1WH2A

Solution structure of the gyf domain of a hypothetical protein from arabidopsis thaliana
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
78
structure length
78
Chain Sequence
GSSGSSGVRVLSYDKEKLNWLYKDPQGLVQGPFSLTQLKAWSDAEYFTKQFRVWMTGESMESAVLLTDVLRLSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein At5g08430
publication title Solution structure of the GYF domain of a hypothetical protein from Arabidopsis thaliana
rcsb
source organism Arabidopsis thaliana
molecule tags Structural genomics, unknown function
total genus 11
structure length 78
sequence length 78
ec nomenclature
pdb deposition date 2004-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02213 GYF GYF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1490.40 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 1wh2A01
3K3VA 1GYFA 3FMAA 4BWSC 1SYXB 1L2ZA 1WH2A
chains in the Genus database with same CATH superfamily
3HB9A 2FLNA 5KFAA 5KFIA 3MWEA 3NGDA 2V4RA 2W9AA 1JDEA 4LFBH 1AN7A 4DL4A 4GKJH 1K83A 1JLLB 4O3PA 2ZDHA 2OWOA 2R8GA 1DV1A 1AUXA 1TA8A 5FLXW 2E2HA 4RZRA 5BMVF 2JA7G 2J9GA 4LSXA 1W96A 3GIPA 1IBMH 4PDBA 4TUYF 3FMAA 1EYZA 5KFYA 2PMZA 3GTPA 4J0MA 3PVXA 3KAKA 4MV8A 3H20A 1BXRA 3Q2OA 4RNMA 2UU9H 1PX2A 2VPQA 3N6XA 3WO1A 3LP8A 5T14A 4GC7A 4EFBA 1KEEA 2YL2A 4IRCA 2SCUB 1P8LA 1KJ9A 1E4FT 4LF5H 3F8NA 2W6QA 1KJIA 4IAJA 5KKNB 3Q8RB 2NUAB 4QWCA 4JI3H 4ED0A 1WR2A 2IP4A 5KG3A 1GO3E 1KJ8A 3UFXB 3V6JA 4EFEA 2GPSA 4B3MH 4EEQA 2PBZA 3BABA 4CC5A 2MCTA 1C3OA 1TAEA 2R7ZG 2Q2UA 3GTJA 2CW7A 1ZETA 4EYHB 2E5LH 1CQJB 4X62H 5JVLA 4O3SA 2I8CA 4YB8B 5KFFA 5J2TF 4JI2H 5DG9A 3PW2A 1N56A 4ECVA 4JV1A 4LF7H 3N44B 4ECRA 2NU6B 1ZQ7A 3R5HA 2WB1A 4MAMA 3BQ1A 1S0NA 2DPIA 2GPWA 2YCHA 4DL2A 2UUCH 3VPCA 5EOYA 3BA9A 3RB0A 3HOZG 4A3LG 3RGXA 2F4VH 4LFAH 4EBEA 4YR2A 3HOXG 5C5JA 4RUCA 3H0GG 2ASDA 3U9SA 2NVYA 3PR4A 1XNRH 4F4ZA 5DLGA 3RAXA 5FJ8G 2R7MA 2XCAA 4O3QA 5EWEA 3GIJA 2JEGA 1Z2NX 4Q8FA 3BQ2A 2RDIA 4ME6A 5I47A 4MTDA 1KC7A 4JI6H 1N33H 3TIGA 3OSNA 3N40P 3N8DA 5FD6A 2R8HA 4DV4H 2QYZA 5EDWA 5A2QW 4X65H 4A3DG 1IBLH 3RF2A 3EYYA 4EEYA 3PN1A 3KTMA 4ECUA 3VPBA 3KHHA 3PW7A 2PN1A 1RYSA 4B3RH 4K0KH 1K1QA 5L1KA 1WCMA 2RDJA 1S10A 3RB6A 3RIZA 4JV5H 2UVWA 1CQIB 2UXCH 4WD3A 1O75A 3E5NA 5KT4A 2X0SA 3JSNA 5F9LA 3OUUA 2WB1E 4JUZA 4J9PA 2BQRA 2JA6A 4C5BA 4HNUA 2AU0A 1I3QA 1BJTA 1TWAA 4ETSA 1E4EA 4YAJB 4EYIB 2Q2TA 4FBUA 3BG5A 4ZQIA 2UXDH 2W6ZA 4ECZA 5FPRA 2FE3A 4DR7H 2VOBA 4UFZA 4WBNF 5KFWA 4DV7H 1ZHQA 4A3JG 2O03A 2VUMA 4LF6H 1A0IA 1B6RA 4ECTA 2HVRA 4DR2H 4RB2C 4X64H 2HJWA 4Q43A 1V4YA 2YRWA 