 1XF3B 3QZNA 3WIHL 3HEIB 4ZUWB 2VDML 2Y06L 1R9FA 3OWRA 2ARWA 3ULVC 3RUGB 4HFUH 4QO1A 1MCKA 3K72B 3LVEA 3OAZK 3QFJE 4IGBD 5B3JE 1MCWM 2IAMC 4NC1C 1YC8A 4MJHA 4UT9A 2D2CC 1ES0A 2CLZA 4OFVA 5J3HC 1P0SE 1IJ9A 4CVXA 5HTSA 5HI3C 5I8EA 3PGCA 3RWFB 3OX8B 2K4AA 1NPNA 2ZUSA 4UMSA 1XCQB 2R1XB 1GGIL 4PYHA 3U6RA 4HS8H 4ZTOH 4NPYB 1A5FL 2EDMA 4MNQE 5ETUB 4MJ4A 3N40P 5EBLA 4HSQA 4ZMLA 3LKQB 4FQQB 2C1OB 1N59B 3W57A 2QADD 2E0PA 1F00I 1U8IA 4ZPTA 5KN5B 1AQ8A 2CBMA 3RZCB 3HB3C 5D7IE 4H88L 4M5SA 1EEYB 3A4AA 3DKHA 2CU9A 4W6XB 2NY5C 4LIQH 1S9XB 5AVRB 1QNZH 2QHLA 4N0UA 2HWZL 4XMWA 3R1GH 2XFXA 5IQ7L 2UZYB 4Y4FB 3CNKA 1Q38A 4NOFA 3SCMC 3QNYB 3TT1L 3IFLL 4GUCA 2IGFL 4E9WA 4RWHA 5CGBA 3QGVA 4U1HB 4Q52A 1NKOA 5HHNA 1T22A 2GW5A 2YUXA 1RUPL 2YBRA 5E1IA 5ESQB 3TIEA 1N64L 2ZD0A 5LN4A 3AXHA 3MRKB 5TE6L 4Y16A 1C16A 3V4VH 2QPFA 1UZ8A 3QCTH 2AI0L 4KK6C 2CR0A 2LHAA 3FUNA 2QQQA 4RAVA 5D70L 5L0QB 5KYUB 1GW6A 3MRIA 3HMXA 4E41E 3IE4A 3MLVL 5HHXL 4H25B 5E1QA 4EDXB 5I1DA 2VAAA 4LEEA 2DL9A 3FCTB 1WGOA 4H5SA 3D85A 4PWFA 2LU5A 3MO1B 1S5HA 3EH2A 2BWDA 1OL0A 4FDWA 4KROD 4AMKL 2R69H 3TA3B 1VENA 1ZLDA 4WFHD 4PGCA 5ERWB 2HFTA 5F1OB 2VM3A 3W38A 2BZCA 4YSCA 3NAAH 2ED9A 1I9IL 4FYQA 4U4BA 4JO2H 2YD0A 4XMXA 3E3QE 1MPAH 4CMHC 4LLQB 1EJ6A 4MMZA 1JNNL 5E2WL 3VI4A 3OJMB 4EUPB 4HUNB 4QXUH 5HDQH 3ULUD 1L9RA 1IBGH 4PJIF 4Z7NB 1NFAA 4N8PA 3SDXF 1J8HA 4MQ7B 3TBBA 4KK8D 1X44A 5CIPH 5AD0A 1Q9WB 1L7IH 3EYFA 2OR9H 1H8NA 4ZG1A 1U8NB 5GGVH 2EUWA 5E8DL 4PRDA 4RVBA 4M1DL 3BQUD 1UB6B 1AY1L 1F4HA 4Y4HA 4CN1A 1QTYT 1GMEA 3PWPB 1YG9A 3GSOA 4L9LA 2MCG1 3VSUA 2DQCH 4UQ2A 2JELL 2PCPA 2VN4A 1K4CA 3AC0A 4X5WB 5EULV 2EADA 5F7YC 4ALAC 2NOYA 1E42A 5LGJA 3FS9A 5EUKB 5IQNA 3L4YA 4XAWH 4P5RA 2OSXA 3JTSB 1DQMH 1SJEA 5FYKH 2FSEA 2QFPA 3DURB 3ZL1A 3X3FL 1QFHA 2A77L 4N2DA 1KGYE 1VEMA 3INUH 2JLPA 4R90L 1B0RB 4WTZA 5IJKC 3RZCC 2HG0A 3TU6A 3UX9B 3ULUE 2FDBP 1JGUH 2DEYX 3LKSA 2GJJA 1N0XL 3L5XH 3C8KB 1S4IA 1D7FA 1SMDA 2WXNA 2WXRA 2GJ6B 5BQ7B 1S7SA 3V0VA 1GZHA 3RVXD 4QT5B 5E4IA 4XNZB 1SBBA 2PP8A 3WKPA 2PCXA 4S1QH 3L2LA 4OZIB 3CN3A 1N3NB 2NY2D 43C9A 4BIKA 5ITFA 1MLCB 4UT7H 4I48B 1S5IH 3AB0B 1U8CA 4NRYA 4TUOA 1YEJL 5INCA 5D1ZI 4Y4FC 1QNIA 4LLDB 4F7KA 5T3XD 3X11A 4I9XA 3KAAA 1QHQA 3T3MF 4FN0A 2P5WA 4Y5XC 5DK2A 3V6OA 2A6IA 2DWYA 2VXQA 1UXLA 3OC5A 4Y9GA 43CAB 1TSHA 4P4KA 2G75B 2YD2A 2HKAA 3ESPA 3GRBA 3MNWA 4N8VA 2FJHA 2GSIA 3ABZA 4L1LA 4J3TA 4BFEA 3QCUH 3QXDA 4MA7L 3TBCA 4QMEA 3VXRE 1B90A 1U91B 2ZT9C 3GMQA 3WNNA 2H0PA 4JB9L 2X4QA 2BHYA 3A22A 3L3IB 3PAYA 2WUBL 4Y9CA 1FL6B 4JANB 5L0QC 1IAKA 2VZUA 2E3VA 1X5MA 1XH0A 1J18A 3ATDA 5GIRA 4R97B 1A7NH 4IBZA 5IQLA 5JHLL 4IMLA 4TULL 4NENA 3SZKC 2Z93B 2XKNA 5DMIL 2CHWA 4X6DB 1AIZA 4JFSA 3MUHL 1N7MH 1HINH 3F7LA 3LQAH 4LRIC 5A16A 1KBPA 1WWBX 3QIWB 5AYTA 1OTUC 5IF0B 3KS0J 5C0AD 3CVHL 5DSCB 1QKZH 2CCLA 2CXGA 2N0MA 4NNXA 5T1KB 3TZVA 2E56A 2J5LB 5FV1L 3K81A 4I2XE 2QHRH 3LH2L 4CVWA 5ID1B 5GZOC 1YMHA 1ZV2A 5JDSA 1P4BL 4XZUB 5T3XE 2YXVA 5HGHB 2G60L 1QRNB 2X4UA 4WI9A 2YJLA 1JZJA 4QOKB 3KLSA 4J12A 3TN0D 1BM3H 1I9RL 3MRGB 4M02A 2X1QA 5IMKB 4TLUA 5B1JA 1QMUA 4JFUA 2AK1H 1FNGB 1WUNT 5IBTH 4H0IA 2MH4A 3IJ9A 4GQ9H 2OMZA 5JHBA 4YEFA 3TPUA 1T2QL 5HHOD 5KJRH 2VIRA 3TNMB 2WGNB 5I73B 3LPOA 5AAPA 5D72H 2XSKA 2B8OT 3OL2A 2DYPD 5CEXA 3TFKD 3OKKA 4BFBD 5B3NA 1Q1JH 4OGYL 5CN3A 2Y36H 3WHE1 4JFPB 2R2CA 2MQCA 4UM9D 1ZV5A 4RDQG 1N26A 1RUKH 5FCSH 3UOAB 5IEHA 4PVBA 3MLWL 4IBVA 1L5GA 3NTCL 3LKRA 5C0AE 1PZAA 1MIML 2X4OA 3BVTA 4FABH 1TYJA 5F44A 2BSTB 3HBZA 3DUUB 1T1ZB 5F7UA 3H9YA 1G6RA 4XPTH 5ID0B 4G6FD 4P46B 3I6GB 5D7SL 4Z7OB 1URZA 4ONHB 2WINB 3C2SA 2BOCA 5E2UH 1YJDH 2J6EA 1AS6A 2UXGA 2DQUH 2ADYA 4GG6E 4N0UB 1WWCA 4H20H 2V2WA 1P4UA 4C4KT 5GZNC 3IDYC 3S88H 5E99L 3AG1B 4TPRL 4K9EH 5C6WH 2CKBH 3MV9A 3HW7A 1FNEA 1NL0H 2N59A 2AQSA 5HHOE 3QCVL 1KPRA 1FGVH 3FT4A 2QQLH 2QQNL 1IVLA 3MA9L 3OJDA 3H9SA 4FQJL 5F7NC 5FUZL 1U95A 2CJUL 4N86A 1RZ8B 3WIHH 5JPNA 2VDMH 4JY4A 4Z5RA 1LYQA 3AB0C 5E0FA 1O0VA 4FADA 2IWFA 2UVFA 3O41B 1JERA 1H0DA 3FQNB 4RMUA 2XZCL 3CZGA 3V0JA 1NCNA 4LVHB 1YHPA 