1WH2A

Solution structure of the gyf domain of a hypothetical protein from arabidopsis thaliana
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
78
structure length
78
Chain Sequence
b'GSSGSSGVRVLSYDKEKLNWLYKDPQGLVQGPFSLTQLKAWSDAEYFTKQFRVWMTGESMESAVLLTDVLRLSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein At5g08430
molecule tags Structural genomics, unknown function
source organism Arabidopsis thaliana
publication title Solution structure of the GYF domain of a hypothetical protein from Arabidopsis thaliana
rcsb
total genus 11
structure length 78
sequence length 78
ec nomenclature
pdb deposition date 2004-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02213 GYF GYF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1490.40 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 1wh2A01
1L2ZA 4BWSC 1GYFA 1WH2A 3FMAA 3K3VA 1SYXB
chains in the Genus database with same CATH superfamily
1Y1VA 3RB3A 2J6TA 2VUMG 3R23A 2FE3A 2FJZA 4LH7A 3HOXG 5L1LA 2C35B 3KALA 2Y0SA 2UUCH 2YRWA 1TWCA 4UCSA 4PWQA 4MV4A 4B3MH 4OX9H 4Q44A 5JH7F 3EPIA 4A2AA 2WAQA 5L1JA 4MV1A 3R5FA 5J2TF 4J9NA 4FS1A 4DUYH 4LF6H 4LF8H 3GIPA 2UXBH 5C8YF 1O75A 2W6NA 2W9BA 2FLPA 2V4RA 4A3CG 3GTKA 4HNUA 4JV5H 2PMZA 3PW7A 4DL3A 2AGOA 1HNZH 2FK1A 3OHBA 2VA2A 1T94A 3BQ1A 1RJRA 2C2EA 2DLNA 4RB2C 2RDIA 2GPWA 5KFPA 1E4FT 3LWBA 4RAZA 5IYDG 4MV7A 3J80W 3UQ8A 4YY3H 5CA0F 5JQWA 2HJWA 5EWFA 1KJJA 5BMVF 3GIJA 4ECVA 2JA5G 2FLLA 2HVRA 2XIGA 4BY1G 3GTLA 4YJ2F 3HOVG 3VPBA 2YRXA 2R8IA 1N32H 4DV7H 4QWEA 2MCTA 3UFXB 2F4VH 2FPIB 2ASJA 2R7MA 2WAQE 1JXLA 1X9NA 4RZQA 4MAMA 5KFZA 2QYZA 5KG2A 4RB3C 2VA3A 2AQ4A 4CC6A 4RU9A 4UFZA 4LF9H 1Y14B 3V4ZA 4DV6H 2HGSA 4WBNF 2NU8B 2XD4A 2CQYA 4UCOA 4TV8F 2O03A 5FJ8G 5DLFA 1KBLA 2C2DA 3WO1A 1CS0A 5D1OA 2GLTA 4LFBH 4XX0B 3VPCA 4ME6A 2R93G 2ZDHA 1HNXH 5IYCG 3KHRA 1GSAA 4ECXA 3M9MB 5T14A 2WB1A 3LMLA 3T5KA 1RYRA 3RV3A 1I6UA 5LMNH 3OHAA 4GKKH 1AUVA 4ECZA 3GTJA 1FJGH 3QZ7A 4IZOA 2ATLA 5GONF 4LSXA 1Y1WG 4LF4H 1B6RA 3NGDA 2R92G 4RUAA 4ZHQF 3GTPA 1C30A 1EHIA 5KT7A 4QIWE 4FBUA 1P8LA 4AYBE 1FKAH 4Q45A 3N43B 1RK5A 5KFBA 5EWGA 4F4WA 4DL7A 2VPSA 5LP6F 5KT6A 4XZ3B 4ED7A 4JI0H 3GIMA 5L9XA 1JX4A 5KFNA 3OUZA 1CE8A 2XCLA 4QWBA 5DQIA 3MFIA 2CW7A 5L1KA 4IRCA 2YS6A 5FLMG 3QFFA 5JVLA 4J9MA 5C1PA 1SCUB 2B63A 3L2PA 1JIHA 2IMWP 3TIIA 3J7AK 1S10A 3PO3G 4Y8VB 2W57A 2WB1E 3MJFA 5KFGA 4Q8EA 4TQRA 2IA6A 2FPGB 3BG5A 5KG5A 4ECYA 3IN5A 4F4XA 4AQYH 5KFFA 2PVPA 2R8KA 3L4KA 3J81W 4Q8FA 4QJFA 4RB0A 5HV6A 2VUGA 3H4BA 3N44B 2DPIA 2W6ZA 4QW8A 3GTQA 1HNWH 2UVWA 4IAJA 4QIWA 4HNVA 