5KFJA 2P0AA 3J80W 2R7NA 5KFMA 3J81W 4EBCA 4ECXA 2W9CB 3TQ1A 5L1JA 3KXYT 1I7LA 1V9PA 2UUBH 1SCUB 3JZIA 2AGOA 2R87A 2W57A 5GONF 5KG7A 4UCTA 4A3KG 4F4YA 3TINA 4ECYA 3GTGA 4KHPH 1FVIA 4LMYA 3VPDA 2HGSA 3T1HH 1FKAH 3V6KA 4JI5H 4A2BA 4M7EA 1S0OA 1XDNA 3I12A 2FPIB 3PO3G 4DR3H 1CE8A 3BJYA 1V51A 3K3PA 1GSHA 1BNCA 3K5HA 2UUAH 1GSAA 1X9NA 5LXTF 4J9KA 4UCOA 1N36H 4DLKA 2W6OA 4ECWA 5C3EG 1W93A 4IZOA 1RYRA 4A3MG 2FMAA 2FLLA 1UC8A 4FU0A 5IWAH 5IYDG 4YHHH 4A3EG 4XYMB 2YZNA 4ED3A 5IYCG 5DG7A 4I50F 3EPGA 4FM9A 1ZHSA 5KG2A 2GLTA 4ED6A 3FDSA 4J9QA 2M05A 4RB1A 1HNXH 3PW5A 2W7PA 1E4GT 3SE7A 1M6VA 5L1IA 1Z2PX 4DV0H 4YJ2F 3L2PA 3G8CA 4LF8H 1CS0A 2E2IA 3LWBA 4UCSA 1AUVA 1JDBB 1N48A 3GIIA 5EWFA 3MR2A 4O3NA 1T94A 2FJZA 1M0TA 3U9TA 5C1OA 3C0FB 1KBLA 3GTKA 1E4EB 2C28A 1GLVA 4HNVA 4QWAA 1KJQA 5KFOA 3H4BA 1Y1VA 1SFOA 4IRDA 1VBGA 5KG4A 5F9NA 2DZDA 4IR9A 2JEIA 4XYLB 4YY3H 3N42B 4JV2A 3T5HA 4LF9H 4IHJF 5KX5F 4ED8A 1B33N 3ETHA 3MR6A 3OHAA 1S97A 3KALA 2YW2A 4UCUA 5KFXA 2NU8B 4FS2A 4A3BG 5CAEB 5L1LA 5C8YF 3SI8A 5KFQA 2YZMA 1TWGA 3R23A 2JEJA 3HOYG 2FB9A 3JRXA 2R84A 4BWSC 2W71A 3GV8B 2RGRA 4OX9H 5IP7G 3HXLA 4DR1H 1B04A 2JA6G 3T1YH 4QW9A 4YR0A 2W9CA 4AYBA 4EGQA 2XC9A 2C2DA 4I4TF 1EHIA 3RUPA 5DGAA 1Y1WG 2VQEH 4GC6A 3EPIA 2XGQA 2FLPA 5BPHA 3KAJA 3LMLA 1XMOH 3PR5B 1XNQH 3T5LA 1DIKA 5DQHA 2W6NA 2J6UA 2QK4A 3OUZA 2VA3A 4MV6A 2VUMG 4DV1H 5KG5A 1OWTA 5EZYF 2B63A 3RV4A 1IOWA 2W7OA 1TWFA 5KT3A 3BA8A 3H40A 4BXXG 5FPOA 1Y14B 3MJFA 2DIKA 3Q8PB 3N43B 5KFLA 3G6VA 4RAYA 2I87A 3Q1KA 4O4LF 3T5KA 2AGQA 4QIWA 5KT6A 3GTQA 4B3TH 1M7JA 2FP4B 4DV6H 4O4HF 2WE6A 5CA1F 3GLKA 3ORQA 5KT7A 3MR5A 3GTLA 5CB4F 2W9BB 2R92A 2OH2A 5D8DA 1HNZH 1TWCA 2JA5G 2R8KA 4G3IA 1EUDB 3V4ZA 2FPGB 4ZOLF 2WYOA 5DQGA 4A3CG 3RFCA 1GGOA 5IP9G 4DUYH 4RNNA 1JKJB 3GTMA 1FJGH 5C4XG 2UXBH 1UC9A 5DQIA 4TQSA 3KHRA 4TQRA 4AYBE 4YAKB 1BGWA 3Q8QB 2XD4A 4NXMH 1VKZA 1RJRA 3I4MG 3IN5A 3FKIA 2CW8A 4YJ3F 3M9OB 2IBKA 2FK3A 5KFDA 2VPSA 4R8UA 2V4QA 1EUCB 2FPPB 3HBLA 3L4JA 4QWEA 4IWXA 4TV8F 5KFTA 5D1OB 5C44G 1I6UA 1JIHA 5KFHA 1JX4A 4R7RA 4HYKA 5KFNA 1Z2OX 2FK2A 4A3IG 4CC6A 3HKZA 4JYAH 1XMQH 2PVPA 4DV2H 3GV7B 2OLSA 3G6YA 3TIIA 2RGVA 4QIWE 5JVDF 5DG8A 4YP3A 4A3GG 2Y0SE 4YR3A 1IOVA 1Y1VG 4MV1A 4EG0A 5BR8H 4XZ3B 3MWMA 4I7HA 5L9XA 4DR4H 4B3SH 3KHGA 2FK1A 5KFRA 4JI0H 4A3FG 3RV3A 2CKZB 4DV3H 4O3OA 4NXNH 3ETJA 1MZBA 2WTFA 5LMUH 4FS1A 2JA8G 4BBRG 3M9NB 2VUGA 4QWBA 4DR5H 3R5XA 5JQWA 2JEFA 4RUAA 4MTEA 1RJQA 3WNZA 4X66H 2W8KA 1N34H 4RB3C 3PW4A 4HR7A 3K3VA 3RGZA 2RF4A 2XCLA 2ZJTA 4F4XA 3JAMW 4FBTA 5D1PA 4M9UA 4J9SA 3MR3A 4J9NA 3HOWG 1I50A 