1WH0A

Solution structure of the cs domain of human usp19
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
134
structure length
134
Chain Sequence
b'GSSGSSGVDEPESMVNLAFVKNDSYEKGPDSVVVHVYVKEICRDTSRVLFREQDFTLIFQTRDGNFLRLHPGCGPHTTFRWQVKLRNLIEPEQCTFCFTASRIDICLRKRQSQRWGGLEAPAARVGGASGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquitin carboxyl-terminal hydrolase 19
publication title Solution structure of the CS domain of human USP19
rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 15
structure length 134
sequence length 134
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2004-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04969 CS CS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.790 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1wh0A01
3VQLA 5DS2A 3W1ZA 3L1EA 2O30A 2Y1YA 3GT6A 3QORA 4JUSA 4M5TA 3L1FA 4YL9A 3GLAA 4ZJ9A 2WJ5A 2RH0A 3QORC 2N3JA 2N0KA 4JUTA 1WGVA 4YLCA 5DS1A 3QORD 4RZKA 1EJFA 2K8QA 2CR0A 2XCMC 3GUFA 4PBDA 2CG9X 3QORB 3J07A 1WH0A 4YE0A 4I88A 3L1GA 2BOLA 4FEIA 3N3EA 2Y1ZA 4M5SA 4PCKA 2JKIS 2KMWA 3Q9PA 1X5MA 1RL1A 1SHSA 4MJHA 2WJ7A 2MNWA 2Y22A 3AABA 3IGFA 4YDZA 4ELDA 1WFIA 3VQMA 5LUMA 2KLRA 3EUDA 1GMEA 4YLBA 3Q9QA 3AACA
chains in the Genus database with same CATH superfamily
4GOSA 3SD2A 5ESAB 1KGUA 3PP3K 1FZKB 1IGYB 1T1WB 2RA1A 4NSKA 3OB0H 3M8OH 3RX8A 5HGAA 2CIIB 3JVGA 4BIKA 5FF6B 2XZAH 4I48B 3WENA 4H26B 3FCUB 4PJAB 1ZE3C 4LRIA 5KSAD 1G7HA 4Z7IA 3ARFC 3GJFH 5F97E 3S36H 5JORA 2XKNB 4MJID 4R96A 1JFHA 4F7CB 4NQXA 5C0CE 1TNMA 1KENL 3D0LB 3FT2B 3U4AA 5C09B 3UYOD 1ETZB 1N3NA 2AZUA 3GS4A 3KAAA 2ZP0T 5IR1A 2QSTA 4NQVB 1XH3A 5BVJB 4RBPK 1D5RA 2GB2A 4UQ9A 4OR1A 5JHDE 2BRQA 4OV5B 5JQIB 3PWVB 4WUUD 1Q4NX 3N44F 4IRJA 4NRXA 4XBMA 5IWLA 3L9RA 3ZT5A 2FBRA 4NDMB 3NRPA 1CVSC 2IH3A 2QFRA 4QXWA 2NOYA 4NEHB 2VR9A 4PJCE 3JV0A 5AVTB 1JGEB 4ZMXA 4ZX4A 3CVBA 3DGCR 2AMGA 1ZGLB 3SJVE 2VLKD 1DQTA 4QT5A 1F4WL 3P2BA 2VITA 3MX0B 5DC9B 2X1QA 5DEGA 2NNAA 1GZPA 1BQHG 2VGLM 3OPUA 3FDWA 1CN4A 3T2NL 4M7LT 2JK5A 5SWZD 1IT9H 4I0PB 2XETA 3MN8A 4HW6A 5MP6L 3DDGA 1TTCA 3HBQA 4U1SB 4Z7WE 1CXIA 2EIKB 3QARA 3EUUA 3O6KL 2W9LA 1V27A 3WIIL 5F9OL 5FK9A 1Z3RA 3G6DL 4ZTOH 5DZOA 4LLQA 4QHUB 1BXUA 2RTTA 4KZDL 3VXMA 4HS3B 1RIVH 2X44D 3C5ZD 3JWDC 1PSKL 3NZHH 4HUNB 4KAQH 4LF3A 3JTTB 4LBEA 1I9EA 1IE4A 4HIIA 1IVLA 2K6YA 2YXFA 4HWNA 1CS6A 4LL4A 4QTHA 5D7SL 2WN3A 4B53A 4PJHE 4EI5A 4NYLA 1N59A 4I1RA 2IAND 3CZFA 3NESA 3FYIB 3OJDB 3DYMA 4FG6C 3R0MA 3ZDZF 1GS7A 3PHOA 5J11B 4AENB 1YEDA 3WEAA 2FQGA 2A73A 5DJXB 2I27N 1M7DB 4R7DA 4XH2A 2X4OA 3QZMA 2YGNA 3M88A 1FYTE 4MNQE 4N2GA 2V3DA 3CVIL 4MDIA 4UMGA 2IQAA 1A0QL 5LWYH 1N6QH 3ZE0E 1WE5A 4IKIA 1IBGH 3W9DA 1AR1D 4UU9B 4W70A 3TZVC 2XQBH 4JO4H 4AMKH 2H6PB 3CN0A 2IIJA 5F9AC 4AGMA 5E51A 2H32B 4PJIF 3LS5L 3HI6L 2ZKXA 1XIWA 1NBVH 4EOWH 2IDSA 4RX4A 4U1HB 5L8LB 3PGFH 3L3GB 2A6DA 1CBVH 1VLXA 4WVRA 1F3JB 2Z8RA 2ADJA 3ZTEA 3PWLB 2AEWA 2E59A 4G9FA 5EH1A 2E6QA 3DTXA 3UZVB 1CTOA 2ZPKH 2OMXA 3TF7C 4GKLA 3KPOA 4TTDD 3TA3D 3DJ9A 3RWIA 4WI0A 4Z7VA 4APQC 4Y5YA 3FT4A 1EBPA 4YAQB 3D0VB 4PH8A 1UT9A 5DUJA 3ZMRA 4S0SD 4H25B 2BSSA 3AUVA 3DGGA 3FQUA 3JUYA 4PG2C 5FUOL 1A4JA 5I30L 3QR2A 4S1SH 4XOEA 3CSYB 1SDDA 1JGLL 3NK3A 1KXQA 2B1HH 4OLZL 2APVA 4C55A 3KBHE 1UWEH 1CFQA 4ALAH 2QADD 1BIHA 5ID1A 4MA7H 2DB8A 1TF4A 3LIZH 4Z7QF 3M45A 3SODB 4JFDB 1JCKA 2GC4C 4AMWA 3IJ7A 1QLEL 1LMIA 1HWGB 2FQFA 3IFOA 3RA7H 2B0SL 3MZGB 2EXTA 1WUNT 5TDPA 5IZ7A 4XNYH 1RJLB 3PGDA 3B2XA 4R3SA 3WY3A 1JK8A 4RRPA 1T1ZB 2JTDA 1KGIA 1EGJH 1VEMA 3FYEB 4P2QA 4JLRA 2EDMA 3MRCA 4LEOA 3FCTB 2GFBB 1WS8A 2JQAA 4M6OL 3W0WD 3IDNB 1QBLL 3K71B 1YEKH 1HL4A 4LSTH 4QTIL 5AYUH 5HYIA 1MJUH 3SO3B 2ZKHL 1BW8A 3QZNA 3REVB 1DHKA 5G5DB 3OQ3B 4Y4KD 4IKJA 2I5YH 5DK2B 5DS8A 4IOIA 1RJZB 1A5FL 1H8NA 1MNNA 5J6HA 2BOCA 1DANT 3RJDA 3U9PH 3LKNA 3KR3H 3AQZA 4AQAB 4WW1B 5K9QI 2FO4A 3ARFA 4J3VA 5D72H 4YGVA 5DRXA 2OJ1A 4BH7A 3MV7A 3P4NA 3QULA 1MFAH 1A4CA 2ZXWB 4HUXB 4R2GB 4YEEA 1G0XA 2WYHA 1OP5K 5FX3A 3M7FB 1YZZA 3P3TA 1FO0L 4LPTA 4ZBJA 4Y4FB 5I1GL 2PP9A 4A7QA 2FD6L 3I3EA 4XVUD 2VDML 2WHVA 3KJ4B 4ISVB 2G3MA 1SN0A 3F00A 4Z95L 1YNLH 3Q13A 3MLTA 1A9VA 3PDDA 4J3OG 4X80H 3FONA 4R4NC 2Y4SA 3QAQA 5TE6H 5F7EH 1TSHA 5CJXC 1DBJL 3ARQA 5I1AA 4YBLC 4UIKH 4Z3EA 4NIYE 4UB0H 5IV2B 3G9AB 5C9KA 1FL6B 3C75A 3T8XA 1A25A 5EBWB 2OCFD 2MSPA 3QUMA 3QK0A 2NT1A 2CGRL 3ZL1A 4GUOA 1NC4B 4IS6A 5E00A 1ZANL 2WWMD 4U3SB 4DQAA 3K74B 2R0LL 3O4LA 4OCSH 3DUSB 4EXKA 2R8SH 3FU3A 3DJTA 1S3RA 3ZZSA 3TBYB 1CICB 3BMWA 2Y07H 3QPQD 1CGTA 4LESA 2FCBA 1FBIL 3WEBA 3LD8B 1I7RB 4KJQC 4M7LL 3BPCB 2F53D 1HL8A 4M5YH 3FFCD 3K6OA 1H8LA 2BVYA 2FNWA 4M48H 2AV1A 4WCYH 5GS2H 3FUDA 1U0QA 1FFOB 1BBJA 3AT9A 3KLKA 1A7QL 2DKSA 3QJQB 2GQHA 5E7BA 2DH3A 3HC3L 1KMGA 4H8WH 1P53A 3PL6C 4PJXB 3VI4B 1IC5H 3LJ3A 4OZ4B 3II3A 2DIJA 2F58L 4N0UA 3LNDA 3OVUB 1C12B 4POUB 4FXGB 4PJDF 3QNXA 1NM4A 3WMQA 5FO9B 1UM4H 2ZZUT 1S9KC 3T04D 1WFOA 5AVRB 1P7HL 5E94A 3ARWA 2P44B 2BMKB 3EJZD 2RCSH 2XXMB 4RSVA 1XZ0B 4NQDB 4B6ZA 1QZ1A 3BIBX 3SE8H 4KKCC 3AGVA 3GJEB 1HT6A 3N42B 3FL7A 3TZVA 4PIBA 3FK3A 1SJEA 2ZYIA 3MRNA 1EDHA 