1WH2A

Solution structure of the gyf domain of a hypothetical protein from arabidopsis thaliana
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
78
structure length
78
Chain Sequence
GSSGSSGVRVLSYDKEKLNWLYKDPQGLVQGPFSLTQLKAWSDAEYFTKQFRVWMTGESMESAVLLTDVLRLSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the GYF domain of a hypothetical protein from Arabidopsis thaliana
rcsb
source organism Arabidopsis thaliana
molecule tags Structural genomics, unknown function
molecule keywords Hypothetical protein At5g08430
total genus 11
structure length 78
sequence length 78
ec nomenclature
pdb deposition date 2004-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02213 GYF GYF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1490.40 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 1wh2A01
3K3VA 1WH2A 4BWSC 1SYXB 3FMAA 1L2ZA 1GYFA
chains in the Genus database with same CATH superfamily
5L1IA 3V6HA 2UUBH 2UXBH 2YS7A 2W6MA 3GIDA 4Y8VB 3V6KA 4TV8F 1P8LA 3ETHA 3TINA 3EPIA 1I50A 4BY1G 3MR5A 3GILA 5DQIA 1JIHA 4ED1A 2DIKA 1A0IA 2X0SA 1XNRH 3RV4A 4F4ZA 5KFJA 5BPHA 3JRWA 5KFPA 1Y1WA 5LA6F 4DR1H 3M9MB 4EGQA 1Y1VA 2SCUB 3T1YH 2I87A 3MJFA 3HB9A 3GIKA 4LH7A 4ZI7F 4WBNF 1S0NA 3KAJA 2YZGA 1GSHA 5C1OA 2WTFA 4ECTA 4DUZH 1R9TA 3M9OB 5KFXA 4APMA 4BY7G 1UNNC 1KC7A 2HVSA 1W96A 3N6XA 4ECWA 2J6UA 1GO3E 3WNZA 2ZM6H 3GIQA 5CB4F 4TQSA 4QWEA 3G6VA 4J9QA 1OWTA 3KHLA 2B63G 3TIGA 5KG4A 2FPGB 3UFXB 4RNMA 4JI5H 2R93A 2W70A 3GV7B 3G6YA 1I6UA 1RJQA 2IBKA 4XX0B 4Q8EA 1K83A 5KT3A 4EYHB 1CE8A 1A9XA 2VUMA 2WE6A 4O4IF 4TV9F 2FLPA 1BGWA 1RYSA 4Q8FA 2W6ZA 3G6XA 3QFFA 2DLNA 5KFEA 4A3DG 2R92G 2JA5A 5KFKA 5KFFA 4HYKA 2UUAH 3PN1A 2W71A 4FS2A 3EPGA 3KHGA 1XDNA 2R87A 3V4ZA 2GPWA 5KFDA 1VBHA 3JSLA 2C2EA 1B6RA 4DR4H 4DV6H 2JEFA 3HOXG 1GLVA 3GTKA 1XMOH 5C44G 4GC6A 2YW2A 1I3QA 5D1OA 5DLFA 2P0AA 4YR3A 3CQZA 4DR2H 1C3OA 5EDWA 3TIIA 4F4XA 1CQJB 3KALA 1AUVA 4J9PA 5J2UF 3RIZA 3OUZA 4QWAA 1GSOA 2W9BB 3BQ1A 4JV1A 2R8HA 1N34H 1DV2A 1B04A 1AN7A 4O3QA 4NLGA 4A2AA 2YZNA 1ZHSA 4I7HA 5FLXW 4O2BF 3RAXA 4QJFA 3V4SA 2W9CB 4FM9A 4LSXA 5EOYA 5J2TF 3J7AK 5KG0A 4LH6A 1E4FT 1EZ1A 1WCMG 5DGBA 5LOVF 4DR5H 1JDEA 4J9LA 1DIKA 3Q2OA 4EBCA 2BQUA 4WD3A 2OH2A 4TUYF 1ULZA 3UQ8A 1N36H 2OLSA 1O75A 4R7RA 2I80A 5KFBA 4DL2A 4EEYA 2ZJTA 3LMLA 4JI8H 1VBGA 4UCRA 2RGRA 5C5JA 3BABA 4DR6H 3JRXA 2VQEH 2JEJA 2R84A 4HNUA 4Q45A 3L2PA 5LP6F 5KT5A 4ZOLF 3MR6A 3JZIA 4DLKA 5KFWA 4OX9H 5T14A 4DV3H 2R85A 2XGQA 4RZRA 4A3EG 2AGPA 4MV3A 1B33N 5KFGA 2R7NA 3U9SA 4NXMH 1E4EA 4HR7A 4RB0A 5IYZF 1N48A 2HVRA 4I50F 4MA0A 