3GQCA 4RU9A 5C1PA 3OHBA 4QJFA 1J5EH 2HVSA 3RAQA 2BQUA 4JI4H 2R7KA 2R86A 1L2ZA 4Q44A 4LH7A 3QZ7A 2R8JA 4LF4H 1JXLA 3QZ8A 2BR0A 2W9BA 2C22A 4RAZA 2YS6A 3HKZE 3N41B 1S03G 1KJJA 1I7NA 2VR1A 2UVUA 2FKLA 2C2RA 3M4IA 4ZHQF 1T36A 2DWCA 2YYAA 3RTXA 4J9LA 4XX0B 2B63G 4RZQA 5KG6A 5KFVA 3RBEA 5FLMG 4C2MA 4YBZB 1DGSA 4R8UB 4ZI7F 1PK8A 5BPFA 3RJ0A 3M9MB 3BQ0A 2VA2A 4O2BF 5JH7F 3Q8SB 3GTOA 3MWDA 2ASJA 4IR1A 4ECQA 4F50A 4LH6A 5KFPA 4NLGA 4MV7A 3GV5B 2R92G 3AYHB 1S68A 2AQ4A 2V5AA 2UVVA 3BAAA 5KFSA 5D1OA 4F4WA 1WCMG 5HV6A 3UQ8A 2XCPA 4JI1H 4TV9F 3ORRA 2IA6A 2C00A 3G6XA 2WAQA 5KFZA 3L4KA 4AQYH 1S9FA 1EZ1A 2ZDGA 2XGPA 3CVZA 4E4TA 2HVQA 5KT2A 4Q45A 4BBSG 5LA6F 5LP6F 2ALZA 1RK6A 4O3RA 2R93A 1TWHA 3FKIG 4UCVA 2VQFH 1VS0A 1DV2A 3R5FA 4GLXA 5KG1A 4YQWA 3HOUG 5DLFA 4Y8VB 4MA5A 2YRXA 3HOVG 4DL7A 2AGPA 4BY1G 4HQ6A 2ATLA 5KG0A 2HHHH 1RK5A 2DPJA 4ED1A 2XIGA 4C5CA 4ECSA 2UVRA 4MV4A 4DUZH 1SYXB 4LFCH 2JA7A 4QW8A 4LSAA 2W6MA 2KSWA 2ASLA 4MV9A 4APMA 3DF7A 2J6TA 4PWQA 5HBRB 1IBKH 2Y0SA 5LMNH 2PMZE 2IMWP 3GIMA 4I55F 2CZGA 3VMMA 4RNOA 5FD5A 3V6HA 3RBDA 1I94H 1N32H 4DR6H 1M0WA 3H3VH 3GIDA 4O4IF 5JUMA 3RB4A 2ZDQA 3TQTA 2WDTA 2WAQE 4IRKA 4ED2A 5K2MA 4J9OA 4EBDA 1C30A 5IT9W 2NU7B 2V58A 4HNTA 2DLNA 2YZGA 4GKKH 2I80A 2R7ZA 1GSOA 2YS7A 4EGJA 4ED7A 4O2AF 4DL3A 4JI8H 3CQZA 4U7CA 2W8LA 1HNWH 4JI7H 3GIKA 2BQ3A 4MA0A 4DL5A 3I4NG 5H80A 3GILA 4IWYA 3V4SA 4J9RA 1WH2A 2C35B 2YU9A 5LYJF 2R6FA 3RB3A 3OSPA 4BY7G 1HR0H 3KHLA 3OTOH 3K5IA 3H4DA 2NVXA 1UNNC 1ULZA 5J2UF 1T3NA 1Y1WA 4MV3A 5CA0F 5KFKA 2ZM6H 1VAJA 3JRWA 1K1SA 4DV5H 4Q0YA 2V59A 1SEIA 2R82A 3H0GA 2W6PA 1GYFA 2C2EA 3T5JA 5KFCA 2R85A 2CQYA 2R8IA 2W70A 5KFBA 5KFEA 4C5AA 2J6SA 2VQDA 3GIQA 2NU9B 5EWGA 3PZPA 1R9TA 4JV0A 3PO2G 5LL6b 4QWDA 3PW0A 4A93G 1B6SA 1S0MA 5LOVF 2V9WA 4DL6A 3IG0A 1WSCA 4J9MA 3J7AK 5KFGA 4L1KA 2R7LA 1A9XA 5IYBG 4U6PA 3JSLA 3QFFA 5DGBA 5IYZF 3MFHA 3MFIA 4UCRA 3WO0A 1VBHA 5KFUA 4A2AA 2R93G 4Q8EA 5KT5A 4RB0A 2JA5A 1RJPA
chains in the Genus database with same CATH topology
4RAYA 2FE3A 5FPRA 2VOBA 4DR7H 4UFZA 4AQYH 3L4KA 4DV7H 1ZHQA 4B3TH 1AN7A 2O03A 4LFBH 4LF6H 1A0IA 4DV6H 2HVRA 4GKJH 3CVZA 4DR2H 2HVQA 2WE6A 4X64H 4RB2C 2OWOA 1TA8A 5FLXW 1HNZH 3J80W 3J81W 4LSXA 4UCVA 3KXYT 1VS0A 2VQFH 1IBMH 4GLXA 1V9PA 2UUBH 4PDBA 2WYOA 3FMAA 2W57A 4UCTA 4J0MA 4KHPH 4DUYH 1FVIA 1FJGH 3KAKA 4LMYA 2HGSA 3H20A 3T1HH 1FKAH 2HHHH 2UU9H 4JI5H 2UXBH 3N6XA 4A2BA 1BGWA 2XIGA 4NXMH 4M7EA 4EFBA 4DUZH 1SYXB 1XDNA 4LFCH 1P8LA 4DR3H 2CW8A 1E4FT 4LSAA 2UUAH 4LF5H 3F8NA 2KSWA 2VPSA 4IAJA 1X9NA 4MV9A 4APMA 3L4JA 3DF7A 4UCOA 1N36H 4JI3H 