2OL3B 1OP4A 4G83A 1KIPA 1QQDB 3T3PF 5SX5H 1CMOA 4H5SB 3JT2A 3V52H 3GC3A 4G70B 5EDXA 1XHHA 5AVSB 1U8JA 3PJNA 2BNRA 1GGIH 4HXBL 1MNUL 2MHAA 2V3EA 3LNHA 1A5FH 5BOZG 2RA1A 2H9GA 5DFVD 2W59A 1KIUA 4QPEA 1PY9A 2PMZA 4IRSD 3NN8A 4R7XA 3R7RA 3FNKA 3GJEA 4GSRA 5GS1A 1E6JL 1TLKA 2V37A 1QI5A 3T0EA 1S7TA 1UZGA 3J2PA 3KEDA 3IMUA 3QIWC 3RURA 4R8WL 5IGXH 4U6YB 2BMKB 2DQDL 3B9EA 3QIUB 1NAMA 2KLRA 1FHGA 2C4FT 2J5LC 1D5ZB 4QHPA 5GJTL 3AS2A 1D6EB 2OJZL 2HWZH 5I66A 1Z9PA 1GPOL 3LQZA 1LP9B 4QXGH 1KCVL 2XN9D 3A6OA 4HD5A 1BZ9B 4KOCA 2EUZA 1ZXKA 2IGFH 1VFAA 4JGJA 2WWOA 5DHEA 2BWIA 5DEZA 4IBWA 4YHLL 3D34A 3EFOA 5HBBA 4JLRA 1LEKA 1A7OL 4UQ2B 1NGWA 5JW5B 1G9NH 3MUJA 4EN3A 2JQZA 2ROYA 3MMEB 4P04A 4XVUC 2WVUA 5GRJH 5D70H 3U0PB 4AL8H 3MJ6A 5LAXB 1P7QB 2WVSA 4A7GF 3D0LA 3QWQB 5AVTB 2NR6C 4YIQB 3D07A 2OMXA 1UJTA 3VB8A 4WWKD 2BIHA 1IGIL 2HKHL 1CG9B 5C3LD 3FOMB 1DQLL 3QS2A 1R5VB 4Z6AT 2OTPA 1LE5B 3KYAA 3ZSTA 3VFVA 1N2RA 2Z31A 4PB9L 3HVNA 4M43L 4D9RD 4FFWD 3VCLA 3L4CA 1EDQA 4P46C 3K71B 3NIFB 5C0CA 2Z7ZA 3H3KA 3Q3GA 3KYOA 4ODSH 3DV4B 1MEXL 5GGSA 2EIZA 2XN9E 4RDBA 4GQQA 3TO4A 3UC2A 2ZAGA 4PVMA 3GRWA 3CC5A 4L4VD 2IPKA 1JNNH 2H0EA 3WUWB 5SWSD 4I5BB 3U7AA 4NRYB 5AW0B 1MCSA 3QZOA 3F7VA 3UTSD 5D7LE 1BXAA 4XHQA 2FYVA 3C87A 1QOKA 2AMGA 2PN5A 4DGYH 5MEPA 1CGTA 4NJAL 3VFGL 4LEXL 4HJEA 4IRJD 5DJAA 3WU1A 4E9QA 1AKJD 4OV5A 5C0GA 4F2ME 2GK2A 3QPQC 2QJDA 4XP9H 5F7EL 4CADB 2A9NH 2VDOB 4V2CB 2QKIB 4YSOA 5KYYB 2OMVB 5T33H 4JVUA 1ONQA 3LH9A 4PJIE 3FQUA 1QLRA 4XP4H 1MFDH 5F9DC 5K9JL 3CSPA 3SDXE 1VLXA 4D9RE 1YEEL 4POUB 1RZIA 2PP7A 3TYFA 3ZYZA 1UT2A 3RWDB 1EK3A 1OT2A 3MRDA 4XVSH 1PL3A 4N5EC 1YEIH 1INQB 4AWJC 2A77H 2BNUB 1EGJL 4L4VE 5JO5A 1URLA 2BCMA 2H6UA 2VDKL 3QQNA 5SWSE 3UJIL 5AZ2L 1P53A 5A2KH 1IKNC 1DVFA 2WKGA 2YGOA 3IS0X 3IKKA 5I6OA 2X12A 1EAOA 2CO6A 5FECB 3UTSE 4XN5A 3FQ4A 2VXUH 1F18A 4HX1B 3KLDA 1PQZA 3DO3A 3SGKC 3DPBA 1BX2A 3QIUC 1J5OH 4AEHH 3ZUCA 5JW3H 1SLWA 3BP6B 5HDRA 4J8RB 4XXCA 1YEJH 3N2JA 1HI6B 2AITA 1J0IA 1GC1L 4Z8FL 4PJGA 5F21B 3C09C 4ZUSA 4BH8B 3PHAA 4YXKH 3MSPA 3F6LA 3PNWB 4LSQL 4OFDA 5I82A 4DEPB 3HNSL 2MNUA 5JIMA 3S35L 5JYMA 1LTXA 2HVJA 5E08L 4F58L 5CFAA 1C5BL 4LCWD 3MV7A 5JIIA 4F7MA 4U0RB 4YHIA 4CKQA 2GITA 3KM1A 4K2UL 4YVNA 3PWVB 3IDIA 3O9WB 3MLXL 4L37A 5JNYB 2A5UA 2PTTB 3PV6A 5I23A 4Y7MA 1NEUA 1TCRA 1ASPA 1KDIA 2ZXBA 2CPUA 3T3ME 5HPOA 2BOCB 3MCKB 2X9WA 3IBEA 1JTPA 5CINH 5DDHA 2H8PB 2R29H 3VTAA 3UIYA 1J1PL 1HC1A 1NFIA 2ZX9A 3BH9B 3MUGA 3GRGA 1PDKA 2UUDH 5E51A 1PIFA 3U79A 1FNEB 1L0QA 3IF1A 1I1YA 1P4BH 2JJSA 3EJCA 2HT3D 3PV7A 4TUUA 4JM2F 3FT4B 2B20A 3SKOB 5DO8A 3H9SB 1CIUA 3TF7C 2B59A 1I9RH 3HRZC 3BXNB 4FQXB 2P48B 3CFBB 3VACA 3PWLB 2MQ0A 2FNBA 3MVSA 4LCWE 3UCRA 4G11A 5HYIA 4F7TA 1H0DB 1FAIL 1PLGH 2WXLA 3QDGA 2WUCL 3GK8L 1AAJA 2N7AA 1FFQA 5ACLA 5ICZB 4HUVB 2D7OA 2NYKA 3DV6B 4YE4L 1AQHA 2ZUQB 3BT2L 1U8JB 5TF1H 3FT3B 3EYSL 1HCYA 4JE0A 4ZDHA 2WQVA 1KELL 3JWOH 4PLNC 4HWBH 3MJ9A 4XVTH 4CBZA 1TU2A 4ODHL 2WQSA 2UXFA 4UQ3B 1EANA 3MLWH 3QUHA 1TCMA 3VA6A 3RVWD 4M48H 2YPVA 3WDIA 4E5XB 5IHZA 2H6OA 4HLZG 4K71B 2WD0A 4J3SA 4PREA 5H94A 3GI8L 1EZLA 2XPGB 4JKPH 5CCJA 2VT0A 4ZW5A 4IU3A 3QEQD 5J3HD 1PZUB 4G9FB 4U7SA 4MRCA 4PJFB 4TVUA 3AU1B 3HUJB 5HI3D 3SQOH 1OE2A 1IGYA 3NSYA 1AJ7L 2W60A 3CFIC 4OZIF 2PNDA 4G6JH 2DZEA 2EIDA 1U2YA 2W91A 4ZFFA 5I66B 2R83A 3Q7JA 5DEFB 4WW1B 4LVNB 4WNQB 1OGAB 4X6CA 3VJ6A 3D3VA 1RL1A 2FBRA 2YUVA 1L9QA 1MFUA 1PX3A 5C8JA 5D6CB 3UAAA 2GFBB 5JQHC 1VFAB 3QCVH 4K7FA 3MJ7A 3GSQB 2QQNH 3EHBC 3RWCB 4HS3A 4FQJH 3BEWB 5DTFA 5FOBA 4W9KC 1UKSA 3FFDB 4GSUA 4NZJA 3A6CL 4OJDH 3EXJA 2F1BA 4GKOA 3AG2B 1WFOA 2XZCH 3U36B 4NPKA 3S4SA 3BGAA 5GGVY 5F72S 4D8PA 2HFFB 4DEPC 5DR5H 1Y7VA 3ZHLA 4NC1E 2R0LL 3SCMD 5FLVA 1UKQA 3CLEL 2DH2A 1G9ML 5DZNA 4LOUD 3QEQE 5DWUH 5TK4A 3W9DB 1YPZA 2WAQA 2PWEA 4PR5A 5DJ6A 1UATA 2A73B 1CICB 4ZSOE 2XVGA 3O9WC 4R0LA 1ZA3A 4AKOA 2VLJD 4G9DA 1IZKA 4XXWA 4EI5B 4MBOA 3BWSA 4LEOA 2YGVA 1RIUH 5FDWB 2EVIA 4NFBA 4FLHA 4KK6D 3VD0A 1EH9A 1E6JH 2WOYA 3KLLA 2C3GA 3V0WL 2F68X 1QATA 4NQDD 2IPKB 2F74B 3T3PE 4Y8DC 1OW0C 