2ZDHA 3GIMA 4LFAH 4R8UA 1TWHA 5KFVA 4YQWA 1DGSA 3K3PA 3RUPA 2VR1A 2RDJA 2JEGA 3PO2G 4YR0A 2YRXA 3L4JA 5D1PA 5BPFA 3GTOA 5BMVF 3BG5A 4ED8A 1V51A 4MA5A 4J0MA 2FK2A 4J9SA 4FBUA 2FLLA 2R7KA 3RTXA 5IP9G 4MV1A 1V4YA 4ETSA 3RB0A 4A93G 3BA9A 4RNNA 1RJRA 1IOVA 1JDBB 2J9GA 2UUCH 5HBRB 5EWGA 2FMAA 3IG0A 4IAJA 4UFZA 4CC5A 2JA5G 4MV6A 5FD5A 4HNVA 4RB3C 5KFHA 4A3CG 2VUGA 1TWAA 3IN5A 3JAMW 3PO3G 3LWBA 4XYMB 3Q1KA 2R92A 1SCUB 4LFCH 5DG9A 4DV4H 4DV7H 3T5HA 3RB3A 3N8DA 1EUDB 1Y1VG 1JX4A 2C35B 5IP7G 4A3GG 4HNTA 3H20A 2R8GA 5IYCG 3T5JA 2RGVA 1Z2PX 1Y14B 5KT6A 3JSNA 2Y0SE 4JI3H 2AGQA 4GC7A 4ED3A 4QWBA 2FLNA 4JI1H 2JA7A 1K1SA 4YB8B 3I12A 1T94A 3G8CA 4IWYA 2CQYA 5KG3A 3RJ0A 4A3FG 3QZ7A 2XC9A 3M9NB 3OTOH 4IRKA 2B63A 3Q8RB 3VPBA 4B3TH 2DWCA 2JEIA 1EHIA 1GYFA 1I94H 2JA6A 3ETJA 4QW9A 5JVDF 4DV5H 3T5KA 4LF9H 1RYRA 1N56A 2DZDA 2V58A 4J9KA 2R6FA 4ZHQF 4ECSA 1GSAA 3F8NA 4LF8H 4EFBA 4RU9A 4BXXG 2VPQA 5KFTA 5LXTF 1S0MA 4ECZA 2VUMG 1HNWH 2Y0SA 1IBMH 3AYHB 3BQ2A 4O3OA 5F9LA 1M0WA 2YU9A 1Z2NX 2GPSA 1CQIB 4MAMA 4M9UA 4RUCA 4C2MA 5KFNA 4R8UB 3OHAA 3H0GA 2W8LA 1BNCA 2WYOA 4J9RA 1KJJA 1RK5A 2VQDA 1EUCB 3H40A 5JH7F 4EG0A 3HXLA 1KBLA 4X66H 3KAKA 2YZMA 4MV7A 1KJQA 3RF2A 5IWAH 4EYIB 4IWXA 4EBDA 4DL3A 2R93G 4U6PA 3Q8SB 2R8IA 1PK8A 1M7JA 3PW2A 4GKKH 5KFMA 4RUAA 4A2BA 2R7MA 2W7OA 1BJTA 5F9NA 5DG8A 3DF7A 4DR3H 3QZ8A 4RB1A 5KG6A 3MR3A 4BBSG 4L1KA 2HVQA 3BQ0A 3K5HA 4ECVA 1ZETA 3HOWG 1XNQH 3MR2A 4EFEA 2W57A 4IZOA 5KX5F 5CA0F 2R8JA 4JI4H 5HV6A 3NGDA 5IT9W 1KJ9A 3MFIA 2NU8B 5BR8H 3H4BA 3H3VH 5FPRA 5JUMA 2C2RA 1S10A 1RJPA 5LL6b 2GLTA 5KFQA 4FBTA 3GIJA 4YY3H 3ORQA 1TA8A 3N40P 4DL5A 4LF7H 1GGOA 5DG7A 3RAQA 2PBZA 2UVUA 3MWMA 5FD6A 4XZ3B 3VMMA 3FKIA 4C5CA 1TWGA 1JLLB 4MV4A 3RFCA 2CZGA 2PMZE 2ZDGA 4YAJB 5KT7A 4IR9A 1IBLH 3FDSA 5IYDG 4FU0A 4ECQA 2ASDA 3GTGA 5EWFA 2V5AA 3N43B 4A3KG 4JV5H 4AQYH 4M7EA 4PDBA 4LF5H 2YL2A 2NUAB 2E5LH 4LFBH 1KJIA 1L2ZA 4LF6H 1IOWA 3J81W 3MFHA 3KHHA 5KT4A 5KFIA 2IMWP 1FVIA 2YCHA 5C3EG 3CVZA 4JI6H 2W6PA 5KFLA 3TQTA 4DL7A 3E5NA 3N41B 5KG7A 4NXNH 2MCTA 4EEQA 3K5IA 2JA6G 2UU9H 3WO1A 3ORRA 5L1JA 2NU9B 2R8KA 3GTLA 1S0OA 1HR0H 5GONF 1S68A 1J5EH 2WB1E 3PVXA 3PW7A 4YJ2F 5FPOA 4Q0YA 1FJGH 2HJWA 4IRCA 4F4WA 3SI8A 2Q2UA 4IRDA 2DPIA 4GKJH 3H0GG 3N42B 3N44B 4MTEA 4MV8A 4ECXA 3RBEA 2OWOA 1XMQH 5I47A 3WO0A 4UCSA 4A3JG 1X9NA 1TWCA 3RV3A 5CA1F 3OHBA 2C00A 4DV0H 5DQHA 2QK4A 1I7LA 2PN1A 3HKZA 1S9FA 3PW0A 2W6OA 3J80W 3RB6A 1VS0A 2FJZA 4RZQA 1T3NA 2IP4A 1E4GT 5C8YF 2J6TA 4I4TF 1Z2OX 2QYZA 1M6VA 4ED2A 4G3IA 1WR2A 3PW5A 2AGOA 3PW4A 2UVVA 4JV0A 5C1PA 3FMAA 2NVXA 5D1OB 3GV8B 