1IBKH 1I6UA 5D1OB 5LMNH 4EFEA 4R7RA 4B3MH 1Z2OX 4EEQA 3BABA 4CC5A 5FD5A 4CC6A 5IWAH 4YHHH 1I94H 1N32H 4JYAH 2MCTA 1XMQH 1TAEA 1M0WA 2Q2UA 4DR6H 2CW7A 4DV2H 4FM9A 1ZHSA 4X62H 4RB1A 4JI2H 1HNXH 2RGVA 2WDTA 1E4GT 4DV0H 1Z2PX 5BR8H 3L2PA 4LF7H 4LF8H 3N44B 5IT9W 3MWMA 4I7HA 4UCSA 4DR4H 4B3SH 4GKKH 4JI0H 4DV3H 4NXNH 4JI8H 1HNWH 1M0TA 1MZBA 2YCHA 5LMUH 3C0FB 4JI7H 2UUCH 4DR5H 2VUGA 5EOYA 3BA9A 3RGXA 2F4VH 4MTEA 4YY3H 1N34H 4X66H 3N42B 1WH2A 4LFAH 4RB3C 4LF9H 3K3VA 3RGZA 2ZJTA 3KALA 4UCUA 1HR0H 3JAMW 1XNRH 3OTOH 5D1PA 1Z2NX 2HVSA 1J5EH 4JI4H 2ZM6H 4MTDA 4BWSC 2RGRA 4JI6H 1N33H 1L2ZA 4OX9H 4LH7A 4DV5H 3N40P 4Q0YA 5FD6A 4LF4H 4DV4H 3HXLA 1S03G 1SEIA 3N41B 4RAZA 4DR1H 1GYFA 1B04A 5A2QW 3T1YH 4X65H 1IBLH 3RF2A 3M4IA 3EYYA 3RTXA 4RZQA 3PN1A 2VQEH 4B3RH 4K0KH 5LL6b 1DGSA 3KAJA 3LMLA 1XMOH 1XNQH 3RIZA 4JV5H 3RJ0A 2UXCH 3IG0A 1O75A 2E5LH 3JSNA 4DV1H 3J7AK 3JSLA 4LH6A 4MV7A 4UCRA 1BJTA 1S68A 4ETSA 3BAAA 3BA8A 4A2AA 5D1OA 2Q2TA 5FPOA 3UQ8A 2UXDH 4JI1H 3N43B 4RB0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3K3V A;  1GYF A;  3FMA A;  4BWS C;  1SYX B;  1L2Z A;  1WH2 A; 
#chains in the Genus database with same CATH topology
 3HB9 A;  2FLN A;  5KFA A;  5KFI A;  3MWE A;  3NGD A;  2V4R A;  2W9A A;  1JDE A;  4LFB H;  1AN7 A;  4DL4 A;  4GKJ H;  1K83 A;  1JLL B;  4O3P A;  2ZDH A;  2OWO A;  2R8G A;  1DV1 A;  1AUX A;  1TA8 A;  5FLX W;  2E2H A;  4RZR A;  5BMV F;  2JA7 G;  2J9G A;  4LSX A;  1W96 A;  3GIP A;  1IBM H;  4PDB A;  4TUY F;  3FMA A;  1EYZ A;  5KFY A;  2PMZ A;  3GTP A;  4J0M A;  3PVX A;  3KAK A;  4MV8 A;  3H20 A;  1BXR A;  3Q2O A;  4RNM A;  2UU9 H;  1PX2 A;  2VPQ A;  3N6X A;  3WO1 A;  3LP8 A;  5T14 A;  4GC7 A;  4EFB A;  1KEE A;  2YL2 A;  4IRC A;  2SCU B;  1P8L A;  1KJ9 A;  1E4F T;  4LF5 H;  3F8N A;  2W6Q A;  1KJI A;  4IAJ A;  5KKN B;  3Q8R B;  2NUA B;  4QWC A;  4JI3 H;  4ED0 A;  1WR2 A;  2IP4 A;  5KG3 A;  1GO3 E;  1KJ8 A;  3UFX B;  3V6J A;  4EFE A;  2GPS A;  4B3M H;  4EEQ A;  2PBZ A;  3BAB A;  4CC5 A;  2MCT A;  1C3O A;  1TAE A;  2R7Z G;  2Q2U A;  3GTJ A;  2CW7 A;  1ZET A;  4EYH B;  2E5L H;  1CQJ B;  4X62 H;  5JVL A;  4O3S A;  2I8C A;  4YB8 B;  5KFF A;  5J2T F;  4JI2 H;  5DG9 A;  3PW2 A;  1N56 A;  4ECV A;  4JV1 A;  4LF7 H;  3N44 B;  4ECR A;  2NU6 B;  1ZQ7 A;  3R5H A;  2WB1 A;  4MAM A;  3BQ1 A;  1S0N A;  2DPI A;  2GPW A;  2YCH A;  4DL2 A;  2UUC H;  3VPC A;  5EOY A;  3BA9 A;  3RB0 A;  3HOZ G;  4A3L G;  3RGX A;  2F4V H;  4LFA H;  4EBE A;  4YR2 A;  3HOX G;  5C5J A;  4RUC A;  3H0G G;  2ASD A;  3U9S A;  2NVY A;  3PR4 A;  1XNR H;  4F4Z