1WH2A

Solution structure of the gyf domain of a hypothetical protein from arabidopsis thaliana
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
78
structure length
78
Chain Sequence
b'GSSGSSGVRVLSYDKEKLNWLYKDPQGLVQGPFSLTQLKAWSDAEYFTKQFRVWMTGESMESAVLLTDVLRLSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein At5g08430
publication title Solution structure of the GYF domain of a hypothetical protein from Arabidopsis thaliana
rcsb
source organism Arabidopsis thaliana
molecule tags Structural genomics, unknown function
total genus 11
structure length 78
sequence length 78
ec nomenclature
pdb deposition date 2004-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02213 GYF GYF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1490.40 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 1wh2A01
1GYFA 4BWSC 3K3VA 1L2ZA 3FMAA 1SYXB 1WH2A
chains in the Genus database with same CATH superfamily
4UCVA 3H3VH 3KTMA 5BPHA 4QIWE 4UCRA 4HNTA 4A3LG 2VR1A 2VOBA 4DL2A 4ECUA 1E4EB 3Q8RB 4EEQA 5KFRA 5C44G 2WTFA 2R8KA 5KFEA 2WAQA 4QW9A 3RV4A 4RNOA 5KFZA 4JV2A 2J9GA 2R92A 1JXLA 3Q2OA 1TWFA 3K3VA 4FS2A 1UNNC 2FK3A 2YRWA 4BXXG 5L1IA 1FKAH 3H4BA 4OX9H 2VUMA 2XCLA 1FJGH 3HKZE 3L2PA 4BY7G 2UVWA 1CQJB 4ZHQF 2C00A 1S10A 2Y0SA 4O4HF 4MTDA 2UXDH 1EUDB 2ASJA 4ECRA 5KT3A 2W9CB 5KFIA 5L9XA 2R7KA 4Q8EA 4JI3H 1RJPA 1I3QA 4MA5A 1V51A 4JUZA 3L4KA 4DL4A 2HVQA 2R6FA 3N8DA 1I6UA 5FD6A 3BQ1A 3N6XA 1HNZH 2FLPA 2R7ZA 1IBMH 5HBRB 4F4YA 4L1KA 2JA5A 4DR1H 4KHPH 1PX2A 3PW2A 3BJYA 1N32H 3K3PA 5DQIA 3C0FB 4MV8A 3SE7A 4FU0A 1ULZA 4X64H 4UFZA 2HJWA 1DV1A 2R7MA 4ZOLF 4M9UA 4EFBA 3R23A 4AYBA 4IAJA 2JEGA 4YAJB 3RF2A 3TINA 2W71A 1KBLA 3RUPA 5J2UF 5IYDG 3PVXA 5C1OA 5KT4A 1I7NA 5KFDA 5IYCG 2BR0A 2VQFH 2ZDGA 1I7LA 2VUGA 2X0SA 3OUUA 4B3TH 4O2BF 5IT9W 4YP3A 2JEIA 3MWEA 2YZMA 4EBCA 4EBDA 1WSCA 4HR7A 3GILA 2NU9B 1DGSA 1CQIB 1KJ8A 2AGQA 4EEYA 3KXYT 5L1LA 4J9SA 3I4NG 5EDWA 2JEFA 2RF4A 5KFWA 4YQWA 1KC7A 2OLSA 2O03A 5JH7F 4Q44A 2NUAB 2J6SA 1Y1VA 4RZQA 5GONF 5DGAA 2UVVA 1RYRA 1E4GT 5EOYA 4IRCA 4A3CG 3V6HA 2VA2A 4MV3A 3MR5A 4ED6A 3N43B 4DV6H 5DG7A 1N33H 5FD5A 3MR2A 1BXRA 2DLNA 3BQ2A 5EWEA 4EBEA 1GYFA 4I50F 3MR6A 4JI1H 2WDTA 1KEEA 3GTQA 3H4DA 3KHLA 2OWOA 2M05A 5CA0F 4BBSG 4O3RA 2R7LA 4O2AF 3VPCA 3U9SA 5KG7A 4YR3A 4IWYA 3V6KA 2AQ4A 4B3RH 2CKZB 4TV8F 2WAQE 4O3OA 3OTOH 3JZIA 1GO3E 2WYOA 5EZYF 3SI8A 2XC9A 3H40A 3AYHB 2CW8A 3VPBA 4DR4H 2W8LA 1JKJB 1Y14B 1XMQH 2FMAA 3OUZA 4EGQA 5KG4A 3GV5B 2JA6A 2Y0SE 1GSHA 2W6MA 3ORRA 3Q1KA 5LL6b 3PR5B 3RAQA 4DL7A 2YW2A 5J2TF 1T3NA 3RGXA 2F4VH 