4DV0H 4I4TF 5IWAH 3GQCA 1S0OA 4FU0A 3RTXA 3HOZG 1ZHSA 1OWTA 5KKNB 1J5EH 5C5JA 2WTFA 5CAEB 3VPDA 2W7OA 1KJQA 3HKZE 3VMMA 2XGPA 4UCTA 4DV1H 4ECWA 5KG3A 4O3PA 1K1QA 3H40A 4QWAA 3RAQA 1XMQH 1N33H 4Q0YA 1I7NA 5BPFA 4RAYA 3BQ0A 3T1YH 3GTMA 4DR1H 3T1HH 2FPPB 5HBRB 2R7ZG 2R7KA 2VUMA 2SCUB 4NXMH 3G6XA 2JEIA 4A3MG 3MFHA 2FB9A 4JYAH 4U7CA 4ECUA 3HOYG 4A3BG 2WYOA 3PN1A 5KFWA 4IRDA 4O4IF 4G3IA 2GPSA 5JVDF 4A2BA 4F4YA 1IBLH 2DZDA 1B04A 5H80A 1UC8A 2QK4A 5KFSA 4DR4H 2X0SA 4ECQA 4GKJH 3U9TA 3HKZA 4U6PA 5C3EG 3FKIA 5LYJF 4R8UB 4LSAA 5EOYA 2B63G 1PX2A 4LF5H 5KT2A 3I4MG 3H4DA 2WDTA 3TINA 2VPQA 2W70A 3HBLA 1I50A 2XCAA 3GV8B 1T3NA 2Y0SE 2JEFA 4O2AF 3I12A 3ORRA 2V9WA 2AGQA 1CQIB 1SYXB 5KG6A 2R6FA 4M9UA 4R7RA 1EYZA 4YP3A 5KG0A 4JUZA 4ECRA 3MWMA 4EBCA 1DGSA 2ALZA 3SE7A 2R8JA 2C00A 2UVRA 2W6MA 5LL6b 1I94H 4I50F 4L1KA 4EGJA 3KAKA 5DLGA 4ZOLF 2W9CB 5KFHA 1BJTA 3SI8A 1AUXA 3RB6A 2OLSA 3G6YA 4MTDA 4X64H 2XCPA 1XDNA 2YW2A 3N42B 3MWDA 4R8UA 4C5AA 4K0KH 1EUCB 5DQHA 3Q8SB 4EYHB 2PN1A 4DV4H 4EYIB 5DG8A 2R7ZA 5EWEA 2BR0A 2IP4A 2C2RA 2ZJTA 4J9QA 2UU9H 1DIKA 2E2IA 3H0GA 3R5HA 2R82A 3CQZA 2V4QA 3JSNA 3RUPA 3JZIA 2AU0A 4J9PA 4LMYA 2V5AA 3WNZA 3PR5B 2E5LH 3HXLA 3RBDA 1HR0H 3BJYA 5KT4A 5KFJA 2UXDH 2UUBH 3GLKA 1Y1WA 3PR4A 1VAJA 1BNCA 4YQWA 3GIDA 3T5HA 2W9CA 1XMOH 4ED1A 2W7PA 3PZPA 2ZDGA 5KG4A 1L2ZA 4QWDA 2YCHA 4J9SA 4IR9A 2BQRA 3PW0A 2XGQA 4EEQA 5C1OA 2W71A 1E4GT 3M9OB 1IBKH 3ORQA 2NU9B 3DF7A 4DR5H 4JI7H 4PDBA 1S9FA 5KFVA 4BY7G 4JV2A 3GTOA 3AYHB 3K5IA 3RF2A 2FMAA 1GSOA 1FVIA 2VQEH 2HHHH 3OSNA 1UC9A 1RJPA 2NVYA 3K3PA 5KFDA 4FM9A 4RNOA 2JA7A 4ZQIA 5LMUH 4RUCA 5BPHA 3JRXA 4X62H 1I3QA 5D1OB 5JUMA 2R85A 5KFIA 2E2HA 3M9NB 2UUAH 1A0IA 2YL2A 5KFAA 5KG7A 1GGOA 4DR6H 4JI8H 4O4HF 3JRWA 1XNQH 3GTGA 2NU6B 2VQFH 1WH2A 4DL5A 3Q8PB 3I4NG 4YAKB 4JI6H 4QW9A 4X66H 1JDBB 4J9KA 3R5XA 4IWXA 3BABA 3U9SA 5IYBG 1JDEA 1JKJB 1TWFA 3L4JA 4EFEA 4EGQA 4BWSC 4ECTA 3CVZA 4EBDA 3TQ1A 3PW2A 1ZHQA 3KHGA 5KT3A 5IT9W 2KSWA 5KFOA 4B3RH 1I7LA 4A3GG 1GYFA 4GC7A 1S68A 5C4XG 2JA6G 5KFMA 4NLGA 1TWAA 2R8GA 5F9LA 3HOWG 2FP4B 3LP8A 1W93A 4DR3H 3Q2OA 5D1PA 4QWCA 3GIIA 2YZNA 1RJQA 4YJ3F 4A3KG 2CW8A 3KXYT 5I47A 3E5NA 3RV4A 4JI3H 4BXXG 1TWHA 1SEIA 1Z2PX 3OTOH 4DL6A 4DV3H 4C5CA 3PVXA 3V6JA 3HB9A 5EDWA 1S97A 2WE6A 3MWEA 4MV6A 1MZBA 3JAMW 3JSLA 2JA8G 5CB4F 5KFLA 1Z2NX 4RNMA 2P0AA 3N41B 1S0MA 3EYYA 3H20A 3BAAA 4FBTA 4JI1H 4JI5H 5DGAA 2R7LA 3MR3A 2RF4A 4I55F 4KHPH 4YAJB 4A3FG 5KX5F 4J9RA 4RZRA 4O3SA 4GC6A 5FD6A 2BQ3A 2V58A 2C22A 3GIQA 1N34H 1V4YA 4ECSA 3H3VH 4B3TH 2HVQA 1CQJB 2YYAA 1M7JA 3HOUG 2R92A 3OUUA 4O2BF 