1WH5A

Solution structure of homeobox domain of arabidopsisthaliana zinc finger homeobox family protein
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
80
structure length
80
Chain Sequence
b'GSSGSSGSSAEAGGGIRKRHRTKFTAEQKERMLALAERIGWRIQRQDDEVIQRFCQETGVPRQVLKVWLHNNKHSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ZF-HD homeobox family protein
publication title Solution structure of homeobox domain of Arabidopsisthaliana zinc finger homeobox family protein
rcsb
source organism Arabidopsis thaliana
molecule tags Dna binding protein
total genus 15
structure length 80
sequence length 80
ec nomenclature
pdb deposition date 2004-05-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1wh5A00
2EBIA 3BTLA 1FIAA 1FTTA 2JMWA 3QPSA 3CMYA 1MBHA 2E2IJ 5FJ8J 2HOTA 1I6HJ 2LLKA 1OJLA 5F04A 5J1YA 2YUSA 1S7EA 3LSGA 1PUFA 4IEJA 1DU0A 2GM4A 3ZQHA 4C3JJ 4C3IJ 1LFUP 2EZHA 2K9NA 1ZR2A 3IV5A 2ECBA 5C44J 3GTMJ 2CRGA 5EGOB 4FE7A 1HDDC 2JWTA 5IYDJ 2DMUA 1GDTA 4FISA 3DCFA 3HBLA 4DZPA 4J19A 4FTHA 4X1EA 5EZGA 3TP0A 2RAEA 4Y52J 1P7JA 5IP7J 2HXOA 3BG5A 2R92J 1U9NA 4D7NA 4QTRA 3GTQJ 5DTDA 1A5JA 2VUMJ 5FKOA 1JUSA 3GTKJ 3WHCA 4AYBN 1K83J 1QRYA 1MSEC 1XS9A 1UHSA 2IAIA 4L5EA 1UG2A 1IC8A 2K9QA 3BG3A 2NVYJ 2G0EA 1ETWA 3Q0UA 3CCYA 3FK7A 4JP0A 4DYCA 1MSFC 1Y1VJ 1U78A 2FQ4A 2QCOA 4JX4A 5JLWA 2R0QC 3MVPA 2H1KA 1WCMJ 4IHXA 3PO2J 1BA5A 3WHBA 1ZTRA 1O4XA 2JA6J 5E3LA 3W6VA 1CQTA 1T33A 4CYCA 4A3EJ 3OIOA 5FKLA 1U9OA 1ETXA 2CQXA 3TW7A 5E3NA 5F0HA 3C2BA 1JT0A 1JJ6C 1FEXA 1VFCA 4A3IJ 4A3BJ 4DYRA 3MN2A 4EEFG 2DA5A 1RKWA 2HOAA 3Q0WA 4DZJA 4XRMA 1U8BA 2JA5J 2DA6A 4M6VA 3MKLA 2VI6A 1JKPC 2GBYA 2LVSA 2I10A 3TW6A 3DEWA 3GTPJ 4A3GJ 4JYKA 3SFIA 1X58A 1WGXA 1ETOA 2KDZA 5GPAA 5EG0A 4BBSJ 3FK6A 2GLOA 4QIWN 3O8HA 3SDGA 1MBEA 2XB5A 4B3AA 1QVTA 3LSJA 3A03A 5K7ZA 2JK3A 1TWCJ 5M5XJ 3NARA 3BTJA 1SANA 3M3YJ 3ZQLA 2O8KA 1I50J 2OF7A 3I4MJ 1ETYA 4A3CJ 1APLC 2NOGA 5BNGA 1IRZA 2O7OA 5IOZA 1T56A 3BR6A 4XIDA 2DA7A 3VPRA 3BR2A 5EEAA 3BTCA 4X6AJ 3SJMA 1GT0C 2R5ZB 3ZOBA 2E2HJ 2DN0A 5FKNA 4A3FJ 1E3OC 5HODA 5FKKA 3S16J 2FX0A 2E1OA 4V2GA 2TRTA 3HB9A 5F0FA 2R7ZJ 2ME0A 1D5YA 1IGNA 4ABZA 2DA1A 3FIWA 3JR9A 4D5FA 4A3LJ 1W0UA 5FLVA 2ZB9A 4HNVA 3HOZJ 1HOMA 3LOCA 1ETQA 4UUSA 1BL0A 3S15J 3G1OA 4W1UA 1ZKGA 3H3VK 3FKIJ 5J1UA 4C3HJ 3Q0VA 3JREA 2FJ1A 1FTZA 3PM1A 1Z77A 2LP0A 3LNQA 3K2AA 3A01A 1WH7A 2LK2A 3JRGA 2NVQJ 1POGA 3JRDA 2L7MP 3JRBA 1LE8A 2JA7J 1W0TA 4A69C 4I76A 3TP3A 2E19A 4G12A 2LTPA 2VKEA 1IDYA 3S1RJ 4BBRJ 1TWGJ 2K40A 3H0GJ 2IEKA 4M3DA 1JJ8C 1B72B 4IHYA 1Y1WJ 2LY9A 3RKQA 2Y30A 2M0CA 1YRNA 5F1JA 1VI0A 2LR8A 1NK3P 4M3EA 1JTYA 4B4CA 2EZLA 2Y31A 5IYCJ 4XRSA 3QQAA 2XPVA 2DMTA 4DW6A 1RETA 2L7FP 1ZGWA 1RPWA 2XGCA 1FJLA 5GP9A 2DMNA 1K61A 1TWHJ 1BW6A 1AU7A 2CUFA 4AC0A 5IPAA 1ETKA 2L0KA 4RBOA 1GUUA 1P7IA 4C2MJ 2L7ZA 3GTJJ 1MNMC 3BR1A 3CDLA 5IOYA 4MFEA 4A3JJ 3GTOJ 2P81A 2JA8J 2ME6A 2XRLA 1AKHA 2R5YA 2N8GA 2IBDA 3UKGA 4Y7NJ 2MSYA 4XRSG 2EQRA 1JKQC 3S2HJ 4MO7A 5EDNA 5J1RA 5IP9J 4QSHA 2EH3A 2X6OA 2XPWA 1H89C 4M3FA 1LFBA 2CJJA 2CUEA 5DS9A 3S2DJ 3GBGA 1BW5A 2DJNA 2HQ5A 3IH4A 4B1RA 2YS9A 1OCPA 5M5WJ 4M3GA 3HGYA 3S1NJ 2DA3A 1HLVA 3HKZN 3S17J 3HOWJ 2PMZN 2L9RA 1H8AC 5EGOA 2X48A 3IH2A 1MBGA 1FIPA 3GTLJ 5IYBJ 3D1NI 4A93J 1B8IB 2CQQA 1BJZA 3HOVJ 1GV2A 2VKVA 2M2EA 2QF7A 1IUFA 5EYRA 4BY1J 1HDPA 3ZQGA 1DU6A 3BT9A 1R9TJ 4BXXJ 2MG4A 4DYQA 2R93J 2Y0SN 1XC5A 2ID6A 2HYJA 3RQIA 2DTZA 4XK4A 1GV5A 5M3MJ 4W97A 1Z0XA 4MFDA 1ENHA 3S1QJ 4NDLA 2OPTA 2EZKA 2DMQA 1GVDA 2XPUA 2H8RA 1IG7A 1RESA 2W48A 1ITYA 2K9SA 2VPRA 1TWAJ 1VNDA 2CU7A 2NVXJ 5C4JJ 1SFOJ 2Y9YA 1Q1VA 1JKRC 1MBKA 1OFCX 4A3DJ 5FLMJ 2JN6A 5E3OA 2E2JJ 1TWFJ 3G1MA 5EZHA 3BQZA 5C3EJ 1ZR4A 1EF4A 1A6IA 1X2MA 4MLOA 1MH4A 9ANTA 3E7LA 2AO9A 3JRCA 2KT0A 3HDDA 3G1LA 1JGGA 2ECCA 3RZOJ 4A3MJ 3S14J 5K7HA 1JUPA 2HOSA 1UMQA 1IDZA 3IH3A 1VF9A 5EG0B 4A3KJ 1AHDP 2LD5A 3K7AJ 4UUTA 2EZIA 2FD5A 3L1PA 1X2NA 3BR3A 3BG9A 1MBFA 3OSGA 3QPLA 1B8IA 1MBJA 1MH3A 3I4NJ 3ZQFA 2Y2ZA 3FISA 1IJWC 5F27A 3OSFA 2AHQA 2TCTA 4M3BA 5FKMA 4I6ZA 3O8GA 4JX5A 2R5ZA 4RDUA 4BY7J 4LOCA 2WB1N 1H88C 3B6AA 2XGDA 3JRFA 2COBA 1HF0A 3PO3J 2WAQN 2M8GX 5IP6A 4MIMA 1I3QJ 2DA4A 5C4XJ 3B6CA 2LKXA 2JJ7A 1JKOC 1QVUA 1WI3A 1RKTA 3A02A 3ZQIA 1OCTC 2YU9J 3HOXJ 2NS8A 1IV6A 1NK2P 2B63J 4IHWA 4UUSB 3HM5A 2D5VA 1JUMA 2MW8A 5F08A 2HXIA 1JTXA 1PUFB 3OOUA 3BQYA 3BR5A 2MGQA 5GPCA 3JRAA 3A01B 4JX6A 4FE4A 2NS7A 3M4OJ 3HEFA 1F43A 1LE8B 2HI3A 3Q3SA 3ZQCA 5JLXA 2DA2A 3HGGA 1B72A 1HCRA 2ELKA 5K7FA 4AUXA 4S0HB 3HOYJ 3S1MJ 3NAUA 1RR7A 1ORKA 4IHVA 5J3LA 3RZDJ 5M5YJ 3BTIA 4D5CA 2O9LA 1YRNB 1ETVA 2M9HA 2WV1A 5E3MA 4V2FA 4GFBA 2NVTJ 3LSRA 1QPIA 3JRHA 3TEDA 3F0CA 3HOUJ 1JT6A 1XG1A 1ZQ3P 3GTGJ 2M34A 3BR0A 1WPKA 4CYCB 2DMPA 2LFBA 5EF6A 1TC3C 4D7MA 2HDDA 2Y9ZA 2XGEA 1WH5A 1ZK8A 5F0CA 3JRIA 3LSPA 2XSDC 2XB0X 1AKHB 2R5YB 3CQZJ 1G2HA 2ID3A 5M3FJ 1NTCA 4BKXA 2X9DA 1F36A 4XICA 4FCYA
chains in the Genus database with same CATH superfamily
1BI2A 1O3SA 3CCMI 3HYIA 3FMRA 1S7AA 5JR3A 3GZ5A 1SMTA 3TQNA 5J1YA 2P5VA 4YFNF 2O5RA 2R3SA 3DKWA 1JE8A 4F52A 2R7SA 2EJRA 3DXJF 2OU2A 4IEJA 4PUSA 3WG7H 2IS1A 4BJTA 1WKMA 5GTIC 1LFUP 3J7YJ 2X51A 4LK0F 2K9NA 2UZKA 1ZR2A 1GHCA 1FOYA 2LBFB 5EGOB 1HDDC 1IV8A 5IYDJ 1EKEA 2X1EA 2KISA 2FU4A 2RQQA 4F3QA 4L5JA 4KFCA 5TISC 3TP0A 2RAEA 3GW2A 3KLOA 3GTQJ 2RKHA 3N05A 2F5FA 3DF8A 4F55A 3TO7A 1X4PA 1IF1A 1K83J 4PFOA 4Y4RA 1MSEC 4OIRF 1XS9A 2OAZA 3M1EA 3C18A 2G0EA 1ETWA 5LGTA 5KCMA 1QHHD 4DYCA 1Y1VJ 1SFXA 4Y3OA 4EMSA 4U0VA 1IXCA 2K9MA 1ZTRA 3IHUA 5B66C 1O4XA 4Y15A 1CQTA 3W6VA 4ZYGA 3VYTB 2A05A 1JT0A 1ZREA 1HKSA 3TDZC 5F0HA 1TW2A 3DBHB 1R49A 2XKPA 3CUQB 3W2VA 4EATA 1F1ZA 1FNNA 2KRHA 1T38A 2HZDA 3BCBA 2OTJI 3HRTA 2PQ8A 4EEFG 4ENMA 1RKWA 3Q0WA 1K4SA 4M74A 3U9GA 1ZGAA 5H6RA 1JKPC 2GBYA 2JSCA 2A07F 4QPOA 3F8NA 2CV2A 1Q1HA 3MQ0A 4JYKA 4LD5A 3OWTA 1BIAA 3K10A 4RAZA 3SFIA 4XN3A 5GPAA 4P9UA 3RJPA 1IO2A 3FK6A 3I9V2 4HPQA 4QIWN 3SZPA 4ENNA 3O8HA 4B3AA 2HDWA 4HX7A 2A3SA 2W85A 3A03A 4I98B 1IAWA 1MD0A 2Z99A 1VQ8I 4LK1F 4BJ6C 4TV7A 2VE8A 2QSHX 1XCVA 2QLZA 2EINH 1X1DA 3DTIA 5DD4A 1SANA 4HYEA 4CYDA 4E7ZA 4I09A 4UV9A 4XLCA 4XKWA 3H0DA 4FX4A 3H3UA 4PSWA 3BC8A 4KIGA 5ILVA 5BNGA 2AXTC 2BVMA 3WGGA 5IOZA 1T56A 4O6JA 1RNLA 2DA7A 3FZVA 1KGSA 4IPAA 3DTKA 3DLLF 1BIBA 2HU9A 2M30A 5EEAA 1TLHB 3G6EI 1WJFA 2R5ZB 3K0LA 2E2HJ 4XKVA 5D8LB 2OD5A 2DN0A 5E8IA 1T0FA 3ZQQA 4A3FJ 3PUBA 1P4XA 5HODA 2DK5A 2G7HA 3OV8A 4BE1A 2FX0A 4PCQA 4BE0A 2EA4A 3BROA 3K4KA 3BY6A 1XMKA 5F0FA 2QVOA 1R1TA 2KZGA 3IAM2 1DQUA 3SHFA 3UNGC 5AONA 1IGNA 1ZARA 4OIQF 3JR9A 2VC1A 4A3LJ 3M1CA 5J4VA 2ZB9A 3LL7A 1HOMA 3H9QA 2ZNYA 2CQNA 1YIJI 5JFRA 2E7XA 3V8LA 4EGYA 1IN6A 4ZDOA 3OS0A 1FSEA 2WAEA 5CVIA 5FB2A 2RVCA 3Q0VA 2H94A 3FX3A 2LP0A 3KZIC 2NRAC 4BXUA 2ISYA 2LK2A 3CZ6A 1ZGJA 2NVQJ 5IT9K 3JRDA 2ZFWA 1IN4A 2HTJA 2L7MP 3DTEA 1FP1D 2MLKA 2OCCH 1K78B 4A69C 5DUIA 2X0LA 3ERED 3TMOA 4NQWB 1USSA 3L2QA 1IDYA 4F91B 5D5WB 1DUXC 1BR4A 1R5ID 2KIMA 2IEKA 2P6TA 3H0GJ 3OL3A 4XQFA 1B72B 1UELB 3RKQA 2Y30A 4HQEA 1MMGA 1T95A 3R0AA 1MDMB 3WGIA 1IRXA 1VI0A 1D8JA 2HNHA 4M3EA 4YEJA 4RAYA 2NNYA 5F1RA 1VQ9I 3ECHA 5IYCJ 2BHYA 4U7BA 3FHNA 3I3LA 1QGPA 4RS8A 1G3YA 4DW6A 1RETA 3CCEI 2E5ZA 5J6XA 1J2XA 1FBSA 2BEOA 2ZMEC 2XKOA 1K61A 4L9NA 1AU7A 2GA2A 1XTAA 1ETKA 1G3SA 4RM3A 4WWCA 4C2MJ 2Z5UA 3HPHA 2P4WA 4M6YA 2ZSIB 3CDLA 5IOYA 2QKLB 1OYYA 4M9ZA 3TBIA 4HNUA 3ZN1A 1CGPA 2H8WA 4Y7NJ 4MEYF 2EQRA 1JKQC 1W5TA 3S2HJ 2RQPA 5EDNA 2QSGX 4PSXA 1K7AA 1X3WB 3F8MA 