3JRWA 3RB4A 1KJJA 1XNRH 4MV7A 5KT6A 2XGQA 2W7OA 1C3OA 1EYZA 2E2IA 3RV3A 2ZDHA 4R7RA 1BNCA 3LP8A 5DLGA 1VKZA 5IYBG 1S97A 4NLGA 2FP4B 4ED3A 2W6OA 4MTEA 4ED7A 2RGRA 4G3IA 1L2ZA 3J81W 3OHBA 2Q2UA 4C2MA 4IZOA 4F4WA 2B63G 2GPSA 5F9LA 1JLLB 2R86A 5H80A 2C35B 1IOVA 1JDEA 1XNQH 2HGSA 3GIDA 5IP9G 3MR3A 5KFOA 3N40P 4AYBE 2W9CA 4QWEA 1ZQ7A 2YYAA 3RB0A 1Y1WG 2W6NA 3CVZA 3I12A 5KFQA 1ZHSA 1O75A 2DZDA 1S0OA 5C4XG 2ASDA 3JRXA 4HQ6A 2R85A 2JA7A 4RUCA 3PZPA 1T94A 2BQUA 5KFGA 4AQYH 2R82A 4A3BG 4NXMH 4DV3H 4J9LA 4YR2A 4EFEA 1GLVA 2DPIA 3GIQA 4DR2H 1K1QA 5K2MA 2NVXA 3BABA 4DL5A 4LMYA 2Q2TA 5FJ8G 3PW4A 1WR2A 4J9QA 4F50A 3PW7A 2C2EA 4XYLB 4F4XA 2R8JA 4TUYF 5KFPA 5LOVF 3MFHA 4J9NA 4LSAA 4LH7A 2R87A 3BAAA 1K83A 4E4TA 1IBLH 3FKIA 2MCTA 1W93A 5JVDF 2R7NA 4YR0A 1SEIA 4MV9A 1IBKH 4DL6A 3GTGA 3ETJA 4PDBA 3TQ1A 2YS7A 1C30A 2FPGB 3GV8B 3GTLA 1KJQA 3GTPA 3BA8A 4YB8B 2CQYA 3H20A 2V5AA 4IRDA 4J9PA 1I94H 5KG3A 4HNUA 5JQWA 2B63A 4I4TF 5DLFA 2VQEH 1EHIA 5EWGA 3FMAA 3G8CA 1CE8A 5F9NA 4IR1A 4ECYA 1V9PA 3M4IA 5CAEB 3R5FA 2FE3A 1RJRA 4A3FG 4IR9A 2YZNA 4HYKA 5D1OA 4Q0YA 3GTOA 2XIGA 4C5CA 3VPDA 1PK8A 5JUMA 5BPFA 2V9WA 1RK6A 1S03G 1TWHA 1VBGA 4RAZA 2CZGA 2VQDA 2UUAH 2HVSA 3JAMW 3M9NB 4DV7H 1R9TA 3Q8PB 2C2DA 5BMVF 2R8IA 2XCPA 5KG2A 4DV5H 5KT7A 5C5JA 2VPSA 1DV2A 2WB1A 3T1YH 1W96A 3T5KA 3U9TA 3RB3A 3GIJA 2IMWP 3PR4A 4X66H 4WD3A 5DQGA 4U7CA 2W9AA 2J6TA 2ZM6H 4GC6A 4ETSA 4XZ3B 4QWDA 3RJ0A 3K5IA 3KAJA 3KHRA 4F4ZA 5KFCA 3MFIA 4RAYA 5D1OB 4A93G 4A2BA 5KFJA 4MV6A 2UXBH 4TV9F 3R5XA 4CC5A 4APMA 2RDJA 4YJ2F 4Q8FA 3QFFA 2I87A 4LSXA 4X65H 2UUBH 1Z2OX 4JV5H 5FPRA 2R8GA 2PVPA 2WE6A 2W70A 1ZHQA 4C5BA 4R8UA 5KFAA 4RB3C 3LMLA 5KFKA 2V4QA 5L1KA 3PO2G 3HOVG 1MZBA 1T36A 1AUVA 3T5JA 2ALZA 4EG0A 3J80W 5KFNA 3BA9A 5C1PA 2W9BA 1GGOA 4UCUA 3GLKA 1E4FT 4ED0A 5LP6F 1ZETA 3BG5A 1VAJA 1WH2A 4FBTA 3NGDA 1S0NA 4ECZA 3RBEA 1OWTA 4NXNH 2DWCA 1V4YA 2RGVA 1N36H 4LF8H 4X62H 2R92G 3RGZA 5KFHA 3K5HA 2I8CA 3UQ8A 1TAEA 3V6JA 2CW7A 3GIMA 3HBLA 4RB1A 1XMOH 1RYSA 4R8UB 1FVIA 5KFUA 1M0TA 1S9FA 4I7HA 5IWAH 2RDIA 2AGPA 3MJFA 2W6ZA 3PN1A 3HB9A 1JDBB 1M0WA 1TWCA 2YL2A 3RTXA 1A9XA 3OHAA 2W9BB 5KFMA 5FLMG 2PMZA 4DV2H 2I80A 1P8LA 4YJ3F 3VMMA 3RIZA 3N42B 5KX5F 3QZ7A 2ZJTA 5CB4F 5D1PA 4K0KH 1UC9A 3PW0A 4DLKA 4ECTA 3GTKA 4DR6H 4LF4H 1RJQA 1TWGA 2R7ZG 5C3EG 4HNVA 2AU0A 4A3MG 3N41B 5DGBA 2HVRA 2VPQA 1BJTA 2NU6B 2JA5G 5DG8A 2NU8B 3Q8QB 2GLTA 4ME6A 4ECQA 3RBDA 4LFBH 2XD4A 4DL3A 2YZGA 5KG1A 2V59A 4JI8H 3HOUG 4A3GG 4Q43A 5KFFA 4PWQA 2WB1E 2C22A 4M7EA 3ETHA 3KHGA 2W8KA 5D8DA 2V58A 1A0IA 2P0AA 1Z2NX 4GKKH 1HNXH 4MA0A 3IN5A 