1NSNL 5KUMA 3D39A 1HL5A 1VFUA 1L7IL 2QR0A 3NK4A 1GSMA 5CCKH 3TX4A 2XVBA 1OV8A 1JPGA 1KXVC 4C59B 4W4NA 2CPCA 5EZPA 1H3GA 3G5ZB 1NUNB 4KROD 2WZPA 4FI7A 5C0DA 2LV4A 4TNEA 3AXIA 2E9WA 5I6PA 1QFWM 3VXRA 4M43H 1TTBA 1CQKA 4APQA 1GMEA 2VDPB 3BEWA 4HYTB 5T3XL 3WNLA 4JB9H 4ABVA 4ZMWA 3N41B 1IM3B 4ZFOA 5KBPA 3AS2A 4YGAB 1GOHA 5FGRA 4ZOBA 3ISRA 4BQBA 1HE7A 4YBQD 4OB5L 1G1KA 2PO6D 1INEH 3TN0A 3UABA 2G4EA 3OAUL 1T03L 1KG0B 2CO6A 5JYMA 1SDAB 2V3FA 5KVMC 1UASA 2XG4B 3N43B 4YUEL 4AKPA 5KYXA 1INDL 2BSBA 2J6EA 2FSEA 1MI5D 1UEMA 1A6WL 2DJ4A 2YWYA 2X12A 3MRPB 4BUGA 1KN2H 4W9JC 3TBTB 3V0EA 5IQ7H 3VDBA 5ETUA 3L5WB 1CLZH 2JQMA 5AQ0A 1QR4A 3EO0A 1U8KA 3ZTCC 3CU7A 2NY0D 2YARA 4NP9A 2ZCKL 4K3JH 1XAUA 4ZFGL 4JN2B 2IPUG 5A2LH 4L18A 3NFSL 2HLAA 3NACL 1IC7L 1Q0YH 2KMWA 3I6LE 3QQ9C 2PCYA 4J1UA 1UOKA 1ASOA 2JIXB 1ZS8B 3GKWH 1FQ9C 5TE4H 3VGAB 2GSMB 4UBDC 2APXA 3AG1B 2H0EA 3GXDA 3RVVD 2G75A 2ITFA 3GSNA 4OFYA 1PYWB 2IEPA 2R4RL 3MJ9L 4HKJB 1YEEL 2PN5A 3TH2T 1E8XA 4MZ3A 1UWGL 3T4YB 3KXFA 3FBQA 2HJLB 2BFGA 5HDOA 3QHZL 5DHVH 1K6QL 3EOTL 2P4AB 3GLDA 3RPIA 5TH2B 1MJ7L 2JKLA 3T8VA 2ADFH 3IJ9A 5DJAB 1KLGA 4FKKA 4NLHA 5LGJA 5BO0D 4U0RB 1OK0A 3ML9A 3VI3E 3BXNA 1ZHNB 3GSWB 4JM2C 2F74B 4U7KA 3TBWB 4ZZFA 4ZYKB 1U93B 5I16B 3ETBJ 1DBBL 4JS7A 4ZMOA 5I1JH 1F97A 1RZKH 1N8OE 4OLWL 4EVNA 3GF8A 3RWJA 1PZ5B 4M5TA 5T1DH 2VYRE 5T5FL 1ZHKA 3KLQA 4JKKA 4KRMB 3L3DA 5CJXA 3HR5A 5HYJE 1OPOA 1CDUA 4LPWA 3LKQA 2OQJA 3WG7B 4C47A 4HFUL 3K1KC 4LCYA 4AV0A 3BYYA 3B9VA 1EZUA 3WIFA 1KCLA 4DN4H 2WQAA 4ONGH 3ZYJA 5IOPA 3G5WA 4GMTL 4WZ9A 2H0FA 2WIMA 3BAEL 2JV6A 3QWRD 5BOJA 2CUHA 1TKWA 1TQTA 1HXMA 3FKUS 4RGNC 1M05B 1YJDH 1M6OB 2ITDB 5DD6B 3JTSA 4P23D 2VSKB 4BH8B 4EDXA 5F8RC 5LBSL 2EABA 3ZE2F 5A6IA 3NH7L 3VA6A 3WNIA 3IMUA 2FLRT 2HT3D 3PWJB 4AQ1C 4ODVH 1I8UA 2XXGA 5CEZL 4UQCA 4UNTA 4PMEA 3L9YA 3CMGA 2G4GA 2XQ0A 3QFJE 3V8CA 5ISZA 3WXVH 1S7WA 3JT2A 1DQVA 2C4FU 1IO4C 5CEZD 5EOQH 4LLYA 3RE0A 2W95A 4WO4D 1TEGA 2VR8A 3TEZA 4U6HA 3BLPX 4YPGB 2E9JA 4MX7A 2XV6B 3PL6A 2OV0A 1ZT4B 1N18A 2DQJH 3TVMB 3VAEA 5IT2L 1L0YA 2X6MA 3RX9A 3MRQB 4K23H 1WZMA 2HRPL 4GSDH 2PR4H 2K70A 3AFLA 4XAWH 1D7CA 1B3JA 2XT1B 3VGGA 4X6EA 1EFXA 1T5WB 2G0KA 2Y7LA 1JJUA 3ATAA 4L8SB 2FGZA 1TITA 2NTFA 2FJUB 4XWGH 1YO4A 3O3AA 1K72A 4QRTA 3U79A 1TZIA 1QUNA 1MWAB 1E9PB 3KVQA 3DUUA 4IKKA 3V5KB 5DJDB 4OZFA 5IMKA 2AEPH 5E2UH 1CE1H 1XVSA 3FMGH 2Y7QB 3L2MA 4GAGL 1F86A 5L4FA 2BP5M 3D4YA 1JGVH 4FTVE 3ZOAA 2X0UA 2YKLL 3QRGL 1KXVA 4NO0D 5E4EC 4HXBL 4OZGB 3UIZA 3RFRA 1E27B 1T0MB 3IDXL 1ETJA 2R29A 4KMQA 2CBQA 3VX1A 4ECNA 5LNEA 2WNXA 1CDHA 4QRPB 1JYXA 3DX1A 2EYTB 5BS0B 3D34A 3RI5K 1FFPB 1AHWC 3U1SL 3HG5A 4M1GL 3ZKND 1YPZB 1PAZA 1J86A 4IKLA 1T20A 3IJEA 4XNAA 1Q9KB 3VYNA 5JQHC 4PJ7A 5CIPH 3WSQL 4L1BA 3GBML 3VD7A 5EORL 3IF1B 1DBKL 3ASWA 1F11B 1I3RB 2WSKA 1URIA 2WUCL 4XBGA 1FORL 1QFWI 5E8NA 2R2HB 4S11A 1OHZA 4BA8A 4WU7A 1HCZA 4PV8B 3T6XA 1VFBB 1BBDH 4KRPD 3DXAD 4IBZA 1KJVB 1J8RA 4Z0XA 2QKSA 1YY9D 5PAZA 3G5YA 2Q10A 2O6EA 4WSGA 3ROOA 3ESVF 2WQUA 1EEYA 2CHZA 2NX5D 4JKLA 4Y19D 1KPUB 1SXBA 3CCHB 4TSAL 3IDMA 1J0YA 1URZA 1S7UB 1ZTMA 2FWUA 3A23A 3NCXA 1BFVL 4WFFE 2ZSWB 2BVQB 4CU8A 5ACLA 4JFFB 2OMVB 3GSXB 3LH2H 4OVUA 3S8WA 2GIYA 1UVQB 2V2WA 5AW0B 4BZ2A 4JO2H 3IAPA 4HU8A 4KKRA 1MJJA 3QGVA 4FP8L 3VFGL 5FYJE 4AIXA 3KPQB 4D8OA 4PLNC 3FU5A 1YEWA 2VM3A 3ABLB 3LKSA 1NIFA 3CDCA 2R56H 3ARPA 4N2HA 5L7XL 4X6CF 2YLHA 5I6LA 3D1MC 4BE5A 3CXHK 1KTDA 1MUJB 3ZQWA 1YMMA 3SGJC 1FL3A 1A6UL 4FNTA 4KUZH 5EOCJ 1WA2X 3LKPB 4TVPL 4KMTH 4XBEH 1P69B 4OLVH 4MSWB 2YPLE 1MAJA 4MMYA 3TBVA 4UUJA 4L4VE 5AZEL 2WWOA 1YEJH 4RFOL 5EF2A 1SZNA 2ROYA 3VFVA 1YQVL 3IN0A 4P9HC 2QFPA 2DJSA 1OM9A 4KHXH 4TVPD 1S5HA 1H15A 2DIEA 3E6FA 3O11A 3QXAA 3N1FC 4XP6L 4HFWB 4WWNA 3VMNA 5HHNA 3V95A 3EDEA 1SN5A 1OAYH 3LPPA 1MCWM 1EAPB 4G7VH 4XVJH 5DWUL 4WHTA 3NPSB 1VGKB 5E4AA 5TF0A 1YN7A 3QJRB 1AD0A 2J8UE 4WJG3 2XQYK 4DO4A 2AJVL 3SKMA 1N26A 5CGBA 1QLFA 3HE7B 2VM4A 4Z7VF 5IVZB 3OZ9L 5PCYA 1OQXA 1XF3B 2ZCZA 4AQEA 3C5JB 5IB2A 1KTCA 3L1EA 4PUBL 4FGMA 3THMH 3VH8G 2H3KA 5D2NE 5E6YA 5D1QD 3WTSA 5DHMC 1A47A 1OGAA 1EBAA 1FRGH 5IQOA 1U6AL 4FQIL 3L2NA 1TFHA 5IVXA 5CKGA 1G6RB 4IU2A 3V0IA 3EYUL 3PWNB 3QUZD 5I1KL 5C6TH 3RNQA 3DA0A 3GI8H 1O5PA 4AITA 4JGNA 2ZOTA 2HFGH 3NIDF 1FAIL 5I15L 1WBYB 1Y7VA 5ID0A 2WOYA 5I8CB 4IGBB 1OHQA 4KQ3L 3S3SA 2BNUB 2B2XH 4N0CC 4AQ1A 3MNMA 4KTDL 2VDOB 5CO1A 1HAUA 3BD4A 3CZLA 4IRZA 4OLUH 1UD3A 5AG9A 1D7FA 4ENEC 4ZXBC 3UCRA 3IDJB 4XC3H 1UGNA 2R2EB 3LRMA 4XNUL 3CDZA 3RWHA 2JKTM 3WAJA 3ARVA 2HTKC 5EF1A 4LDCA 4ZG1A 1JP5A 2AQ1A 4YO0B 1OTUD 2VLJD 3ZYIA 1EJOL 4IRJD 4NXSA 2H3NA 4X6DA 1CO1A 1SXAA 3QS3A 1MEXL 2AKRB 1C5BL 4XO8A 1IEHA 4JY5H 1F3DH 3PAYA 3ERXA 2X5PA 2ETWA 1F6FB 2XWEA 3CSFA 2DEWX 2R0KL 2WGXA 4ODWA 2EEBA 5CS7A 3SCMB 1KYOK 4ZAKC 5GGVH 1VJSA 3PQYD 3OKLB 3OAZK 5FM5O 4L3EA 3U7YH 5JHMA 3LV3A 1E28A 1HH9A 2YC1B 1OPGL 2A74B 2ZOLA 2R1YA 4X0NA 1FN4B 4WUUB 3L1GA 4HWEL 2VDRL 3EDKA 1GGYA 1ODUA 5F1NA 1AGCA 3T77A 3LMJL 1BOYA 3VTAA 1JFQH 1S9YA 5BXFB 2WINB 3KYNB 2IALB 2C1PA 3D3VA 4KKBD 4POZC 2V8LA 2VLKB 1IJNA 3ZKQD 4HOZA 5KSBB 4WFED 1QLRA 1N5YL 2TRYA 2I07B 3BVWA 1Z32X 