1WH4A

Solution structure of the death domain of interleukin-1 receptor-associated kinase4 (irak4) from mus musculus
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
127
structure length
127
Chain Sequence
GSSGSSGMNKPLTPSTYIRNLNVGILRKLSDFIDPQEGWKKLAVAIKKPSGDDRYNQFHIRRFEALLQTGKSPTCELLFDWGTTNCTVGDLVDLLVQIELFAPATLLLPDAVPQTVKSLPPSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the DEATH domain of Interleukin-1 receptor-associated kinase4 (IRAK4) from Mus musculus
rcsb
source organism Mus musculus
molecule tags Transferase
molecule keywords interleukin-1 receptor-associated kinase 4
total genus 30
structure length 127
sequence length 127
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2004-05-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.533.10 Mainly Alpha Orthogonal Bundle Death Domain, Fas Death Domain, Fas 1wh4A01
2LWDA 2GF5A 2L6AA 4A2QA 1CY5A 4UZ0A 2MPCA 4I16A 3KATA 1D2ZB 2IB1A 4P4HI 2B1WA 4IZ7B 2NZ7A 4D8OA 1D2ZA 3CL3A 2N7ZA 4NQKA 4QOBA 3T6PA 4F42A 1FADA 3J63A 3MOPA 2G7RA 2OF5A 3EZQA 1CWWA 2YQFA 2N00A 1E41A 4JUPA 2A5YB 2DBFA 4EWIA 2MB9A 3LQQA 3MOPG 1PN5A 2YGSA 2YVIA 4M9ZA 1WXPA 2KN6A 2MN4A 2N97A 2D96A 2NSNA 3CRDA 2A9IA 3MOPK 4O6XA 3YGSP 2LWEA 1NGRA 3J6JA 2P1HA 4O7QA 4IZAB 1WH4A 4ZBWA 4P4HA 1WMGA 2DBHA 4N1JA 2DBGA 3LQRA 2F1SA 2N80A 2L9MA 4O9LA 2HM2Q 3EZQB 4DWNA 4M9XA 2VGQA 4F44A 3QF2A 1Z6TA 2LS7A 2DO9A 2BBZA 2O71A 4O9FA 2MS7A 2MS8A 4JQWA 4RHWE 3YGSC 2NAQA 2YU0A 1YGOA 4RHWA 4N1KA 2BBRA 1A1ZA 1A1WA 1DDFA 1N3KA 2OF5H 4IZ5E 1C15A 2M5VA 2KM6A 4E9MA 4N1LA 1DGNA 4M9SA 2N83A 4LWDA 4FH0A 1ICHA 1UCPA 2N1FA 4A2WA 2DBDA 1E3YA
chains in the Genus database with same CATH superfamily
2LWDA 2GF5A 2L6AA 4A2QA 1CY5A 4UZ0A 2MPCA 4I16A 3KATA 1D2ZB 2IB1A 4P4HI 2B1WA 4IZ7B 2NZ7A 4D8OA 1D2ZA 3CL3A 2N7ZA 4NQKA 4QOBA 3T6PA 4F42A 1FADA 3J63A 3MOPA 2G7RA 2OF5A 3EZQA 1CWWA 2MJMA 2YQFA 2N00A 1E41A 4JUPA 2A5YB 2DBFA 4EWIA 2MB9A 3LQQA 3MOPG 1PN5A 2YGSA 2YVIA 4M9ZA 1WXPA 2KN6A 2MN4A 2N97A 2D96A 2NSNA 3CRDA 2A9IA 3MOPK 4O6XA 3YGSP 2LWEA 1NGRA 3J6JA 2P1HA 4O7QA 4IZAB 1WH4A 4ZBWA 4P4HA 1WMGA 2DBHA 4N1JA 2DBGA 3LQRA 2F1SA 2N80A 2L9MA 4O9LA 2HM2Q 3EZQB 4DWNA 4M9XA 2VGQA 4F44A 3QF2A 1Z6TA 2LS7A 2DO9A 2BBZA 2O71A 4O9FA 2MS7A 2MS8A 4JQWA 4RHWE 2XV9A 3YGSC 2NAQA 2YU0A 1YGOA 4RHWA 4N1KA 2BBRA 1A1ZA 1A1WA 1DDFA 1N3KA 2OF5H 4IZ5E 1C15A 2M5VA 2KM6A 4E9MA 4N1LA 1DGNA 4M9SA 2N83A 4LWDA 4FH0A 1ICHA 1UCPA 2N1FA 4A2WA 2DBDA 1E3YA