3GQCA 2C28A 4O3SA 1GSOA 4UCTA 1B6RA 3MWDA 4GKJH 5FPOA 5LMNH 3V4ZA 4A3DG 2YS6A 4LH6A 2R8HA 2J6UA 4DUYH 4MV4A 1N48A 3DF7A 2C2RA 4EYHB 3E5NA 5KFYA 3JSLA 5FLXW 5KFBA 1SYXB 4Q45A 3T1HH 1DIKA 3PO3G 2UUCH 2ATLA 3GIKA 1Y1VG 4O4IF 1BGWA 1TA8A 4JV1A 2YU9A 2W57A 1X9NA 4LF6H 5KG5A 4RUAA 4JYAH 2FLLA 5A2QW 4DR3H 4JI5H 3HXLA 4RNMA 2HHHH 3OSPA 2JA8G 2QYZA 2R84A 5KFVA 4LFAH 5LMUH 4MV1A 4ZQIA 4LF7H 2ZDQA 4BWSC 1Y1WA 2E5LH 2JEJA 1B33N 3WO1A 4LF5H 3GTMA 3I4MG 5CA1F 4YY3H 3L4JA 1JX4A 3HOWG 4A3EG 2IP4A 3F8NA 4DUZH 2DIKA 2PBZA 4XX0B 4JI0H 4CC6A 2V4RA 4Y8VB 4QWAA 3EPIA 1JIHA 4ECSA 1SCUB 3WO0A 3GIPA 2UVRA 1B04A 4I55F 3FDSA 4A3KG 1EUCB 3G6YA 3N44B 5L1JA 2UU9H 2JA6G 4J9MA 4B3MH 4UCSA 4DR7H 3H0GG 4IHJF 1UC8A 4ZI7F 2PMZE 4QIWA 3QZ8A 1WCMG 4ECXA 5KFXA 3M9MB 3IG0A 4QJFA 4A3IG 4C5AA 3T5LA 2UVUA 4FM9A 4FS1A 3T5HA 4YHHH 1IOWA 2FK2A 3KALA 3TIGA 1XDNA 5KG6A 2BQRA 2FLNA 2R93G 3GTJA 2E2HA 4ECWA 4JI7H 2YRXA 2FKLA 1CS0A 3HKZA 1RK5A 4BBRG 4O3PA 4JV0A 5LXTF 3UFXB 3R5HA 5DQHA 2AGOA 3RB6A 5EWFA 4UCOA 5LA6F 5HV6A 3KHHA 4DR5H 2W7PA 2DPJA 1KJIA 1HNWH 4TQRA 3TQTA 2NVYA 4ECVA 2IA6A 4LF9H 1VBHA 2QK4A 4J9RA 2W6QA 5KKNB 3EYYA 1TWAA 4FBUA 4MAMA 5KFLA 2JA7G 2NU7B 5LYJF 2XGPA 4IRKA 3WNZA 4DV0H 1HR0H 1KJ9A 2YCHA 2W6PA 4U6PA 4GC7A 2FPPB 3KAKA 3HOXG 2UXCH 1Z2PX 3HOYG 1SFOA 4TQSA 2IBKA 5I47A 4RB0A 1AN7A 4O4LF 3Q8SB 5T14A 4RZRA 2VUMG 1EZ1A 3EPGA 3M9OB 3MWMA 4J0MA 5C8YF 4QWCA 1S68A 1GSAA 2FPIB 4JI2H 4GLXA 4A3JG 3BQ0A 5KFSA 4YAKB 2PN1A 5KT2A 4RNNA 1N34H 1J5EH 2FK1A 3OSNA 4O3QA 4BY1G 1VS0A 5JVLA 2FB9A 1I50A 5DG9A 3GIIA 3G6VA 4DV4H 4ED1A 4JI4H 3H0GA 5KT5A 3FKIG 5KG0A 1WCMA 3JSNA 4A2AA 1N56A 4J9OA 1B6SA 1M7JA 2ASLA 2BQ3A 3TIIA 3LWBA 4DV1H 2KSWA 1E4EA 1M6VA 1K1SA 5KFTA 4RB2C 3RFCA 4EYIB 4LFCH 4JI6H 5IYZF 2R93A 3GV7B 4ED2A 4IWXA 2GPWA 3CQZA 2SCUB 2OH2A 3RAXA 3HOZG 3G6XA 4B3SH 4QWBA 1S0MA 4ED8A 2VA3A 4RU9A 2XCAA 3PW5A 5IP7G 3V4SA 2FJZA 3ORQA 5BR8H 4O3NA 4YBZB 4WBNF 4J9KA 3J7AK 4EGJA 4XYMB 1AUXA 4QW8A
chains in the Genus database with same CATH topology
4UCVA 5LMUH 4A2BA 1XNRH 4UCRA 2UXBH 4LF7H 4MV7A 2VOBA 4BWSC 2E5LH 5D1OB 4CC5A 4EEQA 4APMA 4LF5H 4R7RA 4YY3H 3L4JA 4LSXA 4X65H 2UUBH 3F8NA 1Z2OX 4LFAH 5FPRA 4DUZH 4JV5H 3K3VA 4JI0H 4MTEA 2WE6A 4CC6A 2RGRA 1L2ZA 3J81W 1ZHQA 1FKAH 4OX9H 2Q2UA 1B04A 4RB3C 3LMLA 1FJGH 1MZBA 3L2PA 3N44B 2UU9H 1XNQH 2HGSA 3J80W 4B3MH 4UCSA 3BA9A 4MTDA 2UXDH 4DR7H 4UCUA 1E4FT 3N40P 1WH2A 4JI3H 3IG0A 3CVZA 3L4KA 1ZHSA 1O75A 4FM9A 4NXNH 2HVQA 1I6UA 5FD6A 4YHHH 2RGVA 1N36H 4LF8H 4X62H 3N6XA 3KALA 3RGZA 4AQYH 1XDNA 1HNZH 1IBMH 3UQ8A 1TAEA 4JI7H 4DR1H 2CW7A 4KHPH 