5LOVF 2W9BB 1Z2OX 4MV3A 2JA7G 4EBEA 3MR2A 4APMA 5D8DA 3RBEA 2R84A 2M05A 3Q8QB 4C5BA 3G6VA 3RGZA 2FK2A 4J9OA 2YS7A 4C2MA 4F50A 4IR1A 2NVXA 3C0FB 2OH2A 2C28A 4O3RA 1N56A 5FPOA 2R8HA 1B6SA 4ED3A 4A3EG 4CC5A 2FKLA 2W6OA 5EZYF 3T5JA 3K3VA 5A2QW 3T5LA 4A3JG 2NU7B 4DV5H 1PK8A 2OWOA 2W8LA 5DG7A 4IHJF 1WCMG 5KG1A 4A3LG 2W6QA 1R9TA 3RB4A 5KFYA 4J0MA 1E4EA 4IWYA 5FD5A 3RFCA 4ED2A 5L1IA 4LFCH 3Q1KA 3KHHA 5BR8H 2CKZB 4MV8A 4B3SH 1E4EB 4Q43A 5DG9A 3RJ0A 4MA5A 3KTMA 1DV1A 2RGVA 5IP9G 1W96A 4TV9F 1WCMA 1GO3E 5F9NA 4ED0A 3KAJA 4DR2H 2V59A 4RB1A 4X65H 2J9GA 2BQUA 1KC7A 1RYSA 4O4LF 4JI4H 1SFOA 3V4SA 4BBRG 2PBZA 1ZQ7A 3BA9A 2RDJA 2R7NA 1EUDB 1EZ1A 4UCUA 1IOVA 3RAXA 4A3DG 4ED6A 3GV5B 1V51A 3ETHA 4E4TA 4I7HA 4F4ZA 2ASLA 1IBMH 1N48A 1UNNC 1VBHA 2I80A 2ZM6H 2J6SA 4HR7A 3V6HA 2RGRA 4TUYF 2ASDA 3ETJA 2JA5A 4GLXA 5DGBA 4DL4A 1TA8A 1JLLB 3Q8RB 3V6KA 3TQTA 4BBSG 1KJ9A 3QZ8A 3KHLA 4DUZH 5DQGA 3H0GG 4DV2H 2FLNA 4RNNA 4MV9A 2VR1A 4DL2A 1VS0A 3GILA 4LFAH 4FS2A 3MR6A 1BXRA 2YZGA 1K1SA 4AYBA 4DLKA 4IRKA 4YBZB 1TWGA 4YR2A 4HQ6A 5KFUA 1Y1VG 2W6PA 4J9LA 4DR7H 4ETSA 4YR3A 2UVUA 4YB8B 2FK3A 4LF7H 2UVVA 5K2MA 3G8CA 4A3IG 2W9AA 1M0TA 2ZDQA 4A93G 2R87A 3GIKA 2VOBA 4XYMB 2HVSA 4O3QA 1BGWA 4MTEA 1VKZA 2DPJA 2I87A 5LXTF 1C3OA 3N40P 1WSCA 4O3NA 2XC9A 1KJIA 2NUAB 5KFXA 1GLVA 4YHHH 2W8KA 1T36A 5LA6F 3IG0A 4EG0A 3RGXA 3EPGA 4ZI7F 4EFBA 3M4IA 5KFTA 4TQSA 5FPRA 3PW4A 3RB0A 4ED8A 3BQ2A 1B33N 2I8CA 4JI2H 3RIZA 5KFKA 1S0NA 3PO2G 1S03G 1ZETA 3MR5A 1M0WA 1M6VA 2R86A 5IP7G 3OSPA 3BA8A 3PW5A 1K83A 1KJ8A 3N8DA 4MA0A 1A9XA 5FLXW 3N6XA 3WO0A 5CA1F 5C44G 3GV7B 1DV2A 5KT5A 3K5HA 1N36H 2JEGA 2JEJA 1AN7A 4YR0A 4JV0A 3F8NA 4O3OA 3TIGA 1XNRH 3FDSA 4XYLB 2UXCH 1WR2A 1TAEA 5KFCA 2YU9A 2DWCA 3FKIG 4UCRA 4EEYA 1VBGA 5KFEA 2AGPA 4NXNH 1IOWA 2PMZE 2YZMA 5J2UF 1GSHA 4JV1A 1KEEA 2JA6A 5KFRA 4HNTA 1ULZA 3FMAA 4M7EA 2VQDA 2J6UA 4LH6A 2Q2UA 1RK6A 2Q2TA 2IBKA 5KFQA 2CZGA 4HYKA 1V9PA 5IYZF 2R93A 4WD3A 4UCVA 2DIKA
chains in the Genus database with same CATH topology
1XNQH 3KAJA 4RAYA 4DR2H 3T1YH 4LH7A 2FE3A 4RB1A 2VQFH 1WH2A 2UUCH 3KALA 4X65H 4DR1H 3T1HH 4UCSA 4B3MH 4OX9H 4JI6H 4NXMH 4A2AA 4JYAH 4JI4H 4X66H 2WYOA 3PN1A 4DUYH 4JI8H 4LF6H 4LF8H 3BABA 3BA9A 2UXBH 1O75A 4A2BA 4UCUA 4EFEA 4BWSC 3L4JA 1B04A 3CVZA 1IBLH 4JV5H 1HNZH 1ZHQA 4I7HA 1IBMH 4RB2C 5IT9W 4DR4H 2ZM6H 2KSWA 4B3RH 4GKJH 1GYFA 1E4FT 1S68A 2RGRA 4RAZA 4GLXA 4MV7A 3J80W 1TA8A 4LSAA 5EOYA 3UQ8A 4YY3H 4LF5H 4DR3H 4DUZH 2WDTA 5D1PA 4DV2H 2HVRA 2XIGA 4MV9A 1N32H 1VS0A 2CW8A 3KXYT 4DV7H 4LFAH 2MCTA 2F4VH 4JI3H 1SEIA 1SYXB 1Z2PX 4RZQA 1X9NA 