A;  5DLG A;  3RAX A;  5FJ8 G;  2R7M A;  2XCA A;  4O3Q A;  5EWE A;  3GIJ A;  2JEG A;  1Z2N X;  4Q8F A;  3BQ2 A;  2RDI A;  4ME6 A;  5I47 A;  4MTD A;  1KC7 A;  4JI6 H;  1N33 H;  3TIG A;  3OSN A;  3N40 P;  3N8D A;  5FD6 A;  2R8H A;  4DV4 H;  2QYZ A;  5EDW A;  5A2Q W;  4X65 H;  4A3D G;  1IBL H;  3RF2 A;  3EYY A;  4EEY A;  3PN1 A;  3KTM A;  4ECU A;  3VPB A;  3KHH A;  3PW7 A;  2PN1 A;  1RYS A;  4B3R H;  4K0K H;  1K1Q A;  5L1K A;  1WCM A;  2RDJ A;  1S10 A;  3RB6 A;  3RIZ A;  4JV5 H;  2UVW A;  1CQI B;  2UXC H;  4WD3 A;  1O75 A;  3E5N A;  5KT4 A;  2X0S A;  3JSN A;  5F9L A;  3OUU A;  2WB1 E;  4JUZ A;  4J9P A;  2BQR A;  2JA6 A;  4C5B A;  4HNU A;  2AU0 A;  1I3Q A;  1BJT A;  1TWA A;  4ETS A;  1E4E A;  4YAJ B;  4EYI B;  2Q2T A;  4FBU A;  3BG5 A;  4ZQI A;  2UXD H;  2W6Z A;  4ECZ A;  5FPR A;  2FE3 A;  4DR7 H;  2VOB A;  4UFZ A;  4WBN F;  5KFW A;  4DV7 H;  1ZHQ A;  4A3J G;  2O03 A;  2VUM A;  4LF6 H;  1A0I A;  1B6R A;  4ECT A;  2HVR A;  4DR2 H;  4RB2 C;  4X64 H;  2HJW A;  4Q43 A;  1V4Y A;  2YRW A;  5KFJ A;  2P0A A;  3J80 W;  2R7N A;  5KFM A;  3J81 W;  4EBC A;  4ECX A;  2W9C B;  3TQ1 A;  5L1J A;  3KXY T;  1I7L A;  1V9P A;  2UUB H;  1SCU B;  3JZI A;  2AGO A;  2R87 A;  2W57 A;  5GON F;  5KG7 A;  4UCT A;  4A3K G;  4F4Y A;  3TIN A;  4ECY A;  3GTG A;  4KHP H;  1FVI A;  4LMY A;  3VPD A;  2HGS A;  3T1H H;  1FKA H;  3V6K A;  4JI5 H;  4A2B A;  4M7E A;  1S0O A;  1XDN A;  3I12 A;  2FPI B;  3PO3 G;  4DR3 H;  1CE8 A;  3BJY A;  1V51 A;  3K3P A;  1GSH A;  1BNC A;  3K5H A;  2UUA H;  1GSA A;  1X9N A;  5LXT F;  4J9K A;  4UCO A;  1N36 H;  4DLK A;  2W6O A;  4ECW A;  5C3E G;  1W93 A;  4IZO A;  1RYR A;  4A3M G;  2FMA A;  2FLL A;  1UC8 A;  4FU0 A;  5IWA H;  5IYD G;  4YHH H;  4A3E G;  4XYM B;  2YZN A;  4ED3 A;  5IYC G;  5DG7 A;  4I50 F;  3EPG A;  4FM9 A;  1ZHS A;  5KG2 A;  2GLT A;  4ED6 A;  3FDS A;  4J9Q A;  2M05 A;  4RB1 A;  1HNX H;  3PW5 A;  2W7P A;  1E4G T;  3SE7 A;  1M6V A;  5L1I A;  1Z2P X;  4DV0 H;  4YJ2 F;  3L2P A;  3G8C A;  4LF8 H;  1CS0 A;  2E2I A;  3LWB A;  4UCS A;  1AUV A;  1JDB B;  1N48 A;  3GII A;  5EWF A;  3MR2 A;  4O3N A;  1T94 A;  2FJZ A;  1M0T A;  3U9T A;  5C1O A;  3C0F B;  1KBL A;  3GTK A;  1E4E B;  2C28 A;  1GLV A;  4HNV A;  4QWA A;  1KJQ A;  5KFO A;  3H4B A;  1Y1V A;  1SFO A;  4IRD A;  1VBG A;  5KG4 A;  5F9N A;  2DZD A;  4IR9 A;  2JEI A;  4XYL B;  4YY3 H;  3N42 B;  4JV2 A;  3T5H A;  4LF9 H;  4IHJ F;  5KX5 F;  4ED8 A;  1B33 N;  3ETH A;  3MR6 A;  3OHA A;  1S97 A;  3KAL A;  2YW2 A;  4UCU A;  5KFX A;  2NU8 B;  4FS2 A;  4A3B G;  5CAE B;  5L1L A;  