4XMXA 1DANU 5FGCE 4OZHA 2WYIA 1PLCA 3HG1E 5SWZB 5F93C 1JN6B 4X6BA 4YSRA 4FZEL 2WXLA 4PRDB 5SX4I 2FUTA 5SWSA 1WZKA 1CG9B 4YDJB 2ERJC 3BGAA 4NWUL 5LXVA 3LTVA 3A5VA 1AHWA 3C2AH 3PJSA 4PJFE 1BVZA 5DTFB 4G1MA 1Q9WA 1QI3A 4X5XB 5SX4H 4DP6X 1XT5A 4N2BA 2XY2A 1XO8A 4M93C 4G8FA 5IW3A 1UH4A 2FUQA 3C5ZB 1KFAL 3A4DA 4FC3E 2QLVB 1NZRA 4EIGB 5HHMD 4FQLL 4NQSB 1G7LB 1NEZA 2VMJA 4N0FB 5GQBA 1GPOH 2UZYA 2IANB 4JQXC 3N40F 4KDVA 4P05A 1WCBA 3K8LA 1IGJB 3HA0A 2VQ1A 3D69B 4YFDB 1RZFH 3TWCH 3X3GL 4C58B 4KNTA 4R0LC 5C70A 5I1HH 4HISA 1E3FA 4YDLB 3CXDH 3D7PA 2ATPA 5H35A 4HGKC 1PFOA 1E3ZA 4F7EB 3QEQE 1X7QB 3EJSA 1ZJAA 2FIKB 4LGRB 4NB7A 3ZTJG 1OGPA 4LFHG 5LGKA 4G9FD 1IGMH 4JFZH 4F9PC 3BP7B 3HZKB 3BH9A 5IHZA 2P7TB 3Q8CA 3N04A 5JIKA 5BPPA 5C0CA 3ABZA 1WWBX 2H6UA 1AP2A 1FG9C 2WXKA 5GZOD 1TCRA 2CDGB 4OFIA 4LEXL 1LILA 5D55A 1MCSA 4GXVL 3SGJA 1CFSA 5ESVB 4DCQA 3NIGF 5JHDA 4B9KC 1DQLL 1SXCA 1T66D 4NXKA 4K7PX 4XNBA 2ZUYA 5FHAH 2X6VA 4DAGH 2QV2A 4OJEH 1NINA 4XRCB 3TP4A 2A6IB 4MXWL 2J43A 4URKA 5DYOA 4PJCA 3W11C 3DVNB 3TA3B 2DM2A 1NKRA 2RH0A 2BPBA 3V5DA 1N0XH 3CIQA 3LQMA 2P8MA 3QWOB 4KVPA 3M07A 4ONFL 2WQ8A 4WNQB 3R4DA 1P4IL 4AKOA 3N6YA 2BNQE 4JE4B 3IN2A 5AL0A 2NW3A 1KYUA 2H1PL 4FHBD 3WJJC 1UB6B 1DLFH 1ID5I 3GKZA 4MDJA 4Z7WA 4K0OA 3UJJL 4NKMB 1OP3H 5CJQL 4P2QD 1AS7A 2ZJSL 1I8KB 4P48A 3QSKB 1F18A 2ICWB 1BYOA 2V6HA 4U4BA 3KGSA 5IB5B 1ZT7B 2K78A 4F8QA 5DD1H 4Z7OF 3AQYA 4QNPF 5JQ6H 4O00A 5DT1H 1B0RA 1ROWA 2DQHL 4BRJA 4HHWA 3QG6A 1QLEB 4YDNA 3FO0L 3MR9B 3D85A 4HIXL 1BQHA 5HHPB 1LEIB 3VE0B 5IFJA 3S3BB 4PJHA 2IV8A 2ZT9C 1GOFA 3LZPA 4UT6L 4LLWA 2DKMA 5L6YH 1MOEA 5KW9L 3W0WB 2B1OA 2C9AA 1EXHA 1C7TA 4A1RA 3PLYA 3N44B 2LTQC 1K8IB 4ZXBA 1UXWA 2O6FA 4OCMC 3I84A 1EAJA 1RUQL 1FYTA 4MNQA 4XWOC 1Y1DA 2AMUA 4G6KH 5IMMB 1ZLWH 3UG4A 5D6CA 1CXFA 1TQCB 4HUWB 3JBG7 3FT0A 1DUYA 3UTQB 3H9SE 3TO2A 1QR1B 4PJ5E 4Y16D 4I5BA 4PLKC 1SLUA 3LEXB 3L1OH 3NTCH 3GSOB 1J0JA 4XMPH 5HYEA 4E9VA 3AT0A 3FTSA 4NHUB 1W91A 3INUH 3QUML 1UOLA 2JB6B 4GIPD 5DD3L 4ZAKA 2VZ3A 4L1SA 4DEWA 3RU8L 1JZ3A 3QZWB 4YR6A 3DBXA 1AQMA 1CZ8L 4Z8FH 1EEZA 3P77A 4PVNA 3WFZA 5D2LE 3T71A 1KIRB 4OZIE 3FUIA 2IQ9H 1FO0B 1XAKA 4ZDHA 3VSQA 3H55A 5EFIB 2NZ1A 3WN5C 2VDMB 4MBOA 4EBQL 3LQZA 1RXLA 3JWDL 1OCRB 3LDBC 3QT2A 3HC2A 3KD4A 1BOGA 4JMNA 1MHCA 1Z5YD 1J1XL 3QUGA 2LU5A 7PAZA 4ACPA 2WB1A 5BO1L 4XN1A 5MEPA 2J44A 1QWNA 1XCQA 1N68A 3BUTA 2R4SH 4OIAA 1O7DE 3BP4A 4S1RH 3PP3H 1EK3A 3Q2LA 3Q01A 4K2UH 4NQCB 2NSXA 5C3LD 2I9LB 3IXAB 4PGBB 3QI9D 3VA2C 1RVFL 3DIVA 1I1AB 1DJGA 3IJHB 1EHNA 1ORQB 3JV5A 4GKNA 1V3MA 4PVBA 3G7TA 3PP4L 4HZ1A 1J5CA 5GISH 3H1ZA 4FG6D 3IWVA 1X7TA 1PLBA 1BAWA 1W0VA 2JELH 4J8RA 4LT7A 1HEHC 4BM7A 3EHBC 1N6UA 3TIEA 4PWHA 3VD2A 3V55A 2DMBA 2VR7A 3OR6B 1G7JA 5I0ZA 2F53B 4XVSL 5IGXH 4KZEH 3AXLB 5E8EB 1R5VA 3WTUA 2FJGB 3D18B 3FB6B 2KS0A 1AO7E 4LAQL 5KYWB 1J0HA 4GW5A 2CGYA 4ZUTB 1HJCA 1X5GA 1BEYH 4RBPH 4PWEA 2JSFA 2XIBA 3GSRB 3MV8B 4JQXA 1OAKL 2J7LA 4BKSC 1I7UB 1J1PL 1VHPA 2BC4B 3MI6A 4BFRA 1R3LA 1BLNA 2QGEA 4A2LA 1T89A 4HWBA 1R47A 4JZJB 2G60L 4R0LA 5E2WH 5D71H 4WWID 4U6TA 2CNYA 2WKGA 5I5RA 1FIGL 4ELMF 1L0QA 2QQQA 2EQDA 4RQQA 4BFIB 4GRLD 2WZPD 2HG5B 3B56A 3K2MC 3OHXB 4YHOH 1EMTH 4F9PA 1DLHA 2A9NH 2IF7A 1Z9SB 3BQUC 1BIIB 2MMXA 4TUJA 4CMHB 3DTUB 1NA8A 2ORBH 1RIUL 1ND0B 4HX1A 1AQDA 4ADJA 4Z7QB 1ADQL 1YAIA 1B0GA 3IPEA 2FEEL 3MLSH 1BCIA 4HCIA 4KROB 1J9CT 2LQRA 2P5EE 4BFOA 2X9YA 4HKZA 1LDSA 5AZUA 1F1AA 4KXCA 2DQFB 3ARDC 3FF7A 4A6YA 1NUFA 3EFDH 2BFVH 4PTUA 2YRLA 4YIQA 4QOKE 3KJ6H 4KTGA 4JFVA 1GJUA 4CVXA 3BUPA 3HZMA 3VFTA 4QXGL 5FB8B 3QORC 3BO8B 3P0GB 1RK0A 2G30A 2AEOA 2BJML 4FQCH 1ZA3A 4FXKC 4P3CH 2F54D 4Y88A 1FNSL 3WJJA 3L4YA 3HFFA 2APSA 4JO1H 2PO6B 3HNSL 4LLMA 5I1IL 3DVGB 2MPAL 4UQ3A 4TVUA 1AFVL 2D0FA 3SDYH 3LHPH 1J8HD 2ZCHH 3WNNA 4PBWD 1YC8A 1SVCP 2EO1A 3GSNL 2MQ3A 5F88A 3UBXI 1KPVA 1ZAGA 4M4RB 4IDJH 1YUHB 3BP5B 4NNYB 1EFQA 4XP1H 4Y9BA 1MHHB 4S1DC 2EKJA 4OFYD 4KK8D 5CF3A 2IVFC 3ABKB 3CFMA 3PJNA 4HK0A 4R9HA 3QJZA 1AZNA 3AU1A 1AMYA 3KXFD 5D70H 3Q2VA 1XH0A 3VXSD 3EYSL 5AVVB 4GMSH 2WXPA 5K9JH 1XMWA 1YYLL 1BZ9A 4LVOB 5E8PB 4PJBE 1PDKB 4YDMA 3PWUA 4L4TD 4DEPC 1JZGA 5DLLA 5J12C 5KG9A 4A2HA 2N0MA 2QHRL 2E27L 1UB5A 2OL3B 2M83A 1JUFA 1X9LA 3ZW3A 3NCCB 2OZNA 1KV7A 4DUXA 1NOAA 2NMSA 3SKUD 4R4ND 4AGPA 4QF1A 4KO5A 1CD1B 1CL7I 1I1FB 3L3KB 4S10A 4BDVA 4TTGA 3FQWB 4HJSA 4M6AA 4KH2A 5F9WB 4PQXA 1R4XA 1AKJD 4NUJA 2WVVB 3MLZL 2OXHA 1NFIA 1CL7H 4JFUA 3FB5A 3P9MB 4BSJA 4XMZA 3T6ZA 1DVYA 1SLXA 3KCWA 4HPYH 4Y1TA 3BKJL 3F64A 3T2LA 1FVEA 1IC4H 1GW6A 1QFUL 2QDVA 5DVPA 3VTTA 3WN5A 2OSLB 4X4XB 4JM2F 2FX9H 5CJOL 2P8PA 2ZOKB 1FNHA 5KYYB 1JDAA 1QEWA 3BAWA 5CJBA 3DX3A 3SB3A 1RJCA 25C8L 3X17A 4KJQD 4AXWB 32C2A 2VXTL 2RGSA 4UT7L 3EJUA 1I7ZA 5CZXC 3VYOA 2WWKT 5CBEB 4Z7UE 5JDSA 1JYWA 4R7VA 2IPKA 2Q9OA 4O58L 3C87A 1U91A 4PJDB 5AB2A 4DNLA 1HKFA 3STZA 1ONQB 1UENA 3RIAK 1AGEA 1WT5C 2YMXH 3PL6D 1IFHH 2XRAH 3EF7A 3HBGA 1RUMH 1DQJA 4OTXH 1K9TA 4R26L 2PPAA 4JDZA 1I8MA 1HINL 4AVHA 4HD5A 4RISL 3C5XA 2A4EA 3O2WH 1U8OB 2WGNB 5FYLL 4EZLA 4HS8L 4JJ5B 2X40A 2WXQA 5DJ6B 3WXWH 1R0AH 2OK0H 3AMKA 1HVXA 1ZD6A 2FEDD 1BLIA 4K94C 4KKCD 