1NGZA 2DQDH 3JTTA 4F9LA 3QO1A 1OAZL 4PWEA 2VZSA 2OA9A 5FFGA 5GJTH 2FX7L 2H2PD 2K7QA 2AEPH 4O2EA 1TMCB 2A4EA 1ROCA 4HZAA 5LNDA 4KRMB 5A3IC 1L9PA 2C9PA 5A1AA 3CFEB 3OJ2C 5DRZA 3NIGF 4FNPA 4JO4H 1CF8L 1RZPA 4FQXC 4WGKA 4C47A 2EJ1A 4OBRA 1TQWA 1UXWB 1PG7X 3KJ4B 1NBCA 3EJJX 2W07A 4F37F 4JW3A 1AXSA 1MHEA 2FAUA 3SQRA 3BO8B 3QEHB 4M5ZH 1QLRB 3GIZH 4KTDH 3VWKD 1UGNA 4YX2H 2VLJE 5TH2A 3TYFB 4Z7OF 2XTJB 3MREA 5DQ9A 1HXYA 3FB6A 3LD8B 4PG2A 4AK2A 4LLYB 2MCMA 1AZNA 4Y9EA 5J11B 1IGIH 1SDAB 2HKHH 1FIEA 1DQLH 4LSPL 3RGVA 4NQDE 4FNQA 5JO5B 3B7RL 2C3VB 2QQKL 2N3JA 5C0FB 4K71C 4M43H 3VSQA 3VUAA 4KQ3L 2FVNA 1IC7L 2OYPA 4A66A 4OQTA 1ITBB 4ISVA 1MEXH 4XC3L 5HDLA 5B39G 1AGCA 3DPBB 3QAQA 3IJYB 5ISZA 2ZPKL 3HJ0A 3T77B 5CWSA 4HKBA 5JIDA 1Q9LA 1VF5C 4RETB 3KYNB 1BQRA 2AKRA 1J48A 1RSYA 4OCYL 3N91A 5CSBA 2J7LA 4UOW1 4JREB 2PCFB 1ZVYA 5TGBB 5HYEA 3Q8CA 4NKOA 4BSVA 4MA8H 3POCA 4N2LA 5CR1A 3WS6C 3LKOB 2F54A 3LNEA 4NKMA 3RZCD 4KH9A 2PW2A 2XKUA 3VFGH 3BDYL 2FEJA 4I88A 1R3HB 2P47B 5KYXA 32C2B 1ETB1 2Q3AA 5K1VA 3RTLA 4UOQA 4UT6A 1U58B 4L8SC 4QGTA 4L3EA 4K8RD 1KPVB 3RDTC 3LRHA 4IM8A 1MIEL 2R39A 2P52A 3LZQA 5IZ7A 3NJHA 1X5FA 4HC1H 5GSRA 3FB8A 1RZGB 7PAZA 5C7ZA 4MAYB 3WEBA 4AYFB 2ZONA 4L9DA 4M61A 2NY1C 1A7PH 4Y4FD 1NBYB 2IG2H 5CBAA 3ME0A 1IE4A 1I3VA 1U3ZA 2C4XA 5E6UB 1IBDA 2G3ZA 5F7KC 2PO6C 4H8WC 5EIIB 4JZOA 5GXBB 4J4PD 5BXFA 2YO3A 1B88A 1N67A 3VI4F 2A2QT 1CICC 4KKCC 4NP9A 3ZZQA 1EGJH 4J23A 3S36X 2Q6WB 2YAFA 3FT2A 3WDHA 3KE0A 5H8DA 3SPVA 2VDKH 5AZ2H 1PY4A 5H4YA 1LP9F 2ORBL 5KAQG 5LN8A 5AYUL 3P11L 4TM9A 3RHWK 1MFBL 3WJLC 3IDGB 2B59B 5BZWB 4DKFH 1JGDA 2YUZA 5LHDA 1UUSA 1JWUA 3UO1H 4JG0H 5E5MA 1IKOP 1BFTA 2CBQA 3KG5A 4TNGA 2AEWA 4ZO6A 4F7TB 4Z7AA 3TA3D 3DBXA 4X8JA 1OTUD 1Q0EA 4GP5B 1V3KA 2DQEH 1X9RA 4U1LB 4BQ8A 2EKSA 1BQHG 4AQAB 1CZ8L 4QLRA 3L3HA 2QZ5A 5GZOD 1ZGLA 3RYMA 3OXRA 3MJ8B 5GGTH 1CGXA 3S35H 3KJ4C 4YH6A 1CBJA 3ZL4H 1O7DE 1C5BH 1KCSL 1R24B 1TVDA 1YAZA 4KJWC 3DX6B 3FQWB 4GNKB 1WO2A 5LGHH 4QI3A 3FYEB 3N0PB 2VDQB 3E38A 3FTVA 1U21A 3MLXH 4BQCA 2CH8A 3ULUL 1DJWA 4P06A 3LEVH 2XTJC 1TF4A 1T1WB 3IFNL 3MBWA 4JM2D 1GSMA 4JDZA 4GW1A 2J21A 3TESA 1E4HA 1U8LA 1YN6B 4LGRB 2IWKA 2WAHA 4WKXA 5EBMA 4IDJL 4JY6B 1HU8A 5JHDA 1Q9KB 3PWPD 4OKVA 3K6DA 2X4TB 3D3VB 1BA9A 1EAQA 5EU4B 1DQIA 2BOBA 4M7ZB 4YZFF 3AREB 3MRBA 4YEEA 2R1WA 1DQTA 2HVBA 4K7FB 4XOBA 1NCIA 2LLLA 4KHXL 2WW8A 2IH3A 2YD4A 2YS4A 4ERSL 4HKJA 4G1EA 4GRWB 3T0AA 4RMQA 2NSQA 4XBEH 3ZE0B 3MRLA 2EIKB 4J3VA 3U7WH 3V0HA 4JREC 3NJJA 4HF5H 4RSVA 2G2NA 5KANG 1ODUA 5H2BA 3PWUA 5BUAA 2WZPD 4Z7NE 4N4YB 5GZND 1LO2H 3ALWA 1CD1B 2BVOA 2QT6A 2CHNA 2GJ6D 2NZ1A 4GIAA 4JFTA 5LBSH 3BT2H 2XG4A 2WLZA 5GGRY 4PJHB 3GGWB 3SDYL 5A7BA 1EFXA 3EYSH 5DJ6B 3UZQA 4LFHD 3T6XA 1KELH 2UV3A 3H7BA 4P59H 2H5UA 3V2AR 2VM9A 4WAFA 3F7YA 2YKLH 4HFWB 4MAYC 4PLOB 4PS3A 5FFLA 3UAEA 3MYJB 1MJUH 1ZHKB 1NFDA 3QSKB 4OLWL 1JPFA 2HLAA 2XWDA 1QBAA 4OCWL 4N2BA 2YQBA 4QHMB 1YEDB 3WY4A 2VYRE 1TJXA 4HZ1A 4F9PA 3H54A 3ZQXA 1JF1A 4ZODA 5T3XL 4APXA 1U4EA 3O3AA 1V27A 1LNUA 2OMUB 3QB7C 5CEYA 5LUMA 3N1GC 5FW8A 3TPKA 4H8UA 5ICUA 4O02A 4OQ1A 3OHXA 3JTTB 4NAQA 4S1RL 3QIBB 4XCYA 4DQOH 2OMWA 4MSWB 4JCLA 4Y1SA 1N18A 1WWAX 2B16A 4RMSA 5FGBC 4PJDA 5IQ9B 5M94B 4TRPL 2KMWA 1RJCA 3MUUA 5E9AA 3UG5A 3IBOA 2QGEA 2ZYIA 4JFOB 1SDDA 2X88A 5L2JA 3ZE2F 4BFGA 4J1UA 1N5AB 4Z7QB 2ZWYA 3DX2A 5I71B 2GJ6E 2BIMA 5E8OB 1G7IB 5TQ2L 1JWMA 2I25N 3PWJB 4GMSL 4NO0A 3KLQA 3DUSA 4DP7X 2N0KA 1M56B 4UAHA 3RVUC 5T1KD 4E9RA 4OZIE 1NC4D 1OT1A 3OPZL 4Y7OC 1W72B 1KV3A 3O2VL 5EV7A 4XI5C 4F91B 3IJEA 3QR2A 4GAJH 2R7EA 1VGEH 2ICEB 2PLTA 5EBWB 1BFOB 1MKFA 4ZBJA 1NICA 3S96B 1PF3A 2AV7A 2D9QB 3FB6B 1QRND 3MREB 3FBQA 4QTHB 1BLNB 4QOKD 5DD5L 1GHFH 1UQSB 2CO4A 4G5AA 2OYMA 2GK0A 4JCWA 4LCIL 1GS8A 4ONFL 3ILPB 2P43B 3MXWL 4M5YL 1SFHA 4BYHA 4R9HA 2AXJA 1DQJA 2FD6L 1U8PA 4BUQA 3IDJA 4PVNA 1YRKA 1CD9B 4ZFOA 3RPIA 1OB1A 5DLMH 3VFNA 5SV3A 1E8ZA 4XCNB 4ISVB 5I16A 1JSYA 4NUJA 3WS3B 2EE3A 4KI5F 4AGPA 2QTEA 3P9LA 3DYPA 3V6ZA 2V4LA 2IH1A 1OAZH 3PIQB 1AR1B 3GBDA 1WK0A 1C08A 1EUUA 2WCSA 3CDZA 