2BOLA 4C2UA 3CP2A 2DT5A 5HLHA 1J09A 1I5ZA 5CVVA 1O3TA 4PFPA 4BEHB 4ZC3A 3IP4B 3OS1A 1LDKB 1VQ5I 3OOPA 4AVZA 3H92A 4O5VA 5HDGA 2FNAA 2LY1A 2QUFA 3HGYA 2Z1DA 4OIOF 3G3ZA 2PMZN 2X6WA 2RC4A 3PQJA 1YI2I 1ZRDA 3OIQA 1MBGA 1FIPA 2WADA 2IPQX 4RGUA 4BACA 1UJ8A 3N4MA 1HQCA 1MIJA 3FXOA 4CZCA 1FP2A 3PNTA 2HQNA 3HKZA 3HSEA 3HOVJ 2ZXJA 4B48A 5HS8A 3FM3A 4UV8A 4XSZF 2Y69H 4I7HA 4E7KA 2MC4A 4BY1J 3K4BA 3ZQGA 4IO9F 3OYMA 1SD7A 3VYSB 4MQ9F 1I39A 1W36D 2K3FA 2MG4A 2PG4A 2Y0SN 1NG7A 3ABUA 1JGSA 2ID6A 3P9CA 4Y17A 4EM1A 4XLPF 1J7KA 2P6SA 3E6BA 5M3MJ 2K85A 3S1QJ 2QEXI 4PGGA 3I64A 1FX7A 3NRVA 1GVDA 3ABTA 2XPUA 1PJRA 1RESA 3IKTA 2PEXA 2W48A 3VSKA 4AVPA 2K9SA 2VBYA 3KFWX 2CU7A 4KICA 3RYRA 3C7JA 2AXLA 3LAJA 2NVXJ 1MMAA 1J59A 1XCBA 3JCUC 1MBKA 3W2WA 3RQ4A 4NB5A 4A3DJ 5FLMJ 2KIQA 5EZHA 4KNYA 1DP7P 5E8GA 1EF4A 5J47A 1X2MA 3GFLA 3FF5A 1G4DA 2BXZA 2HWVA 3G2BA 2OZ6A 3H35A 2JRTA 3LSKA 1JUPA 3GZ6A 3MZYA 2NXNB 2VJ5A 2QKMB 1VF9A 2QQAA 3TO9A 4IJAA 2FUG2 3K7AJ 1E2XA 2PJPA 1LFPA 2FD5A 3GX4X 3VFZA 2EWNA 3OR1C 2CW7A 2BY0A 1XGMA 3BR3A 1YITI 4IXAA 3QPLA 2CYYA 1XN7A 1A35A 1MH3A 3H5NA 1AA7A 2QQBA 3I4NJ 2M3AA 4HAMA 3ZQFA 4EGZA 2DYRH 1QQIA 1X1AA 1Z67A 1IRGA 5CPRB 1TNSA 3D5LA 3GFIA 3EPZA 1R36A 2LOOA 2F48A 2R7OA 3FISA 1K79A 2XROA 4HW0A 3OSFA 4ZTFA 2AHQA 4UB8C 1SFKA 5FKMA 4I6ZA 3O8GA 3NWSA 2QQ8A 2Q1ZB 4PZJA 3CUOA 2DPUA 3QWLA 2CUZA 1RC9A 4RDUA 3ZGKA 4BY7J 4UHTA 4XORA 1U5TA 2WB1N 4HRIA 3OYKA 2VBZA 2XF7A 5CQEA 3PO3J 4R8HA 1G8XA 3E6DA 2QQ9A 4JBAA 3GCMA 5D6FA 1O7FA 1J9IA 6PAXA 1TQIA 2M0MA 1I3QJ 3CJQB 4I01A 3IRQA 2YPRA 1LVAA 2DA4A 5GTHC 3B6CA 1YW9A 1Y39A 2LKXA 2WY8Q 4AIKA 1OR7C 4UNOA 1QVUA 1OCTC 2W57A 2R7RA 2STTA 3FXMA 3EUHC 1WWXA 3I53A 1FMVA 3EETA 3HOSA 4J00A 4RB2C 3R4KA 3HM5A 2QGUA 2K27A 5F08A 2EILH 1PUFB 1TBXA 2V7FA 3BR5A 4HF0A 3IWFA 4NC8A 1ON2A 1BI1A 3H36A 4FE4A 5HNFA 3CF2A 2NS7A 3PUFA 5D4RA 5JVGF 3HEFA 4G7ZF 1R5HA 3FBIB 3M4OJ 2GXGA 4BAYA 4NBQA 3REOA 3EDPA 1Z7LA 2OA4A 1O57A 2DA2A 5JLXA 2F5EA 1R5GA 3HGGA 3CCVI 2ELKA 1FOXA 2FEZA 4WK8F 4N4OB 1K6OA 3GLLA 4UB6C 1P92A 3R6SA 1X1BA 3DV8A 5KAFC 3K9TA 2FE3A 1K6YA 3BTIA 2ELJA 2JPBA 2M8EA 5FGMA 4L9TA 1OYIA 4CCMA 3KP6A 1MNEA 2IP2A 2WV1A 1YHQI 5E3MA 3DPLC 2D45A 3LSRA 4PJLA 2P7CB 5HLTA 4MGRA 2H1LA 4M73A 1YYVA 2P8TA 1YX3A 4BJ5C 1ZQ3P 2MD0A 3RTRA 2CUJA 3DU5A 4D7MA 3K70D 2DFHA 2RNJA 2Y9ZA 1RZ4A 2TDXA 3FXRA 3LFUA 2XSDC 1YW8A 1NH3A 5BPDA 5M3FJ 4P96A 3U2RA 3GF2A 3J80Z 1F36A 3ABKH 3F3XA 3PL8A 1KA8A 5HS9A 1SAUA 5J40A 1GLNA 1HC8A 1FTTA 3MKYB 3ML6A 1MBHA 4HEA2 2KJCA 1I6HJ 2LLKA 3OYCA 2B7EA 2YUSA 4WX9A 1T8IA 4V19K 4QLCU 4Z2YA 1VQKI 1N75A 1U0JA 3TO6A 1DU0A 2GM4A 2COMA 4BU2A 2FF4A 3AL0B 2K02A 1PDNC 4LG0A 3AL0C 1ZH5A 2JWTA 4IF4A 2EFOA 3DCFA 4DZPA 1SD6A 2HTSA 1XDSA 2YR2A 1LEBA 1P7JA 1VQ6I 2HXOA 4MTDA 4ITVA 2VIXA 2Q8KA 1CF7A 2VUMJ 5FKOA 1Z7UA 4FX0A 1KZHA 2B9SA 4AYBN 3OR2C 1FT9A 4F92B 3F6VA 2ZJRF 2M7BA 5CJ9A 3E5UA 1KU2A 2L02A 2WY7Q 1QPMA 5GAEJ 1BC7C 4L5EA 4IKFA 1H9TA 1BR2A 4AIJA 3BG3A 1L3LA 4BHBA 2EIJH 3LWFA 4ZZLA 4ZDPA 3K4CA 2KQRA 3Q0UA 3HHHA 3K1MA 5FRNA 2AS5F 4HF1A 2QCOA 2O0YA 2QBYA 1PP8F 3MVPA 1BA5A 4B8XA 4I0AA 1S29A 2K86A 2JA6J 2X1DA 4AWXB 2KRCA 4CYCA 3OIOA 5FKLA 1U9OA 4FHTA 1ZYRF 2A68F 3C2BA 3F8FA 3SZTA 5E3NA 1FEXA 2DXIA 1D0ZA 1XX5A 1VFCA 5D5XB 2VBWA 4I2OA 2ESNA 4G8XA 4A3BJ 4DYRA 1B1BA 2LRDA 3K4JA 4YIRX 2HOAA 4H4KC 1F9NA 1X19A 1SD5A 5HS7A 4IQJA 2VI6A 3KEOA 3OYNA 2I10A 2V1DA 4A3GJ 1LEAA 2HR3A 2R7TA 1Y0NA 2VC0A 2ZXIA 2F4IA 1XD7A 2KLOA 3HZJA 4A0ZA 3RCOA 4IRGA 2OV7A 2F5VA 3SDGA 2XB5A 4MNUA 4G7OF 1QVTA 4WXHA 2FBHA 2JK3A 3F9KA 1TWCJ 2A6TA 3NEUA 1I6XA 4HSTA 3BTJA 4KMFA 3I4MJ 1I50J 1P9QC 2OF7A 5BOXA 1Y0UA 2EIMH 3S2WA 1ACIA 2PMZA 2PI0A 2MC3A 3CC4I 1HA8A 1R71A 3ZCOA 5DM6F 1S72I 1IRZA 4RGRA 1SFEA 2B0LA 2UXNA 2OBPA 3BR6A 3OYHA 2KDOA 2BV6A 3VPRA 2DDBA 3BTCA 4X6AJ 4DNCA 3SJMA 1GT0C 1JI8A 3L2RA 4EV0A 2GXBA 1FBQA 3VYRB 2DBBA 4PK4A 3I59A 1W5SA 5H2FC 3I55I 4DJAA 3S3NA 4A0YA 1IXRC 5KVRA 5IY5H 1KU9A 1NHAA 2FNPA 5FKKA 2F4MB 3W3CA 3S16J 3KYCB 3JSPA 3QYBA 2R7ZJ 2Y0SA 3QP6A 2ETHA 2FOWA 3LFKA 3FIWA 1S5LC 4XLFA 4AD9A 1HSTA 2BY3A 4HNVA 2FRHA 2GA1A 2HVQA 4UUSA 2JZYA 1I3AA 3M07A 2BW3A 3PJRA 4W1UA 1ZKGA 3FKIJ 2O8XA 4C3HJ 2FJ1A 3MD2A 1Z77A 3LNQA 1X3ZB 2ZO4A 4XOPA 4LIUA 1YW7A 2M45A 4HSRA 5L3BA 2RDPA 1V5EA 3JRGA 4NNJA 5LHIA 3HUGA 1LE8A 2JA7J 4JOMA 4AM3A 4I76A 3K4NA 1ZG3A 3VB2A 2XGXA 2GXAA 1OKRA 3QPTA 3CMMA 3S1RJ 1UG0A 3FXKA 2K40A 3DBRB 4BBRJ 5F6FA 4HV6A 1D1CA 3ULQB 2ZJPF 2LY9A 1Y1WJ 2WV0A 3LMMA 2L54A 1S9HA 3EYYA 3MZ8A 3A1YA 1JTYA 3ELKA 4B4CA 2W84A 2QSFX 3W6JB 4C9YA 1XB4A 4XRSA 2A5YB 3QQAA 2JT1A 2DMTA 2VXDA 2EFPA 2P0WA 4KITB 2EFNA 3JAMK 4A5MA 2L7FP 1ZGWA 1XMAA 5GP9A 3O6BB 3BDDA 2Q2EA 1BW6A 2GOMA 2CUFA 3J81K 4AC0A 1GUUA 1ZLJA 1YO5C 3J7ZI 4DIQA 2MYSA 2L7ZA 1VQMI 3GTJJ 1HW1A 4L9JA 3CD6I 5LGUA 4BQAA 4MFEA 4A3JJ 2P81A 2XAUA 3CUQC 3KEYA 4M72A 2JUCA 2N8GA 4BQNA 2R5YA 2IBDA 3UKGA 4GXOA 1WZ2A 1H9GA 2E1NA 2VOPA 1Y6IA 1DGWY 3KYLA 2WB1A 4QSHA 1R00A 3QYFA 5E79C 4I0BA 3MMYB 1LUJB 2QA4I 2XPWA 4FASD 5D5VB 3L9FA 3S3MA 5BQTA 1Z1DA 2PMUA 1BW5A 4UVAA 1WJEA 3U1DA 1FOKA 1TTYA 5JVTA 3QAHA 4EJTA 4M3GA 3S1NJ 1JHHA 1P2FA 1FYKA 2K5CA 4DBQA 3HOWJ 4A12A 1H8AC 2CQKA 2M87A 2X48A 3IH2A 3KP2A 4N0BA 5J4YA 1YJ9I 2IW5A 1M1EB 2X85A 4LG0B 5IYBJ 2V1NA 4A93J 3V8JA 3ZMVA 2CQQA 5D4SA 1N25A 1P4WA 4XN0A 1BJZA 1B8IB 2XAGA 3HIFA 1GV2A 1W7PD 1P4AA 4LB6B 3E5XA 2QF7A 3E5QA 2CFXA 1R22A 5EYRA 2V9PA 2HDCA 1CF7B 1DU6A 3NQOA 3BT9A 4II3A 1E3HA 2IS6A 2A6HF 5BS6A 4DYQA 2R93J 2K3PA 1XC5A 2HYJA 1WSUA 2DTZA 4UVBA 2BE5F 2KHMA 2UUZA 1Z0XA 4OU0A 1ENHA 2DFFA 4S05A 2EZKA 2DMQA 1UHWA 4MEXF 2QBYB 3PIPF 3RPQA 1ITYA 5K5QA 3HTUA 1W7PA 1REPC 3CMEI 1XSXA 4FQGA 1IRFA 5C4JJ 4BDYA 2EB7A 2OTLI 2G7UA 4RB1A 2EPFA 4MQVA 1FY7A 1WHUA 5E3OA 2E2JJ 2VJJA 3C2HA 3BQZA 1FWZA 4MLOA 5BPIA 3PFYA 4QWQA 9ANTA 1LDJA 1KONA 4XLNF 5LRRA 2AO9A 3HDDA 5D5UB 1MW7A 3G1LA 4L0YB 1A36A 1WRJA 1X1PA 2E1CA 4ASNA 5K7HA 1QBJA 3HSFA 1UMQA 2OC6A 4AIDA 4RA2A 1ZAOA 5HOOA 1D0XA 1AHDP 2FBKA 3K69A 1T6SA 1BOBA 3P9IA 1F4KA 5IT3A 5ILUA 1QHGA 1X2NA 2LYCA 4NUBA 3HG9A 3AG4H 3DFGA 2VT3A 2F4OB 4XLAA 1BOAA 3F72A 2FQ3A 4FETA 4ZH4F 4L9VA 2MH2A 4BL0B 4ESBA 1YTYA 2ZJQF 4NHJA 2V9KA 3BG7A 5E17F 2TCTA 2E1MB 4R1HA 3OL4A 4U0WA 4H0EA 4KUMA 3IL2A 2HQAA 3HRUA 4HZFA 3A0HC 1ERDA 1HW5A 3QU3A 2NYXA 2XGDA 3T1BA 1IUYA 1HF0A 2R7DA 3I59B 4R79A 2JUGA 1Y8RB 3MWMA 4FT8A 2YX7A 5E1ZB 4AYBA 1USTA 2V6CA 2VLAA 4OAZA 5C4XJ 2IGNA 2ZXHA 1GXPA 2EV0A 3EUAA 5CYVA 4HQMA 3P7NA 2WC2A 4CUGA 4RGSA 2QENA 1OCRH 1RKTA 3ZQIA 2YU9J 3H9GA 3HOXJ 2DOEA 4IZZA 3SQNA 1VZ0A 5DCMA 2NS8A 5ILSA 5KHDA 2HS5A 3S8PA 4P9FA 4UUSB 3COAC 2D5VA 1EJ9A 1JUMA 1KQ8A 1I1GA 2BW3B 2MW8A 3W2AA 2HXIA 2DYSH 3CCUI 3ZP5A 2DK8A 4OMYA 3H9JA 4YIIA 2Y48A 5DUKA 5GPCA 3JRAA 1U6GA 3VSLA 4ENJA 2BHZA 4CSWA 3OYIA 3HUGB 1YS6A 2QZ8A 3DLAA 1LE8B 3QOEA 4KMUX 5E20A 2LH9A 5K7FA 4OINF 4MHGA 2Z2SB 2XAJA 3CJRB 1RR7A 3IWZA 4B09A 3HOYJ 3H3ZA 5J3LA 1XMXA 3LQQA 5LHGA 4KT6A 3KZYA 1E0EA 1MKMA 1WFXA 4YFKF 3ZMSA 5ICFA 2H09A 4CZZA 3HTSB 4V2FA 4C2TA 2NVTJ 3TKYA 2HKXA 2FA5A 4KISA 3JRHA 2F5DA 3F0CA 2Y75A 3TEDA 3X2QH 2VOOA 1SAXA 3M7GA 1VQ7I 3HOUJ 3MZHA 3ABMH 4RGXA 2IA1A 2L9SA 1UCRA 3JSOA 3LSHA 2LFBA 2E36A 1YS7A 3FMQA 4G6QA 4GYGA 3KYDB 1WH5A 2MD5A 5F0CA 2YX4A 3JRIA 1I1SA 2C6YA 2RN7A 3ZMZA 1QZEA 2R5YB 3CQZJ 1G2HA 4B43A 2ID3A 1ODDA 2R7XA 2X9DA 3HSRA 3WTXC 4XICA 4FCYA 4EJWA 2EBIA 4HDVA 1ZG1A 1FIAA 2IS4A 5EJCA 3J7AY 2E2IJ 2HOTA 2E7WA 4U87A 1OJLA 2E60A 2WTEA 4CXFA 3KCCA 1ZN2A 2MH9A 4JK1X 2OQRA 4LG3A 2DQLA 3V4GA 