3OTOH 4R7RA 4DV3H 4RB3C 3MWMA 4CC6A 1DGSA 4UFZA 4ETSA 4LF9H 4DR7H 4DV6H 4LF7H 2WE6A 1M0TA 1MZBA 2HGSA 3JSLA 3JAMW 5LL6b 1Z2NX 1I94H 4UCOA 2O03A 3N41B 2VOBA 3EYYA 3KAKA 3H20A 4LFBH 1BJTA 5D1OA 2HVSA 3BAAA 4JI1H 4JI5H 1BGWA 4MTEA 4X64H 4MTDA 1HNXH 4KHPH 1XDNA 3N40P 3N42B 3LMLA 4YHHH 1I6UA 5LMNH 4K0KH 5FD6A 4GKKH 3RGXA 3IG0A 4DV4H 1FJGH 4EFBA 3M4IA 5FPRA 4LSXA 4LF4H 1N34H 2ZJTA 2UU9H 4B3TH 2HVQA 3RIZA 1P8LA 4JI2H 3JSNA 1FKAH 3N43B 1S03G 2E5LH 4LMYA 1M0WA 3HXLA 1HR0H 2VPSA 1Z2OX 4JI0H 3BA8A 4APMA 5FLXW 2UXDH 2UUBH 3N6XA 2CW7A 3RGZA 3C0FB 1XMOH 3L2PA 1N36H 3J7AK 5FPOA 1L2ZA 1AN7A 4CC5A 2YCHA 3F8NA 1XNRH 2W57A 3K3VA 4EEQA 5A2QW 2UXCH 4DV5H 1E4GT 1TAEA 1IBKH 2OWOA 3DF7A 4UCRA 4AQYH 4DR5H 3L4KA 3J81W 4JI7H 4PDBA 4RB0A 2VUGA 4NXNH 3N44B 3RF2A 1FVIA 2VQEH 4IAJA 2HHHH 1HNWH 4DV0H 5IWAH 4FM9A 3RTXA 3FMAA 4J0MA 5LMUH 4M7EA 5FD5A 1ZHSA 4LFCH 4X62H 4LH6A 5D1OB 1J5EH 2Q2UA 5BR8H 4B3SH 2Q2TA 2UUAH 1A0IA 1V9PA 4UCTA 3RJ0A 4DV1H 1XMQH 4DR6H 1N33H 2RGVA 4UCVA 4Q0YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1L2Z A;  4BWS C;  1GYF A;  1WH2 A;  3FMA A;  3K3V A;  1SYX B; 
#chains in the Genus database with same CATH topology
 1Y1V A;  3RB3 A;  2J6T A;  2VUM G;  3R23 A;  2FE3 A;  2FJZ A;  4LH7 A;  3HOX G;  5L1L A;  2C35 B;  3KAL A;  2Y0S A;  2UUC H;  2YRW A;  1TWC A;  4UCS A;  4PWQ A;  4MV4 A;  4B3M H;  4OX9 H;  4Q44 A;  5JH7 F;  3EPI A;  4A2A A;  2WAQ A;  5L1J A;  4MV1 A;  3R5F A;  5J2T F;  4J9N A;  4FS1 A;  4DUY H;  4LF6 H;  4LF8 H;  3GIP A;  2UXB H;  5C8Y F;  1O75 A;  2W6N A;  2W9B A;  2FLP A;  2V4R A;  4A3C G;  3GTK A;  4HNU A;  4JV5 H;  2PMZ A;  3PW7 A;  4DL3 A;  2AGO A;  1HNZ H;  2FK1 A;  3OHB A;  2VA2 A;  1T94 A;  3BQ1 A;  1RJR A;  2C2E A;  2DLN A;  4RB2 C;  2RDI A;  2GPW A;  5KFP A;  1E4F T;  3LWB A;  4RAZ A;  5IYD G;  4MV7 A;  3J80 W;  3UQ8 A;  4YY3 H;  5CA0 F;  5JQW A;  2HJW A;  5EWF A;  1KJJ A;  5BMV F;  3GIJ A;  4ECV A;  2JA5 G;  2FLL A;  2HVR A;  2XIG A;  4BY1 G;  3GTL A;  4YJ2 F;  3HOV G;  3VPB A;  2YRX A;  2R8I A;  1N32 H;  4DV7 H;  4QWE A;  2MCT A;  3UFX B;  2F4V H;  2FPI B;  2ASJ A;  2R7M A;  2WAQ E;  1JXL A;  1X9N A;  4RZQ A;  4MAM A;  5KFZ A;  2QYZ A;  5KG2 A;  4RB3 C;  2VA3 A;  2AQ4 A;  4CC6 A;  4RU9 A;  4UFZ A;  4LF9 H;  1Y14 B;  3V4Z A;  4DV6 H;  2HGS A;  4WBN F;  2NU8 B;  2XD4 A;  2CQY A;  4UCO A;  4TV8 F;  2O03 A;  5FJ8 G;  5DLF A;  1KBL A;  2C2D A;  3WO1 A;  1CS0 A;  5D1O A;  2GLT A;  4LFB H;  4XX0 B;  3VPC A;  4ME6 A;  2R93 G;  2ZDH A;  1HNX H;  5IYC G;  3KHR A;  1GSA A;  4ECX A;  3M9M B;  5T14 A;  2WB1 