1A14L 3DSNA 4M7ZC 3BAXA 3AREC 4JQIL 4NKOB 1MUJA 1ZY9A 2GQHA 2PW2B 3B2PA 3S7GA 4AYEC 1EEZA 2EDBA 1JG9A 4P46D 4AMXA 3WMQA 2ADFH 3PFQA 2J1KA 5DHVB 5T1LB 5G4NA 1BBDL 2X6UA 3CFKB 2J20A 3VFUA 4U6XB 3Q8FA 1QRNE 5L4IA 2JIXB 3K7UA 4JGUA 3W9EA 4QOKE 1WHPA 2D4FA 2AW2A 5FM8A 4LLUA 1MLBA 3JV4B 4IKKA 5FAAA 5DGQA 5AG9A 4GRLB 2XIBA 4KKAC 2P5EA 1SJHB 3A6BH 2EIJB 1JZ4A 4PJFF 1YO4A 3D06A 3NFNA 2QELA 4FXGB 3VWJA 4YGVB 3X1NA 4NEHB 1S46A 1M1XA 2KC0A 3NIGE 3A3YB 4BDVA 1DUZB 1D9KC 1YLBB 2QQKH 5CMAB 4ZI8A 3V4VA 4RFEB 3US0A 5DURB 1SN0A 4KZDL 1IO4C 1PYWA 3RTQA 2P44B 1IC7H 5F2FA 4PLKC 4A7TA 3N85L 5EEZA 5M95B 1VHPA 2IANB 3QJTB 3UBXA 4NQUA 3QUKB 1JGDB 3DI2B 3Q5OA 3ATBA 4N20A 1JWUB 2ZPKH 4K5NA 1GYWA 1TTGA 2CGRH 3HR5A 3QIBC 1P4IH 1D7BA 4Z7OE 2R69A 2WZ5A 4O9HL 4Z77B 3HIZA 4E41B 4N5ED 4X8JB 4OCYH 3F85A 2PW1A 4OFYD 5E9DB 1E7UA 3TBWB 2KI6A 2XZQH 3IJSB 5ADOH 1V7NH 2MPAL 4NQXA 4DP6X 4N0UE 4LPXA 2FO8A 1F6AA 1IGTB 5HI5C 1JHKL 2WQ8A 3BDYH 3OZLA 3MOBH 4APQB 2XY2A 1UACL 2XQYK 3D05A 4GG8A 5E6RB 5B8CB 4DF9A 3WEMA 2YRPA 3FN0L 2QPSA 2H32H 3QJVB 1GVIA 4FI7A 3SYAA 4A6YA 2AEIT 4WEUD 3WIIL 2WXOA 3QIUD 1MIEH 2QVKA 4PHXA 2VXSL 5CILL 4E2OA 1G7QA 1NLDL 5CIPA 3IYLW 1IEBA 4N3UA 2ICEC 2GJPA 1AGEB 3PL6A 3QUGA 4LARL 3MBWB 4WHCA 3QNXB 4LCVA 1OLLA 3CHOA 4W4OA 3UZVB 2IDSA 1VAHA 3O6KL 1V7ML 3HLAA 1FFNA 4XP1L 2WKLA 1MH5B 1YUHB 4DAGH 4PLJC 1RZKC 3L4WA 3MNZA 3QWNA 5JHDB 2BCKA 1MW3A 2EYSB 1PZCA 3ARWA 1WT5C 4WEBL 5EORH 1RZFH 2PPFA 4PFEA 3GEWB 3TEWA 5E2TL 1CXIA 1HNFA 3MRBB 5TE4H 4C56A 5MERA 1GS6X 2JI1A 5AYUH 1I8MB 3MRFA 4FERA 1OWRM 3ARYA 1P7QD 4X5XA 3HN5A 2ESVA 3VRIA 4XH2A 1UD2A 5HHQA 1A4BA 4KNUA 4OF7A 4F33B 2IOIA 4H8HA 1A6UH 1NKGA 1CR9H 3NZ8B 1A7RH 3HBPA 5CAYB 1G84A 2HPTA 2N1KA 4JRXA 2UY7B 1MG3C 3QZWB 1FZJB 2XG4B 2ZCKL 3DMMC 1LP9E 1UWXH 3UJTL 3N1QC 1L4IA 1SM3L 3MRNA 2VL4A 3DROA 1HSAA 3MV8A 4G71B 1C5DB 4UNVA 4ZX3A 1KCSH 4HGWB 2MCAA 5FO9A 4IHOA 3F7YB 4Z3GA 4NO2B 4GRLC 1ZTXE 4JGNA 5BRQA 2HLAB 5H4ZA 4H1LG 1JYVA 4CA4A 3ULUH 3CXDL 3HZYB 1KLUA 1JF1B 3IFNH 2AJ3B 4Y4KA 2OCCB 3IE9A 4FXGC 3KNBB 5CEYB 5E4AA 4N2KA 3OHXB 3EBHA 4XGZB 3EF7A 2YZ8A 4EI6B 3RWIA 1CLOL 5J9PA 4HSAC 3L3DB 5CZXD 5FEBA 4KKLC 1QBBA 4W70A 4X9IA 4OCSL 1WA0X 5JHMA 1GS7A 3K6SA 3OF6D 1QLEL 4PJGF 1DN0B 3VXPB 4BK8A 5FX3A 4NM8L 3TVMC 2CM6A 4AV5A 1C1EH 4QXTB 4JM4L 1DZBA 5HGAA 4JPWL 3UP1A 4D3CL 1AE6H 1TZIA 5ANHA 3T8XB 3MLYL 3NIFE 4NN6B 1ZLUH 4ZMZA 2V2XB 4I13B 4NO0B 5I75C 3A5VA 1SF3A 3KDMA 2OKMA 3L4ZA 5BV7B 4J3BA 4ANVA 1KCBA 2CO3A 5DQJA 1N0LA 3II2A 2D31B 5ICXA 1I3RB 4IU2B 1ZVSA 1HQRB 4JHUA 4PI0A 2R7EB 4YHYB 4XP5L 5TPWL 4APQC 3DJSA 1AHWA 1H8OA 4OZFB 5B8CC 1VFMA 1JUFA 4LB8A 3IDMA 4ZT1A 4UQAA 4YZFE 4BQ6A 1N6UA 2V3FA 3SDYH 3X13A 4MNGB 4AH2B 1A7BA 1Q0XL 3BPOB 1U8PB 5DC4B 1IM3A 1M3JA 2CNYA 3WHXA 2CK0H 2H41A 1QPPA 3GTTA 3RB5A 4JFFA 4Y89A 3SJVA 2FEEI 1UEYA 4OLWH 5I18H 4A04A 3ATFA 5I16B 4CL7A 4KKZA 3GTVA 3GIVA 3JBG7 1YY8B 5KVEH 3QPXL 1NIFA 4OM1L 5FWQA 5C0JB 1IEHA 3FHQA 3WIAA 2X42A 2DBJA 1T4KA 4HT1L 1RUML 1NAKH 4O5LL 1L3NA 4K55A 2UUDK 1R0AH 1WEJH 1GYCA 5EZOH 2B5IC 3TJHC 2XA3A 1I8IA 3B56A 3K8MA 1WZ1L 2Z1KA 1OGTA 3EH4B 3EO0B 1AQDB 3BLBA 4PJCA 1EJOL 4EZKA 2WBJC 4M8UA 3AACA 4FTVB 5F3HB 4HEPG 4I4WA 5TQ2H 5IB1B 2G0KA 4E0RB 4GMSH 5EO0B 1FZKA 3H42H 1U8OB 1LD9B 3MGAA 3KH4A 4IKNA 2Y7LA 3CN4A 4RISH 4DOHB 3B5HA 3K6IA 2AJZA 5FO8A 5ITBL 3MBEB 3R8QA 4UZGA 3O2VH 3BUQA 3PJSB 2ZUWA 3OQRA 1AGBB 4K9JA 3LEYL 4DP0X 2XJKA 2BFVL 5GRYA 2RFXA 1OT4A 2ZCHH 2BIQA 3H53A 3DHMA 1KEML 4IIQA 3H9SD 1WWWX 4ONFH 4KI5D 4LCIH 3WIHA 2OK0H 3GKWL 3MXWH 4PRNA 3OAUL 4FQXD 3WN5C 5B4MC 2FD6H 1T6VN 1L9MA 4X6CF 3QQ9C 5JOFA 4IOIB 4ZS6C 5FYJD 4L48A 1FN4B 1IBBA 4O4YL 5FW7A 4UINL 2BK8A 2J8OA 2ZUYA 5IREA 3FK3A 4M8VA 4ZK8A 1RUQH 4JJOA 3EOYG 4YSSA 1TDQA 1YQVL 3NIDF 4FEIA 4GRWF 2VRKA 3PXLA 2PWHA 2BNRD 1HL9A 3BOVA 5J1TC 5BCAA 2R4RL 1AFVH 1FH2A 2XN0A 3P2BA 2PW1B 3UAJC 1A14H 2ED8A 4JQIH 4GYBA 2IBGA 1LL1A 2Z91B 4XCEA 5IOPA 3ROLB 4PJ7A 4WUUB 3CAFA 2HRPL 3E8UL 4HBCH 2JV6A 4NN6C 2IFFL 3ARDC 4G9FD 4LCYA 1NCBL 4PJHF 5CP7B 1BBDH 1F86A 4K5OA 2BW4A 4BA8A 4IOFC 1K8IB 1HWGB 