5KKNB 4A3IG 2DPJA 2CW7A 5EWEA 2RF4A 3T1HH 1SFOA 2W8KA 1TWFA 2W9BA 3GIPA 3GLKA 3H4DA 3KTMA 2JA7G 2V4RA 2R7ZA 2VQFH 2C22A 4UCVA 2XCAA 2HHHH 2PMZA 4JUZA 2W9CA 4RB2C 1IBKH 4O3SA 1MZBA 4J9NA 3HOUG 1WSCA 2ZDQA 2E2HA 3GTJA 2FPIB 3VPDA 2YYAA 5L9XA 4X62H 3R5HA 2WAQA 4B3MH 4JV2A 2C28A 5KFAA 4LF4H 2YS6A 2FPPB 2M05A 2W6QA 3LP8A 4UCUA 2UVWA 3MWEA 1ZQ7A 5KFRA 5IYBG 2XIGA 2NU7B 4QWCA 2V4QA 2KSWA 3PZPA 4Q43A 2VA2A 4O4HF 2R86A 2IA6A 4A3BG 4O3NA 3C0FB 4DL4A 4TQRA 3BA8A 1CS0A 2VA3A 3GV5B 4HQ6A 3U9TA 1UC9A 5KG1A 2BR0A 2CKZB 2NU6B 3Q8QB 4PWQA 5L1LA 3OSNA 5KT2A 2HGSA 5KFSA 4BBRG 5DGAA 4DR7H 1EYZA 4J9OA 4JI2H 1E4EB 1KJ8A 3GTPA 1HNXH 3I4NG 2VOBA 1RK6A 2WAQE 4B3RH 2ASJA 4B3SH 5KG2A 4JI7H 2V59A 2XCPA 2W7PA 5EZYF 5CAEB 1W93A 5C4XG 3GTMA 2I8CA 5FJ8G 1N33H 2ATLA 2NVYA 3FKIG 3HOYG 4YJ3F 1AUXA 3VPCA 4DV1H 3KXYT 5K2MA 5KFUA 5L1KA 2W6NA 4QW8A 5DLGA 3R5XA 3K3VA 3KHRA 5KFOA 4AYBA 4QIWA 4X64H 4ECUA 4O3PA 1T36A 4IR1A 2FK3A 4X65H 2FE3A 5A2QW 2J6SA 2V9WA 3HOVG 4I55F 1K1QA 1Y1WG 4QWDA 1HNZH 3MWDA 5LMUH 1PX2A 4UCOA 2R7ZG 4O2AF 5FLMG 5H80A 2RDIA 3RGXA 4IHJF 4EGJA 3HOZG 4ME6A 2ASLA 4ZQIA 4O4LF 4DUYH 4F4YA 4FS1A 2AQ4A 1UC8A 4C5BA 3HKZE 2FB9A 2ALZA 2F4VH 4MV9A 4E4TA 1SEIA 1VKZA 4MTDA 3HBLA 1C30A 4O3RA 4A3LG 4KHPH 3OSPA 3M4IA 4ED7A 2BQ3A 4XYLB 1FKAH 1I7NA 4AYBE 3R5FA 4CC6A 4LSAA 1JKJB 5KG5A 1BXRA 4YBZB 2FK1A 3PR4A 4YP3A 4RAZA 4JYAH 4RNOA 4C5AA 3BJYA 3TQ1A 2UXDH 3RGZA 1TAEA 3OUUA 4YAKB 1KEEA 3PR5B 5JQWA 4U7CA 4ECRA 5KFZA 4LMYA 4RAYA 1SYXB 1WCMA 2XCLA 4BWSC 2C2DA 2CW8A 4ED6A 1S97A 1M0TA 3GQCA 3RBDA 1V9PA 5D8DA 4YR2A 3L4KA 2R82A 4GLXA 4EBEA 1DV1A 3T5LA 2AU0A 2FP4B 2XD4A 4QIWE 2BQRA 2YRWA 4F50A 2UXCH 5JVLA 3R23A 2PVPA 4UCTA 3EYYA 5KFCA 5DQGA 2UVRA 1JXLA 4DL6A 2WDTA 1ZHQA 1VAJA 2Q2TA 4A3MG 3GTQA 1B6SA 2WB1A 4ED0A 3GIIA 2E2IA 2R7LA 2W9AA 3SE7A 4DV2H 3BAAA 4ECYA 4J9MA 3I4MG 1WH2A 4Q44A 2O03A 5LYJF 5LMNH 3V6JA 1N32H 2XGPA 5KFYA 4JI0H 4YHHH 3RB4A 1S03G 2JA8G 4K0KH 3Q8PB 2VPSA 2FKLA
chains in the Genus database with same CATH topology
2KSWA 2UUBH 5LL6b 2UXBH 4RB0A 2HVRA 4YY3H 1P8LA 4LFAH 3C0FB 1DGSA 1TA8A 3BA8A 3N40P 4LF7H 1A0IA 1XNRH 3L4JA 3MWMA 5FD6A 5D1PA 4DR1H 2HGSA 4DR7H 4JI2H 4J0MA 3T1YH 1HNXH 2VOBA 4LH7A 3RTXA 1IBLH 4B3RH 4ETSA 4B3SH 3BA9A 4JI7H 3KAJA 2UUCH 4DUZH 4APMA 3IG0A 3N43B 4IAJA 4UFZA 4CC5A 4JV5H 5FD5A 4AQYH 4M7EA 4RB3C 4PDBA 2HVSA 4LF5H 2VUGA 3N6XA 1N33H 2E5LH 4LFBH 3JAMW 1L2ZA 4LF6H 2ZM6H 3J81W 4LFCH 4DV1H 1FVIA 3KXYT 2YCHA 4DV4H 3CVZA 4DV7H 4JI6H 4JI5H 3N41B 4NXNH 1I6UA 2MCTA 4EEQA 2UU9H 3H20A 2RGVA 3K3VA 1Z2PX 3JSNA 4JI3H 4X64H 2WE6A 1HR0H 4JI1H 1S68A 