A;  3LML A;  3T5K A;  1RYR A;  3RV3 A;  1I6U A;  5LMN H;  3OHA A;  4GKK H;  1AUV A;  4ECZ A;  3GTJ A;  1FJG H;  3QZ7 A;  4IZO A;  2ATL A;  5GON F;  4LSX A;  1Y1W G;  4LF4 H;  1B6R A;  3NGD A;  2R92 G;  4RUA A;  4ZHQ F;  3GTP A;  1C30 A;  1EHI A;  5KT7 A;  4QIW E;  4FBU A;  1P8L A;  4AYB E;  1FKA H;  4Q45 A;  3N43 B;  1RK5 A;  5KFB A;  5EWG A;  4F4W A;  4DL7 A;  2VPS A;  5LP6 F;  5KT6 A;  4XZ3 B;  4ED7 A;  4JI0 H;  3GIM A;  5L9X A;  1JX4 A;  5KFN A;  3OUZ A;  1CE8 A;  2XCL A;  4QWB A;  5DQI A;  3MFI A;  2CW7 A;  5L1K A;  4IRC A;  2YS6 A;  5FLM G;  3QFF A;  5JVL A;  4J9M A;  5C1P A;  1SCU B;  2B63 A;  3L2P A;  1JIH A;  2IMW P;  3TII A;  3J7A K;  1S10 A;  3PO3 G;  4Y8V B;  2W57 A;  2WB1 E;  3MJF A;  5KFG A;  4Q8E A;  4TQR A;  2IA6 A;  2FPG B;  3BG5 A;  5KG5 A;  4ECY A;  3IN5 A;  4F4X A;  4AQY H;  5KFF A;  2PVP A;  2R8K A;  3L4K A;  3J81 W;  4Q8F A;  4QJF A;  4RB0 A;  5HV6 A;  2VUG A;  3H4B A;  3N44 B;  2DPI A;  2W6Z A;  4QW8 A;  3GTQ A;  1HNW H;  2UVW A;  4IAJ A;  4QIW A;  4HNV A;  4DV0 H;  4I4T F;  5IWA H;  3GQC A;  1S0O A;  4FU0 A;  3RTX A;  3HOZ G;  1ZHS A;  1OWT A;  5KKN B;  1J5E H;  5C5J A;  2WTF A;  5CAE B;  3VPD A;  2W7O A;  1KJQ A;  3HKZ E;  3VMM A;  2XGP A;  4UCT A;  4DV1 H;  4ECW A;  5KG3 A;  4O3P A;  1K1Q A;  3H40 A;  4QWA A;  3RAQ A;  1XMQ H;  1N33 H;  4Q0Y A;  1I7N A;  5BPF A;  4RAY A;  3BQ0 A;  3T1Y H;  3GTM A;  4DR1 H;  3T1H H;  2FPP B;  5HBR B;  2R7Z G;  2R7K A;  2VUM A;  2SCU B;  4NXM H;  3G6X A;  2JEI A;  4A3M G;  3MFH A;  2FB9 A;  4JYA H;  4U7C A;  4ECU A;  3HOY G;  4A3B G;  2WYO A;  3PN1 A;  5KFW A;  4IRD A;  4O4I F;  4G3I A;  2GPS A;  5JVD F;  4A2B A;  4F4Y A;  1IBL H;  2DZD A;  1B04 A;  5H80 A;  1UC8 A;  2QK4 A;  5KFS A;  4DR4 H;  2X0S A;  4ECQ A;  4GKJ H;  3U9T A;  3HKZ A;  4U6P A;  5C3E G;  3FKI A;  5LYJ F;  4R8U B;  4LSA A;  5EOY A;  2B63 G;  1PX2 A;  4LF5 H;  5KT2 A;  3I4M G;  3H4D A;  2WDT A;  3TIN A;  2VPQ A;  2W70 A;  3HBL A;  1I50 A;  2XCA A;  3GV8 B;  1T3N A;  2Y0S E;  2JEF A;  4O2A F;  3I12 A;  3ORR A;  2V9W A;  2AGQ A;  1CQI B;  1SYX B;  5KG6 A;  2R6F A;  4M9U A;  4R7R A;  1EYZ A;  4YP3 A;  5KG0 A;  4JUZ A;  4ECR A;  3MWM A;  4EBC A;  1DGS A;  2ALZ A;  3SE7 A;  2R8J A;  2C00 A;  2UVR A;  2W6M A;  5LL6 b;  1I94 H;  4I50 F;  4L1K A;  4EGJ A;  3KAK A;  5DLG A;  4ZOL F;  2W9C B;  5KFH A;  1BJT A;  3SI8 A;  1AUX A;  3RB6 A;  2OLS A;  3G6Y A;  4MTD A;  4X64 H;  2XCP A;  1XDN A;  2YW2 A;  3N42 B;  3MWD A;  4R8U A;  4C5A A;  4K0K H;  1EUC B;  5DQH A;  3Q8S B;  4EYH B;  2PN1 A;  4DV4 H;  4EYI B;  