5BV7C 1Q94A 3H9SE 3RNQB 1YY9C 3BZDA 4KI5E 5F71A 3ZT6A 3S98A 3OKEA 1JV5A 1S9VA 4LSTL 4A2MA 4K7PL 5CIPB 3BCFA 1OGAD 1DBJL 3GS7A 5T1MA 5MEQB 3PPSA 1AI1L 4ZUVB 3CPUA 5E4EC 4K94L 2DQTL 1A6TA 3GSUB 3QWRA 5FYJE 3U1QA 2MNJB 3CDGB 3F64A 4MS8D 4XN7A 1FFNB 5KSAC 3WFEL 5BJTA 3DOSB 1F4XL 2YPKB 3SYOA 3BPOC 4CC0A 5GGRA 3S6CA 1J12A 2BX5A 1XFPA 4WQOA 2E9IA 4NUQA 4CSPA 3GXUB 1WTLA 4LSSL 1OCWH 2BNRE 4XO5A 1ID2A 3SDDA 3IVKA 5IW3A 2Y6TE 2WVTA 1LJMA 2WP3T 3AITA 4Y19A 5TF0A 2BW5A 5L6YH 4WFGD 2VDPL 3GBEA 2AQ3A 1KOAA 4R7NA 4OLEA 2WBKA 2C9RA 3MRFB 3N85H 4FE9A 1ZT4A 3SZ6A 4BGLA 3RA7H 3ZR5A 4F5CA 4TSCH 3AXIA 5F9JB 3VRIB 4AQ1A 4G9FE 4P0DA 3DO7B 1XMWA 5C2UB 3H1ZA 4PJFE 4MD5A 2D73A 3SB3A 3CK0H 4KMTL 1CICD 2UXTA 3S3DB 4KKCD 2FEDD 2ICWB 2Z31D 3LY6A 3VXMA 4WWNA 3QUML 1HH6A 5DEGA 2GTWA 3MBXH 4EI5D 3ARGB 4UIMB 2EIBA 4D0BA 1BVNT 1JHKH 1OGAE 1ZDQA 1YYML 2Y5QA 4BK5A 2W38A 4FXLA 3L4UA 2R8SH 5ALCH 3DROB 1G0XA 4OLXL 3NABL 1HQ4B 2X4RB 3IDNA 3ABMB 1TJMA 2EUXA 1J5CA 2DQFB 2ITEA 3MBEC 3QG6A 1XSJA 4D2NA 2VXSH 5IWLA 3WMPA 2IPTH 1JDCA 4GUPA 4I3RH 3CV5A 2VR7A 3BEVA 3ZHKA 5D5MA 3KPOA 1UASA 1P5VB 1P4LA 1IIIA 3B4NA 4Y4KB 1GOGA 4WFGE 3KGRA 3SBQA 3UYRH 3WTXA 1V7MH 1F2QA 4HW6A 2BSRA 4EZJA 1CD8A 1SN5A 2R2BB 1SGKA 1QFWI 4Q58C 5DVLA 1KCWA 4TQEL 1JK8B 4YK4B 2Y07L 5DFAA 3RBGA 2G4EA 3V4PL 4KJWD 3X14A 1NDGB 3WL9A 2NNXA 3BZEA 5E2TH 4FQ1L 4L5FE 1H3TA 3D0VB 3QUZB 4PTUB 3U9UB 3MR9B 4N2NA 2ZG1A 5HGAB 1MCIA 3U83A 2HAZA 2CBPA 2W9EL 2HRHA 5DZPA 4PV9B 3HBQA 5KVGH 2XTJD 3NYKA 3O4OC 5DJ2B 2ZSWB 3RWEB 1U3YA 2WPGA 3WFHA 1NEPA 1XAKA 3REVA 2GUYA 4X4YA 1ZS2A 3L1OL 3WJJA 3WEXB 4LLAA 4GJTB 4FG2A 1OSPH 4X83A 4KJPD 3V7MA 1EA9C 1KBBA 1JUFB 3IT8D 2KH2B 1PPIA 1OXYA 1SM3H 5T3ZD 2C9VA 1T80A 5DZ9A 3WSQL 2CR6A 3L3JB 2ED6A 3H9HA 2OW7A 3OR7A 1BZOA 4PY7A 3VI3B 2PYFA 3LHPL 3FRPG 4PRBB 2A99A 4JFFB 3VFPB 4EPSA 2Q2EB 1YMMB 1KLFA 1VPOH 3TCXA 5A40E 1E7VA 1ZJAA 2V8LA 4IHBA 3CVIH 2DQJH 2EEDA 4G8GA 4YHPB 2NQDA 4OVVA 4DK3A 5EDSA 5PAZA 2V6HA 3EUUA 4NC2B 1BFSA 4Y5VA 3O11B 4XOEA 5MHSD 2XTJE 4JDVB 3L7FA 4I9WD 1CLOH 3EXLA 1YNKH 2GB2A 4EDWH 3MA7A 4OCSH 4MA3A 1QLEH 3GT6A 3EGXB 1PEWA 3DIVA 3LN5A 4K8RL 4MAYD 1AD9B 3ABLB 4CRPA 5IMLB 1WD8A 1F6FB 4JM4H 2IQAA 4PJXB 5J6HB 1X7SA 4JUTA 5HDBB 1S7RA 2X2JA 1R47A 4B9CA 2X4NB 2R29A 3DYMA 1F11A 2FIKB 4XHJD 3RY6C 3MRRA 4RMTA 1AMXA 3P0YH 1UWEH 2X4SB 3B5GA 1JP5A 4FAAB 1XIWB 3TFBA 1JHLL 3ARGC 1KCUL 2CKBB 3K2MC 1BP3B 3HNTL 4LVOB 3NP3A 3A4DA 3GO1L 4G42A 3DX0A 5JIQA 3DXAB 4JNXA 3QHFL 3TO2A 2EDWA 4R4BA 3U1SL 4Q9RH 4ANUA 3KWWA 2LGNA 1U3HB 4UBDD 5CN1A 1XGRA 1TZHA 5J7CC 1FLRL 3MV7E 2Y2YA 4DGWC 1WD9A 5MHSE 3A23A 4I9WE 4F92B 1NGYA 1S9KC 3RVUD 1N70A 2YPLA 4YLBA 1OAKL 2GBTA 1HCFX 5D1XA 4B3EA 1IKFH 3VW3H 4GRMA 5EFIA 1ECYA 3QPXH 4JGMA 4XI5D 4UCFA 2CBOA 2VZTA 3BZ4A 3GSNL 4N8CL 4PUBL 4X6FA 2N4IA 5INDA 1R5WA 5EO9A 3ES6B 4MZIA 5HPMA 3QT2A 3WD5L 4YK4C 2V3DA 4HT1H 4X7EC 1MHHB 3OAYK 4HWBA 2ZSVB 5DZOA 4M7LT 1G7MB 3FU3A 3QUZC 4FA7B 1WZ1H 5I17A 3TYGL 4L05A 3MKGA 4JQXC 5EIVA 5EZPA 3TWCH 3IXAA 3FQ2A 3QDJB 2MMXA 4KUCF 4BSJA 2CRIA 3V4LA 2EVFA 2K70A 5F8RC 2HFEA 4KO6A 4R26L 4OUUA 5E1AA 4WDIA 3ASNB 2I07A 4NBXB 2W0PA 1IB5A 3MFFB 1EXUA 5HP5A 3ECQA 3BPCB 1WITA 3K4DA 5E0QA 4AVKA 4B95C 3WYRA 3ILQC 5C9JA 1ULVA 1A9BB 4WGVB 1AP2B 1NFDF 3D3VD 4ENZA 1B9KA 4MHHI 3RWHB 3ECUA 4QJ4B 1PLAA 5BOPA 3ARED 5I2IA 1HZKA 1OTTC 3MCLL 2BFVH 1R4XA 2CALA 4NZRH 1CFVL 2DTSA 4P23A 4JBSA 4PRPB 5E8EB 2XVKA 4J5VA 2CSPA 4M62H 3OAUH 2EO9A 4FZEL 4JHBA 4CGTA 4XPAL 1FLTX 1CFQB 2BPBA 1I7UA 4EO5A 1E9QA 4P05A 3HZMA 1I7TA 5GGUB 3HJEA 4PJDF 4U1KB 3I84A 3MOAH 5AEAA 3BGMA 1BFVH 4X4KA 5EWIH 2YAHA 4QD2E 2NY0B 3RWJB 4LQFL 4HCRL 1A6WL 1YQVH 4AQ1B 3MLPA 3GMRB 2R23A 1R6VA 4MD5B 5CXPA 1FYTA 4MX7A 4X7FC 4Y16C 1F3DH 5DS8A 3IU4H 4YUEL 5ICYB 2WVVA 2MTAA 3CX5K 1NCDL 4U0QB 1HH6B 3CMOH 3FB7B 2NXYC 4KTYA 4FFTA 4EMZA 1RMFH 2A4CA 3C60A 4X6CE 4XNMA 3D3VE 1IV8A 3EJRA 2B3IA 3ULVH 3MXVH 3E8UH 3ARFA 3DETD 5GRXG 3W39B 3O45B 4BKTC 1RK1A 2X3BA 1U92A 2W0FA 1P5UA 2I7OA 3BIKA 3LSOA 1LO5B 2YFOA 2YEZB 3CHSA 3QIBD 2KBGA 3NIDE 4MZ3A 1XIWC 4GRWE 3P4MA 