1E0OB 3ESUF 2BSRB 2PYFB 1IZKA 4P06A 3NCJL 1UZ6E 1KFGA 4YHML 2XG5A 4LHUD 3I74A 1QSEB 4FRWA 2IDTA 5C0EA 2R29L 4AGQA 4YEFA 1MIML 3QJHA 1E40A 1K4DB 1HEZB 1C5CL 4K3EH 3FCBA 4I77H 1LE9A 1Q9LA 1WVZA 5LN8A 4G1EB 1VENA 4UZUA 3X14A 3KCPB 3L17A 5I8EB 4TLTA 5EU7E 3CSBA 3TCLB 3BQUA 1TJHL 3VW3H 4CN4A 3RTQA 5FS5A 3EGXB 3V9CA 1JL8A 5EPMB 2HX8A 4OLEA 3VI3A 4ZUSA 3AY2A 1P4BL 5DRZB 4NO0B 1ZV9A 4G82A 2VCOA 2GBTA 1BAFL 2QMKA 1WC7B 4Q9CA 1ZTXH 1PG7H 4WI4A 1VA9A 2WM0A 5CP7A 2JQZA 1HS6A 2XVGA 3QCVL 4MNGB 3ARDA 3SDXE 4D9LL 3GBDA 5F7HA 2C7FA 2WIIB 4PGCB 4PS4H 3UEQA 2OXGB 5HYJA 3Q8BA 4TMPA 4RAUB 4M7ZC 5ABAA 3VSUA 4XNDA 1KEGL 4HH9B 5D2NC 4CJ1A 3QORA 4I4WB 2B7DT 5FM5M 4ZODA 1D9KB 4UWQB 3WL9B 1JF6A 2WBWB 3BAIA 3KPMB 1A6TB 4BZ2L 1H6FA 3I6GA 2F8VA 3S0PA 1AXSB 3DV4B 2A4ZA 3BPLB 3NGBC 4IKNA 3BJLA 2P46B 4WFHD 3T9WA 4N24A 1VZIA 1RMFL 4KY1L 5EOTA 1IM9B 5GS3A 4F7MA 1X5MA 4DP2X 3T65A 3QQ9D 2DYPA 4PP2A 4KRPB 5AOJA 1IBZA 4LE8A 1ZGLP 4I2XB 3V6BR 1AQHA 5D5ME 4PWJA 4X9FA 4J23A 1JZHA 2NX5B 4MYPA 1C9SA 3QDAA 2JXMB 1G9NH 1S3KL 3QFJA 4DKFL 1YMMD 4UZSA 5LAPA 4NKOB 3VSVA 3S5ZA 4P57A 3BT2H 5AW7B 5FDWA 1SM3L 4NENB 1UM5L 5IFAH 1PJ9A 2V7NB 3IJSA 4HG4K 2K3TA 3O3DB 1FVDA 4LSSH 3H4HA 5JHLA 5H37H 2C9QA 3TT1H 4ZX6A 4YDKL 3C09C 3JYCA 1HDMA 1XD1A 3BJ91 4JM2D 4CU7A 2Q20A 5IEHB 5L2KE 1JNHA 4ZO9A 2YEQA 1CU4H 3QPKA 3I50L 1JZ7A 1FCCA 4XPTL 4LLVA 4IYKA 1RK1A 3MLVH 1I8AA 4OQTA 1F56A 2ICWJ 3GRWA 4Y2OB 4XPHL 2X4SA 2CIKA 1PZUB 5GGTH 4GW1B 1MCFA 2XOTA 3PCYA 2C7UB 5FFLA 4FTVA 3PHSA 4ZMNA 5AG8A 3DGDA 5FA4B 3UG5A 5IF0A 4PR5A 5AKVA 4ZUUA 4AYFB 4WIQA 1V8HA 4V2CB 5H2BB 2XZQL 2HRLA 3U4EA 1XB3A 3ZE2B 2ZSVB 1MELA 3L3HB 1NM9A 3KGUA 1PS3A 2F15A 2AFNA 3MNWB 3FUKA 5EUOF 5G4MA 4GQPH 4KO6A 5CU5A 1IAKA 2Q5BA 4BRVA 1R1CA 1MIEH 1WBZB 1EAOA 4IRZL 4JFWA 1MCQA 5IESH 3GMPB 5EEUA 1UH3A 4I18B 3VI4E 1AXTL 1KC5H 3MQIA 2GSGA 2X1PA 5DHDA 4D0DA 2XCMC 1HZHH 1U41A 5D1QB 4D0CA 3QUKA 3X11B 4AM0B 4ZFFA 1KTBA 2DYSB 1CD0A 4B9PA 5SV4A 4Z7WF 2BLFA 2G5BA 3ZSSA 5IB3A 4NSKB 5EEXA 4X5PA 2V5SA 4NZFA 3P30L 3E8UH 4G83A 2P42B 2YOAA 2ZF8A 1PVHA 2ZWLT 5HGAB 3D50A 3WFBL 1TPXB 2H2PD 4NZUH 3ZO0A 1LO4L 1WT5A 3FTXA 3MVSA 1EWHA 1G7HB 3TFBA 1U58A 3A22A 3L1FA 4R96B 4Z7NF 4H88H 2OSXA 3C8KA 1XFPA 1RH8A 3HMXH 4G42A 4NQXB 2IOOA 4YHNA 3UMTA 3ZLQC 4Y1AD 1UT1A 5B38B 1N3NB 3ISYA 4F24A 5IR1B 1N64H 2Q7NA 5A3IC 1XH3B 2Z4TA 1FZMA 4BZ1A 5BJTA 3FO1A 4WW2C 5A2CA 2YOCA 1VFAA 5A2KH 2ZIDA 4IRJB 4NRXB 4R5VA 3L9RB 5FW8A 2X42A 4Z76A 3GZOA 3ARUA 4G80A 3PWPD 3QJXA 4JRFA 4AGNA 4LSRL 5T3ZH 4Z3IA 5ITBL 4LLDB 2R9HD 4GSRA 3D3VD 2NW2A 4W9LC 3ZE0F 2PCXA 2VITB 3VD3A 4UYQA 5DEGB 4BK8A 2NNAB 1GZPB 1PD0A 2D8KA 3BVUA 3ZHLA 5EZOH 4Z18A 3WEMA 2PP7A 3FU6A 2J12B 2JK5B 4JRLA 2YPLA 4L4VA 5F2FA 3I9PA 3GO1L 4YXLL 1EXUA 5SWSD 3V52H 2EDTA 3LXBA 1FG2A 3C8HA 4QGTA 1UZGA 2B5IB 1O9ZA 1JV5A 4O4YL 5LVEA 5KVDL 4FYQA 5FK9B 4HV8A 2VDRB 3FTGA 1BVKA 2APFA 2ZXQA 3O2DH 5DQDH 2FECL 3QBTB 2J8UA 2EINB 4W93A 3W5MA 4WK0B 5FYKL 4LF3B 1NFDE 4LBEB 1I1CA 2JKJA 2WXRA 1JAEA 3F85A 3HN3A 4HIIB 4QTHB 3VXNA 1QATA 2VL4A 3WDHA 2COQA 4P2OC 5FDYA 4EI5B 4GRMA 4NYLB 1N59B 5D2NA 5GJSL 5JIIA 2BZDA 3CZFB 1CYXA 1LXMA 4H7VA 6FABH 4NUMA 3PHOB 3UFIA 1I3GH 1YEDB 3V5HA 5E8OA 4GG6F 3B5TA 2A73B 4R7DB 4XH2B 2L0DA 2X4OB 4X5WA 1CFVH 3TTYA 4J5VA 3P0VL 4QAWA 4MXVF 1N2RA 4X4ZA 3CU1A 5DR5H 3TJHC 2UYLA 4MDIB 3QEUA 2IQAB 1H6TA 3CDGA 5HHMB 3WU1A 2Z7YA 4PCYA 2DQDL 4QDGA 1MRFL 3W9DB 4BWUA 1B4JL 1J18A 4YVUA 4H0GA 1JMXA 3FUMA 3S96A 1F4XH 3G5XA 3O6FC 3VH8A 3ULUH 4Z3JA 2I7SA 2XSKA 3SPJA 1S7QA 2WQWA 4KV5E 3FH5A 5KSVA 1UQSA 2BP0B 3VNYA 1KNOB 1XIWB 3WTWA 4P9HL 5JHDD 2A6DB 1DSFL 2ADJB 1NWOA 2DBJA 1HTYA 1ZLVK 3V0JA 5F7NC 2WLMA 2DIAA 4G9FB 3DTXB 2OMXB 3EO9L 3QW9A 3QCUL 3TFKC 2J8OA 3KPOB 1QNZH 4Q56A 5D7HA 4Z7VB 4Y5YB 3FT4B 4JO3L 1Z5HA 3G08A 3K6NA 1NGXA 1CF8H 2XPGB 4XHQA 1N7ML 7TAAA 1XXFC 5F1OB 4A04A 3TC9A 4ZS7H 2BSSB 2VDQH 3DGGB 2KI6A 3FQUB 3LPOA 5G2NA 1A4JB 2Q6WA 3SDAC 1G9MH 2CM6A 4HUMB 4F7KA 4O5LH 4NUQA 2MNUA 2C3GA 1CFQB 2H7WA 3MACH 1UJ3C 3QJSB 5ID1B 3NZ8B 4B41A 4PCTA 3D48R 2Y5QA 3NIDB 3AADB 3A6CH 4PJ8C 3S3JA 4EMZA 1VERA 3IFOB 3UP6A 1FZOA 3SE9H 3HG1A 1PLAA 1EVUA 5TDPB 1Q72H 1O7DC 3D85D 3PGDB 3BWAA 4K07A 4IBYA 4QRAA 4R3SB 5B8CC 1JK8B 3HN8A 4P2QB 4PJFA 4JPVL 5FO2A 4JLRB 3MRCB 4N0CD 1ZHLA 4LEOB 4F37F 4BGDA 5JZ7C 1S8DA 2UZXB 1QWUA 4JFPA 4HJEA 4ENED 1S4IA 4FHJA 3UYRL 1GZHA 4UI2A 5IJDC 2MHAA 3VFSA 1JPST 2PTVA 3O9WC 2Y3AA 5DS8B 1QHQA 3LXCA 4IOIB 5J6HB 2BOCB 3T0XA 2E5EA 5TDOA 2QVTA 1WHOA 3LKNB 5T1MA 7FABL 2FO4B 2EXYC 3ARFB 1TLMA 4YGVB 3GK8L 5DMIH 3MV7B 1DCEA 5EWIL 3OJMB 1X4YA 2BY2A 3P4NB 3QULB 5I74C 4HSQA 3WDJA 2OULB 3RWDB 4EJ1C 5FHBH 3APDA 4HC1H 15C8L 4ILDA 3AREC 1CGUA 3S34L 4DGUA 4P5MA 3QEQA 4WW2A 1DDTA 1K8DA 3A4EA 3F5WA 3GHBH 1EZLA 1GYWA 2QBWA 3IDUA 3MLTB 4L1HA 4TOYL 2ZKYA 1M7IA 2RQ8A 3FONB 4HALA 3B6SA 5I17A 3GXMA 4LP8A 4N9GA 1AS6A 4D3CH 1KB5A 5C9JA 5IVNA 4JM0A 5I1AB 3M86A 4BBWA 3EYVA 3ZDYE 1LWHA 1E9QA 5DCCA 3T8XB 3CH8A 3DRTA 3QUMB 5CAYB 1QP1A 4LO9A 2ILLA 4MA3A 2J1YA 2C9XA 1LEKA 2A9BA 4JQVC 1ZOXA 4FYRA 4IS6B 5E00B 2X9XA 3O6ML 4M5SA 3IGUA 4D7PA 2YPVA 3GUTA 1WA1X 5L0QC 3O4LB 2WO3B 3UPCA 2XTSA 1MQ8A 