chains in the Genus database with same CATH topology
2LWDA 2GF5A 2L6AA 4A2QA 1CY5A 4UZ0A 2MPCA 4I16A 3KATA 1D2ZB 2IB1A 4P4HI 2B1WA 4IZ7B 2NZ7A 4D8OA 1D2ZA 3CL3A 2N7ZA 4NQKA 4QOBA 3T6PA 4F42A 1FADA 3J63A 3MOPA 2G7RA 2OF5A 3EZQA 1CWWA 2MJMA 2YQFA 2N00A 1E41A 4JUPA 2A5YB 2DBFA 4EWIA 2MB9A 3LQQA 3MOPG 1PN5A 2YGSA 2YVIA 4M9ZA 1WXPA 2KN6A 2MN4A 2N97A 2D96A 2NSNA 3CRDA 2A9IA 3MOPK 4O6XA 3YGSP 2LWEA 1NGRA 3J6JA 2P1HA 4O7QA 4IZAB 1WH4A 4ZBWA 4P4HA 1WMGA 2DBHA 4N1JA 2DBGA 3LQRA 2F1SA 2N80A 2L9MA 4O9LA 2HM2Q 3EZQB 4DWNA 4M9XA 2VGQA 4F44A 3QF2A 1Z6TA 2LS7A 2DO9A 2BBZA 2O71A 4O9FA 2MS7A 2MS8A 4JQWA 4RHWE 2XV9A 3YGSC 2NAQA 2YU0A 1YGOA 4RHWA 4N1KA 2BBRA 1A1ZA 1A1WA 1DDFA 1N3KA 2OF5H 4IZ5E 1C15A 2M5VA 2KM6A 4E9MA 4N1LA 1DGNA 4M9SA 2N83A 4LWDA 4FH0A 1ICHA 1UCPA 2N1FA 4A2WA 2DBDA 1E3YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LWD A;  2GF5 A;  2L6A A;  4A2Q A;  1CY5 A;  4UZ0 A;  2MPC A;  4I16 A;  3KAT A;  1D2Z B;  2IB1 A;  4P4H I;  2B1W A;  4IZ7 B;  2NZ7 A;  4D8O A;  1D2Z A;  3CL3 A;  2N7Z A;  4NQK A;  4QOB A;  3T6P A;  4F42 A;  1FAD A;  3J63 A;  3MOP A;  2G7R A;  2OF5 A;  3EZQ A;  1CWW A;  2YQF A;  2N00 A;  1E41 A;  4JUP A;  2A5Y B;  2DBF A;  4EWI A;  2MB9 A;  3LQQ A;  3MOP G;  1PN5 A;  2YGS A;  2YVI A;  4M9Z A;  1WXP A;  2KN6 A;  2MN4 A;  2N97 A;  2D96 A;  2NSN A;  3CRD A;  2A9I A;  3MOP K;  4O6X A;  3YGS P;  2LWE A;  1NGR A;  3J6J A;  2P1H A;  4O7Q A;  4IZA B;  1WH4 A;  4ZBW A;  4P4H A;  1WMG A;  2DBH A;  4N1J A;  2DBG A;  3LQR A;  2F1S A;  2N80 A;  2L9M A;  4O9L A;  2HM2 Q;  3EZQ B;  4DWN A;  4M9X A;  2VGQ A;  4F44 A;  3QF2 A;  1Z6T A;  2LS7 A;  2DO9 A;  2BBZ A;  2O71 A;  4O9F A;  2MS7 A;  2MS8 A;  4JQW A;  4RHW E;  3YGS C;  2NAQ A;  2YU0 A;  1YGO A;  4RHW A;  4N1K A;  2BBR A;  1A1Z A;  1A1W A;  1DDF A;  1N3K A;  2OF5 H;  4IZ5 E;  1C15 A;  2M5V A;  2KM6 A;  4E9M A;  4N1L A;  1DGN A;  4M9S A;  2N83 A;  4LWD A;  4FH0 A;  1ICH A;  1UCP A;  2N1F A;  4A2W A;  2DBD A;  1E3Y A; 
#chains in the Genus database with same CATH topology