1HBXG 3PNVA 2DODA 3OYGA 3CC7I 4WF2A 4C3IJ 4C3JJ 5LEJA 4K2EA 3M8EA 2YSRA 3OMYA 2ECBA 3GTMJ 4A6EA 3MAJA 1G3TA 2VT2A 3KLNA 4FE7A 2R7UA 2K7LA 2JPCA 2DMUA 1KU3A 4YFXF 4FISA 1GDTA 1FLIA 4FTHA 4X1EA 2X6YA 5K5OA 4HA8A 3BG5A 2PN6A 2R92J 4D7NA 2IXSA 4QTRA 2PJRA 2XIGA 2V1XA 4XKCA 3T8TA 1MZBA 1Z3XA 2L3DA 3TGNA 3GTKJ 2LDUA 5LD2C 1EA3A 3WHCA 3FMSA 1IZ1A 1LNWA 1DPUA 3HRMA 3IAS2 2K9LA 1UHSA 1YLFA 2IAIA 1IC8A 1OQYA 3PSIA 2ACJA 2DT6A 2X6XA 2XC7A 1T0FC 4JP0A 1MSFC 3L2UA 1U78A 2FQ4A 4IHXA 1HKQA 5JLWA 1WCMJ 1EV7A 1GXQA 1S3JA 1FZPB 3E0JB 2R4GA 3AKZA 4A3EJ 2CMPA 3VYUB 3GVAA 1W7PB 1ETXA 2CQXA 1LVKA 5K1YA 1JJ6C 2LREA 2KRFA 3SDBA 5LHHA 2JQ7A 3H5RA 3T8RA 4A3IJ 4LLGF 3OYLA 2DA5A 4DZJA 2XASA 2L4AA 4CH7A 1ZRCA 3GZNB 3MKLA 2LVSA 1UFMA 1FPQA 2XHKA 3WU1B 5FD5A 3CLQA 3TW6A 4I02A 3ZXSA 3DEWA 2XDVA 3G71I 1MGTA 2CS3A 4BHCA 2VXZA 1ETOA 2WAFA 2KDZA 3FXJA 2CV1A 4PJ0C 4IQ4A 2WA0A 1HXDA 1MBEA 5AIPA 1R1VA 3LSJA 1YOVB 5K7ZA 2VQLA 1TT0A 3CCLI 2LBFA 2AQEA 5L3GA 5M5XJ 1T98A 4E7LA 3NARA 3CMAI 3ZQLA 2MFZA 2E5NA 5DEQA 1APLC 2NOGA 2ICWG 3GEZA 2PMHA 3DWLE 3BWGA 4LITA 3OYEA 4ZYEA 2P7VB 2VKDA 1QNTA 2W24A 2Y0MA 3BR2A 5FO5A 4JQFA 3ZOBA 5LBQA 4PJNA 1WJ5A 2E71A 5B1AH 2I8DA 3K1NA 3E97A 4BQOA 3A0BC 4L5IA 2E1OA 4V2GA 2JA2A 3S93A 2ME0A 3F21A 1X1CA 4ETSA 2DTRA 2KPMA 1D5YA 4ABZA 2ISZA 2FBIA 4D5FA 1W0UA 4E4HA 5FLVA 4ZJZA 2XVCA 3HOZJ 3LOCA 2XSJC 3M8JA 3U1KA 1R58A 2M4KA 1BM9A 2VN2A 4N9IA 1YFHA 1Y56A 1BL0A 3S15J 3G1OA 5TGTA 4BUPA 4GCVA 4B3XA 3E6CC 3PM1A 1B6AA 2CFOA 5H20A 4G9YA 3A01A 1DP3A 1WH7A 2O03A 5EEHA 2V1UA 3JRBA 3OS2A 1W0TA 4KJZA 3TP3A 2F6CA 4G12A 2LTPA 4EM0B 2HOEA 1TWGJ 4EJUA 3MFKA 1J5YA 2E34A 4IHYA 3S32A 4ZYDA 3KP4A 2M0CA 4M9SA 3F6OA 1AWCA 1YRNA 1X4OA 1DPRA 1WQ2A 2LR8A 2ZXWH 4I99C 2KMUA 3VOEA 1NK3P 4F7ZA 3D0SA 2FSWA 2EZLA 5ED4A 5B1BH 4KYWA 2KZVA 2XPVA 2RGVA 2KKOA 3GUDA 5JHUA 2FMYA 2H6CA 2L7KA 2XGCA 3C2GA 5LRSA 3SFZA 4G6TB 4E70A 1YJWI 1TWHJ 1SEUA 1ZELA 3ERMA 3HOTA 2LMDA 5IPAA 2L0KA 4RBOA 2EV6A 3WTWC 3KE2A 5FRMA 3K2ZA 1UAAA 4IRHA 2JA8J 5DV5A 2ME6A 2XRLA 1AKHA 2BVLA 2O61A 3ESWB 2QYOA 2MSYA 3T0YA 2KP6A 4KA4A 3F8CA 3P5JA 4MO7A 3HL2A 1W36C 2OUMA 4A2UA 5J1RA 3ECOA 3M8FA 2R7VA 1IN7A 3IC7A 5FLXK 2HZTA 5DM7F 1LDDA 3ZMUA 1H89C 2A61A 4M3FA 1T39A 2CUEA 1BR1A 3GBGA 3F23A 2DJNA 3IH4A 2XF5A 1S6LA 3ZN0A 3DEEA 1PYVA 3BLYA 2YS9A 2X4HA 1OCPA 4LJZF 5M5WJ 4U7DA 4UVCA 2DA3A 4LFUA 3HKZN 4ZYHA 3S17J 1P6RA 1D5VA 3J80K 1D0YA 2KL4A 2YU3A 3GTLJ 5HNHA 1TZLA 2VJ4A 1O7LA 1K78A 1D1AA 1JXSA 4PGHA 2ZJ2A 3RIRA 2VKVA 3F22A 4RM2A 2HPMA 2M2EA 2HYGD 2DFEA 3RSNA 2DCEA 2OJED 4BYYA 3O2PE 1A04A 4UUVA 1T08B 2EIKH 1MNDA 2HGCA 3FM5A 1R9TJ 4BXXJ 4II2A 4ZZDA 3RQIA 4XK4A 1U5TB 3ROUA 1U5TC 4XBFA 1R4MB 4MFDA 2ZMEA 1TNTA 1UZCA 2OPTA 5JHFA 1W1WE 2Z16A 4YG2F 2J5PA 1SVMA 2VJIA 2NVUB 4Q4ZF 1VQNI 2LC2A 2MLGA 3WODF 2Z3YA 1XPXA 2R7QA 1VNDA 5DD8A 1WJCA 1MJAA 3RKYA 1SFOJ 4IL6C 4A0XA 1A31A 3TOAA 4IX7A 5FROA 1Q1VA 1JKRC 1OFCX 2VQHA 5A2QK 1TWFJ 3G1MA 5C3EJ 3WU2C 3HHGA 4XM3A 1MH4A 2L9VA 3WTTC 3VEPA 1LKXA 3E7LA 1UB9A 1TT5B 2FOKA 2XV4S 1PP7U 2CO5A 1TQMA 1H0MA 1O3RA 3DU6A 4D0PA 1JGGA 1HW2A 3WTYC 2CW8A 3BJAA 3S14J 3RZOJ 2M5WA 1WJAA 2HOSA 3IH3A 4PDKA 3GWZA 3WE2A 2HVRA 4HOBA 4HV5A 1FYMA 5KNLA 3MKZA 4IRIA 3BPVA 4LMYA 1VQPI 2G9WA 4DOZA 3K4LA 2DPDA 3I0TA 3G73A 2GIVA 1MBFA 2QM3A 4KDPA 2W00A 1MBJA 4Y33A 4XL9A 4BH9A 1OCOH 4ZDLA 4F93B 2VQGA 2PX9A 4IHSA 3DQVC 2Y2ZA 5BMZA 3BJ6A 3KP3A 4UXNA 1IJWC 3VODA 1XGOA 2AQFA 4M3BA 2W4SA 3P9KA 3L2WA 1R4NB 2IA0A 3CCJI 4CCOA 3RPUD 1MJ9A 1U2WA 4LB5A 5LEKA 4LOCA 1YE9A 1H88C 3OYAA 3RKXA 3B6AA 2COBA 2EFQA 3ISPA 2IA2A 2WAQN 1BBYA 2M8GX 5IP6A 4MIMA 2ZCWA 4BE2A 4ZTJA 3QRFF 2HYFA 3E3VA 4G94A 2CWEA 4Y13A 2JJ7A 5IT9Z 1JKOC 2ZNZA 1LPQA 4U0YA 1WI3A 1L0OC 3ZQ7A 3ASNH 4A5NA 1IV6A 1NK2P 2B63J 4UY8I 4D9JA 1R7JA 1RI7A 3RPUA 1F5TA 1J0RA 5CLSA 1JTXA 5D8KB 3OIPA 1FSHA 3K70C 1OPCA 3A01B 3V7SA 4GRIA 3V7RA 3GFJA 2HQRA 2R7FA 2ELHA 4P55A 5GADJ 2JVGA 3BG6A 4E7HA 2VPLA 2IGMA 1STZA 5CVJA 2D1HA 2K4BA 1S8NA 2CGPA 1YQAA 2XAFA 2ZFUA 3RDIA 4AUXA 3LSTA 4IHVA 1ORKA 3QPHA 2CV0A 5K5RA 2F5CA 1ONVA 4GGGA 2Z9OA 4D5CA 2O9LA 2DO7A 1YRNB 4EVIA 4EJOA 1ETVA 2M9HA 1XSDA 3I71A 3HJEA 2OCEA 2VE9A 4GFBA 4GDFA 4QPQA 3ZPLA 5DCFA 4CHUA 3CTAA 2R7WA 1QPIA 5DDGA 1JT6A 1WI9A 2BYVE 4LLLA 2VQCA 3BR0A 2W25A 1WPKA 4CYCB 4E7SA 5EF6A 2BY2A 3Q9SA 4BHPA 2A6EF 4P1WA 1EH8A 1NG6A 2XGEA 1ZK8A 2E35A 4PJJA 1AKHB 4BNCA 2ZKZA 1BI0A 2ZC2A 1G3WA 1Z91A 1OR7A 2UWMA 3NWTA 3E1SA 3KP5A 1SFUA 2GQQA 3BTLA 4IVNA 3EUHA 4XONA 2LG4A 2GWRA 2JMWA 3QPSA 3CMYA 5FJ8J 5H6QA 5F04A 3BZ6A 3HC7A 1S7EA 1OCCH 3LSGA 4G6DA 5L3FA 3RKWA 1PUFA 2ADUA 2I5UA 2KIFA 4RAGA 3ZQHA 2CH0A 5KAIC 2CG4A 2EZHA 2JTVA 3WE3A 1QZYA 3IV5A 4BQQA 5C44J 3IRRA 3V7CA 3OYBA 4IHTA 3VWBA 2CRGA 4PJMA 1E3PA 5TRDA 2CQ7A 5F64A 2MBFA 3HBLA 2FXAA 4XLEA 4J19A 1AOYA 5EZGA 4Y52J 5LLQA 5IP7J 1U9NA 3PNYA 4AIHA 3DP7A 5DTDA 1A5JA 3HXLA 4P5OA 5B3SH 3JTHA 1JUSA 2E1MC 3Q9VA 4E6KG 2D1VA 3KEQA 1RUNA 3RI4A 1QRYA 3PQKA 3WGHA 2QWWA 3J7AO 4WCGA 3FHZA 2PFBA 1KQ9A 1HKTA 1UG2A 2K9QA 3I4PA 1V4RA 4YRVA 2NVYJ 3LQRA 3CCYA 3FK7A 1V54H 1KYZA 3TL4X 3L09A 1QO0D 5DYMA 2R0QC 2MABA 4JX4A 1BN5A 1RUOA 2H1KA 3PO2J 2ZMEB 2W82A 3WHBA 3U21A 4XR6A 4B47A 2EK5A 5E3LA 4E7IA 1Z05A 1T33A 1V5GA 3V42A 2RNGA 1TL8A 3TW7A 4OWRB 5ICCA 2HEOA 2PBIA 3BPXA 3AG3H 4YIFA 4L0ZB 2EA2A 4CICA 1OYWA 3MN2A 3OYFA 4XRMA 1U8BA 2JA5J 2DA6A 3M9AA 4M6VA 4HG2A 1V5FA 2VKHA 3GTPJ 2HPIA 1ON1A 3PFIA 2CSOA 1X58A 1WGXA 5EG0A 2DI3A 1T2KA 2NS0A 4BBSJ 3IUOA 2GLOA 3L2VA 2ZBKA 3L7WA 1K4TA 2DQRA 5FFXA 2GAUA 1VTNC 3LA2A 1V3FA 2KFDA 1SVOA 2MA3A 3WU0A 2DOAA 2RREA 4HDUA 4KIFA 1RR8C 3L2CA 3T5XA 3M3YJ 2VL8A 4NC7A 2O8KA 2V4JC 2XRNA 1ETYA 4A3CJ 5FD6A 2BZTA 4ON0A 2J5OA 2VASA 2Q0OA 2VB6A 2NAZA 4G7HF 2O7OA 4XIDA 4E7JA 2Q2EB 4U88A 4XMYA 5FFZA 3CESA 4NC6A 2L9NA 2UXXA 1I27A 5L3DA 4CO8A 3BZKA 1VQ4I 1N78A 1IN8A 5FKNA 4OAYA 1E3OC 1TQPA 5E1XA 5CKTA 3LA7A 1IN5A 3B02A 3C3WA 1BI3A 4RLFA 3GO5A 2TRTA 3HB9A 3DKYA 3GYHX 3K6GA 2IRFG 3I54A 3KETA 2DW4A 1X3UA 2DA1A 3H5AA 4RMNA 4N4NB 5GAGJ 1C0WA 3FXQA 3OYDA 3FXUA 4EJVA 1ETQA 1SMYF 2HVSA 1U3EM 5HDNA 2Z33A 5L3CA 1YJNI 2JRMA 5HLIA 5ICGA 1PUEE 3H3VK 1FTZA 5J1UA 3AG2H 2DFIA 3R61A 3A4CA 3JREA 1BJAA 4C30A 3GXOA 1VQOI 3K2AA 1DGRM 1QU3A 1KU7A 4Z6YA 1FYLA 5KK1A 1POGA 4O3MA 1G59A 1FC3A 4EQQA 3CCSI 1SC7A 2CW0F 1XDUA 3S3OA 2E19A 4MTEA 2IT0A 1FBUA 2VKEA 4IOCF 4M3DA 1JJ8C 4BS9A 4CCJA 3FXLA 3WTUC 3ONQA 2WWYA 4XRFA 2K4JA 5F1JA 4AU7A 5HLGA 2BGCA 1EH6A 4XSXF 5LGNA 3CO6C 3WG9A 2Y31A 3B73A 4XNFA 3TOBA 4B44A 1OCZH 3I5UA 3ZRGA 2KIUA 2V9VA 3LSIA 3MKWB 1ZLKA 1RPWA 1LJ9A 1FOWA 1FJLA 3CCRI 3OY9A 3O3KA 2DMNA 3DPTA 4HBLA 3Q5FA 1PVEA 4HX4A 1BC8C 1MMSA 1P7IA 3SZGA 3CC2I 2BXYA 1MNMC 2ZSHB 3WTVC 3BR1A 5CVRA 2M4GA 4LGWA 3GTOJ 1O3QA 3SEQA 3WTZA 3I56I 5L3EA 3W6KB 4KT5C 4XRSG 2L5QA 3GMEA 2PLYA 2XAQA 4RB0A 5IP9J 3KPHA 1S7OA 1ULYA 3QYEA 1JHFA 5J8CA 3G4SI 3KIOA 2EH3A 2DU9A 2X6OA 1KYWA 2WAQA 5LFAA 4GYIA 3E6MA 1LFBA 2CJJA 5DS9A 2LF7A 3S2DJ 2HQ5A 4B1RA 1SD4A 1EH7A 3KX2A 1W5CC 2XF6A 1HLVA 2V26A 1OMIA 1Z6TA 2L9RA 2L01A 5EGOA 3K4MA 1RIOH 3IKVA 2STWA 2OZUA 2BY1A 4LIVA 3OYJA 2VODA 2XUBA 4N9HA 2DOFA 3D1NI 4KN4X 1Z6RA 3CLOA 3SEZA 4WXCA 3RYPA 3BP8A 2LSOA 4ENKA 4Q47A 4LLNA 4CA0A 1MJBA 1IXSB 4A6DA 2IGOA 1OLTA 1IUFA 2DJIA 2EFWA 4HLYA 3VDXA 1IW7F 4CCKA 3BOQA 1HDPA 2F2EA 3BJOA 1E17A 1GVJA 2LKSA 4M9XA 2VONA 3EQLF 3GLXA 4M71A 1TW3A 4YELA 1GV5A 3SXYA 3QP5A 1A6QA 4W97A 2BBYA 3CDIA 4NDLA 3BCAA 3EUKL 1KQ0A 3AFHA 2M7AA 2P5KA 2H8RA 1IG7A 3CJNA 2DT7B 4DGWB 2VPRA 1B9NA 2V79A 