4RB1A 1XMOH 4DV3H 4NXMH 1FVIA 4EFEA 1N32H 1M0TA 3C0FB 4DR2H 4I7HA 5IWAH 4X64H 4UFZA 3PN1A 3RTXA 1M0WA 4EFBA 4UCOA 4DR5H 3BABA 1HNWH 4IAJA 4LMYA 4DV2H 2Q2TA 1P8LA 4LF9H 3RF2A 3RIZA 3N42B 2ZJTA 1IBLH 4LSAA 4LH7A 3BAAA 3EYYA 5D1PA 4K0KH 2MCTA 2VQFH 1SEIA 4MV9A 4DV0H 2VUGA 1IBKH 4B3TH 4LF4H 4DR6H 1HR0H 4PDBA 5IT9W 2YCHA 2UXCH 3KAKA 3N41B 1Z2PX 2HVRA 3BA8A 1BJTA 4RB0A 1AN7A 3H20A 1DGSA 4LFBH 1I94H 3KXYT 3MWMA 4J0MA 4JI8H 1S68A 4JI2H 4GLXA 2O03A 2VQEH 4M7EA 4RZQA 1N34H 3FMAA 1J5EH 1VS0A 1A0IA 4DV4H 1V9PA 4JI4H 1Z2NX 1E4GT 5EOYA 3M4IA 4GKKH 1HNXH 2FE3A 3N43B 4DV6H 1N33H 5FD5A 3JSNA 5D1OA 4A2AA 4UCTA 4Q0YA 1GYFA 4GKJH 2XIGA 2WDTA 5FPOA 4DV1H 4JI1H 5LMNH 2OWOA 2KSWA 1S03G 4LH6A 4RB2C 4DUYH 4RAZA 2UUAH 2HVSA 4LFCH 4JI6H 3JAMW 4DV7H 4B3RH 3DF7A 3JSLA 5FLXW 3OTOH 1SYXB 2WYOA 4DV5H 3T1HH 2F4VH 2VPSA 3T1YH 2UUCH 4B3SH 2CW8A 1BGWA 1TA8A 4DR4H 2W57A 1X9NA 1XMQH 4LF6H 4X66H 4JYAH 5BR8H 2ZM6H 5A2QW 4DR3H 4JI5H 3J7AK 3HXLA 4ETSA 5LL6b 3RJ0A 3KAJA 2HHHH 4RAYA 3RGXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GYF A;  4BWS C;  3K3V A;  1L2Z A;  3FMA A;  1SYX B;  1WH2 A; 
#chains in the Genus database with same CATH topology
 4UCV A;  3H3V H;  3KTM A;  5BPH A;  4QIW E;  4UCR A;  4HNT A;  4A3L G;  2VR1 A;  2VOB A;  4DL2 A;  4ECU A;  1E4E B;  3Q8R B;  4EEQ A;  5KFR A;  5C44 G;  2WTF A;  2R8K A;  5KFE A;  2WAQ A;  4QW9 A;  3RV4 A;  4RNO A;  5KFZ A;  4JV2 A;  2J9G A;  2R92 A;  1JXL A;  3Q2O A;  1TWF A;  3K3V A;  4FS2 A;  1UNN C;  2FK3 A;  2YRW A;  4BXX G;  5L1I A;  1FKA H;  3H4B A;  4OX9 H;  2VUM A;  2XCL A;  1FJG H;  3HKZ E;  3L2P A;  4BY7 G;  2UVW A;  1CQJ B;  4ZHQ F;  2C00 A;  1S10 A;  2Y0S A;  4O4H F;  4MTD A;  2UXD H;  1EUD B;  2ASJ A;  4ECR A;  5KT3 A;  2W9C B;  5KFI A;  5L9X A;  2R7K A;  4Q8E A;  4JI3 H;  1RJP A;  1I3Q A;  4MA5 A;  1V51 A;  4JUZ A;  3L4K A;  4DL4 A;  2HVQ A;  2R6F A;  3N8D A;  1I6U A;  5FD6 A;  3BQ1 A;  3N6X A;  1HNZ H;  2FLP A;  2R7Z A;  1IBM H;  5HBR B;  4F4Y A;  4L1K A;  2JA5 A;  4DR1 H;  4KHP H;  1PX2 A;  3PW2 A;  3BJY A;  1N32 H;  3K3P A;  5DQI A;  3C0F B;  4MV8 A;  3SE7 A;  4FU0 A;  1ULZ A;  4X64 H;  4UFZ A;  2HJW A;  1DV1 A;  2R7M A;  4ZOL F;  4M9U A;  4EFB A;  3R23 A;  4AYB A;  4IAJ A;  2JEG A;  4YAJ B;  3RF2 A;  3TIN A;  2W71 A;  1KBL A;  3RUP A;  5J2U F;  5IYD G;  3PVX A;  5C1O A;  5KT4 A;  1I7N A;  5KFD A;  5IYC G;  2BR0 A;  2VQF H;  2ZDG A;  1I7L A;  2VUG A;  2X0S A;  3OUU A;  4B3T H;  4O2B F;  5IT9 W;  4YP3 A;  2JEI A;  3MWE A;  2YZM A;  4EBC A;  4EBD A;  1WSC A;  4HR7 A;  3GIL A;  2NU9 B;  1DGS