1J5EH 1BGWA 4X65H 2FE3A 5FPOA 5A2QW 4Q0YA 3RJ0A 1FJGH 2Q2UA 4GKJH 3OTOH 1HNZH 5LMUH 3N42B 4B3TH 4UCOA 3N44B 4MTEA 2UUAH 1GYFA 3PN1A 3RGXA 1I94H 2OWOA 1XMQH 1XDNA 4UCSA 1X9NA 4DV5H 4LF9H 4DR4H 3JSLA 4DUYH 4DV0H 4DV6H 2F4VH 4MV9A 3F8NA 1SEIA 1XMOH 4LF8H 4MTDA 4EFBA 3J80W 5D1OA 4KHPH 1VS0A 3M4IA 4RZQA 4DR2H 1E4GT 1FKAH 3KALA 1HNWH 4LSAA 4CC6A 1IBMH 1Z2OX 1M0WA 1Z2NX 3RIZA 1N34H 1B04A 4RAZA 1AN7A 4JYAH 4A2AA 2WYOA 2UXDH 3RGZA 1ZHSA 4I7HA 5FLXW 1TAEA 3FMAA 5D1OB 4X66H 3HXLA 3KAKA 5IWAH 4MV7A 3RF2A 4FM9A 4LMYA 2CW7A 1SYXB 4RAYA 4BWSC 5EOYA 4LSXA 2CW8A 3T1HH 3J7AK 1M0TA 1V9PA 4LH6A 1E4FT 3L4KA 4GLXA 4GKKH 2UXCH 4A2BA 2VQFH 4UCTA 1BJTA 4DR5H 3EYYA 3DF7A 4DR3H 4UCVA 2HHHH 2WDTA 4RB1A 1ZHQA 1N36H 3UQ8A 4RB2C 1IBKH 1MZBA 1O75A 4R7RA 2Q2TA 2HVQA 2ZJTA 4DV2H 3LMLA 4JI8H 4UCRA 2RGRA 1XNQH 3BAAA 3BABA 4EFEA 4DR6H 2W57A 4X62H 2VQEH 4B3MH 3L2PA 1WH2A 2O03A 4JI4H 5LMNH 4LF4H 1N32H 4JI0H 5IT9W 4YHHH 1S03G 4UCUA 5BR8H 4OX9H 4DV3H 4K0KH 5FPRA 2VPSA 2XIGA 4NXMH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3K3V A;  1WH2 A;  4BWS C;  1SYX B;  3FMA A;  1L2Z A;  1GYF A; 
#chains in the Genus database with same CATH topology
 5L1I A;  3V6H A;  2UUB H;  2UXB H;  2YS7 A;  2W6M A;  3GID A;  4Y8V B;  3V6K A;  4TV8 F;  1P8L A;  3ETH A;  3TIN A;  3EPI A;  1I50 A;  4BY1 G;  3MR5 A;  3GIL A;  5DQI A;  1JIH A;  4ED1 A;  2DIK A;  1A0I A;  2X0S A;  1XNR H;  3RV4 A;  4F4Z A;  5KFJ A;  5BPH A;  3JRW A;  5KFP A;  1Y1W A;  5LA6 F;  4DR1 H;  3M9M B;  4EGQ A;  1Y1V A;  2SCU B;  3T1Y H;  2I87 A;  3MJF A;  3HB9 A;  3GIK A;  4LH7 A;  4ZI7 F;  4WBN F;  1S0N A;  3KAJ A;  2YZG A;  1GSH A;  5C1O A;  2WTF A;  4ECT A;  4DUZ H;  1R9T A;  3M9O B;  5KFX A;  4APM A;  4BY7 G;  1UNN C;  1KC7 A;  2HVS A;  1W96 A;  3N6X A;  4ECW A;  2J6U A;  1GO3 E;  3WNZ A;  2ZM6 H;  3GIQ A;  5CB4 F;  4TQS A;  4QWE A;  3G6V A;  4J9Q A;  1OWT A;  3KHL A;  2B63 G;  3TIG A;  5KG4 A;  2FPG B;  3UFX B;  4RNM A;  4JI5 H;  2R93 A;  2W70 A;  3GV7 B;  3G6Y A;  1I6U A;  1RJQ A;  2IBK A;  4XX0 B;  4Q8E A;  1K83 A;  5KT3 A;  4EYH B;  1CE8 A;  1A9X A;  2VUM A;  2WE6 A;  4O4I F;  4TV9 F;  2FLP A;  1BGW A;  1RYS A;  4Q8F A;  2W6Z A;  3G6X A;  3QFF A;  2DLN A;  5KFE A;  4A3D G;  2R92 G;  2JA5 A;  5KFK A;  5KFF A;  4HYK A;  2UUA H;  3PN1 A;  2W71 A;  4FS2 A;  3EPG A;  3KHG A;  1XDN A;  2R87 A;  3V4Z A;  2GPW A;  5KFD A;  1VBH A;  3JSL A;  2C2E A;  1B6R A;  4DR4 H;  4DV6 H;  2JEF A;  3HOX G;  1GLV A;  3GTK A;  1XMO H;  5C44 G;  4GC6 A;  2YW2 A;  1I3Q A;  5D1O A;  5DLF A;  2P0A A;  4YR3 A;  3CQZ A;  