5C8Y F;  3SI8 A;  5KFQ A;  2YZM A;  1TWG A;  3R23 A;  2JEJ A;  3HOY G;  2FB9 A;  3JRX A;  2R84 A;  4BWS C;  2W71 A;  3GV8 B;  2RGR A;  4OX9 H;  5IP7 G;  3HXL A;  4DR1 H;  1B04 A;  2JA6 G;  3T1Y H;  4QW9 A;  4YR0 A;  2W9C A;  4AYB A;  4EGQ A;  2XC9 A;  2C2D A;  4I4T F;  1EHI A;  3RUP A;  5DGA A;  1Y1W G;  2VQE H;  4GC6 A;  3EPI A;  2XGQ A;  2FLP A;  5BPH A;  3KAJ A;  3LML A;  1XMO H;  3PR5 B;  1XNQ H;  3T5L A;  1DIK A;  5DQH A;  2W6N A;  2J6U A;  2QK4 A;  3OUZ A;  2VA3 A;  4MV6 A;  2VUM G;  4DV1 H;  5KG5 A;  1OWT A;  5EZY F;  2B63 A;  3RV4 A;  1IOW A;  2W7O A;  1TWF A;  5KT3 A;  3BA8 A;  3H40 A;  4BXX G;  5FPO A;  1Y14 B;  3MJF A;  2DIK A;  3Q8P B;  3N43 B;  5KFL A;  3G6V A;  4RAY A;  2I87 A;  3Q1K A;  4O4L F;  3T5K A;  2AGQ A;  4QIW A;  5KT6 A;  3GTQ A;  4B3T H;  1M7J A;  2FP4 B;  4DV6 H;  4O4H F;  2WE6 A;  5CA1 F;  3GLK A;  3ORQ A;  5KT7 A;  3MR5 A;  3GTL A;  5CB4 F;  2W9B B;  2R92 A;  2OH2 A;  5D8D A;  1HNZ H;  1TWC A;  2JA5 G;  2R8K A;  4G3I A;  1EUD B;  3V4Z A;  2FPG B;  4ZOL F;  2WYO A;  5DQG A;  4A3C G;  3RFC A;  1GGO A;  5IP9 G;  4DUY H;  4RNN A;  1JKJ B;  3GTM A;  1FJG H;  5C4X G;  2UXB H;  1UC9 A;  5DQI A;  4TQS A;  3KHR A;  4TQR A;  4AYB E;  4YAK B;  1BGW A;  3Q8Q B;  2XD4 A;  4NXM H;  1VKZ A;  1RJR A;  3I4M G;  3IN5 A;  3FKI A;  2CW8 A;  4YJ3 F;  3M9O B;  2IBK A;  2FK3 A;  5KFD A;  2VPS A;  4R8U A;  2V4Q A;  1EUC B;  2FPP B;  3HBL A;  3L4J A;  4QWE A;  4IWX A;  4TV8 F;  5KFT A;  5D1O B;  5C44 G;  1I6U A;  1JIH A;  5KFH A;  1JX4 A;  4R7R A;  4HYK A;  5KFN A;  1Z2O X;  2FK2 A;  4A3I G;  4CC6 A;  3HKZ A;  4JYA H;  1XMQ H;  2PVP A;  4DV2 H;  3GV7 B;  2OLS A;  3G6Y A;  3TII A;  2RGV A;  4QIW E;  5JVD F;  5DG8 A;  4YP3 A;  4A3G G;  2Y0S E;  4YR3 A;  1IOV A;  1Y1V G;  4MV1 A;  4EG0 A;  5BR8 H;  4XZ3 B;  3MWM A;  4I7H A;  5L9X A;  4DR4 H;  4B3S H;  3KHG A;  2FK1 A;  5KFR A;  4JI0 H;  4A3F G;  3RV3 A;  2CKZ B;  4DV3 H;  4O3O A;  4NXN H;  3ETJ A;  1MZB A;  2WTF A;  5LMU H;  4FS1 A;  2JA8 G;  4BBR G;  3M9N B;  2VUG A;  4QWB A;  4DR5 H;  3R5X A;  5JQW A;  2JEF A;  4RUA A;  4MTE A;  1RJQ A;  3WNZ A;  4X66 H;  2W8K A;  1N34 H;  4RB3 C;  3PW4 A;  4HR7 A;  3K3V A;  3RGZ A;  2RF4 A;  2XCL A;  2ZJT A;  4F4X A;  3JAM W;  4FBT A;  5D1P A;  4M9U A;  4J9S A;  3MR3 A;  4J9N A;  3HOW G;  1I50 A;  3GQC A;  4RU9 A;  5C1P A;  3OHB A;  4QJF A;  1J5E H;  2HVS A;  3RAQ A;  2BQU A;  4JI4 H;  2R7K A;  2R86 A;  1L2Z A;  4Q44 A;  4LH7 A;  3QZ7 A;  2R8J A;  4LF4 H;  1JXL A;  3QZ8 A;  2BR0 A;  2W9B A;  2C22 A;  4RAZ A;  2YS6 A;  3HKZ E;  