A;  1CQI B;  1KJ8 A;  2AGQ A;  4EEY A;  3KXY T;  5L1L A;  4J9S A;  3I4N G;  5EDW A;  2JEF A;  2RF4 A;  5KFW A;  4YQW A;  1KC7 A;  2OLS A;  2O03 A;  5JH7 F;  4Q44 A;  2NUA B;  2J6S A;  1Y1V A;  4RZQ A;  5GON F;  5DGA A;  2UVV A;  1RYR A;  1E4G T;  5EOY A;  4IRC A;  4A3C G;  3V6H A;  2VA2 A;  4MV3 A;  3MR5 A;  4ED6 A;  3N43 B;  4DV6 H;  5DG7 A;  1N33 H;  5FD5 A;  3MR2 A;  1BXR A;  2DLN A;  3BQ2 A;  5EWE A;  4EBE A;  1GYF A;  4I50 F;  3MR6 A;  4JI1 H;  2WDT A;  1KEE A;  3GTQ A;  3H4D A;  3KHL A;  2OWO A;  2M05 A;  5CA0 F;  4BBS G;  4O3R A;  2R7L A;  4O2A F;  3VPC A;  3U9S A;  5KG7 A;  4YR3 A;  4IWY A;  3V6K A;  2AQ4 A;  4B3R H;  2CKZ B;  4TV8 F;  2WAQ E;  4O3O A;  3OTO H;  3JZI A;  1GO3 E;  2WYO A;  5EZY F;  3SI8 A;  2XC9 A;  3H40 A;  3AYH B;  2CW8 A;  3VPB A;  4DR4 H;  2W8L A;  1JKJ B;  1Y14 B;  1XMQ H;  2FMA A;  3OUZ A;  4EGQ A;  5KG4 A;  3GV5 B;  2JA6 A;  2Y0S E;  1GSH A;  2W6M A;  3ORR A;  3Q1K A;  5LL6 b;  3PR5 B;  3RAQ A;  4DL7 A;  2YW2 A;  5J2T F;  1T3N A;  3RGX A;  2F4V H;  3JRW A;  3RB4 A;  1KJJ A;  1XNR H;  4MV7 A;  5KT6 A;  2XGQ A;  2W7O A;  1C3O A;  1EYZ A;  2E2I A;  3RV3 A;  2ZDH A;  4R7R A;  1BNC A;  3LP8 A;  5DLG A;  1VKZ A;  5IYB G;  1S97 A;  4NLG A;  2FP4 B;  4ED3 A;  2W6O A;  4MTE A;  4ED7 A;  2RGR A;  4G3I A;  1L2Z A;  3J81 W;  3OHB A;  2Q2U A;  4C2M A;  4IZO A;  4F4W A;  2B63 G;  2GPS A;  5F9L A;  1JLL B;  2R86 A;  5H80 A;  2C35 B;  1IOV A;  1JDE A;  1XNQ H;  2HGS A;  3GID A;  5IP9 G;  3MR3 A;  5KFO A;  3N40 P;  4AYB E;  2W9C A;  4QWE A;  1ZQ7 A;  2YYA A;  3RB0 A;  1Y1W G;  2W6N A;  3CVZ A;  3I12 A;  5KFQ A;  1ZHS A;  1O75 A;  2DZD A;  1S0O A;  5C4X G;  2ASD A;  3JRX A;  4HQ6 A;  2R85 A;  2JA7 A;  4RUC A;  3PZP A;  1T94 A;  2BQU A;  5KFG A;  4AQY H;  2R82 A;  4A3B G;  4NXM H;  4DV3 H;  4J9L A;  4YR2 A;  4EFE A;  1GLV A;  2DPI A;  3GIQ A;  4DR2 H;  1K1Q A;  5K2M A;  2NVX A;  3BAB A;  4DL5 A;  4LMY A;  2Q2T A;  5FJ8 G;  3PW4 A;  1WR2 A;  4J9Q A;  4F50 A;  3PW7 A;  2C2E A;  4XYL B;  4F4X A;  2R8J A;  4TUY F;  5KFP A;  5LOV F;  3MFH A;  4J9N A;  4LSA A;  4LH7 A;  2R87 A;  3BAA A;  1K83 A;  4E4T A;  1IBL H;  3FKI A;  2MCT A;  1W93 A;  5JVD F;  2R7N A;  4YR0 A;  1SEI A;  4MV9 A;  1IBK H;  4DL6 A;  3GTG A;  3ETJ A;  4PDB A;  3TQ1 A;  2YS7 A;  1C30 A;  2FPG B;  3GV8 B;  3GTL A;  1KJQ A;  3GTP A;  3BA8 A;  4YB8 B;  2CQY A;  3H20 A;  2V5A A;  4IRD A;  4J9P A;  1I94 H;  5KG3 A;  4HNU A;  5JQW A;  2B63 A;  4I4T F;  5DLF A;  2VQE H;  1EHI A;  5EWG A;  3FMA A;  3G8C A;  1CE8 A;  5F9N A;  4IR1 A;  4ECY A;  1V9P A;  