4GUPB 3KR3L 1O9ZA 2J2ZA 1TG8A 3HI5L 3IAQA 4LVOC 5I74B 2EQDA 2XZZA 3PDGA 3U9PL 2YGNA 2HX8A 2MOVA 3T6WA 3H3BC 3O8XA 1PCSA 1I4FA 2CJTA 2KZKA 2AQPA 4XCFL 4LNVA 3WFEH 1F4XH 3IFOB 1U3HC 5I19L 2PF6A 3G5XA 2A6JB 4NRZA 4MNHA 4BFIB 2Y4SA 4HK0B 4MDJB 1GAFH 4PJHE 4MCZB 5IESL 1ZHLB 3OMAB 1J9RA 3X14B 1D5XA 5F6HI 1CPUA 4KWUA 4A39A 2YC1B 5DMYA 3BZEB 1BG9A 4F93B 4EUPG 3ILEA 3JWNE 4BHUA 3UMNA 2NY5H 1WISA 1JOIA 2I9LB 3H6JA 1HJCA 4PGDB 2B14A 4XOCA 1BVKB 3B7UX 1FNLA 4OT1L 4QRQB 2SEBA 1L0XA 4AXWA 4Y4HC 1MHCA 4AX3A 4X4YB 3REVB 1WV7T 1F02I 2JB6A 3CBKB 1FV1B 4KMTH 3BYYA 4YDVA 5D7JB 5EU5A 3VXUB 4H2CA 2AJYL 1KYOK 2R9HC 5DJCB 3K46A 3VD1A 3F8UB 3QUMH 4UTAH 5LBVA 1G5GA 2BJML 5TDNB 1OF0A 5ENWB 3VGFA 3DJZA 3V9FA 1CLYL 2XQBL 2FX9H 2FBJL 1YYMH 4WSKA 4Z7UB 3QJFA 5FKAB 4MMXA 2X7LA 4UT9L 1D2PA 2BSSA 2CQVA 3QRGH 4OLXH 4WHTA 1DBBL 4UNUA 1YZZA 7FABH 2EXSA 3FCSA 3OR7B 4JO8A 1DVZA 4P2OC 3BI9X 1X4ZA 1AR1D 2BP0B 4EBQL 2FH6A 5KSBB 4Y0GA 4XRCA 2D2OA 3D08A 5LXVA 2X09A 1HZHL 2EDEA 4MD4A 4P2RB 4PEEA 1ZVNA 2C1PB 3VXTB 4ZMOA 3IGAA 4LESA 4W9FC 4XN4A 5DUMH 1K85A 3AMKA 2NY3B 5JIKA 5T1LD 4Y5VB 1IC1A 1OE3A 2V5TA 5IB2A 3L7FB 4L3ED 3LIUA 2JIXD 4GKNA 3VM5A 3F04A 3MA7B 3FF8A 2K7PA 2FE0A 2RQEA 2ZKWA 2Y07H 3C5XA 2O5NA 5JW4Q 4L0YA 3GMOA 5IB4A 3LN5B 5FK9A 2BSED 1KIQB 4FQ1H 3V6OC 3DVFA 2NY0C 1J9QA 4XVJL 3JWDC 5AL0A 4P4KC 1WBYB 2X28A 1A4JB 1MQ8A 3FCGA 2B1HH 2Y22A 3RJQB 3DTDA 1PX4A 3RHWF 4R7DA 4D7PA 1T4WA 5I1JL 1HHJA 1LE9A 2HG5B 1O7VA 1EGJA 1H15B 3L1OH 3BAEL 3VFSB 1ED3A 3AT0A 2HX7A 5HGGS 3GZQA 3M1BA 3S34L 4A1RA 5DURD 4Q74A 2G2PA 2F53B 3EOBA 2X6VA 2YMOA 5J6SA 2FUQA 1TEFA 2VJ8A 4QRTA 4G42B 2HUEA 2ZX7A 2IAND 3NQIA 1DZ0A 2F5BL 3QEUB 1TTAA 4OGQC 2AXGA 1BQKA 1QD0A 5I76B 2BHZA 4K5MA 2OL3L 3ZGIA 3HMXL 2DH3A 4X7TB 4N6RB 4JFXA 4XN1A 3V5KB 1BOYA 1XBDA 4ALAH 2BVPB 2AQQA 3FSAA 2GIXA 3GXPA 3TZVC 4E41D 2FT8A 4PRAB 4DKEH 1JBJA 4L3EE 4HYTB 5E9DD 1XCXA 3HG1B 3ZRFC 4ZX6A 4U6TA 2AQRA 5D1XB 3WEOA 4NZ8A 1QBLL 3SDAA 1RIVL 1OE1A 3FJTA 5EFIB 4E68A 1FNHA 4RNRA 1KTLA 4AUUA 4APQD 2E86A 3GSRA 3MCG1 5EO9B 4JFZL 4BM7A 4PP1D 5HPMB 5B1JC 2FJGB 1JGIA 5KBMA 3U1PA 1HYSC 4FQLH 2NNAA 2OJ1A 5EOQL 3QBTB 2V5YA 1SQ2N 3IXAB 1F4YL 5KOVC 3DHUA 4EIBA 3UBFA 2OR7A 3DX8A 1QZNA 3NQKA 2FO4B 1ZLVH 4XB8A 4PJ5A 2ZJSH 5K9KA 3FTGA 1RPQA 2IANE 4OSUH 4U49A 2R0WL 5FA4B 1EXUB 1XZ0A 5EA0L 4KVPA 3CFJA 2ADGB 3NJLA 3DTXA 4QWWC 5JHDD 4N2AA 1CI5A 2O72A 2IXQA 4M9PA 4YBLB 1ZTXL 1A02N 5JDJA 5AL8A 3HZVB 3M8OH 4LLVB 1CDGA 1UWXK 3HNTH 3PHOA 3Q2NA 3NK3A 4U1IA 4XO8A 5I2IB 4POYA 5E9DE 2CRMA 2HX9A 5CUSH 3U0TA 1A3LH 2MOQA 1NIDA 2YXFA 2KDGA 3HC0B 3U1SH 4BV1A 4ADIA 3LN4B 1SYSA 2YQ3A 5AVZB 2HT4D 2WSDA 3DK2A 4HUXB 4UUJB 4V33A 3SBRA 1I7UB 1E9QB 3K5RA 1I7TB 4NT6A 2O5XL 2KKQA 2HLFD 2FGWL 4OLZH 3OKNA 3GF8A 2P8MB 3NFPB 2E9GA 3PFUA 2NUPB 4KUCD 5LBSA 2NY3C 4N8CH 2O1AA 5JPNC 2GHZA 3KBPA 2DQGL 2H3NB 1ZRUA 2JVUA 4O2FB 4OF3A 3FO2A 4YDJA 5DS1A 2VLRA 3VFOB 1L7TL 2PPDA 2Y2TA 3QFDB 4UV7H 1GIGH 1KBGL 3U4AA 4GS7B 4MYWB 2CIKB 2WNKA 5JHDE 1QI3A 4EUPH 3T2NH 2CGYA 3TYGH 3MRMA 4GQZA 4ZS6D 1J10A 4WI5A 1ZLUK 2YA0A 2M26A 4V1DA 2N01B 1M57B 5LDSA 1OOAA 2O61B 4YMPA 2VR9A 2W0FB 1SHMA 4R26H 2R56L 4DJMA 2QFRA 4N87A 1ZT1B 4YR6B 3N0AA 2O5ZL 4HEMA 4QAWA 3LB6C 1YECL 1TENA 2YGPA 4ZO7A 2MQGA 4RMVA 5AG8A 1TETH 4M7KH 1OEZW 1QTSA 3DHPA 4EIUA 4QRBA 3RBSA 2BO0A 1P1VA 1IGCH 2YIHA 2VDOL 3UJJH 12E8H 2VW4A 4JKLA 1DYZA 1I85A 5B39A 3UYOD 4QYOA 2WXGA 3QUXA 1A6VH 4N0RA 4LPWA 5EU3A 4C83B 4B9IA 1Z1WA 5J12B 4NO0D 2EUVA 2QSCL 3SPCA 1ZPLA 2B15A 3QDAA 4ZAKC 1SVZA 4J3UA 4KNQA 1Y1DA 2X9YA 3QORB 1RJLB 1YY9D 2FQFA 4UTCA 1LMKA 3FHEA 3IU3B 5I6PA 2EO1A 4Z78A 2QVFB 5JPMA 4Z0BL 2CLVA 4JR9L 2P5PA 1NFDE 4W9IC 2I32A 1MHPL 4LQFH 4PJXF 2R0ZH 2JK5B 3ENEA 5HDBF 1DJYA 1Z3RA 4XO9A 1MHCB 1QPKA 1FDLL 2ZUXA 4M4PA 4NHCL 1JMXA 3GXFA 3AGWA 4HKZB 1TVBB 2EDXA 2FX8L 1KXQE 1SOXA 4GW5B 1NCDH 4OV6F 3T65A 3ZT7A 1LK3L 1INEH 2BIPA 2D7TH 4BRVA 1KC5H 4QCIB 5HVGB 2XBDA 5KVFE 3RY4A 3EYVA 4NUMA 2NTFA 2OMTB 5JZ7C 3Q2LA 3ZDZB 3QQDB 2V7NB 3IK2A 1AG6A 4WHTB 2ZF9A 3CX2A 3N44B 1A2YB 2VC2B 5DK0B 4LNRB 2JKLA 2BXYA 2ATKA 