3N41 B;  1S03 G;  1KJJ A;  1I7N A;  2VR1 A;  2UVU A;  2FKL A;  2C2R A;  3M4I A;  4ZHQ F;  1T36 A;  2DWC A;  2YYA A;  3RTX A;  4J9L A;  4XX0 B;  2B63 G;  4RZQ A;  5KG6 A;  5KFV A;  3RBE A;  5FLM G;  4C2M A;  4YBZ B;  1DGS A;  4R8U B;  4ZI7 F;  1PK8 A;  5BPF A;  3RJ0 A;  3M9M B;  3BQ0 A;  2VA2 A;  4O2B F;  5JH7 F;  3Q8S B;  3GTO A;  3MWD A;  2ASJ A;  4IR1 A;  4ECQ A;  4F50 A;  4LH6 A;  5KFP A;  4NLG A;  4MV7 A;  3GV5 B;  2R92 G;  3AYH B;  1S68 A;  2AQ4 A;  2V5A A;  2UVV A;  3BAA A;  5KFS A;  5D1O A;  4F4W A;  1WCM G;  5HV6 A;  3UQ8 A;  2XCP A;  4JI1 H;  4TV9 F;  3ORR A;  2IA6 A;  2C00 A;  3G6X A;  2WAQ A;  5KFZ A;  3L4K A;  4AQY H;  1S9F A;  1EZ1 A;  2ZDG A;  2XGP A;  3CVZ A;  4E4T A;  2HVQ A;  5KT2 A;  4Q45 A;  4BBS G;  5LA6 F;  5LP6 F;  2ALZ A;  1RK6 A;  4O3R A;  2R93 A;  1TWH A;  3FKI G;  4UCV A;  2VQF H;  1VS0 A;  1DV2 A;  3R5F A;  4GLX A;  5KG1 A;  4YQW A;  3HOU G;  5DLF A;  4Y8V B;  4MA5 A;  2YRX A;  3HOV G;  4DL7 A;  2AGP A;  4BY1 G;  4HQ6 A;  2ATL A;  5KG0 A;  2HHH H;  1RK5 A;  2DPJ A;  4ED1 A;  2XIG A;  4C5C A;  4ECS A;  2UVR A;  4MV4 A;  4DUZ H;  1SYX B;  4LFC H;  2JA7 A;  4QW8 A;  4LSA A;  2W6M A;  2KSW A;  2ASL A;  4MV9 A;  4APM A;  3DF7 A;  2J6T A;  4PWQ A;  5HBR B;  1IBK H;  2Y0S A;  5LMN H;  2PMZ E;  2IMW P;  3GIM A;  4I55 F;  2CZG A;  3VMM A;  4RNO A;  5FD5 A;  3V6H A;  3RBD A;  1I94 H;  1N32 H;  4DR6 H;  1M0W A;  3H3V H;  3GID A;  4O4I F;  5JUM A;  3RB4 A;  2ZDQ A;  3TQT A;  2WDT A;  2WAQ E;  4IRK A;  4ED2 A;  5K2M A;  4J9O A;  4EBD A;  1C30 A;  5IT9 W;  2NU7 B;  2V58 A;  4HNT A;  2DLN A;  2YZG A;  4GKK H;  2I80 A;  2R7Z A;  1GSO A;  2YS7 A;  4EGJ A;  4ED7 A;  4O2A F;  4DL3 A;  4JI8 H;  3CQZ A;  4U7C A;  2W8L A;  1HNW H;  4JI7 H;  3GIK A;  2BQ3 A;  4MA0 A;  4DL5 A;  3I4N G;  5H80 A;  3GIL A;  4IWY A;  3V4S A;  4J9R A;  1WH2 A;  2C35 B;  2YU9 A;  5LYJ F;  2R6F A;  3RB3 A;  3OSP A;  4BY7 G;  1HR0 H;  3KHL A;  3OTO H;  3K5I A;  3H4D A;  2NVX A;  1UNN C;  1ULZ A;  5J2U F;  1T3N A;  1Y1W A;  4MV3 A;  5CA0 F;  5KFK A;  2ZM6 H;  1VAJ A;  3JRW A;  1K1S A;  4DV5 H;  4Q0Y A;  2V59 A;  1SEI A;  2R82 A;  3H0G A;  2W6P A;  1GYF A;  2C2E A;  3T5J A;  5KFC A;  2R85 A;  2CQY A;  2R8I A;  2W70 A;  5KFB A;  5KFE A;  4C5A A;  2J6S A;  2VQD A;  3GIQ A;  2NU9 B;  5EWG A;  3PZP A;  1R9T A;  4JV0 A;  3PO2 G;  5LL6 b;  4QWD A;  3PW0 A;  4A93 G;  1B6S A;  1S0M A;  5LOV F;  2V9W A;  4DL6 A;  3IG0 A;  1WSC A;  4J9M A;  3J7A K;  5KFG A;  4L1K A;  2R7L A;  1A9X A;  5IYB G;  4U6P A;  3JSL A;  3QFF A;  5DGB A;  5IYZ F;  3MFH A;  3MFI A;  4UCR A;  3WO0 A;  1VBH A;  5KFU A;  4A2A A;  2R93 G;  4Q8E A;  5KT5 A;  4RB0 A;  2JA5 A;  1RJP A; 