2VBXA 2XAHA 1TWAJ 5FLXZ 3CUQA 3PIOF 5TJJA 5D6EA 5DCMB 2DAOA 2IGKA 2Y9YA 4X0GA 4HF2A 4DBRA 1R23A 3KZZA 3DBLB 4M6XA 2JN6A 1ZR4A 1A6IA 2L4MA 1ZHFA 4EM2A 5E18F 3JTGA 3JRCA 2GZWA 2KT0A 2OQGA 1Z21A 1YX5A 2ECCA 3PSFA 4A3MJ 3HPGA 4CCLA 2GOXB 1FMWA 1IDZA 5EG0B 3FBNB 2P5LC 1QZZA 1G6NA 2HKOA 4BXFA 2JSPA 5JI6A 4ESJA 4A3KJ 2LD5A 2NOJB 2LY2A 4KN7X 4UUTA 2IVMA 4XKBA 2EZIA 4RB3C 3EYIA 3L1PA 3AG1H 3D5SC 3BG9A 1D1BA 3OSGA 1Z3YA 1B8IA 3MCZA 4ANJA 2RV8A 1WVRA 5HVQC 1RRJA 2FMLA 5EEGA 3DEUA 1D8KA 3TDUC 4RLQA 3QU6A 5F27A 3ASOH 4ZYAA 2LNBA 2HFHA 4JX5A 2R5ZA 2D2WA 1MMDA 2LKPA 4ESFA 3BZCA 3LA3A 4Q48A 4CCNA 3R60A 3SYTA 3JRFA 4S04A 4HNTA 1HSJA 4J01A 4GO1A 4DQ2A 3CO7C 1B9MA 1W4MA 3CJTB 3HRSA 5A2QZ 1XGNA 2LF8A 2WBMA 1V55H 5HDKA 3AAFA 3LAPA 3UR3C 3JW4A 3ZR8X 3A02A 3N97A 1QA6A 3F8BA 4Q5SF 2A69F 1DDNA 2X1CA 4IHWA 1ZG5A 3MEXA 3CF5F 3ZMDA 1SVLA 3OOUA 3BQYA 3H1CA 2MGQA 5E1WA 3L00A 3ABLH 3DKXA 4JX6A 1LB2A 3D5RC 1LQ1A 2UV1A 2W1OA 3K1PA 3C1DA 1N77A 1VQLI 1F43A 4NQWA 1WJDA 1U8RA 2O6GE 2HI3A 3Q3SA 1Z9CA 3ZQCA 2DLLA 2M1BA 1B72A 1HCRA 3JAMZ 2EV5A 4OOIA 3R0JA 4WXDA 5GAHJ 2A5WA 4CGZA 4HX8A 4S0HB 2PJRB 2L2OA 1MDMA 3NAUA 5CQGA 2V6EA 4KIBA 3S1MJ 2ESHA 3KP7A 3FWEA 3RZDJ 3LSMA 3CP8A 5M5YJ 3J81Z 3ZMTA 1R6RA 1TP4A 1J75A 4BDZA 3QOPA 4HLXA 4BGDA 1OISA 3I58A 3CDHA 1Y8QB 2H27A 1XSVA 2KJBA 2IJLA 2JVHA 5AIQA 4OIPF 1MMNA 2NNNA 5ICEA 3A2KA 1WJBA 3CCQI 5B5EC 1XG1A 3GTGJ 1D3YA 2M34A 4XLHA 5CVUA 4CDGA 1UHMA 2H6BA 2DMPA 1YG2A 4D1QA 1TC3C 4IOAF 2IS2A 2DDAA 2HDDA 1B4AA 3QODA 2O3FA 3FDYA 3DPUA 2W7NA 3LSPA 1ZRFA 2XB0X 5J8FA 3V8KA 5ERIA 1YIOA 4XOTA 4OMZA 3WTSC 2GIZA 1B59A 1NTCA 4BKXA 1R1UA 1XGSA 3FKJA 3GFMA 4L18B 4BEHA 4RAFA
chains in the Genus database with same CATH topology
2EBIA 3BTLA 1FIAA 1FTTA 2JMWA 3QPSA 3CMYA 1MBHA 2E2IJ 5FJ8J 2HOTA 1I6HJ 2LLKA 1OJLA 5F04A 5J1YA 2YUSA 1S7EA 3LSGA 1PUFA 4IEJA 1DU0A 2GM4A 3ZQHA 4C3JJ 4C3IJ 1LFUP 2EZHA 2K9NA 1ZR2A 3IV5A 2ECBA 5C44J 3GTMJ 2CRGA 5EGOB 4FE7A 1HDDC 2JWTA 5IYDJ 2DMUA 1GDTA 4FISA 3DCFA 3HBLA 4DZPA 4J19A 4FTHA 4X1EA 5EZGA 3TP0A 2RAEA 4Y52J 1P7JA 5IP7J 2HXOA 3BG5A 2R92J 1U9NA 4D7NA 4QTRA 3GTQJ 5DTDA 1A5JA 2VUMJ 5FKOA 1JUSA 3GTKJ 3WHCA 4AYBN 1K83J 1QRYA 1MSEC 1XS9A 1UHSA 2IAIA 4L5EA 1UG2A 1IC8A 2K9QA 3BG3A 2NVYJ 2G0EA 1ETWA 3Q0UA 3CCYA 3FK7A 4JP0A 4DYCA 1MSFC 1Y1VJ 1U78A 2FQ4A 2QCOA 4JX4A 5JLWA 2R0QC 3MVPA 2H1KA 1WCMJ 4IHXA 3PO2J 1BA5A 3WHBA 1ZTRA 1O4XA 2JA6J 5E3LA 3W6VA 1CQTA 1T33A 4CYCA 4A3EJ 3OIOA 5FKLA 1U9OA 1ETXA 2CQXA 3TW7A 5E3NA 5F0HA 3C2BA 1JT0A 1JJ6C 1FEXA 1VFCA 4A3IJ 4A3BJ 4DYRA 3MN2A 4EEFG 2DA5A 1RKWA 2HOAA 3Q0WA 4DZJA 4XRMA 1U8BA 2JA5J 2DA6A 4M6VA 3MKLA 2VI6A 1JKPC 2GBYA 2LVSA 2I10A 3TW6A 3DEWA 3GTPJ 4A3GJ 4JYKA 3SFIA 1X58A 1WGXA 1ETOA 2KDZA 5GPAA 5EG0A 4BBSJ 3FK6A 2GLOA 4QIWN 3O8HA 3SDGA 1MBEA 2XB5A 4B3AA 1QVTA 3LSJA 3A03A 5K7ZA 2JK3A 1TWCJ 5M5XJ 3NARA 3BTJA 1SANA 3M3YJ 3ZQLA 2O8KA 1I50J 2OF7A 3I4MJ 1ETYA 4A3CJ 1APLC 2NOGA 5BNGA 1IRZA 2O7OA 5IOZA 1T56A 3BR6A 4XIDA 2DA7A 3VPRA 3BR2A 5EEAA 3BTCA 4X6AJ 3SJMA 1GT0C 2R5ZB 3ZOBA 2E2HJ 2DN0A 5FKNA 4A3FJ 1E3OC 5HODA 5FKKA 3S16J 2FX0A 2E1OA 4V2GA 2TRTA 3HB9A 5F0FA 2R7ZJ 2ME0A 1D5YA 1IGNA 4ABZA 2DA1A 3FIWA 3JR9A 4D5FA 4A3LJ 1W0UA 5FLVA 2ZB9A 4HNVA 3HOZJ 1HOMA 3LOCA 1ETQA 4UUSA 1BL0A 3S15J 3G1OA 4W1UA 1ZKGA 3H3VK 3FKIJ 5J1UA 4C3HJ 3Q0VA 3JREA 2FJ1A 1FTZA 3PM1A 1Z77A 2LP0A 3LNQA 3K2AA 3A01A 1WH7A 2LK2A 3JRGA 2NVQJ 1POGA 3JRDA 2L7MP 3JRBA 1LE8A 2JA7J 1W0TA 4A69C 4I76A 3TP3A 2E19A 4G12A 2LTPA 2VKEA 1IDYA 3S1RJ 4BBRJ 1TWGJ 2K40A 3H0GJ 2IEKA 4M3DA 1JJ8C 1B72B 4IHYA 1Y1WJ 2LY9A 3RKQA 2Y30A 2M0CA 1YRNA 5F1JA 1VI0A 2LR8A 1NK3P 4M3EA 1JTYA 4B4CA 2EZLA 2Y31A 5IYCJ 4XRSA 3QQAA 2XPVA 2DMTA 4DW6A 1RETA 2L7FP 1ZGWA 1RPWA 2XGCA 1FJLA 5GP9A 2DMNA 1K61A 1TWHJ 1BW6A 1AU7A 2CUFA 4AC0A 5IPAA 1ETKA 2L0KA 4RBOA 1GUUA 1P7IA 4C2MJ 2L7ZA 3GTJJ 1MNMC 3BR1A 3CDLA 5IOYA 4MFEA 4A3JJ 3GTOJ 2P81A 2JA8J 2ME6A 2XRLA 1AKHA 2R5YA 2N8GA 2IBDA 3UKGA 4Y7NJ 2MSYA 4XRSG 2EQRA 1JKQC 3S2HJ 4MO7A 5EDNA 5J1RA 5IP9J 4QSHA 2EH3A 2X6OA 2XPWA 1H89C 4M3FA 1LFBA 2CJJA 2CUEA 5DS9A 3S2DJ 3GBGA 1BW5A 2DJNA 2HQ5A 3IH4A 4B1RA 2YS9A 1OCPA 5M5WJ 4M3GA 3HGYA 3S1NJ 2DA3A 1HLVA 3HKZN 3S17J 3HOWJ 2PMZN 2L9RA 1H8AC 5EGOA 2X48A 3IH2A 1MBGA 1FIPA 3GTLJ 5IYBJ 3D1NI 4A93J 1B8IB 2CQQA 1BJZA 3HOVJ 1GV2A 2VKVA 2M2EA 2QF7A 1IUFA 5EYRA 4BY1J 1HDPA 3ZQGA 1DU6A 3BT9A 1R9TJ 4BXXJ 2MG4A 4DYQA 2R93J 2Y0SN 1XC5A 2ID6A 2HYJA 3RQIA 2DTZA 4XK4A 1GV5A 5M3MJ 4W97A 1Z0XA 4MFDA 1ENHA 3S1QJ 4NDLA 2OPTA 2EZKA 2DMQA 1GVDA 2XPUA 2H8RA 1IG7A 1RESA 2W48A 1ITYA 2K9SA 2VPRA 1TWAJ 1VNDA 2CU7A 2NVXJ 5C4JJ 1SFOJ 2Y9YA 1Q1VA 1JKRC 1MBKA 1OFCX 4A3DJ 5FLMJ 2JN6A 5E3OA 2E2JJ 1TWFJ 3G1MA 5EZHA 3BQZA 5C3EJ 1ZR4A 1EF4A 1A6IA 1X2MA 4MLOA 1MH4A 9ANTA 3E7LA 2AO9A 3JRCA 2KT0A 3HDDA 3G1LA 1JGGA 2ECCA 3RZOJ 4A3MJ 3S14J 5K7HA 1JUPA 2HOSA 1UMQA 1IDZA 3IH3A 1VF9A 5EG0B 4A3KJ 1AHDP 2LD5A 3K7AJ 4UUTA 2EZIA 2FD5A 3L1PA 1X2NA 3BR3A 3BG9A 1MBFA 3OSGA 3QPLA 1B8IA 1MBJA 1MH3A 3I4NJ 3ZQFA 2Y2ZA 3FISA 1IJWC 5F27A 3OSFA 2AHQA 2TCTA 4M3BA 5FKMA 4I6ZA 3O8GA 4JX5A 2R5ZA 4RDUA 4BY7J 4LOCA 2WB1N 1H88C 3B6AA 2XGDA 3JRFA 2COBA 1HF0A 3PO3J 2WAQN 2M8GX 5IP6A 4MIMA 1I3QJ 2DA4A 5C4XJ 3B6CA 2LKXA 2JJ7A 1JKOC 1QVUA 1WI3A 1RKTA 3A02A 3ZQIA 1OCTC 2YU9J 3HOXJ 2NS8A 1IV6A 1NK2P 2B63J 4IHWA 4UUSB 3HM5A 2D5VA 1JUMA 2MW8A 5F08A 2HXIA 1JTXA 1PUFB 3OOUA 3BQYA 3BR5A 2MGQA 5GPCA 3JRAA 3A01B 4JX6A 4FE4A 2NS7A 3M4OJ 3HEFA 1F43A 1LE8B 2HI3A 3Q3SA 3ZQCA 5JLXA 2DA2A 3HGGA 1B72A 1HCRA 2ELKA 5K7FA 4AUXA 4S0HB 3HOYJ 3S1MJ 3NAUA 1RR7A 1ORKA 4IHVA 5J3LA 3RZDJ 5M5YJ 3BTIA 4D5CA 2O9LA 1YRNB 1ETVA 2M9HA 2WV1A 5E3MA 4V2FA 4GFBA 2NVTJ 3LSRA 1QPIA 3JRHA 3TEDA 3F0CA 3HOUJ 1JT6A 1XG1A 1ZQ3P 3GTGJ 2M34A 3BR0A 1WPKA 4CYCB 2DMPA 2LFBA 5EF6A 1TC3C 4D7MA 2HDDA 2Y9ZA 2XGEA 1WH5A 1ZK8A 5F0CA 3JRIA 3LSPA 2XSDC 2XB0X 1AKHB 2R5YB 3CQZJ 1G2HA 2ID3A 5M3FJ 1NTCA 4BKXA 2X9DA 1F36A 4XICA 4FCYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EBI A;  3BTL A;  1FIA A;  1FTT A;  2JMW A;  3QPS A;  3CMY A;  1MBH A;  2E2I J;  5FJ8 J;  2HOT A;  1I6H J;  2LLK A;  1OJL A;  5F04 A;  5J1Y A;  2YUS A;  1S7E A;  3LSG A;  1PUF A;  4IEJ A;  1DU0 A;  2GM4 A;  3ZQH A;  4C3J J;  4C3I J;  1LFU P;  2EZH A;  2K9N A;  1ZR2 A;  3IV5 A;  2ECB A;  5C44 J;  3GTM J;  2CRG A;  5EGO B;  4FE7 A;  1HDD C;  2JWT A;  5IYD J;  2DMU A;  1GDT A;  4FIS A;  3DCF A;  3HBL A;  4DZP A;  4J19 A;  4FTH A;  4X1E A;  5EZG A;  3TP0 A;  2RAE A;  4Y52 J;  1P7J A;  5IP7 J;  2HXO A;  3BG5 A;  2R92 J;  1U9N A;  4D7N A;  4QTR A;  3GTQ J;  5DTD A;  1A5J A;  2VUM J;  5FKO A;  1JUS A;  3GTK J;  3WHC A;  4AYB N;  1K83 J;  1QRY A;  1MSE C;  1XS9 A;  1UHS A;  2IAI A;  4L5E A;  1UG2 A;  1IC8 A;  2K9Q A;  3BG3 A;  2NVY J;  2G0E A;  1ETW A;  3Q0U A;  3CCY A;  3FK7 A;  4JP0 A;  4DYC A;  1MSF C;  1Y1V J;  1U78 A;  2FQ4 A;  2QCO A;  4JX4 A;  5JLW A;  2R0Q C;  3MVP A;  2H1K A;  1WCM J;  4IHX A;  3PO2 J;  1BA5 A;  3WHB A;  1ZTR A;  1O4X A;  2JA6 J;  5E3L A;  3W6V A;  1CQT A;  1T33 A;  4CYC A;  4A3E J;  3OIO A;  5FKL A;  1U9O A;  1ETX A;  2CQX A;  3TW7 A;  5E3N A;  5F0H A;  3C2B A;  1JT0 A;  1JJ6 C;  1FEX A;  1VFC A;  4A3I J;  4A3B J;  4DYR A;  3MN2 A;  4EEF G;  2DA5 A;  1RKW A;  2HOA A;  3Q0W A;  4DZJ A;  4XRM A;  1U8B A;  2JA5 J;  2DA6 A;  4M6V A;  3MKL A;  2VI6 A;  1JKP C;  2GBY A;  2LVS A;  2I10 A;  3TW6 A;  3DEW A;  3GTP J;  4A3G J;  4JYK A;  3SFI A;  1X58 A;  1WGX A;  1ETO A;  2KDZ A;  5GPA A;  5EG0 A;  4BBS J;  3FK6 