5DG8 A;  2R7Z A;  5EWE A;  2BR0 A;  2IP4 A;  2C2R A;  2ZJT A;  4J9Q A;  2UU9 H;  1DIK A;  2E2I A;  3H0G A;  3R5H A;  2R82 A;  3CQZ A;  2V4Q A;  3JSN A;  3RUP A;  3JZI A;  2AU0 A;  4J9P A;  4LMY A;  2V5A A;  3WNZ A;  3PR5 B;  2E5L H;  3HXL A;  3RBD A;  1HR0 H;  3BJY A;  5KT4 A;  5KFJ A;  2UXD H;  2UUB H;  3GLK A;  1Y1W A;  3PR4 A;  1VAJ A;  1BNC A;  4YQW A;  3GID A;  3T5H A;  2W9C A;  1XMO H;  4ED1 A;  2W7P A;  3PZP A;  2ZDG A;  5KG4 A;  1L2Z A;  4QWD A;  2YCH A;  4J9S A;  4IR9 A;  2BQR A;  3PW0 A;  2XGQ A;  4EEQ A;  5C1O A;  2W71 A;  1E4G T;  3M9O B;  1IBK H;  3ORQ A;  2NU9 B;  3DF7 A;  4DR5 H;  4JI7 H;  4PDB A;  1S9F A;  5KFV A;  4BY7 G;  4JV2 A;  3GTO A;  3AYH B;  3K5I A;  3RF2 A;  2FMA A;  1GSO A;  1FVI A;  2VQE H;  2HHH H;  3OSN A;  1UC9 A;  1RJP A;  2NVY A;  3K3P A;  5KFD A;  4FM9 A;  4RNO A;  2JA7 A;  4ZQI A;  5LMU H;  4RUC A;  5BPH A;  3JRX A;  4X62 H;  1I3Q A;  5D1O B;  5JUM A;  2R85 A;  5KFI A;  2E2H A;  3M9N B;  2UUA H;  1A0I A;  2YL2 A;  5KFA A;  5KG7 A;  1GGO A;  4DR6 H;  4JI8 H;  4O4H F;  3JRW A;  1XNQ H;  3GTG A;  2NU6 B;  2VQF H;  1WH2 A;  4DL5 A;  3Q8P B;  3I4N G;  4YAK B;  4JI6 H;  4QW9 A;  4X66 H;  1JDB B;  4J9K A;  3R5X A;  4IWX A;  3BAB A;  3U9S A;  5IYB G;  1JDE A;  1JKJ B;  1TWF A;  3L4J A;  4EFE A;  4EGQ A;  4BWS C;  4ECT A;  3CVZ A;  4EBD A;  3TQ1 A;  3PW2 A;  1ZHQ A;  3KHG A;  5KT3 A;  5IT9 W;  2KSW A;  5KFO A;  4B3R H;  1I7L A;  4A3G G;  1GYF A;  4GC7 A;  1S68 A;  5C4X G;  2JA6 G;  5KFM A;  4NLG A;  1TWA A;  2R8G A;  5F9L A;  3HOW G;  2FP4 B;  3LP8 A;  1W93 A;  4DR3 H;  3Q2O A;  5D1P A;  4QWC A;  3GII A;  2YZN A;  1RJQ A;  4YJ3 F;  4A3K G;  2CW8 A;  3KXY T;  5I47 A;  3E5N A;  3RV4 A;  4JI3 H;  4BXX G;  1TWH A;  1SEI A;  1Z2P X;  3OTO H;  4DL6 A;  4DV3 H;  4C5C A;  3PVX A;  3V6J A;  3HB9 A;  5EDW A;  1S97 A;  2WE6 A;  3MWE A;  4MV6 A;  1MZB A;  3JAM W;  3JSL A;  2JA8 G;  5CB4 F;  5KFL A;  1Z2N X;  4RNM A;  2P0A A;  3N41 B;  1S0M A;  3EYY A;  3H20 A;  3BAA A;  4FBT A;  4JI1 H;  4JI5 H;  5DGA A;  2R7L A;  3MR3 A;  2RF4 A;  4I55 F;  4KHP H;  4YAJ B;  4A3F G;  5KX5 F;  4J9R A;  4RZR A;  4O3S A;  4GC6 A;  5FD6 A;  2BQ3 A;  2V58 A;  2C22 A;  3GIQ A;  1N34 H;  1V4Y A;  4ECS A;  3H3V H;  4B3T H;  2HVQ A;  1CQJ B;  2YYA A;  1M7J A;  3HOU G;  2R92 A;  3OUU A;  4O2B F;  5LOV F;  2W9B B;  1Z2O X;  4MV3 A;  2JA7 G;  4EBE A;  3MR2 A;  4APM A;  5D8D A;  3RBE A;  2R84 A;  2M05 A;  3Q8Q B;  4C5B A;  3G6V A;  3RGZ A;  2FK2 A;  4J9O A;  2YS7 A;  4C2M A;  4F50 A;  4IR1 A;  2NVX A;  3C0F B;  2OH2 A;  2C28 A;  