2NSMA 4EOWL 1ET7A 1IBYA 4YBLC 3QISA 3QFJA 3V0EA 2ZYHA 5D1ZA 3KR3H 5HJGA 3HI5H 4XRCB 2X3AA 1S7QA 3MPCA 3ZTNH 1HKLH 2X3CA 3BN9D 3S3PA 2LE9A 4L3CB 4N68A 1E4XI 1N8ZB 1SBSL 1DLHA 3QH3A 4N0YL 4FTVD 1U8QA 4OFPA 2DKSA 5F1SA 3FO1B 1M4KA 4BRJA 1XBRA 4AGOA 5I19H 1OAYH 3JVGA 1KJ3L 1VDGA 2P80D 1EMTH 1EO7A 1KBVA 4MNGE 5IB4B 3UTQA 3O2WL 5FK9B 3WIFB 1T21A 1W0VA 2B3RA 3WUWG 4NQSA 2YOAA 1BQHA 3X1EA 2D8KA 2WYIA 2JKNA 1O9WA 2AS5M 2VITA 2YRLA 4OT1H 4U3CA 2R4SL 4DP8X 1UHVA 5I1LB 3SO3B 3T8MA 4N28A 1DEEA 1MNNA 3Q01A 3CFCL 4ZFZB 1A3RL 3CX5J 1V10A 1ED3B 4FQHB 3EGSB 4GS7C 4EZMA 5F7DA 4OCXL 5AB2A 4HIHA 2EH8L 2BJMH 3RB7A 1KJMB 4S0TD 4IGBA 3MRHA 1PEZA 2FSDA 4JFYA 4L8DB 4PIRF 3S37L 2VE6A 4XWGL 4F57L 5FYJL 5IW6A 3B9AA 3HI1A 2E75C 3S35X 1DBBH 3FQXA 3K0YA 3C5SA 1FF5A 5EEVA 2Q86A 1MW1A 2VDRH 3N43F 4FTVE 3P77B 3OHMB 5KVMC 5T5FH 2J25A 1GKEA 3EOTH 5CSZA 1OWWA 4F15B 3OZ9L 4KUZH 4XNBA 5F89B 5JLZA 4KHTH 4ZOCA 5HGDB 2WXKA 1SEBA 5LWYL 4NB7A 4DOHE 4YDKH 3BSGA 3GBMH 4PM1A 3LZLA 5AZEL 1X5HA 1TZGL 2QZQA 1KZQA 2UYLB 3OPUA 1MCJA 5DYOA 2YQ2A 2NSXA 5J12C 3KYMA 1CBVH 1E27B 3SGJA 1XAUA 3LZPA 1CJYA 4NHUB 3PWNA 4U3SA 4KTEL 1N10A 1UEMA 1Y0LA 4RH4A 5F96L 3QORC 5AWNL 3FUMA 3R0MA 4OI9A 1RZ7L 2DQHL 3NZHH 3WN6A 3QNFA 4NSKA 2RCSL 1EO8L 4HU2A 3TT3L 2QLVB 1ILUA 5FO7B 1FFOA 5TDPB 3MRPA 1X5YA 3Q9QA 4OF6A 1MN4A 4ODBD 4MQXC 3KPPA 2XG5A 4ELDA 4RIRA 2CO1A 3DTXB 1S3KH 4PG9B 3F12A 3BAEH 1KYOJ 3FC8A 4CC4C 4AGNA 7TAAA 5BVJB 4PYGA 1KFGA 1IT9L 1KB3A 5DD1L 5IHBA 4FQCL 5DMKB 1MVUA 2QLYA 3BP4A 2IWEA 3GPSA 3HC2A 3U0TB 3PDOA 2DF3A 2VKWA 3PQYB 4UOJA 4ZOEA 5FYKD 1P1ZA 3IGKA 2J4WL 1T66C 3NACH 2NNRA 4CVZA 4IEFA 2DLFL 5EC1B 4EXKA 3LIZL 3NK4A 5C9KA 2OAAA 4L5FL 3ARGD 5IB5B 1X5GA 4N2OA 1IARB 2XXFA 4MKTA 1K5NA 4U7MA 4E36A 3K3QA 1DEDA 3FUHA 2VMFA 4UILH 3V10A 2UX7A 2QPDB 3KH3A 4YDJB 2VLRB 4UWQB 3NOIA 1S7VB 1E5ZA 2B1AH 2XTLA 5ILTL 2R0KL 5EOQH 4C4UA 4MD0B 3FU9A 3UIZA 4BBWA 1BVNP 2IV8A 2YQGA 1BXXA 2O5YL 5IOKA 2P42B 3W37A 5IV2A 5HSFA 3P1VA 1F4YH 3VE0A 4MB5A 4V1DB 1CDUA 4JZJB 4YPGA 1YN7B 4Y4KD 3GSWA 4Z7UF 4X7SL 3ISYA 3CCHA 4DETA 4L4TB 3MJWA 5EA0H 5F0MB 4EIGB 5FYKE 5KJ4A 4LQ1A 4YXLH 1S9WB 3OXSA 2C3HA 3BQUA 1LO4L 4KFMA 2BRRL 1ZTXH 4OZHA 2Z34A 5L88L 3SE3C 1D2OA 5FYKU 2EXTA 1JGVL 1DVQA 3OG4B 1ZCRA 3KW7A 3QUZD 4Y5YB 1B4JL 2BLFA 3ESUF 2WCPA 3EOAA 4EJ1C 4L0ZA 4JN2B 1TJIL 4E5XG 3GHBL 5IEKA 1BOGA 2I9TA 4MJ5A 1CDYA 2GTZA 4G6KL 1T83A 4LHUB 4WSJA 4K7PY 5HJBA 4Q9BA 3VM7A 3HCVB 3MX0B 1PG7L 4KX8A 1CU4H 3VD4A 1FGNL 4YWGL 2O6EA 3V8OA 1CFTA 1W2KT 4NJ9H 1FNAA 5AQ0A 2QVIA 4JZNA 4UDTB 1JRHL 2DQGH 1OTTD 1BYPA 3PCYA 4CNIA 2GAZA 1YEWA 2YBGA 2L7JA 4P57A 2HT2C 1L7TH 1EJFA 1R3KB 1KBGH 2MPVA 4XP6L 1TYRA 2AK4B 3TL5A 1JYXA 4JFFD 5CR8A 4HLJA 4XB3A 1YMMD 2DIJA 3QAZB 4I2XA 4PAZA 4MHHG 4G6ML 3A67L 5IHUH 4P9HC 2A74A 4DZBA 5G4MA 1Q9OA 4HH9A 4YN3A 3UO8B 2X44D 1G9HA 3D69A 1C12A 1AXIB 4MFHA 3HNVL 4W93A 3NCYS 2Q3ZA 4BH7B 5IT2L 4WV1B 4B5EA 1J86A 2ATKB 4RAUB 4MASA 4R0LC 1LDPL 2R1YA 1Z5YD 5MP6L 1UWGH 3IJHA 1IFGA 4FNLL 1FWXA 1A6AA 1S7QB 1OQOA 4Y1AB 3HPJA 4YHOH 5FHAH 3WY1A 4IOSA 1SUJA 5DHXB 2LVEA 1F45A 3FUJA 2YARA 3C2AL 3OBAA 2Y7OA 4KY1L 3F01A 1KENL 4Z7VA 5I6MA 4BZ2L 3DPDA 2APFA 1QFWH 1M7IA 4IQHA 2E4TA 5DRXB 1HEZA 2OBGA 3KPNA 1CTOA 1MZZA 1SPDA 2BVQB 3ATEA 2AQ2A 2KPWA 3UPCA 4NQSB 3KPMA 3OKYA 2P8LA 2BY1A 3HLKA 2I27N 5C0AA 4IKLA 2Q8BH 4DGVH 4JR9H 3OD3A 4JFFE 1YYLL 2VUOA 3MLRL 3QWOB 5D1QB 1MHPH 4HIJA 1YMME 5LJYH 2CHDA 2E7LA 1JZ2A 3NDYE 4LKXB 2IGLA 1QR1A 1T7ZA 3ARBB 3MNVA 4KXBA 1U3HD 3LN9A 4TOYL 3QRLA 3TN0A 1I7RA 1WG3A 1GYUA 1ZS8B 2FX8H 1ACCA 3BVNB 2WMPB 3LNGA 4J6IA 4OIFA 5FCUH 5JHAA 4XNDA 1LK3H 3BSZH 2Y7MA 5IUSA 1ROWA 2C9AA 4LSVL 3CZKA 2DY2A 4ZYKA 2YN3A 3TBSA 3OMZA 3K2IA 4KDVA 3GZPA 4JRLA 2DMCA 4Z95H 5HHOA 4ORZC 3TM6A 1PFCA 5GGQL 4CMMA 3EJPA 1HEJC 3DK0A 1F3JA 4PJXE 3NH7L 1PAZA 3VGAB 2K78A 4HIEB 2DYPA 5HDBE 3Q1SH 1T1XA 2R2EB 3QXAA 4JQIA 1E0OB 1V3JA 5IKCA 4Y5YC 2JJVA 5DJYB 2LAGB 4UM9A 3ECVA 2V9UA 4JJHA 4ZJ9A 1GGUA 5LNGA 3B2VH 2EZ0C 2VDQL 2YPVL 1MFCH 4N0YH 4H26B 4MB3A 3KYMB 4TV3A 1H3VA 2DI9A 2H32B 4U3SB 5EC2A 4AZ8A 