4DR2 H;  1C3O A;  5EDW A;  3TII A;  4F4X A;  1CQJ B;  3KAL A;  1AUV A;  4J9P A;  5J2U F;  3RIZ A;  3OUZ A;  4QWA A;  1GSO A;  2W9B B;  3BQ1 A;  4JV1 A;  2R8H A;  1N34 H;  1DV2 A;  1B04 A;  1AN7 A;  4O3Q A;  4NLG A;  4A2A A;  2YZN A;  1ZHS A;  4I7H A;  5FLX W;  4O2B F;  3RAX A;  4QJF A;  3V4S A;  2W9C B;  4FM9 A;  4LSX A;  5EOY A;  5J2T F;  3J7A K;  5KG0 A;  4LH6 A;  1E4F T;  1EZ1 A;  1WCM G;  5DGB A;  5LOV F;  4DR5 H;  1JDE A;  4J9L A;  1DIK A;  3Q2O A;  4EBC A;  2BQU A;  4WD3 A;  2OH2 A;  4TUY F;  1ULZ A;  3UQ8 A;  1N36 H;  2OLS A;  1O75 A;  4R7R A;  2I80 A;  5KFB A;  4DL2 A;  4EEY A;  2ZJT A;  3LML A;  4JI8 H;  1VBG A;  4UCR A;  2RGR A;  5C5J A;  3BAB A;  4DR6 H;  3JRX A;  2VQE H;  2JEJ A;  2R84 A;  4HNU A;  4Q45 A;  3L2P A;  5LP6 F;  5KT5 A;  4ZOL F;  3MR6 A;  3JZI A;  4DLK A;  5KFW A;  4OX9 H;  5T14 A;  4DV3 H;  2R85 A;  2XGQ A;  4RZR A;  4A3E G;  2AGP A;  4MV3 A;  1B33 N;  5KFG A;  2R7N A;  3U9S A;  4NXM H;  1E4E A;  4HR7 A;  4RB0 A;  5IYZ F;  1N48 A;  2HVR A;  4I50 F;  4MA0 A;  2ZDH A;  3GIM A;  4LFA H;  4R8U A;  1TWH A;  5KFV A;  4YQW A;  1DGS A;  3K3P A;  3RUP A;  2VR1 A;  2RDJ A;  2JEG A;  3PO2 G;  4YR0 A;  2YRX A;  3L4J A;  5D1P A;  5BPF A;  3GTO A;  5BMV F;  3BG5 A;  4ED8 A;  1V51 A;  4MA5 A;  4J0M A;  2FK2 A;  4J9S A;  4FBU A;  2FLL A;  2R7K A;  3RTX A;  5IP9 G;  4MV1 A;  1V4Y A;  4ETS A;  3RB0 A;  4A93 G;  3BA9 A;  4RNN A;  1RJR A;  1IOV A;  1JDB B;  2J9G A;  2UUC H;  5HBR B;  5EWG A;  2FMA A;  3IG0 A;  4IAJ A;  4UFZ A;  4CC5 A;  2JA5 G;  4MV6 A;  5FD5 A;  4HNV A;  4RB3 C;  5KFH A;  4A3C G;  2VUG A;  1TWA A;  3IN5 A;  3JAM W;  3PO3 G;  3LWB A;  4XYM B;  3Q1K A;  2R92 A;  1SCU B;  4LFC H;  5DG9 A;  4DV4 H;  4DV7 H;  3T5H A;  3RB3 A;  3N8D A;  1EUD B;  1Y1V G;  1JX4 A;  2C35 B;  5IP7 G;  4A3G G;  4HNT A;  3H20 A;  2R8G A;  5IYC G;  3T5J A;  2RGV A;  1Z2P X;  1Y14 B;  5KT6 A;  3JSN A;  2Y0S E;  4JI3 H;  2AGQ A;  4GC7 A;  4ED3 A;  4QWB A;  2FLN A;  4JI1 H;  2JA7 A;  1K1S A;  4YB8 B;  3I12 A;  1T94 A;  3G8C A;  4IWY A;  2CQY A;  5KG3 A;  3RJ0 A;  4A3F G;  3QZ7 A;  2XC9 A;  3M9N B;  3OTO H;  4IRK A;  2B63 A;  3Q8R B;  3VPB A;  4B3T H;  2DWC A;  2JEI A;  1EHI A;  1GYF A;  1I94 H;  2JA6 A;  3ETJ A;  4QW9 A;  5JVD F;  4DV5 H;  3T5K A;  4LF9 H;  1RYR A;  1N56 A;  2DZD A;  2V58 A;  4J9K A;  2R6F A;  4ZHQ F;  4ECS A;  1GSA A;  3F8N A;  4LF8 H;  4EFB A;  4RU9 A;  4BXX G;  2VPQ A;  5KFT A;  5LXT F;  1S0M A;  4ECZ A;  2VUM G;  1HNW H;  2Y0S A;  1IBM H;  3AYH B;  3BQ2 A;  4O3O A;  5F9L A;  1M0W A;  2YU9 A;  1Z2N X;  2GPS