4O3R A;  1N56 A;  5FPO A;  2R8H A;  1B6S A;  4ED3 A;  4A3E G;  4CC5 A;  2FKL A;  2W6O A;  5EZY F;  3T5J A;  3K3V A;  5A2Q W;  3T5L A;  4A3J G;  2NU7 B;  4DV5 H;  1PK8 A;  2OWO A;  2W8L A;  5DG7 A;  4IHJ F;  1WCM G;  5KG1 A;  4A3L G;  2W6Q A;  1R9T A;  3RB4 A;  5KFY A;  4J0M A;  1E4E A;  4IWY A;  5FD5 A;  3RFC A;  4ED2 A;  5L1I A;  4LFC H;  3Q1K A;  3KHH A;  5BR8 H;  2CKZ B;  4MV8 A;  4B3S H;  1E4E B;  4Q43 A;  5DG9 A;  3RJ0 A;  4MA5 A;  3KTM A;  1DV1 A;  2RGV A;  5IP9 G;  1W96 A;  4TV9 F;  1WCM A;  1GO3 E;  5F9N A;  4ED0 A;  3KAJ A;  4DR2 H;  2V59 A;  4RB1 A;  4X65 H;  2J9G A;  2BQU A;  1KC7 A;  1RYS A;  4O4L F;  4JI4 H;  1SFO A;  3V4S A;  4BBR G;  2PBZ A;  1ZQ7 A;  3BA9 A;  2RDJ A;  2R7N A;  1EUD B;  1EZ1 A;  4UCU A;  1IOV A;  3RAX A;  4A3D G;  4ED6 A;  3GV5 B;  1V51 A;  3ETH A;  4E4T A;  4I7H A;  4F4Z A;  2ASL A;  1IBM H;  1N48 A;  1UNN C;  1VBH A;  2I80 A;  2ZM6 H;  2J6S A;  4HR7 A;  3V6H A;  2RGR A;  4TUY F;  2ASD A;  3ETJ A;  2JA5 A;  4GLX A;  5DGB A;  4DL4 A;  1TA8 A;  1JLL B;  3Q8R B;  3V6K A;  3TQT A;  4BBS G;  1KJ9 A;  3QZ8 A;  3KHL A;  4DUZ H;  5DQG A;  3H0G G;  4DV2 H;  2FLN A;  4RNN A;  4MV9 A;  2VR1 A;  4DL2 A;  1VS0 A;  3GIL A;  4LFA H;  4FS2 A;  3MR6 A;  1BXR A;  2YZG A;  1K1S A;  4AYB A;  4DLK A;  4IRK A;  4YBZ B;  1TWG A;  4YR2 A;  4HQ6 A;  5KFU A;  1Y1V G;  2W6P A;  4J9L A;  4DR7 H;  4ETS A;  4YR3 A;  2UVU A;  4YB8 B;  2FK3 A;  4LF7 H;  2UVV A;  5K2M A;  3G8C A;  4A3I G;  2W9A A;  1M0T A;  2ZDQ A;  4A93 G;  2R87 A;  3GIK A;  2VOB A;  4XYM B;  2HVS A;  4O3Q A;  1BGW A;  4MTE A;  1VKZ A;  2DPJ A;  2I87 A;  5LXT F;  1C3O A;  3N40 P;  1WSC A;  4O3N A;  2XC9 A;  1KJI A;  2NUA B;  5KFX A;  1GLV A;  4YHH H;  2W8K A;  1T36 A;  5LA6 F;  3IG0 A;  4EG0 A;  3RGX A;  3EPG A;  4ZI7 F;  4EFB A;  3M4I A;  5KFT A;  4TQS A;  5FPR A;  3PW4 A;  3RB0 A;  4ED8 A;  3BQ2 A;  1B33 N;  2I8C A;  4JI2 H;  3RIZ A;  5KFK A;  1S0N A;  3PO2 G;  1S03 G;  1ZET A;  3MR5 A;  1M0W A;  1M6V A;  2R86 A;  5IP7 G;  3OSP A;  3BA8 A;  3PW5 A;  1K83 A;  1KJ8 A;  3N8D A;  4MA0 A;  1A9X A;  5FLX W;  3N6X A;  3WO0 A;  5CA1 F;  5C44 G;  3GV7 B;  1DV2 A;  5KT5 A;  3K5H A;  1N36 H;  2JEG A;  2JEJ A;  1AN7 A;  4YR0 A;  4JV0 A;  3F8N A;  4O3O A;  3TIG A;  1XNR H;  3FDS A;  4XYL B;  2UXC H;  1WR2 A;  1TAE A;  5KFC A;  2YU9 A;  2DWC A;  3FKI G;  4UCR A;  4EEY A;  1VBG A;  5KFE A;  2AGP A;  4NXN H;  1IOW A;  2PMZ E;  2YZM A;  5J2U F;  1GSH A;  4JV1 A;  1KEE A;  2JA6 A;  5KFR A;  4HNT A;  1ULZ A;  3FMA A;  4M7E A;  2VQD A;  2J6U A;  4LH6 A;  2Q2U A;  1RK6 A;  2Q2T A;  2IBK A;  5KFQ A;  2CZG A;  4HYK A;  1V9P A;  5IYZ F;  2R93 A;  4WD3 A;  4UCV A;  2DIK A; 