 2LWD A;  2GF5 A;  2L6A A;  4A2Q A;  1CY5 A;  4UZ0 A;  2MPC A;  4I16 A;  3KAT A;  1D2Z B;  2IB1 A;  4P4H I;  2B1W A;  4IZ7 B;  2NZ7 A;  4D8O A;  1D2Z A;  3CL3 A;  2N7Z A;  4NQK A;  4QOB A;  3T6P A;  4F42 A;  1FAD A;  3J63 A;  3MOP A;  2G7R A;  2OF5 A;  3EZQ A;  1CWW A;  2MJM A;  2YQF A;  2N00 A;  1E41 A;  4JUP A;  2A5Y B;  2DBF A;  4EWI A;  2MB9 A;  3LQQ A;  3MOP G;  1PN5 A;  2YGS A;  2YVI A;  4M9Z A;  1WXP A;  2KN6 A;  2MN4 A;  2N97 A;  2D96 A;  2NSN A;  3CRD A;  2A9I A;  3MOP K;  4O6X A;  3YGS P;  2LWE A;  1NGR A;  3J6J A;  2P1H A;  4O7Q A;  4IZA B;  1WH4 A;  4ZBW A;  4P4H A;  1WMG A;  2DBH A;  4N1J A;  2DBG A;  3LQR A;  2F1S A;  2N80 A;  2L9M A;  4O9L A;  2HM2 Q;  3EZQ B;  4DWN A;  4M9X A;  2VGQ A;  4F44 A;  3QF2 A;  1Z6T A;  2LS7 A;  2DO9 A;  2BBZ A;  2O71 A;  4O9F A;  2MS7 A;  2MS8 A;  4JQW A;  4RHW E;  2XV9 A;  3YGS C;  2NAQ A;  2YU0 A;  1YGO A;  4RHW A;  4N1K A;  2BBR A;  1A1Z A;  1A1W A;  1DDF A;  1N3K A;  2OF5 H;  4IZ5 E;  1C15 A;  2M5V A;  2KM6 A;  4E9M A;  4N1L A;  1DGN A;  4M9S A;  2N83 A;  4LWD A;  4FH0 A;  1ICH A;  1UCP A;  2N1F A;  4A2W A;  2DBD A;  1E3Y A; 
#chains in the Genus database with same CATH homology
 2LWD A;  2GF5 A;  2L6A A;  4A2Q A;  1CY5 A;  4UZ0 A;  2MPC A;  4I16 A;  3KAT A;  1D2Z B;  2IB1 A;  4P4H I;  2B1W A;  4IZ7 B;  2NZ7 A;  4D8O A;  1D2Z A;  3CL3 A;  2N7Z A;  4NQK A;  4QOB A;  3T6P A;  4F42 A;  1FAD A;  3J63 A;  3MOP A;  2G7R A;  2OF5 A;  3EZQ A;  1CWW A;  2MJM A;  2YQF A;  2N00 A;  1E41 A;  4JUP A;  2A5Y B;  2DBF A;  4EWI A;  2MB9 A;  3LQQ A;  3MOP G;  1PN5 A;  2YGS A;  2YVI A;  4M9Z A;  1WXP A;  2KN6 A;  2MN4 A;  2N97 A;  2D96 A;  2NSN A;  3CRD A;  2A9I A;  3MOP K;  4O6X A;  3YGS P;  2LWE A;  1NGR A;  3J6J A;  2P1H A;  4O7Q A;  4IZA B;  1WH4 A;  4ZBW A;  4P4H A;  1WMG A;  2DBH A;  4N1J A;  2DBG A;  3LQR A;  2F1S A;  2N80 A;  2L9M A;  4O9L A;  2HM2 Q;  3EZQ B;  4DWN A;  4M9X A;  2VGQ A;  4F44 A;  3QF2 A;  1Z6T A;  2LS7 A;  2DO9 A;  2BBZ A;  2O71 A;  4O9F A;  2MS7 A;  2MS8 A;  4JQW A;  4RHW E;  2XV9 A;  3YGS C;  2NAQ A;  2YU0 A;  1YGO A;  4RHW A;  4N1K A;  2BBR A;  1A1Z A;  1A1W A;  1DDF A;  1N3K A;  2OF5 H;  4IZ5 E;  1C15 A;  2M5V A;  2KM6 A;  4E9M A;  4N1L A;  1DGN A;  4M9S A;  2N83 A;  4LWD A;  4FH0 A;  1ICH A;  1UCP A;  2N1F A;  4A2W A;  2DBD A;  1E3Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...