A;  2GLO A;  4QIW N;  3O8H A;  3SDG A;  1MBE A;  2XB5 A;  4B3A A;  1QVT A;  3LSJ A;  3A03 A;  5K7Z A;  2JK3 A;  1TWC J;  5M5X J;  3NAR A;  3BTJ A;  1SAN A;  3M3Y J;  3ZQL A;  2O8K A;  1I50 J;  2OF7 A;  3I4M J;  1ETY A;  4A3C J;  1APL C;  2NOG A;  5BNG A;  1IRZ A;  2O7O A;  5IOZ A;  1T56 A;  3BR6 A;  4XID A;  2DA7 A;  3VPR A;  3BR2 A;  5EEA A;  3BTC A;  4X6A J;  3SJM A;  1GT0 C;  2R5Z B;  3ZOB A;  2E2H J;  2DN0 A;  5FKN A;  4A3F J;  1E3O C;  5HOD A;  5FKK A;  3S16 J;  2FX0 A;  2E1O A;  4V2G A;  2TRT A;  3HB9 A;  5F0F A;  2R7Z J;  2ME0 A;  1D5Y A;  1IGN A;  4ABZ A;  2DA1 A;  3FIW A;  3JR9 A;  4D5F A;  4A3L J;  1W0U A;  5FLV A;  2ZB9 A;  4HNV A;  3HOZ J;  1HOM A;  3LOC A;  1ETQ A;  4UUS A;  1BL0 A;  3S15 J;  3G1O A;  4W1U A;  1ZKG A;  3H3V K;  3FKI J;  5J1U A;  4C3H J;  3Q0V A;  3JRE A;  2FJ1 A;  1FTZ A;  3PM1 A;  1Z77 A;  2LP0 A;  3LNQ A;  3K2A A;  3A01 A;  1WH7 A;  2LK2 A;  3JRG A;  2NVQ J;  1POG A;  3JRD A;  2L7M P;  3JRB A;  1LE8 A;  2JA7 J;  1W0T A;  4A69 C;  4I76 A;  3TP3 A;  2E19 A;  4G12 A;  2LTP A;  2VKE A;  1IDY A;  3S1R J;  4BBR J;  1TWG J;  2K40 A;  3H0G J;  2IEK A;  4M3D A;  1JJ8 C;  1B72 B;  4IHY A;  1Y1W J;  2LY9 A;  3RKQ A;  2Y30 A;  2M0C A;  1YRN A;  5F1J A;  1VI0 A;  2LR8 A;  1NK3 P;  4M3E A;  1JTY A;  4B4C A;  2EZL A;  2Y31 A;  5IYC J;  4XRS A;  3QQA A;  2XPV A;  2DMT A;  4DW6 A;  1RET A;  2L7F P;  1ZGW A;  1RPW A;  2XGC A;  1FJL A;  5GP9 A;  2DMN A;  1K61 A;  1TWH J;  1BW6 A;  1AU7 A;  2CUF A;  4AC0 A;  5IPA A;  1ETK A;  2L0K A;  4RBO A;  1GUU A;  1P7I A;  4C2M J;  2L7Z A;  3GTJ J;  1MNM C;  3BR1 A;  3CDL A;  5IOY A;  4MFE A;  4A3J J;  3GTO J;  2P81 A;  2JA8 J;  2ME6 A;  2XRL A;  1AKH A;  2R5Y A;  2N8G A;  2IBD A;  3UKG A;  4Y7N J;  2MSY A;  4XRS G;  2EQR A;  1JKQ C;  3S2H J;  4MO7 A;  5EDN A;  5J1R A;  5IP9 J;  4QSH A;  2EH3 A;  2X6O A;  2XPW A;  1H89 C;  4M3F A;  1LFB A;  2CJJ A;  2CUE A;  5DS9 A;  3S2D J;  3GBG A;  1BW5 A;  2DJN A;  2HQ5 A;  3IH4 A;  4B1R A;  2YS9 A;  1OCP A;  5M5W J;  4M3G A;  3HGY A;  3S1N J;  2DA3 A;  1HLV A;  3HKZ N;  3S17 J;  3HOW J;  2PMZ N;  2L9R A;  1H8A C;  5EGO A;  2X48 A;  3IH2 A;  1MBG A;  1FIP A;  3GTL J;  5IYB J;  3D1N I;  4A93 J;  1B8I B;  2CQQ A;  1BJZ A;  3HOV J;  1GV2 A;  2VKV A;  2M2E A;  2QF7 A;  1IUF A;  5EYR A;  4BY1 J;  1HDP A;  3ZQG A;  1DU6 A;  3BT9 A;  1R9T J;  4BXX J;  2MG4 A;  4DYQ A;  2R93 J;  2Y0S N;  1XC5 A;  2ID6 A;  2HYJ A;  3RQI A;  2DTZ A;  4XK4 A;  1GV5 A;  5M3M J;  4W97 A;  1Z0X A;  4MFD A;  1ENH A;  3S1Q J;  4NDL A;  2OPT A;  2EZK A;  2DMQ A;  1GVD A;  2XPU A;  2H8R A;  1IG7 A;  1RES A;  2W48 A;  1ITY A;  2K9S A;  2VPR A;  1TWA J;  1VND A;  2CU7 A;  2NVX J;  5C4J J;  1SFO J;  2Y9Y A;  1Q1V A;  1JKR C;  1MBK A;  1OFC X;  4A3D J;  5FLM J;  2JN6 A;  5E3O A;  2E2J J;  1TWF J;  3G1M A;  5EZH A;  3BQZ A;  5C3E J;  1ZR4 A;  1EF4 A;  1A6I A;  1X2M A;  4MLO A;  1MH4 A;  9ANT A;  3E7L A;  2AO9 A;  3JRC A;  2KT0 A;  3HDD A;  3G1L A;  1JGG A;  2ECC A;  3RZO J;  4A3M J;  3S14 J;  5K7H A;  1JUP A;  2HOS A;  1UMQ A;  1IDZ A;  3IH3 A;  1VF9 A;  5EG0 B;  4A3K J;  1AHD P;  2LD5 A;  3K7A J;  4UUT A;  2EZI A;  2FD5 A;  3L1P A;  1X2N A;  3BR3 A;  3BG9 A;  1MBF A;  3OSG A;  3QPL A;  1B8I A;  1MBJ A;  1MH3 A;  3I4N J;  3ZQF A;  2Y2Z A;  3FIS A;  1IJW C;  5F27 A;  3OSF A;  2AHQ A;  2TCT A;  4M3B A;  5FKM A;  4I6Z A;  3O8G A;  4JX5 A;  2R5Z A;  4RDU A;  4BY7 J;  4LOC A;  2WB1 N;  1H88 C;  3B6A A;  2XGD A;  3JRF A;  2COB A;  1HF0 A;  3PO3 J;  2WAQ N;  2M8G X;  5IP6 A;  4MIM A;  1I3Q J;  2DA4 A;  5C4X J;  3B6C A;  2LKX A;  2JJ7 A;  1JKO C;  1QVU A;  1WI3 A;  1RKT A;  3A02 A;  3ZQI A;  1OCT C;  2YU9 J;  3HOX J;  2NS8 A;  1IV6 A;  1NK2 P;  2B63 J;  4IHW A;  4UUS B;  3HM5 A;  2D5V A;  1JUM A;  2MW8 A;  5F08 A;  2HXI A;  1JTX A;  1PUF B;  3OOU A;  3BQY A;  3BR5 A;  2MGQ A;  5GPC A;  3JRA A;  3A01 B;  4JX6 A;  4FE4 A;  2NS7 A;  3M4O J;  3HEF A;  1F43 A;  1LE8 B;  2HI3 A;  3Q3S A;  3ZQC A;  5JLX A;  2DA2 A;  3HGG A;  1B72 A;  1HCR A;  2ELK A;  5K7F A;  4AUX A;  4S0H B;  3HOY J;  3S1M J;  3NAU A;  1RR7 A;  1ORK A;  4IHV A;  5J3L A;  3RZD J;  5M5Y J;  3BTI A;  4D5C A;  2O9L A;  1YRN B;  1ETV A;  2M9H A;  2WV1 A;  5E3M A;  4V2F A;  4GFB A;  2NVT J;  3LSR A;  1QPI A;  3JRH A;  3TED A;  3F0C A;  3HOU J;  1JT6 A;  1XG1 A;  1ZQ3 P;  3GTG J;  2M34 A;  3BR0 A;  1WPK A;  4CYC B;  2DMP A;  2LFB A;  5EF6 A;  1TC3 C;  4D7M A;  2HDD A;  2Y9Z A;  2XGE A;  1WH5 A;  1ZK8 A;  5F0C A;  3JRI A;  3LSP A;  2XSD C;  2XB0 X;  1AKH B;  2R5Y B;  3CQZ J;  1G2H A;  2ID3 A;  5M3F J;  1NTC A;  4BKX A;  2X9D A;  1F36 A;  4XIC A;  4FCY A; 
#chains in the Genus database with same CATH topology
 1BI2 A;  1O3S A;  3CCM I;  3HYI A;  3FMR A;  1S7A A;  5JR3 A;  3GZ5 A;  1SMT A;  3TQN A;  5J1Y A;  2P5V A;  4YFN F;  2O5R A;  2R3S A;  3DKW A;  1JE8 A;  4F52 A;  2R7S A;  2EJR A;  3DXJ F;  2OU2 A;  4IEJ A;  4PUS A;  3WG7 H;  2IS1 A;  4BJT A;  1WKM A;  5GTI C;  1LFU P;  3J7Y J;  2X51 A;  4LK0 F;  2K9N A;  2UZK A;  1ZR2 A;  1GHC A;  1FOY A;  2LBF B;  5EGO B;  1HDD C;  1IV8 A;  5IYD J;  1EKE A;  2X1E A;  2KIS A;  2FU4 A;  2RQQ A;  4F3Q A;  4L5J A;  4KFC A;  5TIS C;  3TP0 A;  2RAE A;  3GW2 A;  3KLO A;  3GTQ J;  2RKH A;  3N05 A;  2F5F A;  3DF8 A;  4F55 A;  3TO7 A;  1X4P A;  1IF1 A;  1K83 J;  4PFO A;  4Y4R A;  1MSE C;  4OIR F;  1XS9 A;  2OAZ A;  3M1E A;  3C18 A;  2G0E A;  1ETW A;  5LGT A;  5KCM A;  1QHH D;  4DYC A;  1Y1V J;  1SFX A;  4Y3O A;  4EMS A;  4U0V A;  1IXC A;  2K9M A;  1ZTR A;  3IHU A;  5B66 C;  1O4X A;  4Y15 A;  1CQT A;  3W6V A;  4ZYG A;  3VYT B;  2A05 A;  1JT0 A;  1ZRE A;  1HKS A;  3TDZ C;  5F0H A;  1TW2 A;  3DBH B;  1R49 A;  2XKP A;  3CUQ B;  3W2V A;  4EAT A;  1F1Z A;  1FNN A;  2KRH A;  1T38 A;  2HZD A;  3BCB A;  2OTJ I;  3HRT A;  2PQ8 A;  4EEF G;  4ENM A;  1RKW A;  3Q0W A;  1K4S A;  4M74 A;  3U9G A;  1ZGA A;  5H6R A;  1JKP C;  2GBY A;  2JSC A;  2A07 F;  4QPO A;  3F8N A;  2CV2 A;  1Q1H A;  3MQ0 A;  4JYK A;  4LD5 A;  3OWT A;  1BIA A;  3K10 A;  4RAZ A;  3SFI A;  4XN3 A;  5GPA A;  4P9U A;  3RJP A;  1IO2 A;  3FK6 A;  3I9V 2;  4HPQ A;  4QIW N;  3SZP A;  4ENN A;  3O8H A;  4B3A A;  2HDW A;  4HX7 A;  2A3S A;  2W85 A;  3A03 A;  4I98 B;  1IAW A;  1MD0 A;  2Z99 A;  1VQ8 I;  4LK1 F;  4BJ6 C;  4TV7 A;  2VE8 A;  2QSH X;  1XCV A;  2QLZ A;  2EIN H;  1X1D A;  3DTI A;  5DD4 A;  1SAN A;  4HYE A;  4CYD A;  4E7Z A;  4I09 A;  4UV9 A;  4XLC A;  4XKW A;  3H0D A;  4FX4 A;  3H3U A;  4PSW A;  3BC8 A;  4KIG A;  5ILV A;  5BNG A;  2AXT C;  2BVM A;  3WGG A;  5IOZ A;  1T56 A;  4O6J A;  1RNL A;  2DA7 A;  3FZV A;  1KGS A;  4IPA A;  3DTK A;  3DLL F;  1BIB A;  2HU9 A;  2M30 A;  5EEA A;  1TLH B;  3G6E I;  1WJF A;  2R5Z B;  3K0L A;  2E2H J;  4XKV A;  5D8L B;  2OD5 A;  2DN0 A;  5E8I A;  1T0F A;  3ZQQ A;  4A3F J;  3PUB A;  1P4X A;  5HOD A;  2DK5 A;  2G7H A;  3OV8 A;  4BE1 A;  2FX0 A;  4PCQ A;  4BE0 A;  2EA4 A;  3BRO A;  3K4K A;  3BY6 A;  1XMK A;  5F0F A;  2QVO A;  1R1T A;  2KZG A;  3IAM 2;  1DQU A;  3SHF A;  3UNG C;  5AON A;  1IGN A;  1ZAR A;  4OIQ F;  3JR9 A;  2VC1 A;  4A3L J;  3M1C A;  5J4V A;  2ZB9 A;  3LL7 A;  1HOM A;  3H9Q A;  2ZNY A;  2CQN A;  1YIJ I;  5JFR A;  2E7X A;  3V8L A;  4EGY A;  1IN6 A;  4ZDO A;  3OS0 A;  1FSE A;  2WAE A;  5CVI A;  5FB2 A;  2RVC A;  3Q0V A;  2H94 A;  3FX3 A;  2LP0 A;  3KZI C;  2NRA C;  4BXU A;  2ISY A;  2LK2 A;  3CZ6 A;  