A;  1CQI B;  4MAM A;  4M9U A;  4RUC A;  4C2M A;  5KFN A;  4R8U B;  3OHA A;  3H0G A;  2W8L A;  1BNC A;  2WYO A;  4J9R A;  1KJJ A;  1RK5 A;  2VQD A;  1EUC B;  3H40 A;  5JH7 F;  4EG0 A;  3HXL A;  1KBL A;  4X66 H;  3KAK A;  2YZM A;  4MV7 A;  1KJQ A;  3RF2 A;  5IWA H;  4EYI B;  4IWX A;  4EBD A;  4DL3 A;  2R93 G;  4U6P A;  3Q8S B;  2R8I A;  1PK8 A;  1M7J A;  3PW2 A;  4GKK H;  5KFM A;  4RUA A;  4A2B A;  2R7M A;  2W7O A;  1BJT A;  5F9N A;  5DG8 A;  3DF7 A;  4DR3 H;  3QZ8 A;  4RB1 A;  5KG6 A;  3MR3 A;  4BBS G;  4L1K A;  2HVQ A;  3BQ0 A;  3K5H A;  4ECV A;  1ZET A;  3HOW G;  1XNQ H;  3MR2 A;  4EFE A;  2W57 A;  4IZO A;  5KX5 F;  5CA0 F;  2R8J A;  4JI4 H;  5HV6 A;  3NGD A;  5IT9 W;  1KJ9 A;  3MFI A;  2NU8 B;  5BR8 H;  3H4B A;  3H3V H;  5FPR A;  5JUM A;  2C2R A;  1S10 A;  1RJP A;  5LL6 b;  2GLT A;  5KFQ A;  4FBT A;  3GIJ A;  4YY3 H;  3ORQ A;  1TA8 A;  3N40 P;  4DL5 A;  4LF7 H;  1GGO A;  5DG7 A;  3RAQ A;  2PBZ A;  2UVU A;  3MWM A;  5FD6 A;  4XZ3 B;  3VMM A;  3FKI A;  4C5C A;  1TWG A;  1JLL B;  4MV4 A;  3RFC A;  2CZG A;  2PMZ E;  2ZDG A;  4YAJ B;  5KT7 A;  4IR9 A;  1IBL H;  3FDS A;  5IYD G;  4FU0 A;  4ECQ A;  2ASD A;  3GTG A;  5EWF A;  2V5A A;  3N43 B;  4A3K G;  4JV5 H;  4AQY H;  4M7E A;  4PDB A;  4LF5 H;  2YL2 A;  2NUA B;  2E5L H;  4LFB H;  1KJI A;  1L2Z A;  4LF6 H;  1IOW A;  3J81 W;  3MFH A;  3KHH A;  5KT4 A;  5KFI A;  2IMW P;  1FVI A;  2YCH A;  5C3E G;  3CVZ A;  4JI6 H;  2W6P A;  5KFL A;  3TQT A;  4DL7 A;  3E5N A;  3N41 B;  5KG7 A;  4NXN H;  2MCT A;  4EEQ A;  3K5I A;  2JA6 G;  2UU9 H;  3WO1 A;  3ORR A;  5L1J A;  2NU9 B;  2R8K A;  3GTL A;  1S0O A;  1HR0 H;  5GON F;  1S68 A;  1J5E H;  2WB1 E;  3PVX A;  3PW7 A;  4YJ2 F;  5FPO A;  4Q0Y A;  1FJG H;  2HJW A;  4IRC A;  4F4W A;  3SI8 A;  2Q2U A;  4IRD A;  2DPI A;  4GKJ H;  3H0G G;  3N42 B;  3N44 B;  4MTE A;  4MV8 A;  4ECX A;  3RBE A;  2OWO A;  1XMQ H;  5I47 A;  3WO0 A;  4UCS A;  4A3J G;  1X9N A;  1TWC A;  3RV3 A;  5CA1 F;  3OHB A;  2C00 A;  4DV0 H;  5DQH A;  2QK4 A;  1I7L A;  2PN1 A;  3HKZ A;  1S9F A;  3PW0 A;  2W6O A;  3J80 W;  3RB6 A;  1VS0 A;  2FJZ A;  4RZQ A;  1T3N A;  2IP4 A;  1E4G T;  5C8Y F;  2J6T A;  4I4T F;  1Z2O X;  2QYZ A;  1M6V A;  4ED2 A;  4G3I A;  1WR2 A;  3PW5 A;  2AGO A;  3PW4 A;  2UVV A;  4JV0 A;  5C1P A;  3FMA A;  2NVX A;  5D1O B;  3GV8 B;  5KKN B;  4A3I G;  2DPJ A;  2CW7 A;  5EWE A;  2RF4 A;  3T1H H;  1SFO A;  2W8K A;  1TWF A;  2W9B A;  3GIP A;  3GLK A;  3H4D A;  3KTM A;  2JA7 G;  2V4R A;  2R7Z A;  2VQF H;  2C22 A;  4UCV A;  2XCA A;  2HHH H;  2PMZ A;  4JUZ A;  2W9C