3M4I A;  5CAE B;  3R5F A;  2FE3 A;  1RJR A;  4A3F G;  4IR9 A;  2YZN A;  4HYK A;  5D1O A;  4Q0Y A;  3GTO A;  2XIG A;  4C5C A;  3VPD A;  1PK8 A;  5JUM A;  5BPF A;  2V9W A;  1RK6 A;  1S03 G;  1TWH A;  1VBG A;  4RAZ A;  2CZG A;  2VQD A;  2UUA H;  2HVS A;  3JAM W;  3M9N B;  4DV7 H;  1R9T A;  3Q8P B;  2C2D A;  5BMV F;  2R8I A;  2XCP A;  5KG2 A;  4DV5 H;  5KT7 A;  5C5J A;  2VPS A;  1DV2 A;  2WB1 A;  3T1Y H;  1W96 A;  3T5K A;  3U9T A;  3RB3 A;  3GIJ A;  2IMW P;  3PR4 A;  4X66 H;  4WD3 A;  5DQG A;  4U7C A;  2W9A A;  2J6T A;  2ZM6 H;  4GC6 A;  4ETS A;  4XZ3 B;  4QWD A;  3RJ0 A;  3K5I A;  3KAJ A;  3KHR A;  4F4Z A;  5KFC A;  3MFI A;  4RAY A;  5D1O B;  4A93 G;  4A2B A;  5KFJ A;  4MV6 A;  2UXB H;  4TV9 F;  3R5X A;  4CC5 A;  4APM A;  2RDJ A;  4YJ2 F;  4Q8F A;  3QFF A;  2I87 A;  4LSX A;  4X65 H;  2UUB H;  1Z2O X;  4JV5 H;  5FPR A;  2R8G A;  2PVP A;  2WE6 A;  2W70 A;  1ZHQ A;  4C5B A;  4R8U A;  5KFA A;  4RB3 C;  3LML A;  5KFK A;  2V4Q A;  5L1K A;  3PO2 G;  3HOV G;  1MZB A;  1T36 A;  1AUV A;  3T5J A;  2ALZ A;  4EG0 A;  3J80 W;  5KFN A;  3BA9 A;  5C1P A;  2W9B A;  1GGO A;  4UCU A;  3GLK A;  1E4F T;  4ED0 A;  5LP6 F;  1ZET A;  3BG5 A;  1VAJ A;  1WH2 A;  4FBT A;  3NGD A;  1S0N A;  4ECZ A;  3RBE A;  1OWT A;  4NXN H;  2DWC A;  1V4Y A;  2RGV A;  1N36 H;  4LF8 H;  4X62 H;  2R92 G;  3RGZ A;  5KFH A;  3K5H A;  2I8C A;  3UQ8 A;  1TAE A;  3V6J A;  2CW7 A;  3GIM A;  3HBL A;  4RB1 A;  1XMO H;  1RYS A;  4R8U B;  1FVI A;  5KFU A;  1M0T A;  1S9F A;  4I7H A;  5IWA H;  2RDI A;  2AGP A;  3MJF A;  2W6Z A;  3PN1 A;  3HB9 A;  1JDB B;  1M0W A;  1TWC A;  2YL2 A;  3RTX A;  1A9X A;  3OHA A;  2W9B B;  5KFM A;  5FLM G;  2PMZ A;  4DV2 H;  2I80 A;  1P8L A;  4YJ3 F;  3VMM A;  3RIZ A;  3N42 B;  5KX5 F;  3QZ7 A;  2ZJT A;  5CB4 F;  5D1P A;  4K0K H;  1UC9 A;  3PW0 A;  4DLK A;  4ECT A;  3GTK A;  4DR6 H;  4LF4 H;  1RJQ A;  1TWG A;  2R7Z G;  5C3E G;  4HNV A;  2AU0 A;  4A3M G;  3N41 B;  5DGB A;  2HVR A;  2VPQ A;  1BJT A;  2NU6 B;  2JA5 G;  5DG8 A;  2NU8 B;  3Q8Q B;  2GLT A;  4ME6 A;  4ECQ A;  3RBD A;  4LFB H;  2XD4 A;  4DL3 A;  2YZG A;  5KG1 A;  2V59 A;  4JI8 H;  3HOU G;  4A3G G;  4Q43 A;  5KFF A;  4PWQ A;  2WB1 E;  2C22 A;  4M7E A;  3ETH A;  3KHG A;  2W8K A;  5D8D A;  2V58 A;  1A0I A;  2P0A A;  1Z2N X;  4GKK H;  1HNX H;  4MA0 A;  3IN5 A;  3GQC A;  2C28 A;  4O3S A;  1GSO A;  4UCT A;  1B6R A;  3MWD A;  4GKJ H;  5FPO A;  5LMN H;  3V4Z A;  4A3D G;  2YS6 A;  4LH6 A;  2R8H A;  2J6U A;  4DUY H;  4MV4 A;  1N48 A;  3DF7 A;  2C2R A;  4EYH B;  3E5N A;  5KFY A;  3JSL A;  5FLX W;  