1ZGJ A;  2NVQ J;  5IT9 K;  3JRD A;  2ZFW A;  1IN4 A;  2HTJ A;  2L7M P;  3DTE A;  1FP1 D;  2MLK A;  2OCC H;  1K78 B;  4A69 C;  5DUI A;  2X0L A;  3ERE D;  3TMO A;  4NQW B;  1USS A;  3L2Q A;  1IDY A;  4F91 B;  5D5W B;  1DUX C;  1BR4 A;  1R5I D;  2KIM A;  2IEK A;  2P6T A;  3H0G J;  3OL3 A;  4XQF A;  1B72 B;  1UEL B;  3RKQ A;  2Y30 A;  4HQE A;  1MMG A;  1T95 A;  3R0A A;  1MDM B;  3WGI A;  1IRX A;  1VI0 A;  1D8J A;  2HNH A;  4M3E A;  4YEJ A;  4RAY A;  2NNY A;  5F1R A;  1VQ9 I;  3ECH A;  5IYC J;  2BHY A;  4U7B A;  3FHN A;  3I3L A;  1QGP A;  4RS8 A;  1G3Y A;  4DW6 A;  1RET A;  3CCE I;  2E5Z A;  5J6X A;  1J2X A;  1FBS A;  2BEO A;  2ZME C;  2XKO A;  1K61 A;  4L9N A;  1AU7 A;  2GA2 A;  1XTA A;  1ETK A;  1G3S A;  4RM3 A;  4WWC A;  4C2M J;  2Z5U A;  3HPH A;  2P4W A;  4M6Y A;  2ZSI B;  3CDL A;  5IOY A;  2QKL B;  1OYY A;  4M9Z A;  3TBI A;  4HNU A;  3ZN1 A;  1CGP A;  2H8W A;  4Y7N J;  4MEY F;  2EQR A;  1JKQ C;  1W5T A;  3S2H J;  2RQP A;  5EDN A;  2QSG X;  4PSX A;  1K7A A;  1X3W B;  3F8M A;  2BOL A;  4C2U A;  3CP2 A;  2DT5 A;  5HLH A;  1J09 A;  1I5Z A;  5CVV A;  1O3T A;  4PFP A;  4BEH B;  4ZC3 A;  3IP4 B;  3OS1 A;  1LDK B;  1VQ5 I;  3OOP A;  4AVZ A;  3H92 A;  4O5V A;  5HDG A;  2FNA A;  2LY1 A;  2QUF A;  3HGY A;  2Z1D A;  4OIO F;  3G3Z A;  2PMZ N;  2X6W A;  2RC4 A;  3PQJ A;  1YI2 I;  1ZRD A;  3OIQ A;  1MBG A;  1FIP A;  2WAD A;  2IPQ X;  4RGU A;  4BAC A;  1UJ8 A;  3N4M A;  1HQC A;  1MIJ A;  3FXO A;  4CZC A;  1FP2 A;  3PNT A;  2HQN A;  3HKZ A;  3HSE A;  3HOV J;  2ZXJ A;  4B48 A;  5HS8 A;  3FM3 A;  4UV8 A;  4XSZ F;  2Y69 H;  4I7H A;  4E7K A;  2MC4 A;  4BY1 J;  3K4B A;  3ZQG A;  4IO9 F;  3OYM A;  1SD7 A;  3VYS B;  4MQ9 F;  1I39 A;  1W36 D;  2K3F A;  2MG4 A;  2PG4 A;  2Y0S N;  1NG7 A;  3ABU A;  1JGS A;  2ID6 A;  3P9C A;  4Y17 A;  4EM1 A;  4XLP F;  1J7K A;  2P6S A;  3E6B A;  5M3M J;  2K85 A;  3S1Q J;  2QEX I;  4PGG A;  3I64 A;  1FX7 A;  3NRV A;  1GVD A;  3ABT A;  2XPU A;  1PJR A;  1RES A;  3IKT A;  2PEX A;  2W48 A;  3VSK A;  4AVP A;  2K9S A;  2VBY A;  3KFW X;  2CU7 A;  4KIC A;  3RYR A;  3C7J A;  2AXL A;  3LAJ A;  2NVX J;  1MMA A;  1J59 A;  1XCB A;  3JCU C;  1MBK A;  3W2W A;  3RQ4 A;  4NB5 A;  4A3D J;  5FLM J;  2KIQ A;  5EZH A;  4KNY A;  1DP7 P;  5E8G A;  1EF4 A;  5J47 A;  1X2M A;  3GFL A;  3FF5 A;  1G4D A;  2BXZ A;  2HWV A;  3G2B A;  2OZ6 A;  3H35 A;  2JRT A;  3LSK A;  1JUP A;  3GZ6 A;  3MZY A;  2NXN B;  2VJ5 A;  2QKM B;  1VF9 A;  2QQA A;  3TO9 A;  4IJA A;  2FUG 2;  3K7A J;  1E2X A;  2PJP A;  1LFP A;  2FD5 A;  3GX4 X;  3VFZ A;  2EWN A;  3OR1 C;  2CW7 A;  2BY0 A;  1XGM A;  3BR3 A;  1YIT I;  4IXA A;  3QPL A;  2CYY A;  1XN7 A;  1A35 A;  1MH3 A;  3H5N A;  1AA7 A;  2QQB A;  3I4N J;  2M3A A;  4HAM A;  3ZQF A;  4EGZ A;  2DYR H;  1QQI A;  1X1A A;  1Z67 A;  1IRG A;  5CPR B;  1TNS A;  3D5L A;  3GFI A;  3EPZ A;  1R36 A;  2LOO A;  2F48 A;  2R7O A;  3FIS A;  1K79 A;  2XRO A;  4HW0 A;  3OSF A;  4ZTF A;  2AHQ A;  4UB8 C;  1SFK A;  5FKM A;  4I6Z A;  3O8G A;  3NWS A;  2QQ8 A;  2Q1Z B;  4PZJ A;  3CUO A;  2DPU A;  3QWL A;  2CUZ A;  1RC9 A;  4RDU A;  3ZGK A;  4BY7 J;  4UHT A;  4XOR A;  1U5T A;  2WB1 N;  4HRI A;  3OYK A;  2VBZ A;  2XF7 A;  5CQE A;  3PO3 J;  4R8H A;  1G8X A;  3E6D A;  2QQ9 A;  4JBA A;  3GCM A;  5D6F A;  1O7F A;  1J9I A;  6PAX A;  1TQI A;  2M0M A;  1I3Q J;  3CJQ B;  4I01 A;  3IRQ A;  2YPR A;  1LVA A;  2DA4 A;  5GTH C;  3B6C A;  1YW9 A;  1Y39 A;  2LKX A;  2WY8 Q;  4AIK A;  1OR7 C;  4UNO A;  1QVU A;  1OCT C;  2W57 A;  2R7R A;  2STT A;  3FXM A;  3EUH C;  1WWX A;  3I53 A;  1FMV A;  3EET A;  3HOS A;  4J00 A;  4RB2 C;  3R4K A;  3HM5 A;  2QGU A;  2K27 A;  5F08 A;  2EIL H;  1PUF B;  1TBX A;  2V7F A;  3BR5 A;  4HF0 A;  3IWF A;  4NC8 A;  1ON2 A;  1BI1 A;  3H36 A;  4FE4 A;  5HNF A;  3CF2 A;  2NS7 A;  3PUF A;  5D4R A;  5JVG F;  3HEF A;  4G7Z F;  1R5H A;  3FBI B;  3M4O J;  2GXG A;  4BAY A;  4NBQ A;  3REO A;  3EDP A;  1Z7L A;  2OA4 A;  1O57 A;  2DA2 A;  5JLX A;  2F5E A;  1R5G A;  3HGG A;  3CCV I;  2ELK A;  1FOX A;  2FEZ A;  4WK8 F;  4N4O B;  1K6O A;  3GLL A;  4UB6 C;  1P92 A;  3R6S A;  1X1B A;  3DV8 A;  5KAF C;  3K9T A;  2FE3 A;  1K6Y A;  3BTI A;  2ELJ A;  2JPB A;  2M8E A;  5FGM A;  4L9T A;  1OYI A;  4CCM A;  3KP6 A;  1MNE A;  2IP2 A;  2WV1 A;  1YHQ I;  5E3M A;  3DPL C;  2D45 A;  3LSR A;  4PJL A;  2P7C B;  5HLT A;  4MGR A;  2H1L A;  4M73 A;  1YYV A;  2P8T A;  1YX3 A;  4BJ5 C;  1ZQ3 P;  2MD0 A;  3RTR A;  2CUJ A;  3DU5 A;  4D7M A;  3K70 D;  2DFH A;  2RNJ A;  2Y9Z A;  1RZ4 A;  2TDX A;  3FXR A;  3LFU A;  2XSD C;  1YW8 A;  1NH3 A;  5BPD A;  5M3F J;  4P96 A;  3U2R A;  3GF2 A;  3J80 Z;  1F36 A;  3ABK H;  3F3X A;  3PL8 A;  1KA8 A;  5HS9 A;  1SAU A;  5J40 A;  1GLN A;  1HC8 A;  1FTT A;  3MKY B;  3ML6 A;  1MBH A;  4HEA 2;  2KJC A;  1I6H J;  2LLK A;  3OYC A;  2B7E A;  2YUS A;  4WX9 A;  1T8I A;  4V19 K;  4QLC U;  4Z2Y A;  1VQK I;  1N75 A;  1U0J A;  3TO6 A;  1DU0 A;  2GM4 A;  2COM A;  4BU2 A;  2FF4 A;  3AL0 B;  2K02 A;  1PDN C;  4LG0 A;  3AL0 C;  1ZH5 A;  2JWT A;  4IF4 A;  2EFO A;  3DCF A;  4DZP A;  1SD6 A;  2HTS A;  1XDS A;  2YR2 A;  1LEB A;  1P7J A;  1VQ6 I;  2HXO A;  4MTD A;  4ITV A;  2VIX A;  2Q8K A;  1CF7 A;  2VUM J;  5FKO A;  1Z7U A;  4FX0 A;  1KZH A;  2B9S A;  4AYB N;  3OR2 C;  1FT9 A;  4F92 B;  3F6V A;  2ZJR F;  2M7B A;  5CJ9 A;  3E5U A;  1KU2 A;  2L02 A;  2WY7 Q;  1QPM A;  5GAE J;  1BC7 C;  4L5E A;  4IKF A;  1H9T A;  1BR2 A;  4AIJ A;  3BG3 A;  1L3L A;  4BHB A;  2EIJ H;  3LWF A;  4ZZL A;  4ZDP A;  3K4C A;  2KQR A;  3Q0U A;  3HHH A;  3K1M A;  5FRN A;  2AS5 F;  4HF1 A;  2QCO A;  2O0Y A;  2QBY A;  1PP8 F;  3MVP A;  1BA5 A;  4B8X A;  4I0A A;  1S29 A;  2K86 A;  2JA6 J;  2X1D A;  4AWX B;  2KRC A;  4CYC A;  3OIO A;  5FKL A;  1U9O A;  4FHT A;  1ZYR F;  2A68 F;  3C2B A;  3F8F A;  3SZT A;  5E3N A;  1FEX A;  2DXI A;  1D0Z A;  1XX5 A;  1VFC A;  5D5X B;  2VBW A;  4I2O A;  2ESN A;  4G8X A;  4A3B J;  4DYR A;  1B1B A;  2LRD A;  3K4J A;  4YIR X;  2HOA A;  4H4K C;  1F9N A;  1X19 A;  1SD5 A;  5HS7 A;  4IQJ A;  2VI6 A;  3KEO A;  3OYN A;  2I10 A;  2V1D A;  4A3G J;  1LEA A;  2HR3 A;  2R7T A;  1Y0N A;  2VC0 A;  2ZXI A;  2F4I A;  1XD7 A;  2KLO A;  3HZJ A;  4A0Z A;  3RCO A;  4IRG A;  2OV7 A;  2F5V A;  3SDG A;  2XB5 A;  4MNU A;  4G7O F;  1QVT A;  4WXH A;  2FBH A;  2JK3 A;  3F9K A;  1TWC J;  2A6T A;  3NEU A;  1I6X A;  4HST A;  3BTJ A;  4KMF A;  3I4M J;  1I50 J;  1P9Q C;  2OF7 A;  5BOX A;  1Y0U A;  2EIM H;  3S2W A;  1ACI A;  2PMZ A;  2PI0 A;  2MC3 A;  3CC4 I;  1HA8 A;  1R71 A;  3ZCO A;  5DM6 F;  1S72 I;  1IRZ A;  4RGR A;  1SFE A;  2B0L A;  2UXN A;  2OBP A;  3BR6 A;  3OYH A;  2KDO A;  2BV6 A;  3VPR A;  2DDB A;  3BTC A;  4X6A J;  4DNC A;  3SJM A;  1GT0 C;  1JI8 A;  3L2R A;  4EV0 A;  2GXB A;  1FBQ A;  3VYR B;  2DBB A;  4PK4 A;  3I59 A;  1W5S A;  5H2F C;  3I55 I;  4DJA A;  3S3N A;  4A0Y A;  1IXR C;  5KVR A;  5IY5 H;  1KU9 A;  1NHA A;  2FNP A;  5FKK A;  2F4M B;  3W3C A;  3S16 J;  3KYC B;  3JSP A;  3QYB A;  2R7Z J;  2Y0S A;  3QP6 A;  2ETH A;  2FOW A;  3LFK A;  3FIW A;  1S5L C;  4XLF A;  4AD9 A;  1HST A;  2BY3 A;  4HNV A;  2FRH A;  2GA1 A;  2HVQ A;  4UUS A;  2JZY A;  1I3A A;  3M07 A;  2BW3 A;  3PJR A;  4W1U A;  1ZKG A;  3FKI J;  2O8X A;  4C3H J;  2FJ1 A;  3MD2 A;  1Z77 A;  3LNQ A;  1X3Z B;  2ZO4 A;  4XOP A;  4LIU A;  1YW7 A;  2M45 A;  4HSR A;  5L3B A;  2RDP A;  1V5E A;  3JRG A;  4NNJ A;  5LHI A;  3HUG