3WNIA 3SBPA 3BP7B 3BIBX 4GSQA 1E9OB 3AWFA 4AG4L 3EO9L 5GHWH 3O2WH 1BEYL 4UQ9A 1HOCA 2CCWA 4NSKB 1UYWH 1Q8MA 2NPLX 3GBNH 2CIIB 4TQ8A 5F7LB 1DVXA 5IW1A 3QNZA 1LXMA 3VD3A 3QWRD 4BK4A 1ZSDB 2Z9TA 3FZUC 1FIGL 1CLZH 2R4SH 4M8RA 1XL6A 4PS4L 4PRPD 4RIRB 2VH5L 3ZXAC 2B4CL 3O0RL 4L29A 2QL1A 1LDSA 5DVNA 3MJGX 4C54A 3F12B 2Q8AL 3ZUNC 4GXVL 1Y6MR 2WJ5A 3UYPB 4ECNA 3JTBA 3OC8A 3DLQR 4XWOD 1WIOA 3EYQC 2C7FA 2Q0ZX 3QAZC 4H1LA 4H0GA 4DTGL 4DZ8A 3FF7A 2FTAA 1UZ6F 2DWXA 1T7WA 4XPFH 4HUWA 4UV4H 1QVOB 3D25A 5FM5O 2ICWI 1IC5H 2JJTA 2NY0D 3S37H 4K23H 5FYJH 4WV1C 1SXZA 5L9DL 2XVBA 4ZMYA 4ODXA 4PP2A 1KZYA 4RQQA 1OSYA 1GZQA 3G6DL 3VD2A 3RIAK 5DRNA 1AZRA 3R06A 1PMYA 4L8CA 1HHGA 5EIIG 4WF7A 3L5WB 4PGEB 1ZT7B 2ZWLT 4S2SB 2AXWA 3OZ9H 1TJHL 3V95A 2YRBA 1CDCA 1OGSA 5LWYH 1XGQB 5KYWB 5AZEH 1E4WL 1IE5A 1NM4A 3EH1A 4IRSA 3UCQA 1M7DB 5L8JB 3LVTA 3VNZA 1IC4H 1EAPA 3BHBB 2NX5B 4YHNB 4KTEH 2WJ7A 5F96H 4M6MH 4PRPE 2Q10A 1EHKB 3EFDL 1KTDA 4HJTA 3OB8A 3WKMH 1RZ7H 3CH1B 4NUGH 1ODAA 5CZKA 4RGMB 2RCSH 1DBML 3RL2A 4F7CA 2E9JA 1E5BA 5J1AB 5TJWK 4FFZL 3M07A 3L5JA 4U33A 4YPGB 3TT3H 3GSWB 4JFDB 3ZDZF 2B7DT 3FOLB 1IZJA 1E2ZA 3AQZA 5IVXB 1BCIA 2XN9A 4UQEA 2XYBA 1KYFA 2E6JA 3GMLA 2WKOA 3N44F 3AY4A 2V5RA 3MUY1 3FCBA 4P4RB 1HYSD 1IT9H 4OZHB 1R5IB 5DD1H 4FQCH 1B2YA 3UPRA 2DMGA 4ZW7A 1DBKL 4LLMA 2P28B 2VQUA 3GNMH 4QHNA 4A68A 4MDIB 2MEJB 1Q72H 2X2UA 5E5LA 1BOGB 1H5BB 1W72L 3MRJA 3K5SA 4E42B 4XR8C 3RAJL 4F2MA 5BRZB 3GDCA 2J4WH 3NDZE 5KYNA 4LLWA 1G4RA 3EDJA 3UTPE 2VJXA 3DRTB 2YD6A 1N68A 4WWKA 2DLFH 3CXHK 4GAYB 1GJUA 2WC7A 5D7JD 3VXUD 4H8WH 4FXKA 4IDLA 4HWUA 4PJIA 4KDWA 3B2UC 4G7RB 2AXHA 4ODWA 2AJSH 3BWUF 5IM7A 2YD3A 3SDXA 4G7YH 5FB8A 3U7YL 4HEPA 2ZXDA 3MYZA 4P57B 5D6DA 1PX8A 5TDOA 5ILTH 1AYRA 1NC2B 4S10A 3GEFA 4L4VA 3RFZA 5C08B 4LSDA 3HS0A 4N9GB 5SWSA 3IDXH 3EJYD 2A74B 2LFEA 1DANU 3MDJA 2RALA 3UTSA 4P2RD 3QXWA 3REWA 2DTML 1LHZA 2AABL 1RZJL 4X7SH 5F1IB 3VA2C 4G8GD 4DT2A 1C8PA 4PSRA 2NY3D 5DD3H 4IRJA 4PRIB 4JKMA 1BG1A 1AKJA 2VZVA 2CRYA 4KVNL 2XACC 2WBXA 4Q9QL 1D3CA 3IJHB 5ACZB 4PGZA 2B2XL 3IB4A 1LO4H 1B0GA 4IKJA 2A1WL 1JGVH 1YQ2A 2WXQA 2I69A 4OZGA 3VXUE 3BKCL 4Z7VB 1D5BA 2PTUA 1CL7L 2RGSA 4XPHL 4YGAB 1MFMA 3FQRB 5DJ0B 4Z7UE 4AKPA 4XBPA 4G6KH 4NN5C 3RDJA 5TQ0L 3M46A 3WFCL 4AIZB 3TH3T 4HWZA 5EU6A 3DOIA 2DQIL 2ILLA 5C71A 1T0NA 3GUTA 2WTOA 3F7KA 1G1OA 3G5YA 4UDUA 4YWGH 2F53D 1P2CB 2VN7A 1CIDA 1GSKA 1RQ5A 4PS7A 5KSBE 2UZPA 4HIJB 4M00A 1H3PL 1W9XA 1Z0NA 4MB4A 2WNXA 2HTKC 4D9QD 1U6AL 3KCWA 3Q6GL 3VD7A 4P2RE 1MFNA 5EEXA 1GY1A 4G8GE 1INDH 4GY4A 3S3JA 1FG9C 5I15L 1OPGL 1UJ3B 2CUHA 4GP8B 4JMXA 5T3ZH 4RGMC 2DLEA 4QEGA 4F8PA 1UD3A 4LOEA 1AO7A 2J12B 3T09A 1ADWA 3HE7B 4R4FL 1ZLVK 3FONA 3HG1D 5EG6C 2D03L 1LLAA 4LPVA 4UQDA 5D1XD 3W11C 3EAKA 2XXCB 3LNIA 4NGHH 1FVDA 1K2DA 4CMMB 1CDBA 4LCCA 1C7SA 3HNVH 4NO3B 5FUCE 3UADA 1DHKA 5IMOA 2ZYRA 3TLRA 3EG9B 5D9SB 1FP5A 1LDPH 2G3NA 3T08A 3L9BA 2X1PA 3BKYL 4DEUA 4LCWA 5IKCB 4OLYL 4RESB 4PJAA 1VFBA 3AM8C 2GCYA 2WGXA 1Y18B 4WU5A 1KYUA 5FHBL 4M4RB 5HI4C 5IG7A 2ETWA 4HV8A 2F53E 2IIJA 3PXHA 4X5PA 5JZ7D 1J1XL 1NUNB 2NLJB 4J6RH 4BZ2H 3EYOB 3L4TA 4D9QE 1E28A 4KZEH 2ZXQA 1P84J 2Y72A 3GZKA 1T89A 4FFYH 3QQ3A 1ZWIA 2ZZUT 1XGUB 5B38B 4J3OC 3QNZB 4FHKA 3EO1A 5EN2B 3UTOA 3W2DL 1XF5A 3MLRH 5GRWA 3FFCB 4P48A 3TBYB 5GRUL 4QRSA 2UZIL 3HG1E 5G5DA 3MHZA 5D1XE 3SY0A 3WEAA 2E8ZA 1NCTA 4KH2A 5I1AB 3NCXA 2P3YA 3P40A 4M7LH 2EXWC 2IWGA 3BMWA 2ZKMX 1KT2A 1NMAL 3DRQB 3FUDA 3T2OA 4F7EB 1OAXH 1P9MC 2ADIB 4LSVH 1QUPA 5J0BA 2YXWA 2WQWA 3ETBJ 3H7LA 4P2CG 4YVUA 5E6IB 2IH8A 4KJQC 4KRPB 4LOVA 3B83A 2ZP8A 1BJ1H 3VWJC 2MCPL 3NJIA 4NIKB 3P3SA 4BWWA 3I02A 3T4YA 3L3KA 4KXAA 4BKLB 4NDMB 3NH7H 2ODIA 4GKZA 5MENB 4AKQA 5DRNB 1UOKA 4M3HA 1USZA 1JPTL 5JQ6L 1YNTA 3RVVC 1T0MA 4ZW6A 1RVFL 4XNAA 2E7BA 2H4EA 1YNLL 2YMTA 4PWHA 4MAZA 3HG3A 4LP4A 1WF5A 4ORGA 3ARFD 2OPCA 2IAMA 5F9AC 1EAPB 2F8OA 2Z92A 3EFFB 3FPXA 2WWKT 1LEIB 4NNYA 4UM8B 1FJ1B 3QEQA 1G7PB 3BZFA 3IXTA 1F41A 3B5TA 1P7HL 3U46A 2I5YL 5CLTA 4DH2A 5C1MB 4Z3EA 3ERXA 3ZKND 4O02L 5ADPL 1BYOA 3ZKQD 4ETQA 2ATPA 2ZOKA