1GC1L 2JB5L 4DKEH 2Y25A 4Y7OC 1IBYA 3TBBA 1H3XA 2H2SC 4MKTA 5IMOA 5GS0H 5KYNA 2BNQA 3QHFH 1GIGH 4EQ2A 5F6HJ 3D6GA 1CYWA 2D3VA 4N2NA 4ALAC 3FF8A 1NJ9B 2IXQA 5EZLA 4JPKH 1WIOA 2J55A 4QJ3B 3V4LA 2K45A 4P2OA 2ZCLH 4HWBL 1EQWA 2C9RA 3QNYB 1I3VA 2VMEA 4L3CA 3J27A 1D2PA 1NDTA 5DURD 1A9BA 4KH9A 1JE6A 4N0UB 3BFQG 5AVSB 3AQXA 3IWUA 3QNXB 5FOBA 4KTEH 3UTPE 1I82A 1DQDH 2XJKA 5E94B 5DZVA 3K7UA 2APTA 4PRHD 4RDBA 5E9NA 4KDWA 1WP6A 2BVUA 2EDYA 3MKKA 3OKOA 3TZVB 1A3LL 1IUZA 3MRNB 3O6FA 3ZE1E 4GG8A 3FQTB 3D39B 4W9FC 3S35H 5CCJA 1P4LA 4X98A 4XP9L 4P2CG 3CUPA 2JJTC 2QR0B 4PVMA 1JPGB 1GL4B 2KZ1B 3UO1H 4A6YL 3GJFA 1BSIA 4GQRA 5GRWA 1XGRA 4XPAL 4PJ5A 4RMRA 5C0DB 3SGDI 1BHGA 4HCFA 4Z0BH 1TQBC 3OKYA 1C5DA 1JXDA 4XCYA 4K5LA 4ZQKA 4OCYH 5IEKA 3STBA 3VXRB 4K3DL 5LQBH 3GDCA 4E5XG 3I9GH 4M1DH 3SGDH 4APQB 3L7FA 1ZVSA 5FV1L 1IRAY 3EOBB 3LKRA 4ZFOB 2WLJA 4OD2A 3U4KA 3FS9A 2CRYA 3SDAA 5D2LA 4OZIA 1QSFE 2NUTA 3V6OE 4N90D 5FWRA 1TUPA 5LLIC 1C8QA 1XCTA 4Z7OB 1ZIBA 2Q8AL 5MEND 2KKQA 1XQ4A 2AJYL 2OA9A 2Z7WA 4O51A 4ABQA 5JO5A 2CO6B 1UJ3A 1VCBC 2UUDK 2XWRA 5KYXB 4PJ8A 4FD0A 1WSST 2DWYA 4P9ML 1PZSA 2EDJA 4HMEA 3MBXL 4QXVA 4UQAA 2EZ0C 2ZWYA 4QGYA 2BXYA 2FSEB 4ACTA 3LSOA 5HXMA 5ETUB 5L9DH 2ARJQ 1YHPA 4OI9A 1A7OH 3EO0B 2A6JA 1U8KB 3Q8FA 5EEYA 1R3JA 1A65A 3L45A 2F54B 3MA9H 5LGHH 4HEPG 2PWFA 3OC8A 3CQPA 2D7TL 3F65A 4UM9A 2Y36L 5FYKU 3RWCB 5FWQA 4F27A 3U9WA 5B8CA 3DV6A 2R59A 1FH5L 2FB4H 1UACL 3IGLA 4PRPD 2OJEA 4MJIE 2Z65C 2OJZL 5CUSL 4EI6A 2HLAB 4KX7A 1DBAL 5E4IA 4DN3L 1TJIH 1OEZW 4KI5D 4J1UB 1H6EA 1UWXK 2BWIA 4HU2A 4YHLL 4LOUC 4XWOD 1CDGA 3O9WA 1X5IA 4IOSA 3PNWA 3OSVA 4OT1L 3B9KC 2VC2L 1AO7A 5DRWA 5E2VH 4D7BA 1CXHA 1F1DA 2B77A 3GMOA 4PLKD 4PREA 1CLVA 4H8WC 3J2PA 2YA2A 1TJGH 1AE6L 3KXFB 2ESVD 1FIEA 3VXSB 5EIIG 1JNNL 4MJ4A 5KSBE 1BM3H 1WAPA 2VLKE 3QQXA 4UINH 5BRQA 3RPIB 2WWNA 5CMAA 5L88L 5B7FA 1KLGB 4TL5A 3AREA 5LGJB 1T4WA 4XMUA 3BXNB 1QRKA 4CVWA 2Q76A 1NBQA 5SWZE 2DMHA 3ZYOA 1F5WA 43CAA 4LARL 4S1QH 2DIBA 4MAUL 2B14A 4PJEE 4YE4L 1MY5A 4EVNB 1A3RH 1U2YA 3NCYS 4XPGH 3RWJB 4U7SA 1GYAA 5CZVL 3P54A 3KPSD 4K71C 1ZHKB 1OD7A 4OUUA 4AK1A 1ANUA 3L3DB 1WA0X 5I18H 4KKNA 1HX0A 1MRCL 1M9WA 1LO5A 2CZNA 4LCYB 1KCSH 1T80A 3WIFB 5IOPB 4PEEA 2P5EA 3ARBC 4Q9RH 4JQVA 2GSIB 4UV4L 2HSIA 1TKWB 3ZTNL 1HXMB 2H47C 2FZ3A 3PU7A 1OOAA 3CGTA 3D9AL 2Y06H 2C9PA 4EDXB 3HNVH 4QOKA 4YWGL 2YAHA 3Q1EA 4TN9A 3WMPA 3WEXA 2K7PA 2QQLH 4EUPH 4OD1H 1IGYA 4B9IA 1JWMA 4K5MA 1FVCA 4M4PA 3GM0A 5F3FA 1OWRM 4ERSH 1MAMH 3DK0A 3NMEA 1J5OH 1AAJA 4TNWK 2EUXA 4YMPA 3GMMB 5GRJH 3DYOA 4DOHB 5MEQA 3LVTA 4AL8H 3LIZA 4NZTL 5KVGH 1S7WB 3NFPA 4L37B 3WKMH 1NUGA 2XX1A 2DLIA 3A6OA 2KC0A 3H3BC 3L4WA 5AKTA 3L54A 2UXTA 4MX7B 1MFDH 3PL6B 4RAVA 2B16A 2GJRA 3D4ZA 4EF3A 3U0TA 3DHUA 4KMLB 1JD9A 1CLYL 5JA8B 1Z66A 1F02I 2ZUSA 4BWTA 1EGJA 1SLVA 4X6EB 4G3YH 3TXAA 1JIBA 1H19A 2DWTA 5CJ5A 4NDMA 4OKVA 1CQYA 2NTFB 5AOKA 5HGHA 5E6IC 3O3AB 2V2TA 3NCBB 4JR9H 1E5ZA 4QRTB 3FHEA 1TZIB 3GT6A 1QUNB 2YD4A 1X7SA 1QUPA 2WJ5A 3DUUB 3BQUD 1ZGLA 4OZFB 5IMKB 3CZEA 2QPEB 4TQIA 3FXIC 4PJBA 4A7SA 4WO0A 2JJTA 4NJAL 1OK8A 1QYGL 1NCWH 2A83A 1BGXH 2CLZA 5E23A 2H26A 3STLA 1JXFA 2RALA 5KOVC 5C0JA 3WKQA 3QZOA 1F2XK 1W8OA 2BM3A 2EIBA 3I3DA 1YYMH 3BE1L 1L9OA 2H45A 2P48B 3RVXD 1L3NA 4QPEA 1JGUL 1KY6A 3MOAL 4JG1H 1RZ7L 1W8EA 2Y0SA 4TM9A 2FO1A 3LEYL 4O2EA 1F1GA 2Y1VA 4QHUA 1UYWL 2CNZA 1OTTC 3P69A 1PTZA 5IJKA 2KT6A 3ZDWA 3QORD 1T20B 2DQCL 3D4CA 3U7WH 5I24A 4PJ7B 5AVWB 1RZKC 2X10A 4K9EL 2XWJA 1EXGA 1NICA 4HSAC 2V5YA 2KH2B 2VLRD 3CVHH 5ALCH 3N55A 2ZKWA 3T3PB 3SDCC 4HBCH 5E2TL 2AK4D 3HBPA 4RAHA 4XBGB 5E8NB 4NUGH 3W0WE 1W16A 4Y2LA 4KK6C 1ZLSL 3UBXG 3TS8A 2WLYA 2VXVL 2P5WD 4AENA 4M8VA 3ATEA 1ZLUK 2C8NA 3LRGA 4FJZA 4Z0XB 4X99B 2NY5H 1XX9C 3G5YB 2B39A 4YXKL 5D7IF 4S1DD 3VWKC 1EEYB 4HQQL 2CR0A 1YJDC 1XGQB 3IFLH 4Z7UA 4DFIA 1ZT1A 1P1VA 5BOPA 4PJ9C 4UU9A 5FOJA 5JHLL 3VACA 5HSFA 4A7TA 4PAZA 1OCZB 2F9BT 1MH5B 5AAPA 1MJJB 1JWSA 4FOMA 5DD0H 5AB0A 4E42A 4M6NL 5F7UA 1NCAL 2GITA 5D1XC 3LKSB 4PB0H 3B7YA 5DLML 1JHLH 3W81A 4UQIM 6PAZA 2OX5A 4Y8DC 2E7CA 3F7LA 4OQTL 3IYLW 3B9KA 3GRWL 2AC0A 4XPBL 5BQ7A 2EUVA 1KTDB 4BEIA 1YMMB 4PW3A 4X5RA 5JPMC 1FL3B 1O6SA 4DGIL 2OR8A 3JZ7A 4D9RD 5JIHA 4B9CA 1SXZA 3OD3A 4MMYB 1QRND 4NKDA 3TBVB 4UUJB 4HVBA 2VN5A 2DMGA 2J4WL 3EAKA 3VFVB 3L4VA 3VG9C 4YAQA 2OMUA 1U8CA 4FTVD 1BVLA 1VADA 1V7NL 1H15B 3E6FB 3O11B 3QXAB 3WN6A 4GRWB 4YS4A 2KLRA 4DPCX 1A2YA 4A37A 3GXTA 3ZDZE 2I60H 4G8EA 3GHEL 4WHTB 1GJIA 2EDWA 1YN7B 1AD0B 3POHA 4ZX5A 2MQ0A 2NNCA 2IBGA 3UYPA 4DP9X 1QFPA 3HJEA 3SKMB 1A1NA 1QLFB 3EJPA 4LPXA 4L23A 2NNFA 4DP7X 4B60A 4XOBA 1WEJH 1YEHL 5IB2B 3QXTA 1MVYA 3EJQA 1G7MB 3SKOA 1BXVA 5IVXB 3FFCE 3UCQA 1NGWA 4IU2B 5F8QC 3ARBA 5CZXD 5E9DE 5JNYA 3RNQB 1P5VA 3V4UH 4YDIH 3SDXA 3DOIA 1KJ2H 3W1ZA 4RGNB 1NIDA 4PJIE 1DO6A 5ABDE 4XAKE 5ID0B 1WUZA 2EH7H 3TV8A 4LCIH 2VXSL 5AB9A 3LZRA 4Q14A 1PY9A 4AQ1B 1A1OA 1DSWA 3EDDA 4BWWA 3CLFL 1SNRA 4J4PA 1C1EH 4GT0A 4BZ1L 1ORSB 4K94L 1RJZA 3TJEL 2MCPL 4IBQA 1NL0H 4A55A 5FYJL 1SOQA 1RSYA 3CDZB 3RWHB 4N8UA 4N25A 5ACMA 3FN3A 2FT8A 4MFHA 3VO0A 4JEGB 1NLBL 1XF1A 1P4UA 1G0YR 1DDHA 2H3NB 2WPGA 5FGSA 