A;  1LE8 A;  2JA7 J;  4JOM A;  4AM3 A;  4I76 A;  3K4N A;  1ZG3 A;  3VB2 A;  2XGX A;  2GXA A;  1OKR A;  3QPT A;  3CMM A;  3S1R J;  1UG0 A;  3FXK A;  2K40 A;  3DBR B;  4BBR J;  5F6F A;  4HV6 A;  1D1C A;  3ULQ B;  2ZJP F;  2LY9 A;  1Y1W J;  2WV0 A;  3LMM A;  2L54 A;  1S9H A;  3EYY A;  3MZ8 A;  3A1Y A;  1JTY A;  3ELK A;  4B4C A;  2W84 A;  2QSF X;  3W6J B;  4C9Y A;  1XB4 A;  4XRS A;  2A5Y B;  3QQA A;  2JT1 A;  2DMT A;  2VXD A;  2EFP A;  2P0W A;  4KIT B;  2EFN A;  3JAM K;  4A5M A;  2L7F P;  1ZGW A;  1XMA A;  5GP9 A;  3O6B B;  3BDD A;  2Q2E A;  1BW6 A;  2GOM A;  2CUF A;  3J81 K;  4AC0 A;  1GUU A;  1ZLJ A;  1YO5 C;  3J7Z I;  4DIQ A;  2MYS A;  2L7Z A;  1VQM I;  3GTJ J;  1HW1 A;  4L9J A;  3CD6 I;  5LGU A;  4BQA A;  4MFE A;  4A3J J;  2P81 A;  2XAU A;  3CUQ C;  3KEY A;  4M72 A;  2JUC A;  2N8G A;  4BQN A;  2R5Y A;  2IBD A;  3UKG A;  4GXO A;  1WZ2 A;  1H9G A;  2E1N A;  2VOP A;  1Y6I A;  1DGW Y;  3KYL A;  2WB1 A;  4QSH A;  1R00 A;  3QYF A;  5E79 C;  4I0B A;  3MMY B;  1LUJ B;  2QA4 I;  2XPW A;  4FAS D;  5D5V B;  3L9F A;  3S3M A;  5BQT A;  1Z1D A;  2PMU A;  1BW5 A;  4UVA A;  1WJE A;  3U1D A;  1FOK A;  1TTY A;  5JVT A;  3QAH A;  4EJT A;  4M3G A;  3S1N J;  1JHH A;  1P2F A;  1FYK A;  2K5C A;  4DBQ A;  3HOW J;  4A12 A;  1H8A C;  2CQK A;  2M87 A;  2X48 A;  3IH2 A;  3KP2 A;  4N0B A;  5J4Y A;  1YJ9 I;  2IW5 A;  1M1E B;  2X85 A;  4LG0 B;  5IYB J;  2V1N A;  4A93 J;  3V8J A;  3ZMV A;  2CQQ A;  5D4S A;  1N25 A;  1P4W A;  4XN0 A;  1BJZ A;  1B8I B;  2XAG A;  3HIF A;  1GV2 A;  1W7P D;  1P4A A;  4LB6 B;  3E5X A;  2QF7 A;  3E5Q A;  2CFX A;  1R22 A;  5EYR A;  2V9P A;  2HDC A;  1CF7 B;  1DU6 A;  3NQO A;  3BT9 A;  4II3 A;  1E3H A;  2IS6 A;  2A6H F;  5BS6 A;  4DYQ A;  2R93 J;  2K3P A;  1XC5 A;  2HYJ A;  1WSU A;  2DTZ A;  4UVB A;  2BE5 F;  2KHM A;  2UUZ A;  1Z0X A;  4OU0 A;  1ENH A;  2DFF A;  4S05 A;  2EZK A;  2DMQ A;  1UHW A;  4MEX F;  2QBY B;  3PIP F;  3RPQ A;  1ITY A;  5K5Q A;  3HTU A;  1W7P A;  1REP C;  3CME I;  1XSX A;  4FQG A;  1IRF A;  5C4J J;  4BDY A;  2EB7 A;  2OTL I;  2G7U A;  4RB1 A;  2EPF A;  4MQV A;  1FY7 A;  1WHU A;  5E3O A;  2E2J J;  2VJJ A;  3C2H A;  3BQZ A;  1FWZ A;  4MLO A;  5BPI A;  3PFY A;  4QWQ A;  9ANT A;  1LDJ A;  1KON A;  4XLN F;  5LRR A;  2AO9 A;  3HDD A;  5D5U B;  1MW7 A;  3G1L A;  4L0Y B;  1A36 A;  1WRJ A;  1X1P A;  2E1C A;  4ASN A;  5K7H A;  1QBJ A;  3HSF A;  1UMQ A;  2OC6 A;  4AID A;  4RA2 A;  1ZAO A;  5HOO A;  1D0X A;  1AHD P;  2FBK A;  3K69 A;  1T6S A;  1BOB A;  3P9I A;  1F4K A;  5IT3 A;  5ILU A;  1QHG A;  1X2N A;  2LYC A;  4NUB A;  3HG9 A;  3AG4 H;  3DFG A;  2VT3 A;  2F4O B;  4XLA A;  1BOA A;  3F72 A;  2FQ3 A;  4FET A;  4ZH4 F;  4L9V A;  2MH2 A;  4BL0 B;  4ESB A;  1YTY A;  2ZJQ F;  4NHJ A;  2V9K A;  3BG7 A;  5E17 F;  2TCT A;  2E1M B;  4R1H A;  3OL4 A;  4U0W A;  4H0E A;  4KUM A;  3IL2 A;  2HQA A;  3HRU A;  4HZF A;  3A0H C;  1ERD A;  1HW5 A;  3QU3 A;  2NYX A;  2XGD A;  3T1B A;  1IUY A;  1HF0 A;  2R7D A;  3I59 B;  4R79 A;  2JUG A;  1Y8R B;  3MWM A;  4FT8 A;  2YX7 A;  5E1Z B;  4AYB A;  1UST A;  2V6C A;  2VLA A;  4OAZ A;  5C4X J;  2IGN A;  2ZXH A;  1GXP A;  2EV0 A;  3EUA A;  5CYV A;  4HQM A;  3P7N A;  2WC2 A;  4CUG A;  4RGS A;  2QEN A;  1OCR H;  1RKT A;  3ZQI A;  2YU9 J;  3H9G A;  3HOX J;  2DOE A;  4IZZ A;  3SQN A;  1VZ0 A;  5DCM A;  2NS8 A;  5ILS A;  5KHD A;  2HS5 A;  3S8P A;  4P9F A;  4UUS B;  3COA C;  2D5V A;  1EJ9 A;  1JUM A;  1KQ8 A;  1I1G A;  2BW3 B;  2MW8 A;  3W2A A;  2HXI A;  2DYS H;  3CCU I;  3ZP5 A;  2DK8 A;  4OMY A;  3H9J A;  4YII A;  2Y48 A;  5DUK A;  5GPC A;  3JRA A;  1U6G A;  3VSL A;  4ENJ A;  2BHZ A;  4CSW A;  3OYI A;  3HUG B;  1YS6 A;  2QZ8 A;  3DLA A;  1LE8 B;  3QOE A;  4KMU X;  5E20 A;  2LH9 A;  5K7F A;  4OIN F;  4MHG A;  2Z2S B;  2XAJ A;  3CJR B;  1RR7 A;  3IWZ A;  4B09 A;  3HOY J;  3H3Z A;  5J3L A;  1XMX A;  3LQQ A;  5LHG A;  4KT6 A;  3KZY A;  1E0E A;  1MKM A;  1WFX A;  4YFK F;  3ZMS A;  5ICF A;  2H09 A;  4CZZ A;  3HTS B;  4V2F A;  4C2T A;  2NVT J;  3TKY A;  2HKX A;  2FA5 A;  4KIS A;  3JRH A;  2F5D A;  3F0C A;  2Y75 A;  3TED A;  3X2Q H;  2VOO A;  1SAX A;  3M7G A;  1VQ7 I;  3HOU J;  3MZH A;  3ABM H;  4RGX A;  2IA1 A;  2L9S A;  1UCR A;  3JSO A;  3LSH A;  2LFB A;  2E36 A;  1YS7 A;  3FMQ A;  4G6Q A;  4GYG A;  3KYD B;  1WH5 A;  2MD5 A;  5F0C A;  2YX4 A;  3JRI A;  1I1S A;  2C6Y A;  2RN7 A;  3ZMZ A;  1QZE A;  2R5Y B;  3CQZ J;  1G2H A;  4B43 A;  2ID3 A;  1ODD A;  2R7X A;  2X9D A;  3HSR A;  3WTX C;  4XIC A;  4FCY A;  4EJW A;  2EBI A;  4HDV A;  1ZG1 A;  1FIA A;  2IS4 A;  5EJC A;  3J7A Y;  2E2I J;  2HOT A;  2E7W A;  4U87 A;  1OJL A;  2E60 A;  2WTE A;  4CXF A;  3KCC A;  1ZN2 A;  2MH9 A;  4JK1 X;  2OQR A;  4LG3 A;  2DQL A;  3V4G A;  1HBX G;  3PNV A;  2DOD A;  3OYG A;  3CC7 I;  4WF2 A;  4C3I J;  4C3J J;  5LEJ A;  4K2E A;  3M8E A;  2YSR A;  3OMY A;  2ECB A;  3GTM J;  4A6E A;  3MAJ A;  1G3T A;  2VT2 A;  3KLN A;  4FE7 A;  2R7U A;  2K7L A;  2JPC A;  2DMU A;  1KU3 A;  4YFX F;  4FIS A;  1GDT A;  1FLI A;  4FTH A;  4X1E A;  2X6Y A;  5K5O A;  4HA8 A;  3BG5 A;  2PN6 A;  2R92 J;  4D7N A;  2IXS A;  4QTR A;  2PJR A;  2XIG A;  2V1X A;  4XKC A;  3T8T A;  1MZB A;  1Z3X A;  2L3D A;  3TGN A;  3GTK J;  2LDU A;  5LD2 C;  1EA3 A;  3WHC A;  3FMS A;  1IZ1 A;  1LNW A;  1DPU A;  3HRM A;  3IAS 2;  2K9L A;  1UHS A;  1YLF A;  2IAI A;  1IC8 A;  1OQY A;  3PSI A;  2ACJ A;  2DT6 A;  2X6X A;  2XC7 A;  1T0F C;  4JP0 A;  1MSF C;  3L2U A;  1U78 A;  2FQ4 A;  4IHX A;  1HKQ A;  5JLW A;  1WCM J;  1EV7 A;  1GXQ A;  1S3J A;  1FZP B;  3E0J B;  2R4G A;  3AKZ A;  4A3E J;  2CMP A;  3VYU B;  3GVA A;  1W7P B;  1ETX A;  2CQX A;  1LVK A;  5K1Y A;  1JJ6 C;  2LRE A;  2KRF A;  3SDB A;  5LHH A;  2JQ7 A;  3H5R A;  3T8R A;  4A3I J;  4LLG F;  3OYL A;  2DA5 A;  4DZJ A;  2XAS A;  2L4A A;  4CH7 A;  1ZRC A;  3GZN B;  3MKL A;  2LVS A;  1UFM A;  1FPQ A;  2XHK A;  3WU1 B;  5FD5 A;  3CLQ A;  3TW6 A;  4I02 A;  3ZXS A;  3DEW A;  2XDV A;  3G71 I;  1MGT A;  2CS3 A;  4BHC A;  2VXZ A;  1ETO A;  2WAF A;  2KDZ A;  3FXJ A;  2CV1 A;  4PJ0 C;  4IQ4 A;  2WA0 A;  1HXD A;  1MBE A;  5AIP A;  1R1V A;  3LSJ A;  1YOV B;  5K7Z A;  2VQL A;  1TT0 A;  3CCL I;  2LBF A;  2AQE A;  5L3G A;  5M5X J;  1T98 A;  4E7L A;  3NAR A;  3CMA I;  3ZQL A;  2MFZ A;  2E5N A;  5DEQ A;  1APL C;  2NOG A;  2ICW G;  3GEZ A;  2PMH A;  3DWL E;  3BWG A;  4LIT A;  3OYE A;  4ZYE A;  2P7V B;  2VKD A;  1QNT A;  2W24 A;  2Y0M A;  3BR2 A;  5FO5 A;  4JQF A;  3ZOB A;  5LBQ A;  4PJN A;  1WJ5 A;  2E71 A;  5B1A H;  2I8D A;  3K1N A;  3E97 A;  4BQO A;  3A0B C;  4L5I A;  2E1O A;  4V2G A;  2JA2 A;  3S93 A;  2ME0 A;  3F21 A;  1X1C A;  4ETS A;  2DTR A;  2KPM A;  1D5Y A;  4ABZ A;  2ISZ A;  2FBI A;  4D5F A;  1W0U A;  4E4H A;  5FLV A;  4ZJZ A;  2XVC A;  3HOZ J;  3LOC A;  2XSJ C;  3M8J A;  3U1K A;  1R58 A;  2M4K A;  1BM9 A;  2VN2 A;  4N9I A;  1YFH A;  1Y56 A;  1BL0 A;  3S15 J;  3G1O A;  5TGT A;  4BUP A;  4GCV A;  4B3X A;  3E6C C;  3PM1 A;  1B6A A;  2CFO A;  5H20 A;  4G9Y A;  3A01 A;  1DP3 A;  1WH7 A;  2O03 A;  5EEH A;  2V1U A;  3JRB A;  3OS2 A;  1W0T A;  4KJZ A;  3TP3 A;  2F6C A;  4G12 A;  2LTP A;  4EM0 B;  2HOE A;  1TWG J;  4EJU A;  3MFK A;  1J5Y A;  2E34 A;  4IHY A;  3S32 A;  4ZYD A;  3KP4 A;  2M0C A;  4M9S A;  3F6O A;  1AWC A;  1YRN A;  1X4O A;  1DPR A;  1WQ2 A;  2LR8 A;  2ZXW H;  4I99 C;  2KMU A;  3VOE A;  1NK3 P;  4F7Z A;  3D0S A;  2FSW A;  2EZL