#chains in the Genus database with same CATH homology
 1XNQ H;  3KAJ A;  4RAY A;  4DR2 H;  3T1Y H;  4LH7 A;  2FE3 A;  4RB1 A;  2VQF H;  1WH2 A;  2UUC H;  3KAL A;  4X65 H;  4DR1 H;  3T1H H;  4UCS A;  4B3M H;  4OX9 H;  4JI6 H;  4NXM H;  4A2A A;  4JYA H;  4JI4 H;  4X66 H;  2WYO A;  3PN1 A;  4DUY H;  4JI8 H;  4LF6 H;  4LF8 H;  3BAB A;  3BA9 A;  2UXB H;  1O75 A;  4A2B A;  4UCU A;  4EFE A;  4BWS C;  3L4J A;  1B04 A;  3CVZ A;  1IBL H;  4JV5 H;  1HNZ H;  1ZHQ A;  4I7H A;  1IBM H;  4RB2 C;  5IT9 W;  4DR4 H;  2ZM6 H;  2KSW A;  4B3R H;  4GKJ H;  1GYF A;  1E4F T;  1S68 A;  2RGR A;  4RAZ A;  4GLX A;  4MV7 A;  3J80 W;  1TA8 A;  4LSA A;  5EOY A;  3UQ8 A;  4YY3 H;  4LF5 H;  4DR3 H;  4DUZ H;  2WDT A;  5D1P A;  4DV2 H;  2HVR A;  2XIG A;  4MV9 A;  1N32 H;  1VS0 A;  2CW8 A;  3KXY T;  4DV7 H;  4LFA H;  2MCT A;  2F4V H;  4JI3 H;  1SEI A;  1SYX B;  1Z2P X;  4RZQ A;  1X9N A;  3OTO H;  4R7R A;  4DV3 H;  4RB3 C;  3MWM A;  4CC6 A;  1DGS A;  4UFZ A;  4ETS A;  4LF9 H;  4DR7 H;  4DV6 H;  4LF7 H;  2WE6 A;  1M0T A;  1MZB A;  2HGS A;  3JSL A;  3JAM W;  5LL6 b;  1Z2N X;  1I94 H;  4UCO A;  2O03 A;  3N41 B;  2VOB A;  3EYY A;  3KAK A;  3H20 A;  4LFB H;  1BJT A;  5D1O A;  2HVS A;  3BAA A;  4JI1 H;  4JI5 H;  1BGW A;  4MTE A;  4X64 H;  4MTD A;  1HNX H;  4KHP H;  1XDN A;  3N40 P;  3N42 B;  3LML A;  4YHH H;  1I6U A;  5LMN H;  4K0K H;  5FD6 A;  4GKK H;  3RGX A;  3IG0 A;  4DV4 H;  1FJG H;  4EFB A;  3M4I A;  5FPR A;  4LSX A;  4LF4 H;  1N34 H;  2ZJT A;  2UU9 H;  4B3T H;  2HVQ A;  3RIZ A;  1P8L A;  4JI2 H;  3JSN A;  1FKA H;  3N43 B;  1S03 G;  2E5L H;  4LMY A;  1M0W A;  3HXL A;  1HR0 H;  2VPS A;  1Z2O X;  4JI0 H;  3BA8 A;  4APM A;  5FLX W;  2UXD H;  2UUB H;  3N6X A;  2CW7 A;  3RGZ A;  3C0F B;  1XMO H;  3L2P A;  1N36 H;  3J7A K;  5FPO A;  1L2Z A;  1AN7 A;  4CC5 A;  2YCH A;  3F8N A;  1XNR H;  2W57 A;  3K3V A;  4EEQ A;  5A2Q W;  2UXC H;  4DV5 H;  1E4G T;  1TAE A;  1IBK H;  2OWO A;  3DF7 A;  4UCR A;  4AQY H;  4DR5 H;  3L4K A;  3J81 W;  4JI7 H;  4PDB A;  4RB0 A;  2VUG A;  4NXN H;  3N44 B;  3RF2 A;  1FVI A;  2VQE H;  4IAJ A;  2HHH H;  1HNW H;  4DV0 H;  5IWA H;  4FM9 A;  3RTX A;  3FMA A;  4J0M A;  5LMU H;  4M7E A;  5FD5 A;  1ZHS A;  4LFC H;  4X62 H;  4LH6 A;  5D1O B;  1J5E H;  2Q2U A;  5BR8 H;  4B3S H;  2Q2T A;  2UUA H;  1A0I A;  1V9P A;  4UCT A;  3RJ0 A;  4DV1 H;  1XMQ H;  4DR6 H;  1N33 H;  2RGV A;  4UCV A;  4Q0Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...