A;  4RB2 C;  1IBK H;  4O3S A;  1MZB A;  4J9N A;  3HOU G;  1WSC A;  2ZDQ A;  2E2H A;  3GTJ A;  2FPI B;  3VPD A;  2YYA A;  5L9X A;  4X62 H;  3R5H A;  2WAQ A;  4B3M H;  4JV2 A;  2C28 A;  5KFA A;  4LF4 H;  2YS6 A;  2FPP B;  2M05 A;  2W6Q A;  3LP8 A;  4UCU A;  2UVW A;  3MWE A;  1ZQ7 A;  5KFR A;  5IYB G;  2XIG A;  2NU7 B;  4QWC A;  2V4Q A;  2KSW A;  3PZP A;  4Q43 A;  2VA2 A;  4O4H F;  2R86 A;  2IA6 A;  4A3B G;  4O3N A;  3C0F B;  4DL4 A;  4TQR A;  3BA8 A;  1CS0 A;  2VA3 A;  3GV5 B;  4HQ6 A;  3U9T A;  1UC9 A;  5KG1 A;  2BR0 A;  2CKZ B;  2NU6 B;  3Q8Q B;  4PWQ A;  5L1L A;  3OSN A;  5KT2 A;  2HGS A;  5KFS A;  4BBR G;  5DGA A;  4DR7 H;  1EYZ A;  4J9O A;  4JI2 H;  1E4E B;  1KJ8 A;  3GTP A;  1HNX H;  3I4N G;  2VOB A;  1RK6 A;  2WAQ E;  4B3R H;  2ASJ A;  4B3S H;  5KG2 A;  4JI7 H;  2V59 A;  2XCP A;  2W7P A;  5EZY F;  5CAE B;  1W93 A;  5C4X G;  3GTM A;  2I8C A;  5FJ8 G;  1N33 H;  2ATL A;  2NVY A;  3FKI G;  3HOY G;  4YJ3 F;  1AUX A;  3VPC A;  4DV1 H;  3KXY T;  5K2M A;  5KFU A;  5L1K A;  2W6N A;  4QW8 A;  5DLG A;  3R5X A;  3K3V A;  3KHR A;  5KFO A;  4AYB A;  4QIW A;  4X64 H;  4ECU A;  4O3P A;  1T36 A;  4IR1 A;  2FK3 A;  4X65 H;  2FE3 A;  5A2Q W;  2J6S A;  2V9W A;  3HOV G;  4I55 F;  1K1Q A;  1Y1W G;  4QWD A;  1HNZ H;  3MWD A;  5LMU H;  1PX2 A;  4UCO A;  2R7Z G;  4O2A F;  5FLM G;  5H80 A;  2RDI A;  3RGX A;  4IHJ F;  4EGJ A;  3HOZ G;  4ME6 A;  2ASL A;  4ZQI A;  4O4L F;  4DUY H;  4F4Y A;  4FS1 A;  2AQ4 A;  1UC8 A;  4C5B A;  3HKZ E;  2FB9 A;  2ALZ A;  2F4V H;  4MV9 A;  4E4T A;  1SEI A;  1VKZ A;  4MTD A;  3HBL A;  1C30 A;  4O3R A;  4A3L G;  4KHP H;  3OSP A;  3M4I A;  4ED7 A;  2BQ3 A;  4XYL B;  1FKA H;  1I7N A;  4AYB E;  3R5F A;  4CC6 A;  4LSA A;  1JKJ B;  5KG5 A;  1BXR A;  4YBZ B;  2FK1 A;  3PR4 A;  4YP3 A;  4RAZ A;  4JYA H;  4RNO A;  4C5A A;  3BJY A;  3TQ1 A;  2UXD H;  3RGZ A;  1TAE A;  3OUU A;  4YAK B;  1KEE A;  3PR5 B;  5JQW A;  4U7C A;  4ECR A;  5KFZ A;  4LMY A;  4RAY A;  1SYX B;  1WCM A;  2XCL A;  4BWS C;  2C2D A;  2CW8 A;  4ED6 A;  1S97 A;  1M0T A;  3GQC A;  3RBD A;  1V9P A;  5D8D A;  4YR2 A;  3L4K A;  2R82 A;  4GLX A;  4EBE A;  1DV1 A;  3T5L A;  2AU0 A;  2FP4 B;  2XD4 A;  4QIW E;  2BQR A;  2YRW A;  4F50 A;  2UXC H;  5JVL A;  3R23 A;  2PVP A;  4UCT A;  3EYY A;  5KFC A;  5DQG A;  2UVR A;  1JXL A;  4DL6 A;  2WDT A;  1ZHQ A;  1VAJ A;  2Q2T A;  4A3M G;  3GTQ A;  1B6S A;  2WB1 A;  4ED0 A;  3GII A;  2E2I A;  2R7L A;  2W9A A;  3SE7 A;  4DV2 H;  3BAA A;  4ECY A;  4J9M A;  3I4M G;  1WH2 A;  4Q44 A;  2O03 A;  5LYJ F;  5LMN H;  3V6J A;  1N32 H;  2XGP A;  5KFY A;  4JI0 H;  4YHH H;  3RB4 A;  1S03 G;  2JA8 G;  4K0K H;  3Q8P B;  2VPS A;  2FKL A; 