4X6DB 1HC1A 4H8QA 4X7FC 2FGWL 2W9EL 5I6NA 4U7MA 2DQ6A 1QPXA 1ACYL 5D5MA 3PXJA 4Y4FA 3WY2A 4ODWB 3OX8B 3QJVB 3OL2A 5HHQA 5IMLA 4AYBA 3QJOA 2JJUA 3WHE1 4L3EB 3FHAA 3ZGHA 3B2UC 1E28B 1HH9B 5E6IA 1JRHL 1OAQH 2EDFA 2GJZA 3WDIA 1RERA 1M2VA 4AZUA 5DEZA 5F1NB 1XSJA 1AGCB 3EOAA 3T77B 5IV2A 1TTGA 4DQOH 1S9YB 1ZPUA 1YEGH 3L95A 4WW2F 3D3VB 2C1PB 2I24N 5E4EB 2Q87A 4F2FA 1Y07A 5L2KA 1BJ8A 1MDAA 2DQGL 3U82B 1FGNH 5HDRA 1I9JL 1NCTA 2F7OA 3KYKL 4OZHB 3KPTA 2GCYA 2W88A 5DHVA 4PS3A 4X6BB 3ZKMC 5HYSG 1ZPLA 5SWSB 4TXVB 2F1BA 4JZOA 1MI5E 3K46A 1AHWB 3PJSB 4G1MB 1CK0L 1Q9WB 1EJ6A 1ZTXE 2IGLA 1OM3L 5CCGE 2EVGA 4G8FB 1U3HC 4MKMA 4P5RA 4R83A 4TLKA 3SDCA 1A6VL 2ZNXA 3CSTA 2CSPA 2D0HA 3EGDA 3MFFA 4PP1C 4A38A 3L4ZA 4V2BA 3CBKB 3VCLA 5FR3A 3CFEA 3PAVA 3VI4A 1KENH 3UROR 3ML8A 2MTAA 2UZYB 5KEZA 1B6UA 4FQPA 3FFDA 4PWKA 1OW0C 1DVSA 4LHQB 3VWKA 4Y7MA 3C6SA 4HJIA 5IROC 3GNML 4FFTA 5H35B 5H37G 4PJ9A 1BZ7A 4MNHB 4K9JA 2XWDA 4BE6A 1F42A 3U9UA 4CMMA 3FUNA 1OAUL 4KU1A 4JY4B 4P99A 4Z7AA 1ROCA 4N1HB 1RU9L 3C5SA 1MFUA 1RZJL 4GAJH 2WNKA 3BH9B 3IFNL 5IHZB 5C0CB 4BHUI 4JN1L 3RZCC 2EDNA 1AP2B 2GJ6E 2NXZC 1TCRB 3FQNA 3MRLA 3G5ZA 2CR6A 4G70B 1DJZA 5JPMA 1CFSB 4XPFL 4DCQB 1LYQA 4HJUA 4CBPA 1QX1A 5JHDB 3OKDA 4NBXB 4WAFA 3ALPA 4JG5A 4U1KA 4CSSA 2BIPA 4LU5H 4NO5A 1PLGL 5DYOB 2ZNWA 5EUOB 4U3HA 1F4YH 3SHSA 1E6OH 1MN4A 3MNZA 2YS4A 2AJXL 2K7QA 4ZPTA 3V5DB 1EZSA 1CE6A 1J12A 2P8MB 4FYSA 4XP5H 2VLLA 1A9EA 3HG1D 2NW3B 4DVRL 3W38A 1FZJA 2YEVB 4MDJB 4Z7WB 5DZPA 3H2QA 5TE7L 1L6XA 1UCBH 1FLTX 2EIJB 4FKEA 5F7BA 4YK4C 1YVLA 2AW2A 3WIHA 5D2LF 5ESQA 4OZIF 3FN0L 1VAHA 2JJVA 3P40A 3U0PA 5H4YA 4ZMYA 5C8JA 1A0QH 1B0RB 4IBSA 1QWHA 4I85A 3NJMA 4OJAA 12E8L 4JN2A 1NFDA 2R69A 3ULSA 3D85B 1LE5A 5D7LD 1BQHB 5CR1A 1NCNA 5IFJB 3ELAT 2OMYA 1K85A 3KBEA 4LLWB 5CIPA 5I5JA 4NIKB 3VGEA 1CJYA 1OL0A 3NQKA 5GRUH 1MHPL 3UIYA 3X12B 4XXWC 4FQXC 1B0IA 4M5ZH 5BRZD 4ZXBB 1UXWB 2OMBA 1E4KC 3GQFA 5EN2A 5AW3B 4XXCC 4ZW6A 4MNQB 1IAIL 4RMUA 1WG3A 5J6GA 3B2VL 4MD5A 5D6CB 1KYDA 3HRZC 3UJTL 1KB5L 3ZE0B 3AABA 5F21B 3B5HA 1DUYB 1F00I 3C2SA 3MO1A 4PJ6A 3TO2B 5K59E 3UPRA 5J1TC 4I5BB 3VD9A 5A7BA 2A77L 5IG7A 3GXFA 1KIPA 1OT4A 3HEIB 2AQSA 1CTNA 4PY8I 2X4RB 1L0XA 5BVPL 4YSOA 4ZAKB 4ZYKA 5I30H 5GGRY 2V9TA 5CLZA 1ID2A 4YR6B 3I9AA 3DBXB 1JGLH 4I88A 4OLZH 3EZ8A 1EEZB 2YPVL 1S9WA 2DJUA 3GXUB 3P77B 4MNGE 4E9QA 3BWZA 3BGFC 3BUBA 1M53A 3S5LG 3HBZA 4U1MA 1NPJA 3O8XD 4ZDHB 5JXEC 4ESKA 2AXJA 2VH5H 1NMAH 1LTXA 3SKJL 5EF3A 4PBVC 4MJ6A 1I9IH 3LQZB 1IGIH 4LFHD 2IADA 3QFGA 1BOGB 3BN3B 1MHCB 3H2WA 4KVNL 5K33A 1WFTA 3RDTD 1HE8A 2QSCL 4WENB 4CC1A 4J39A 1H6UA 1B6DA 5I8OH 1KXTA 1R24A 4C4BA 1X4XA 3DC0A 1NUDA 3KH4A 5F1KC 5MEPB 5ITFB 1XCQB 3V6OC 1HHKA 3WTTA 3BP4B 4GKSB 1AJ7L 2AXHA 2ERJB 1GXEA 5KOMC 3DXAE 2VWEC 4GKNB 4AIEA 3CTTA 3QO0A 2V17L 2CBMA 5CZKA 3S8GB 3UTOA 1AZCA 1W0VB 2ZD0A 2EDLA 3A67L 4J8RB 4Y19E 4M93B 3ZT7A 2NT0A 3DDFA 1U21A 2NLJA 4QHMA 5ENWA 3TIEB 3UACA 1ZWIA 2XZCL 1G7JB 4LKXA 3VQ2C 2N0KA 3VM7A 4U1LA 1HU8A 4LDLB 1JK9A 1HILA 4OIIH 4YPGA 5F89A 1QBMH 4GW5B 4PWGA 5KSAC 4HETA 4ZMQA 4QHPA 4BQ6A 2X4UA 4G71B 4WF7A 5AL8A 4MAZA 5I1GH 2Y6SD 3MU3A 1KIUA 3GSQA 1OW0A 4GNKB 5LNGA 4CUCA 1WD8A 3CXFA 4R0LB 2JH2A 4JGMA 5DI8B 3ILQD 5C0IA 4OBRA 5FYJU 5AZ2H 1G0DA 3PHAA 1A21A 3C60D 5AUMB 4PJ5D 5B4MC 3LS4H 2VSMB 1Q90A 1DLHB 3BCFA 3ULUE 1YY8A 3QPXH 4O02L 3HUJE 3MKGA 2A38A 3RZCA 3WY1A 4EDWH 4TUJB 3VMPA 3ZE2E 1T83C 4UF7C 1T0MA 4HX1B 2ZXGA 1AQDB 2F08A 5EMYA 4OBSA 1ZANH 1THAA 1R17A 4HIJA 4JY6A 1I1YA 1B0GB 3O0RH 4KK9C 4XCEA 3SDAD 3VRJB 1T5KA 2BHUA 4HD9A 4HKZB 1U9KA 1MCKA 3E3QE 3DARA 4IQHA 1IT9L 4A6YB 2G2RA 2WANA 1FBIH 3CFUA 4PJ8D 3SYAA 1KWKA 4PTUB 5D1QE 4YIQB 3MLWH 5IJVA 4CVXB 3HZMB 1RZPA 3E2HC 3VFTB 4AWJC 4ZTOL 2R27A 4X50A 1RK0B 3VU1A 1ZA3B 1DVQA 4Q58C 3S35X 4BSWA 2K4AA 5DWPA 3BKYH 4C83A 1RIVL 1MREL 2B1AH 3HC3H 3NZHL 4LLMB 2A9MH 3QC6X 3CFBA 4UQ3B 1Y18A 1J0ZA 2AQ3A 2NR6C 3DX8A 4D0BA 1KPUA 3CCHA 1BJ1J 2WP3T 3F04A 2VR6A 4BJLA 2QVKA 1A7PH 4KZ0A 3TV3H 4DZBA 2VDLH 1RIHH 4U4IA 4LOEA 2Z35A 3UAAA 2X9WA 4M7KH 4K7PL 2VLJE 1BZDA 3HZYA 3DX6A 43C9B 1NSNH 1AR1C 3AU1B 3FH8A 1J8KA 3DJSA 4PRPB 4AY0A 3DYPA 2XWTA 2A1WL 5AOIA 5LWYL 1N6QL 1G5AA 3QIWC 4XXWA 4FQXA 1IBGL 4L9DA 4BK4A 2LTQB 3PQYE 4Z7UF 1BZ9B 2ZUQC 4H8VA 4YPJA 4XXCA 2XQYG 3PWUB 2XQBL 3ARED 4JO4L 2PW2B 4AMKL 5IUCA 4TLUA 4XBPB 1T2JA 1H0DA 3HRZA 1FE8H 4N22A 1UB5B 2V3EA 5E08H 1HI6A 1QKZH 4EOWL 1NBVL 2EVIA 3IPFA 1CBVL 4QF1B 5KSUA 2VC2B 4TTDC 1KTKE 3S3DB 1MLCA 4X4KA 4BDVB 2WBJC 4AE0A 5EU3A 5C3IA 1YUKB 2SODB 4NUJB 2ZPKL 4WFEE 2OXHB 1VGKA 2IWGA 2N01B 3FB5B 3WHE0 1ZVYA 4K4KA 5CM1A 1OD9A 5I19H 2AP2A 4RGOH 4LEBA 1UZ6F 4YUEH 2XZZA 2ZAGA 4MXQD 5F6IC 2R2CA 2FYVA 3GS0A 3VWJD 5JXEA 1A6WH 1J0KA 2QADC 3WN5B 4J2XA 3UTTD 5EEWA 4S1SL 3KPSB 3FAXA 3T3MF 3LDBB 3BCDA 5I71C 4XVTH 2P8PB 3DIDA 2B1HL 1LO3H 1IAOA 1QEWB 4OGZA 1UWEL 5CHNA 1JZ4A 4MA7L 2DWSA 1DTUA 3AC0A 2BNRD 2DF3A 4ZO6A 5EBLA 2YFNA 1T0NA 2Y5TB 3L3OC 1IFRA 4JHUA 1QSFA 4G7QB 3V6OA 3PFQA 4X6CE 1PBYA 5M95B 1WBYA 3CZKA 32C2B 1OVZA 3SOBH 5I8CA 3RA7L 3VFUA 2XXFA 1IC7H 1SMAA 3TASA 5JDSB 2IPKB 4XNYL 1U91B 5CZRA 3STZB 3GYRA 5FUZH 3QUXC 1AGEB 1EGJL 5JLZB 