5KFB A;  1SYX B;  4Q45 A;  3T1H H;  1DIK A;  3PO3 G;  2UUC H;  2ATL A;  3GIK A;  1Y1V G;  4O4I F;  1BGW A;  1TA8 A;  4JV1 A;  2YU9 A;  2W57 A;  1X9N A;  4LF6 H;  5KG5 A;  4RUA A;  4JYA H;  2FLL A;  5A2Q W;  4DR3 H;  4JI5 H;  3HXL A;  4RNM A;  2HHH H;  3OSP A;  2JA8 G;  2QYZ A;  2R84 A;  5KFV A;  4LFA H;  5LMU H;  4MV1 A;  4ZQI A;  4LF7 H;  2ZDQ A;  4BWS C;  1Y1W A;  2E5L H;  2JEJ A;  1B33 N;  3WO1 A;  4LF5 H;  3GTM A;  3I4M G;  5CA1 F;  4YY3 H;  3L4J A;  1JX4 A;  3HOW G;  4A3E G;  2IP4 A;  3F8N A;  4DUZ H;  2DIK A;  2PBZ A;  4XX0 B;  4JI0 H;  4CC6 A;  2V4R A;  4Y8V B;  4QWA A;  3EPI A;  1JIH A;  4ECS A;  1SCU B;  3WO0 A;  3GIP A;  2UVR A;  1B04 A;  4I55 F;  3FDS A;  4A3K G;  1EUC B;  3G6Y A;  3N44 B;  5L1J A;  2UU9 H;  2JA6 G;  4J9M A;  4B3M H;  4UCS A;  4DR7 H;  3H0G G;  4IHJ F;  1UC8 A;  4ZI7 F;  2PMZ E;  4QIW A;  3QZ8 A;  1WCM G;  4ECX A;  5KFX A;  3M9M B;  3IG0 A;  4QJF A;  4A3I G;  4C5A A;  3T5L A;  2UVU A;  4FM9 A;  4FS1 A;  3T5H A;  4YHH H;  1IOW A;  2FK2 A;  3KAL A;  3TIG A;  1XDN A;  5KG6 A;  2BQR A;  2FLN A;  2R93 G;  3GTJ A;  2E2H A;  4ECW A;  4JI7 H;  2YRX A;  2FKL A;  1CS0 A;  3HKZ A;  1RK5 A;  4BBR G;  4O3P A;  4JV0 A;  5LXT F;  3UFX B;  3R5H A;  5DQH A;  2AGO A;  3RB6 A;  5EWF A;  4UCO A;  5LA6 F;  5HV6 A;  3KHH A;  4DR5 H;  2W7P A;  2DPJ A;  1KJI A;  1HNW H;  4TQR A;  3TQT A;  2NVY A;  4ECV A;  2IA6 A;  4LF9 H;  1VBH A;  2QK4 A;  4J9R A;  2W6Q A;  5KKN B;  3EYY A;  1TWA A;  4FBU A;  4MAM A;  5KFL A;  2JA7 G;  2NU7 B;  5LYJ F;  2XGP A;  4IRK A;  3WNZ A;  4DV0 H;  1HR0 H;  1KJ9 A;  2YCH A;  2W6P A;  4U6P A;  4GC7 A;  2FPP B;  3KAK A;  3HOX G;  2UXC H;  1Z2P X;  3HOY G;  1SFO A;  4TQS A;  2IBK A;  5I47 A;  4RB0 A;  1AN7 A;  4O4L F;  3Q8S B;  5T14 A;  4RZR A;  2VUM G;  1EZ1 A;  3EPG A;  3M9O B;  3MWM A;  4J0M A;  5C8Y F;  4QWC A;  1S68 A;  1GSA A;  2FPI B;  4JI2 H;  4GLX A;  4A3J G;  3BQ0 A;  5KFS A;  4YAK B;  2PN1 A;  5KT2 A;  4RNN A;  1N34 H;  1J5E H;  2FK1 A;  3OSN A;  4O3Q A;  4BY1 G;  1VS0 A;  5JVL A;  2FB9 A;  1I50 A;  5DG9 A;  3GII A;  3G6V A;  4DV4 H;  4ED1 A;  4JI4 H;  3H0G A;  5KT5 A;  3FKI G;  5KG0 A;  1WCM A;  3JSN A;  4A2A A;  1N56 A;  4J9O A;  1B6S A;  1M7J A;  2ASL A;  2BQ3 A;  3TII A;  3LWB A;  4DV1 H;  2KSW A;  1E4E A;  1M6V A;  1K1S A;  5KFT A;  4RB2 C;  3RFC A;  4EYI B;  4LFC H;  4JI6 H;  5IYZ F;  2R93 A;  3GV7 B;  4ED2 A;  4IWX A;  2GPW A;  3CQZ A;  2SCU B;  2OH2 A;  3RAX A;  3HOZ G;  3G6X A;  4B3S H;  4QWB A;  1S0M A;  4ED8 A;  2VA3 A;  4RU9 A;  2XCA A;  3PW5 A;  5IP7 G;  3V4S A;  2FJZ A;  3ORQ A;  5BR8 H;  4O3N A;  4YBZ B;  4WBN F;  4J9K A;  3J7A K;  4EGJ A;  4XYM B;  1AUX A;  4QW8 A; 