#chains in the Genus database with same CATH homology
 4RAY A;  2FE3 A;  5FPR A;  2VOB A;  4DR7 H;  4UFZ A;  4AQY H;  3L4K A;  4DV7 H;  1ZHQ A;  4B3T H;  1AN7 A;  2O03 A;  4LFB H;  4LF6 H;  1A0I A;  4DV6 H;  2HVR A;  4GKJ H;  3CVZ A;  4DR2 H;  2HVQ A;  2WE6 A;  4X64 H;  4RB2 C;  2OWO A;  1TA8 A;  5FLX W;  1HNZ H;  3J80 W;  3J81 W;  4LSX A;  4UCV A;  3KXY T;  1VS0 A;  2VQF H;  1IBM H;  4GLX A;  1V9P A;  2UUB H;  4PDB A;  2WYO A;  3FMA A;  2W57 A;  4UCT A;  4J0M A;  4KHP H;  4DUY H;  1FVI A;  1FJG H;  3KAK A;  4LMY A;  2HGS A;  3H20 A;  3T1H H;  1FKA H;  2HHH H;  2UU9 H;  4JI5 H;  2UXB H;  3N6X A;  4A2B A;  1BGW A;  2XIG A;  4NXM H;  4M7E A;  4EFB A;  4DUZ H;  1SYX B;  1XDN A;  4LFC H;  1P8L A;  4DR3 H;  2CW8 A;  1E4F T;  4LSA A;  2UUA H;  4LF5 H;  3F8N A;  2KSW A;  2VPS A;  4IAJ A;  1X9N A;  4MV9 A;  4APM A;  3L4J A;  3DF7 A;  4UCO A;  1N36 H;  4JI3 H;  1IBK H;  1I6U A;  5D1O B;  5LMN H;  4EFE A;  4R7R A;  4B3M H;  1Z2O X;  4EEQ A;  3BAB A;  4CC5 A;  5FD5 A;  4CC6 A;  5IWA H;  4YHH H;  1I94 H;  1N32 H;  4JYA H;  2MCT A;  1XMQ H;  1TAE A;  1M0W A;  2Q2U A;  4DR6 H;  2CW7 A;  4DV2 H;  4FM9 A;  1ZHS A;  4X62 H;  4RB1 A;  4JI2 H;  1HNX H;  2RGV A;  2WDT A;  1E4G T;  4DV0 H;  1Z2P X;  5BR8 H;  3L2P A;  4LF7 H;  4LF8 H;  3N44 B;  5IT9 W;  3MWM A;  4I7H A;  4UCS A;  4DR4 H;  4B3S H;  4GKK H;  4JI0 H;  4DV3 H;  4NXN H;  4JI8 H;  1HNW H;  1M0T A;  1MZB A;  2YCH A;  5LMU H;  3C0F B;  4JI7 H;  2UUC H;  4DR5 H;  2VUG A;  5EOY A;  3BA9 A;  3RGX A;  2F4V H;  4MTE A;  4YY3 H;  1N34 H;  4X66 H;  3N42 B;  1WH2 A;  4LFA H;  4RB3 C;  4LF9 H;  3K3V A;  3RGZ A;  2ZJT A;  3KAL A;  4UCU A;  1HR0 H;  3JAM W;  1XNR H;  3OTO H;  5D1P A;  1Z2N X;  2HVS A;  1J5E H;  4JI4 H;  2ZM6 H;  4MTD A;  4BWS C;  2RGR A;  4JI6 H;  1N33 H;  1L2Z A;  4OX9 H;  4LH7 A;  4DV5 H;  3N40 P;  4Q0Y A;  5FD6 A;  4LF4 H;  4DV4 H;  3HXL A;  1S03 G;  1SEI A;  3N41 B;  4RAZ A;  4DR1 H;  1GYF A;  1B04 A;  5A2Q W;  3T1Y H;  4X65 H;  1IBL H;  3RF2 A;  3M4I A;  3EYY A;  3RTX A;  4RZQ A;  3PN1 A;  2VQE H;  4B3R H;  4K0K H;  5LL6 b;  1DGS A;  3KAJ A;  3LML A;  1XMO H;  1XNQ H;  3RIZ A;  4JV5 H;  3RJ0 A;  2UXC H;  3IG0 A;  1O75 A;  2E5L H;  3JSN A;  4DV1 H;  3J7A K;  3JSL A;  4LH6 A;  4MV7 A;  4UCR A;  1BJT A;  1S68 A;  4ETS A;  3BAA A;  3BA8 A;  4A2A A;  5D1O A;  2Q2T A;  5FPO A;  3UQ8 A;  2UXD H;  4JI1 H;  3N43 B;  4RB0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...