4LDOB 5ADOH 1DQJB 2YXWA 4E5XA 3SEPA 3EHBB 4JDZB 5ICYB 3IDYC 1YEEH 4KWUA 3TOPA 1I8MB 1YEKL 3GSUA 4Y4KC 2EUWA 1RY7B 1SQMA 2GIXA 3HG4A 5KAQG 1UA7A 2AK1H 5AYUL 4BFBD 4F1SA 4RWHA 4U1GC 1MJUL 1DZ0A 5KSAA 3T0AA 2H0JA 2YZ8A 1K6QH 2I5YL 4G9FE 1OCOB 4MJIA 1MJ7H 2H41A 1E2ZA 3U9PL 3KR3L 3T8MA 1H5BA 4LQ1A 1QEXA 3CLEH 5D72L 2XG5B 4ZOCA 1BXXA 3HLAB 3WTVA 5C0EB 4QRBA 2HUEA 2WV3A 4YFLI 1MFAL 1WGOA 3HS8A 3QJHB 5DZ9A 3QDGD 3IAGC 4PRAA 4EO5A 4XN8A 1LE9B 5K5YA 1KXQE 4HEPA 2NY1D 1A4KB 3X14B 2VE6A 3ECBA 2Z34A 4HFUH 4IRSC 4YHYC 1YNLL 2EP6A 3NIDE 5KSBA 3BQUB 4PY8J 1ET8A 3TIDA 3VXPA 4UYPA 4M62L 4L8DA 2DEXX 3BOVA 1T83A 2YRZA 5TE6L 1QSVA 4NJ9L 4F1ZA 4YHZL 3VI3B 5F7EL 3NJGA 3UL4A 1M2OA 2YBRA 3BIAX 5SWZA 2FDBP 2ZXCA 4UIKL 4UB0L 4PRDA 4ODTL 4KI1A 2WO2B 5BNXD 3DI3B 5TD4A 4PJEA 1W6LA 3H0TA 5CP7B 2EC9T 4P2QE 3NH7H 4MB5A 3ARDB 3KS0H 2FWOA 1I75A 4JBSA 1FDLH 1NGQH 5TPWH 2X2JA 5HYJB 4NQED 3HG3A 2VIRA 3BN9C 3CMOH 5JW5A 1MQKL 1LO0H 4MWFA 4OCSL 1CIUA 1SXSA 3O41B 3QORB 3WAKA 2R8SL 3C5ZA 3BZ4A 1V7MH 4FXKB 4ANVA 3O45A 2Y07L 2ZX5A 3E8VA 1WZ1H 3QUYC 2Z31C 3I6GB 5J8OA 4N0FA 2A9DA 3B2DC 2MTPA 3OAYK 4M5YL 4MS6A 3W39A 4ES8A 4HJJH 4AW7A 3MXVH 3SQRA 5J0BA 4M48L 3NEOA 4WCYL 3MUHL 5BV7H 4F7MB 3LNIA 2XN9E 4NC0B 1W15A 3T65B 1SMOA 3ZDXF 2DYPB 4PP2B 4PYGA 4JFSA 1AZBA 4LEEA 3NG5A 2XWCA 2YA1A 4U2ZA 4H8WL 5GS2D 2BK8A 1IC5L 3FB8A 3AITA 1IKOP 3B9KD 3LEVL 3QFJB 4MCYA 2X7LA 3BQVA 4YC2C 3EJZC 4NC2B 3MV9D 5JIQA 3BP7A 1UM4L 1V5JA 2AJSH 2BS71 4GAGH 4P57B 5B7MA 1RZIA 4K3HA 5FDWB 3X13B 5FECA 3QIWA 5LNDA 2CKBH 3LNEA 2ATAA 2CO1A 2BINA 3QRGH 3BDBA 2RCSL 3IJSB 2W0KA 4OLYH 1FVDB 3SE8L 5IBTH 1T1YA 4WI9A 4DEPB 3IDXH 1FFTB 5J12B 1ZV2A 1HDMB 2HZHA 3VFOA 1HEJC 1KEMH 1TENA 4R97C 4RZKA 2OP4H 4R4BA 3K4DA 1JNHB 5LAXA 4QHKJ 5AFAA 1HSBA 1L7TH 4G2AA 5CCKL 5EEZA 4TPRH 4NLAA 3SQOL 4LLVB 1RK1B 2YXMA 3DVNA 4LSQH 2X4SB 2CIKB 2OTUA 2ID5A 4M1GH 3EZJB 2WBJA 1SXNA 3FQ2A 3Q2NA 2IAMD 4A7GF 3QWOA 1IAMA 4BA0A 2FBOJ 3Q3GA 4FTVB 5J57B 4YOKA 3PYCA 3GBMH 2UUDH 5IF0B 4Z3GA 4PR5B 4ZUUB 4M43L 3K6SA 4P46D 2WUCH 3U4EB 2WCPA 3QXVA 3T2PA 3WIAA 4YBQC 4EUPG 3S8FB 1MJ8L 3DO4A 3L8QA 5HDBF 1T6WA 2WYTA 2BZ7A 1IAKB 4FE9A 3WO3B 3UGXA 1CFTA 2EO7A 4R6UA 4JO8A 4LVNC 4NX0A 3LCYA 2V37A 4JMXA 2XC8A 4KNUA 4TSAH 4D0DB 3NBNA 4D0CB 2YJLA 3F58H 3ZQ9A 4ZFFB 1QTYT 4BKLA 4HK3N 2P8LA 1KN2L 2NY0C 2G5BB 5IQ7L 4QRRD 1YG9A 1CLZL 4LCUA 1EVTC 3ZKSD 2XYBA 4F9LA 2JNZA 4R90L 2JMRA 5D1ZD 2PWEA 1PKQE 3K6FA 3NIGE 3W0WA 1U33A 3P3UA 2Y3NA 4K3JL 5L7XH 1X5YA 1LK3H 2ATKA 5F1SA 1CUOA 1JZJA 3M1CA 2HT2D 2WWKO 3LB6C 1WBXA 1U58B 4ZTPH 3X1EA 3UZEC 1S6NA 1X9RA 3C8KB 4G42B 5L2JB 4Y4KA 1Q0YL 3RVVC 3CSPA 3WUWG 3BKCH 2CO3A 1WV7T 1JGDA 4QI3A 4BFNA 5FV2A 5AZEH 1GYCA 3GKWL 5TE4L 1D5MA 1QR1A 3L08A 4Y9CA 4PV1C 2O5ZH 1FZMB 4Z6AT 1GHFH 4N0YH 5E6ID 3FO1B 1YQVH 4Q89A 3ILEA 1S7SA 3QZPA 2H0PA 5I5IA 4F8NA 1QOKA 3KWUA 1HH6A 4DGWC 2V33A 4Z76B 3KE0A 4YSDA 2IAAC 1DSYA 3HW7A 1G9NC 1ED3A 4C57C 4HAKA 5C97A 4WRLA 4AM0Q 2VISA 4W9HC 2PKDA 4N5ED 4WI8A 1MNUH 5B39G 3JVFC 2R1WA 2ADFL 1S7TA 3HPJA 3WELA 4UDTA 2D9CA 4WV1C 2YPLB 4Y1SA 5I1JL 1EXUB 3PG2A 1RZKL 2EVJA 1FG2B 4QYAA 2XN1A 1OTTD 1KELH 4ZS6C 8FABB 1EHKB 4LRNL 4WU5B 3FTGB 4D9QE 3MLUH 1BVKB 2IPTH 2MRYA 3TESA 2F54E 4RFEA 1FAIH 1ETB1 1MVFA 1RQ5A 5JTWA 4MD0A 3SDCD 3HS0C 4DN4L 3CK0H 4ONGL 1MW0A 4KQ3H 4P23C 3IJHA 4KTDH 2WNGA 3AW5A 1J8HE 9PCYA 4KK6D 3VXNB 4HP5A 4M7ZB 4KBPA 4NZ8A 1YJDL 4GRMB 4MAYC 2QZ5A 3NJNA 5D2NB 2W59A 3CDYA 1JZEA 2YR3A 3MRGA 3N5AA 3FFCA 3D18A 3FB6A 1NLDH 3QUYA 5E9DA 2Z31A 3V5HB 5KYWA 5E8OB 1EHXA 4J27A 4WGWB 4X5WB 3DBSA 2HA1A 4PJIA 4PJ9D 1G94A 3IMTA 3NGBB 1RZGA 1N2RB 1C5BH 1FPTL 1MCNA 4GI6A 1SJHA 4W9EC 2UYLB 4WO4C 3QEUB 4BELD 3K6IA 3CDGB 5DQJA 1MHEA 2FR4A 4M7JH 5DJZB 2E47A 2BC4A 2UWEE 3VXSE 3WXVL 1JZ6A 3FULA 3N1MC 4E41E 2CLRA 2X0VA 5C7ZA 3DURA 5D1XD 4XMLH 5BZXA 3U83A 1ZIAA 3SYCA 4HIHA 2IG2H 5I1LA 3S96B 4L4TE 2FWLB 3G5XB 3VH8B 2Z8SA 2VDKH 1XMEB 1O7VA 1S7QB 2EEXA 3KPNA 4K23L 3QQ4A 4K15A 4GSDL 5KSVB 3H7BA 2PR4L 1UQSB 3HKZA 4XAWL 3ZR6A 1NOFA 3AWFA 2V5RA 1BIIA 3A24A 5DC2A 5ADPL 4XWGL 5HPOA 5DZNA 1N5YH 4XO3A 1SHXA 4ELKB 3C09B 5HYQA 2AEPL 5E2UL 4F8PA 1CE1L 3FMGL 4OCWH 3NEEA 1JGVL 1NGXB 1CC3A 3FTUA 2EE6A 5EZIH 4F58L 3HFMH 4KKPA 1GYUA 2J1XA 4J2QA 1SUHA 2XBDA 3WIHL 1GS8A 3L5IA 4JVPA 4DKTA 4HH8A 1M7XA 4G7YL 1U92A 1OF2A 4L0PB 1PX4A 4PPTA 5KJRH 4NAJA 2E9BA 4NPYA 3W2DH 2R69L 2UZPA 3DJRA 3ZGIA 4Y89A 5FGCB 3KYOA 4EE2A 1ZLUH 3OKEA 1FZOB 3P2TA 2JKSA 3HG1B 1UFGA 1CGXA 4J3XA 4KOCA 3QDME 4LHUG 4DVBB 4ELME 2XACC 1JOIA 3BWAB 1P7KA 1ULVA 1MI5A 1C08B 3DUHA 4PJFB 3OXSA 4B97A 4M4RA 1ZHLB 2ODHA 1YUHA 1S8DB 4RGMC 5HGGS 4XI5C 5HI4D 4JFPB 2W92A 3ATBA 1BBDL 4AYID 5CR8A 4GO9A 4GQ9H 1WWAX 1OAXH 4XT1C 3EBHA 2MHAB 1SY6L 3VFSB 2ZF9A 2LOEA 1J9TA 3QYNA 5DYFA 2Z1KA 5I6XC 5F44A 3SPIA 4O9HH 5TDOB 1CGVA 4XCNA 5T1MB 4HS6A 2OPCA 4UTCA 5HYSA 2CJUL 5IKCA 3LH2L 3UZEA 4JO2L 4G43A 1OCWH 3EH1A 4JE0A 3BZ5A 5BRZB 4AEHH 1DQLH 1K2DA 1AQKH 1G43A 2BY3A 3BSHA 2R56L 2WB7A 4JG9A 3B2UD 1LQSR 4GIAA 4FNQA 4P5MB 1WFIA 2YAMA 3QEQB 5JW3H 4WW2B 1CD1A 1I1FA 6PCYA 2BHZA 1K8DB 2IOIA 5INDA 4KUZL 2LGNA 1M7IB 4JFYA 4KJWD 5GRVL 5I17B 4KMTL 3ULUC 3B6SB 