#chains in the Genus database with same CATH homology
 4UCV A;  5LMU H;  4A2B A;  1XNR H;  4UCR A;  2UXB H;  4LF7 H;  4MV7 A;  2VOB A;  4BWS C;  2E5L H;  5D1O B;  4CC5 A;  4EEQ A;  4APM A;  4LF5 H;  4R7R A;  4YY3 H;  3L4J A;  4LSX A;  4X65 H;  2UUB H;  3F8N A;  1Z2O X;  4LFA H;  5FPR A;  4DUZ H;  4JV5 H;  3K3V A;  4JI0 H;  4MTE A;  2WE6 A;  4CC6 A;  2RGR A;  1L2Z A;  3J81 W;  1ZHQ A;  1FKA H;  4OX9 H;  2Q2U A;  1B04 A;  4RB3 C;  3LML A;  1FJG H;  1MZB A;  3L2P A;  3N44 B;  2UU9 H;  1XNQ H;  2HGS A;  3J80 W;  4B3M H;  4UCS A;  3BA9 A;  4MTD A;  2UXD H;  4DR7 H;  4UCU A;  1E4F T;  3N40 P;  1WH2 A;  4JI3 H;  3IG0 A;  3CVZ A;  3L4K A;  1ZHS A;  1O75 A;  4FM9 A;  4NXN H;  2HVQ A;  1I6U A;  5FD6 A;  4YHH H;  2RGV A;  1N36 H;  4LF8 H;  4X62 H;  3N6X A;  3KAL A;  3RGZ A;  4AQY H;  1XDN A;  1HNZ H;  1IBM H;  3UQ8 A;  1TAE A;  4JI7 H;  4DR1 H;  2CW7 A;  4KHP H;  4RB1 A;  1XMO H;  4DV3 H;  4NXM H;  1FVI A;  4EFE A;  1N32 H;  1M0T A;  3C0F B;  4DR2 H;  4I7H A;  5IWA H;  4X64 H;  4UFZ A;  3PN1 A;  3RTX A;  1M0W A;  4EFB A;  4UCO A;  4DR5 H;  3BAB A;  1HNW H;  4IAJ A;  4LMY A;  4DV2 H;  2Q2T A;  1P8L A;  4LF9 H;  3RF2 A;  3RIZ A;  3N42 B;  2ZJT A;  1IBL H;  4LSA A;  4LH7 A;  3BAA A;  3EYY A;  5D1P A;  4K0K H;  2MCT A;  2VQF H;  1SEI A;  4MV9 A;  4DV0 H;  2VUG A;  1IBK H;  4B3T H;  4LF4 H;  4DR6 H;  1HR0 H;  4PDB A;  5IT9 W;  2YCH A;  2UXC H;  3KAK A;  3N41 B;  1Z2P X;  2HVR A;  3BA8 A;  1BJT A;  4RB0 A;  1AN7 A;  3H20 A;  1DGS A;  4LFB H;  1I94 H;  3KXY T;  3MWM A;  4J0M A;  4JI8 H;  1S68 A;  4JI2 H;  4GLX A;  2O03 A;  2VQE H;  4M7E A;  4RZQ A;  1N34 H;  3FMA A;  1J5E H;  1VS0 A;  1A0I A;  4DV4 H;  1V9P A;  4JI4 H;  1Z2N X;  1E4G T;  5EOY A;  3M4I A;  4GKK H;  1HNX H;  2FE3 A;  3N43 B;  4DV6 H;  1N33 H;  5FD5 A;  3JSN A;  5D1O A;  4A2A A;  4UCT A;  4Q0Y A;  1GYF A;  4GKJ H;  2XIG A;  2WDT A;  5FPO A;  4DV1 H;  4JI1 H;  5LMN H;  2OWO A;  2KSW A;  1S03 G;  4LH6 A;  4RB2 C;  4DUY H;  4RAZ A;  2UUA H;  2HVS A;  4LFC H;  4JI6 H;  3JAM W;  4DV7 H;  4B3R H;  3DF7 A;  3JSL A;  5FLX W;  3OTO H;  1SYX B;  2WYO A;  4DV5 H;  3T1H H;  2F4V H;  2VPS A;  3T1Y H;  2UUC H;  4B3S H;  2CW8 A;  1BGW A;  1TA8 A;  4DR4 H;  2W57 A;  1X9N A;  1XMQ H;  4LF6 H;  4X66 H;  4JYA H;  5BR8 H;  2ZM6 H;  5A2Q W;  4DR3 H;  4JI5 H;  3J7A K;  3HXL A;  4ETS A;  5LL6 b;  3RJ0 A;  3KAJ A;  2HHH H;  4RAY A;  3RGX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...