#chains in the Genus database with same CATH homology
 2KSW A;  2UUB H;  5LL6 b;  2UXB H;  4RB0 A;  2HVR A;  4YY3 H;  1P8L A;  4LFA H;  3C0F B;  1DGS A;  1TA8 A;  3BA8 A;  3N40 P;  4LF7 H;  1A0I A;  1XNR H;  3L4J A;  3MWM A;  5FD6 A;  5D1P A;  4DR1 H;  2HGS A;  4DR7 H;  4JI2 H;  4J0M A;  3T1Y H;  1HNX H;  2VOB A;  4LH7 A;  3RTX A;  1IBL H;  4B3R H;  4ETS A;  4B3S H;  3BA9 A;  4JI7 H;  3KAJ A;  2UUC H;  4DUZ H;  4APM A;  3IG0 A;  3N43 B;  4IAJ A;  4UFZ A;  4CC5 A;  4JV5 H;  5FD5 A;  4AQY H;  4M7E A;  4RB3 C;  4PDB A;  2HVS A;  4LF5 H;  2VUG A;  3N6X A;  1N33 H;  2E5L H;  4LFB H;  3JAM W;  1L2Z A;  4LF6 H;  2ZM6 H;  3J81 W;  4LFC H;  4DV1 H;  1FVI A;  3KXY T;  2YCH A;  4DV4 H;  3CVZ A;  4DV7 H;  4JI6 H;  4JI5 H;  3N41 B;  4NXN H;  1I6U A;  2MCT A;  4EEQ A;  2UU9 H;  3H20 A;  2RGV A;  3K3V A;  1Z2P X;  3JSN A;  4JI3 H;  4X64 H;  2WE6 A;  1HR0 H;  4JI1 H;  1S68 A;  1J5E H;  1BGW A;  4X65 H;  2FE3 A;  5FPO A;  5A2Q W;  4Q0Y A;  3RJ0 A;  1FJG H;  2Q2U A;  4GKJ H;  3OTO H;  1HNZ H;  5LMU H;  3N42 B;  4B3T H;  4UCO A;  3N44 B;  4MTE A;  2UUA H;  1GYF A;  3PN1 A;  3RGX A;  1I94 H;  2OWO A;  1XMQ H;  1XDN A;  4UCS A;  1X9N A;  4DV5 H;  4LF9 H;  4DR4 H;  3JSL A;  4DUY H;  4DV0 H;  4DV6 H;  2F4V H;  4MV9 A;  3F8N A;  1SEI A;  1XMO H;  4LF8 H;  4MTD A;  4EFB A;  3J80 W;  5D1O A;  4KHP H;  1VS0 A;  3M4I A;  4RZQ A;  4DR2 H;  1E4G T;  1FKA H;  3KAL A;  1HNW H;  4LSA A;  4CC6 A;  1IBM H;  1Z2O X;  1M0W A;  1Z2N X;  3RIZ A;  1N34 H;  1B04 A;  4RAZ A;  1AN7 A;  4JYA H;  4A2A A;  2WYO A;  2UXD H;  3RGZ A;  1ZHS A;  4I7H A;  5FLX W;  1TAE A;  3FMA A;  5D1O B;  4X66 H;  3HXL A;  3KAK A;  5IWA H;  4MV7 A;  3RF2 A;  4FM9 A;  4LMY A;  2CW7 A;  1SYX B;  4RAY A;  4BWS C;  5EOY A;  4LSX A;  2CW8 A;  3T1H H;  3J7A K;  1M0T A;  1V9P A;  4LH6 A;  1E4F T;  3L4K A;  4GLX A;  4GKK H;  2UXC H;  4A2B A;  2VQF H;  4UCT A;  1BJT A;  4DR5 H;  3EYY A;  3DF7 A;  4DR3 H;  4UCV A;  2HHH H;  2WDT A;  4RB1 A;  1ZHQ A;  1N36 H;  3UQ8 A;  4RB2 C;  1IBK H;  1MZB A;  1O75 A;  4R7R A;  2Q2T A;  2HVQ A;  2ZJT A;  4DV2 H;  3LML A;  4JI8 H;  4UCR A;  2RGR A;  1XNQ H;  3BAA A;  3BAB A;  4EFE A;  4DR6 H;  2W57 A;  4X62 H;  2VQE H;  4B3M H;  3L2P A;  1WH2 A;  2O03 A;  4JI4 H;  5LMN H;  4LF4 H;  1N32 H;  4JI0 H;  5IT9 W;  4YHH H;  1S03 G;  4UCU A;  5BR8 H;  4OX9 H;  4DV3 H;  4K0K H;  5FPR A;  2VPS A;  2XIG A;  4NXM H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...