4ONFH 4N9GB 3ULVL 4JK0D 1KB5B 5C9JB 5JW4Q 1TR7A 2GJ6A 4TLSA 1YEJL 5I75C 3ZZLA 5IW6A 5L4JA 4DERA 5AAMC 4AQ8C 1LVEA 4KHXL 5CWSB 3EYVB 1Z1WA 2QSVA 2DQUL 5GSVB 1E9QB 3J8F7 1JPFB 5DFTA 3DRTB 1OAYL 2IWEA 4WV1A 1EO8H 3ZKMD 2NY4C 4MA3B 4X4XA 1WTLA 4GXUN 3ZE1F 4G7VL 4XVJL 3WUZA 1LEKB 5DFVC 5H37A 5JR1L 3E3QC 4BSVA 2NUPA 2EXSA 3BD5A 3GUTB 1M3IA 4GQZA 3PDOA 4NZJA 1IBBA 4TQ8A 2DQHH 5E1QA 2QV4A 4FTDA 4LCCC 5TFSH 3THML 3QUZC 1G9MC 1U3HD 3QWRA 5IMOB 2BNQB 4W9DC 5GGTA 4JCMA 4S2SA 1GTFA 4GKZA 4M6MH 1E8ZA 4P23A 4UT6H 1BYPA 1CGWA 1HIMH 2N7BA 3FT3A 3FU7B 4HXAL 2IXQB 3RGBA 5KW9H 1MRDL 4F3FA 5C6TL 3GI8L 3CHRA 4P2OB 5LCVH 3X3FH 2O6PA 4MAYA 2X0WA 1WTGT 4UDUA 1ITBB 2ZICA 3MHZA 2Z1PA 1IKNA 4F7TA 5EU5A 1U8OA 2AEIT 1A9BB 1KDIA 2D73A 5IROD 4OLUL 4CAGA 2NY3D 5I26A 5FOBB 4WO4A 3KYAA 4B0MB 1N0LA 2DMKA 4XC3L 5DK0B 4IHOA 1UXLA 1ITCA 4IU3A 3CIAA 4JFEE 4ODSH 4LP5A 2C9UA 3OKOB 3RZCD 3BUIA 3DETD 3O6FB 2NXZD 3HZVA 1K4DA 4GG8B 4JFQA 3LKOA 4XNQB 2FATH 4JY5L 1P4LB 3KZ8A 3CUPB 3A21A 3NSYA 2F19H 3VJ6A 3F7PC 4CN1A 2L3BA 2UXGA 5GGVL 5T1KA 5F7DA 3GJFB 1E67A 4HUVB 3JWOH 1XGRB 3TCLA 1LJMA 1Z3GH 4PJ5B 2OI9C 3V7AG 4M56A 3BX7C 3HMXA 2EILB 4RWYH 3RNKB 1C5DB 4XCYB 4N2OA 4ZQKB 1U8PA 4N68A 5IEKB 1U2CA 4NN7C 4BFFA 1TMCB 3ECUA 5A2JH 5DRZA 2WXFA 4NO0A 3H3PL 5BO1H 3BISA 3UTSD 1ZVSB 3MUJA 4GYBA 4MCZA 2ZYRA 1NGPH 1O0VA 3LKRB 2V5MA 2ZX8A 4OD2B 4MNGA 3J7HA 3SDAB 5D2LB 1PGRB 4OZIB 1RVFH 1XWVA 2NUTB 1QFHA 4G5ZH 1XCTB 3PP4H 3OMZA 2JCCE 4LMQI 4RAUA 2G0LA 1ICTA 4O51B 5F7WC 4FADA 2D03L 1MZZA 5JO5B 4E0RA 1UJ3B 4I4WA 4PJ8B 3SE3C 3V7AE 5AW9B 5L8KB 3C2AL 3BLBA 3LSOB 5EUKA 4DO6A 2F7PA 2XLLA 3CH1A 4M9OA 1R3JB 4P4KC 4WI3A 2PWGA 2VM9A 2X3BA 4F20A 3CV5A 2DQMA 5B8CB 3DV6B 1J1PH 1MFCH 4FL4C 3DXAA 3O2DA 1BZ8A 4PI0A 5D4IA 1UADC 3RGVD 3EKCA 4F93B 4OLXH 1DO5A 2OJEB 4EI6B 4Z3HA 5GS0C 4OCLC 2HRGA 2YGOA 4Y1AE 4Y19A 3LQAH 2X2HA 1NCIA 3ME0A 4PLOB 3O9WB 4P2RE 2PLTA 3UTPD 3PNWB 1RZFL 2EC9U 1KCWA 4PRIE 3TWCL 5DRWB 1AO7B 4ZMVA 2H6OA 4WUKH 3RVTC 5HI3D 4JQIH 4LLAA 5I1HL 1SF5A 3FRPG 1QSZA 3GMOB 4PREB 5F0JB 1UA3A 3FAWA 3PWPE 3H6JA 4GG6E 4KY2A 3OJVC 1SHMA 2AI0L 5I74B 5GZOC 1ADQH 2GEQA 4CSPA 1IGML 5CMAB 2O5NA 3AREB 4PS7A 1BMZA 2Q76B 2Z4QA 4YSSA 3GMLA 43CAB 4YDZA 3JYBA 1Z7JA 5JXED 1URLA 1MF2H 2WKOF 2EE0A 3VB8A 4JRXE 1MFVA 3FFOA 3HUJA 1VDGA 3MV01 4E2OA 4JM4L 4OUUB 1A6AA 3MBED 4DAGL 3ABGA 3PAZA 5AAMA 1HWHB 2YK1L 5C0BE 5AW8B 3L3HA 2IMNA 1DN2A 4QWWD 1LO5B 1ET7A 3UG3A 3DNKA 4QXTA 4QLRA 2F18A 3HNSH 1KCUH 3L3IA 2A9AA 1N0XL 1QSFD 1MFEH 3K5RA 1AFVH 3V9FA 3D06A 1JDDA 3CQFA 4N3UA 2FZ3B 2WTRB 5L0QB 1DLFL 4U1NA 5D1QA 4QOKB 4JPIA 4JRWA 3SOTA 1IC0A 3WEXB 5AD0A 1EUTA 4X5QA 3B2PA 2LU3A 1JWMB 2IDFA 1FVCB 2WBKA 3QUZA 1U8JA 3QIUC 2DN7A 4OIBA 4B9FA 4ZPVB 1KACB 1J5IA 5DD1L 2FHBA 2NRDA 4ZMTA 5JQ6L 1M3JA 4YSUA 2XI9A 5DT1L 1PZCA 3UOAB 5JXAH 5MEQB 3RBSA 3DSFL 5LG6A 5DJYA 3NFPB 4M61A 2Q0ZX 3MJ7A 4QEGA 3TH4T 3DMMD 3GTVA 1KZQA 4RAVB 1KB9J 5B38A 5L6YL 2C9SA 4WWPA 2B3RA 2E27H 3U0TB 1INQA 3F7QA 3IM1A 5KS9E 2J72A 4GP8B 2VLJA 2WXGA 3C12A 5HDQH 4DP5X 3FQ1A 3MCKA 1UXSA 4Y16C 4G6KL 5B4MD 4OKVB 5HGHB 3T08A 2V2TB 1UT2A 2J56A 4MMXC 5EUOE 1DQMH 3MYJA 5JOEA 4KVCH 3OWRA 4LLDA 5EBMA 4IJ3C 3IRZA 3PQYA 1K3IA 3NTCL 3L1OL 4PJBB 2MCAA 2X89A 4GFTB 4XMPL 4UTAH 1OIOA 2PETA 2VMCA 1HHHA 3ARGC 3INUL 4H1LH 3LH8A 3V10A 2A83B 2CLZB 4KK9D 2H26B 3STLB 3S2AA 5TDNB 5C0JB 2CUIA 3GPEA 2E4FA 5BUGA 5BMFH 3QZLA 4Z8FL 4P2AA 1TQBB 2F5BL 1S7XB 1DL7L 4XO5A 2K8QA 4F80A 1HXKA 2FYYA 2Y2YA 3KPRD 4HC1A 2IQ9L 3C9NA 4O2EB 4N28A 3FOLA 5HJDA 4UT7H 1NPNA 2B59A 1GGIH 4GSQA 4Z7NE 2XWJB 4NFCA 4O58H 4EAEA 5F0LB 1QMUA 2K0RA 3QI9C 1SEQL 2R4SL 4RDQG 1L6ZA 4S1RL 3DOSA 3SE3A 2NR6D 1ZRUA 1KGCD 1HINH 4GXUM 1IB5A 3BZEA 5FYLH 4HS8H 4WTXA 1CLOH 5GISL 4X6CA 3WO4C 4Y5XC 4TF4A 2JELL 1BAGA 3RWEA 2XTJE 4TYUA 1PZDA 5E99H 4Z7UB 1OANA 2ZYSA 3GMNA 5IGXL 4KZEL 1ZT1B 3BP6B 3NCJH 3S5YA 4DF9A 3QEHA 3QDHA 4FCHA 2DQTL 3QIWD 4G6MH 1JWSB 2ODIA 2BIOA 2YAPA 4E42B 2F1AA 1QD0A 2GITB 1GSKA 2HH0H 2YMOA 4BCZA 5J13C 3CN2A 2WAQA 2BP0A 1KNOA 3HLKA 4AL8C 3QCTH 2OX5B 4GRLC 3B9KB 5BQ7B 5E2WL 5D71L 1O6SB 7PCYA 5MHSE 4WKZA 4JHZA 3K8KA 3MV9B 3WFEH 2NZIA 4FQQA 4WHYH 2H8PA 4NKDB 3QQ3B 3MBWA 2WBJD 5J1AA 5GZOA 1WIPA 3OGCA 3QC5X 1GCFA 4JHWH 1BAFH 2OMUB 1U8CB 2XPGA 1BVLB 1VADB 3LPWA 2KQNA 3SBWC 2A9NL 3GXPA 5EU4A 4DFHA 2HKHH 3CSGA 5HGDA 1AOHA 1KTJA 1SDYA 3QO1A 3T3MB 4NFDA 4D9LH 1A2YB 3RIFK 4Y4HC 1BD2D 3IE4A 4G8EB 1AANA 4OCRH 4XHJD 4ZW3A 3UYPB 3B9AA 1KEGH 3GIVA 3NZ8A 3GBNH 1A1NB 4K71B 3QJTB 4MXVE 1NMBL 2V9UA 4HF5L 5F71A 4G8IA 4NOFA 5LBVA 3VXQA 1XH2A 2VLMD 3SKOB 1RZ8A 3KJ6L 3VM5A 2K9FB 5BZWA 2AXWA 1NGWB 5I6OA 3ARBB 2AJZA 3DPBA 3IBOA 5JNYB 1X5XA 2AQRA 4ICWA 4MBRA 1P5VB 4FQCL 3SDXB 4P3CL 2UZXA 2FQDA 3MXWH 4B3VA 1E2VA 4JO1L 3QUXD 1COBA 4K7FA 5HI5D 1IBFA 1JZFA 3QDJE 1A1OB 1KBPA 4FJ6A 4NPJA 3QIUA 3LHPL 3SDYL 2ZCHL 4DKFH 4L1DA 3VG0H 1KT2A 1NWPA 4KK8C 3UERA 4WTWA 4LCWD 2FL5A 4IDJL 1SM3H 1UM5H 4XP1L 3MRJA 2CGZA 2QGDA 3CVCA 4PRHE 2ZAHA 2WZ6A 3MV11 2XN9A 1DDHB 3MREA 3S3PA 4OGXL 3RWDA 2NY5C 1DVTA 4I9WD 1VCAA 5D5MB 5D70L 2BVOA 2ARJA 5J5EA 5MI0C 3UBGA 5K9JL 4GMSL 1WFNA 4XPTH 5HHQB 5IMLB 2P1YA 5F7YC 2EDBA 5GXBB