A;  5ED4 A;  5B1B H;  4KYW A;  2KZV A;  2XPV A;  2RGV A;  2KKO A;  3GUD A;  5JHU A;  2FMY A;  2H6C A;  2L7K A;  2XGC A;  3C2G A;  5LRS A;  3SFZ A;  4G6T B;  4E70 A;  1YJW I;  1TWH J;  1SEU A;  1ZEL A;  3ERM A;  3HOT A;  2LMD A;  5IPA A;  2L0K A;  4RBO A;  2EV6 A;  3WTW C;  3KE2 A;  5FRM A;  3K2Z A;  1UAA A;  4IRH A;  2JA8 J;  5DV5 A;  2ME6 A;  2XRL A;  1AKH A;  2BVL A;  2O61 A;  3ESW B;  2QYO A;  2MSY A;  3T0Y A;  2KP6 A;  4KA4 A;  3F8C A;  3P5J A;  4MO7 A;  3HL2 A;  1W36 C;  2OUM A;  4A2U A;  5J1R A;  3ECO A;  3M8F A;  2R7V A;  1IN7 A;  3IC7 A;  5FLX K;  2HZT A;  5DM7 F;  1LDD A;  3ZMU A;  1H89 C;  2A61 A;  4M3F A;  1T39 A;  2CUE A;  1BR1 A;  3GBG A;  3F23 A;  2DJN A;  3IH4 A;  2XF5 A;  1S6L A;  3ZN0 A;  3DEE A;  1PYV A;  3BLY A;  2YS9 A;  2X4H A;  1OCP A;  4LJZ F;  5M5W J;  4U7D A;  4UVC A;  2DA3 A;  4LFU A;  3HKZ N;  4ZYH A;  3S17 J;  1P6R A;  1D5V A;  3J80 K;  1D0Y A;  2KL4 A;  2YU3 A;  3GTL J;  5HNH A;  1TZL A;  2VJ4 A;  1O7L A;  1K78 A;  1D1A A;  1JXS A;  4PGH A;  2ZJ2 A;  3RIR A;  2VKV A;  3F22 A;  4RM2 A;  2HPM A;  2M2E A;  2HYG D;  2DFE A;  3RSN A;  2DCE A;  2OJE D;  4BYY A;  3O2P E;  1A04 A;  4UUV A;  1T08 B;  2EIK H;  1MND A;  2HGC A;  3FM5 A;  1R9T J;  4BXX J;  4II2 A;  4ZZD A;  3RQI A;  4XK4 A;  1U5T B;  3ROU A;  1U5T C;  4XBF A;  1R4M B;  4MFD A;  2ZME A;  1TNT A;  1UZC A;  2OPT A;  5JHF A;  1W1W E;  2Z16 A;  4YG2 F;  2J5P A;  1SVM A;  2VJI A;  2NVU B;  4Q4Z F;  1VQN I;  2LC2 A;  2MLG A;  3WOD F;  2Z3Y A;  1XPX A;  2R7Q A;  1VND A;  5DD8 A;  1WJC A;  1MJA A;  3RKY A;  1SFO J;  4IL6 C;  4A0X A;  1A31 A;  3TOA A;  4IX7 A;  5FRO A;  1Q1V A;  1JKR C;  1OFC X;  2VQH A;  5A2Q K;  1TWF J;  3G1M A;  5C3E J;  3WU2 C;  3HHG A;  4XM3 A;  1MH4 A;  2L9V A;  3WTT C;  3VEP A;  1LKX A;  3E7L A;  1UB9 A;  1TT5 B;  2FOK A;  2XV4 S;  1PP7 U;  2CO5 A;  1TQM A;  1H0M A;  1O3R A;  3DU6 A;  4D0P A;  1JGG A;  1HW2 A;  3WTY C;  2CW8 A;  3BJA A;  3S14 J;  3RZO J;  2M5W A;  1WJA A;  2HOS A;  3IH3 A;  4PDK A;  3GWZ A;  3WE2 A;  2HVR A;  4HOB A;  4HV5 A;  1FYM A;  5KNL A;  3MKZ A;  4IRI A;  3BPV A;  4LMY A;  1VQP I;  2G9W A;  4DOZ A;  3K4L A;  2DPD A;  3I0T A;  3G73 A;  2GIV A;  1MBF A;  2QM3 A;  4KDP A;  2W00 A;  1MBJ A;  4Y33 A;  4XL9 A;  4BH9 A;  1OCO H;  4ZDL A;  4F93 B;  2VQG A;  2PX9 A;  4IHS A;  3DQV C;  2Y2Z A;  5BMZ A;  3BJ6 A;  3KP3 A;  4UXN A;  1IJW C;  3VOD A;  1XGO A;  2AQF A;  4M3B A;  2W4S A;  3P9K A;  3L2W A;  1R4N B;  2IA0 A;  3CCJ I;  4CCO A;  3RPU D;  1MJ9 A;  1U2W A;  4LB5 A;  5LEK A;  4LOC A;  1YE9 A;  1H88 C;  3OYA A;  3RKX A;  3B6A A;  2COB A;  2EFQ A;  3ISP A;  2IA2 A;  2WAQ N;  1BBY A;  2M8G X;  5IP6 A;  4MIM A;  2ZCW A;  4BE2 A;  4ZTJ A;  3QRF F;  2HYF A;  3E3V A;  4G94 A;  2CWE A;  4Y13 A;  2JJ7 A;  5IT9 Z;  1JKO C;  2ZNZ A;  1LPQ A;  4U0Y A;  1WI3 A;  1L0O C;  3ZQ7 A;  3ASN H;  4A5N A;  1IV6 A;  1NK2 P;  2B63 J;  4UY8 I;  4D9J A;  1R7J A;  1RI7 A;  3RPU A;  1F5T A;  1J0R A;  5CLS A;  1JTX A;  5D8K B;  3OIP A;  1FSH A;  3K70 C;  1OPC A;  3A01 B;  3V7S A;  4GRI A;  3V7R A;  3GFJ A;  2HQR A;  2R7F A;  2ELH A;  4P55 A;  5GAD J;  2JVG A;  3BG6 A;  4E7H A;  2VPL A;  2IGM A;  1STZ A;  5CVJ A;  2D1H A;  2K4B A;  1S8N A;  2CGP A;  1YQA A;  2XAF A;  2ZFU A;  3RDI A;  4AUX A;  3LST A;  4IHV A;  1ORK A;  3QPH A;  2CV0 A;  5K5R A;  2F5C A;  1ONV A;  4GGG A;  2Z9O A;  4D5C A;  2O9L A;  2DO7 A;  1YRN B;  4EVI A;  4EJO A;  1ETV A;  2M9H A;  1XSD A;  3I71 A;  3HJE A;  2OCE A;  2VE9 A;  4GFB A;  4GDF A;  4QPQ A;  3ZPL A;  5DCF A;  4CHU A;  3CTA A;  2R7W A;  1QPI A;  5DDG A;  1JT6 A;  1WI9 A;  2BYV E;  4LLL A;  2VQC A;  3BR0 A;  2W25 A;  1WPK A;  4CYC B;  4E7S A;  5EF6 A;  2BY2 A;  3Q9S A;  4BHP A;  2A6E F;  4P1W A;  1EH8 A;  1NG6 A;  2XGE A;  1ZK8 A;  2E35 A;  4PJJ A;  1AKH B;  4BNC A;  2ZKZ A;  1BI0 A;  2ZC2 A;  1G3W A;  1Z91 A;  1OR7 A;  2UWM A;  3NWT A;  3E1S A;  3KP5 A;  1SFU A;  2GQQ A;  3BTL A;  4IVN A;  3EUH A;  4XON A;  2LG4 A;  2GWR A;  2JMW A;  3QPS A;  3CMY A;  5FJ8 J;  5H6Q A;  5F04 A;  3BZ6 A;  3HC7 A;  1S7E A;  1OCC H;  3LSG A;  4G6D A;  5L3F A;  3RKW A;  1PUF A;  2ADU A;  2I5U A;  2KIF A;  4RAG A;  3ZQH A;  2CH0 A;  5KAI C;  2CG4 A;  2EZH A;  2JTV A;  3WE3 A;  1QZY A;  3IV5 A;  4BQQ A;  5C44 J;  3IRR A;  3V7C A;  3OYB A;  4IHT A;  3VWB A;  2CRG A;  4PJM A;  1E3P A;  5TRD A;  2CQ7 A;  5F64 A;  2MBF A;  3HBL A;  2FXA A;  4XLE A;  4J19 A;  1AOY A;  5EZG A;  4Y52 J;  5LLQ A;  5IP7 J;  1U9N A;  3PNY A;  4AIH A;  3DP7 A;  5DTD A;  1A5J A;  3HXL A;  4P5O A;  5B3S H;  3JTH A;  1JUS A;  2E1M C;  3Q9V A;  4E6K G;  2D1V A;  3KEQ A;  1RUN A;  3RI4 A;  1QRY A;  3PQK A;  3WGH A;  2QWW A;  3J7A O;  4WCG A;  3FHZ A;  2PFB A;  1KQ9 A;  1HKT A;  1UG2 A;  2K9Q A;  3I4P A;  1V4R A;  4YRV A;  2NVY J;  3LQR A;  3CCY A;  3FK7 A;  1V54 H;  1KYZ A;  3TL4 X;  3L09 A;  1QO0 D;  5DYM A;  2R0Q C;  2MAB A;  4JX4 A;  1BN5 A;  1RUO A;  2H1K A;  3PO2 J;  2ZME B;  2W82 A;  3WHB A;  3U21 A;  4XR6 A;  4B47 A;  2EK5 A;  5E3L A;  4E7I A;  1Z05 A;  1T33 A;  1V5G A;  3V42 A;  2RNG A;  1TL8 A;  3TW7 A;  4OWR B;  5ICC A;  2HEO A;  2PBI A;  3BPX A;  3AG3 H;  4YIF A;  4L0Z B;  2EA2 A;  4CIC A;  1OYW A;  3MN2 A;  3OYF A;  4XRM A;  1U8B A;  2JA5 J;  2DA6 A;  3M9A A;  4M6V A;  4HG2 A;  1V5F A;  2VKH A;  3GTP J;  2HPI A;  1ON1 A;  3PFI A;  2CSO A;  1X58 A;  1WGX A;  5EG0 A;  2DI3 A;  1T2K A;  2NS0 A;  4BBS J;  3IUO A;  2GLO A;  3L2V A;  2ZBK A;  3L7W A;  1K4T A;  2DQR A;  5FFX A;  2GAU A;  1VTN C;  3LA2 A;  1V3F A;  2KFD A;  1SVO A;  2MA3 A;  3WU0 A;  2DOA A;  2RRE A;  4HDU A;  4KIF A;  1RR8 C;  3L2C A;  3T5X A;  3M3Y J;  2VL8 A;  4NC7 A;  2O8K A;  2V4J C;  2XRN A;  1ETY A;  4A3C J;  5FD6 A;  2BZT A;  4ON0 A;  2J5O A;  2VAS A;  2Q0O A;  2VB6 A;  2NAZ A;  4G7H F;  2O7O A;  4XID A;  4E7J A;  2Q2E B;  4U88 A;  4XMY A;  5FFZ A;  3CES A;  4NC6 A;  2L9N A;  2UXX A;  1I27 A;  5L3D A;  4CO8 A;  3BZK A;  1VQ4 I;  1N78 A;  1IN8 A;  5FKN A;  4OAY A;  1E3O C;  1TQP A;  5E1X A;  5CKT A;  3LA7 A;  1IN5 A;  3B02 A;  3C3W A;  1BI3 A;  4RLF A;  3GO5 A;  2TRT A;  3HB9 A;  3DKY A;  3GYH X;  3K6G A;  2IRF G;  3I54 A;  3KET A;  2DW4 A;  1X3U A;  2DA1 A;  3H5A A;  4RMN A;  4N4N B;  5GAG J;  1C0W A;  3FXQ A;  3OYD A;  3FXU A;  4EJV A;  1ETQ A;  1SMY F;  2HVS A;  1U3E M;  5HDN A;  2Z33 A;  5L3C A;  1YJN I;  2JRM A;  5HLI A;  5ICG A;  1PUE E;  3H3V K;  1FTZ A;  5J1U A;  3AG2 H;  2DFI A;  3R61 A;  3A4C A;  3JRE A;  1BJA A;  4C30 A;  3GXO A;  1VQO I;  3K2A A;  1DGR M;  1QU3 A;  1KU7 A;  4Z6Y A;  1FYL A;  5KK1 A;  1POG A;  4O3M A;  1G59 A;  1FC3 A;  4EQQ A;  3CCS I;  1SC7 A;  2CW0 F;  1XDU A;  3S3O A;  2E19 A;  4MTE A;  2IT0 A;  1FBU A;  2VKE A;  4IOC F;  4M3D A;  1JJ8 C;  4BS9 A;  4CCJ A;  3FXL A;  3WTU C;  3ONQ A;  2WWY A;  4XRF A;  2K4J A;  5F1J A;  4AU7 A;  5HLG A;  2BGC A;  1EH6 A;  4XSX F;  5LGN A;  3CO6 C;  3WG9 A;  2Y31 A;  3B73 A;  4XNF A;  3TOB A;  4B44 A;  1OCZ H;  3I5U A;  3ZRG A;  2KIU A;  2V9V A;  3LSI A;  3MKW B;  1ZLK A;  1RPW A;  1LJ9 A;  1FOW A;  1FJL A;  3CCR I;  3OY9 A;  3O3K A;  2DMN A;  3DPT A;  4HBL A;  3Q5F A;  1PVE A;  4HX4 A;  1BC8 C;  1MMS A;  1P7I A;  3SZG A;  3CC2 I;  2BXY A;  1MNM C;  2ZSH B;  3WTV C;  3BR1 A;  5CVR A;  2M4G A;  4LGW A;  3GTO J;  1O3Q A;  3SEQ A;  3WTZ A;  3I56 I;  5L3E A;  3W6K B;  4KT5 C;  4XRS G;  2L5Q A;  3GME A;  2PLY A;  2XAQ A;  4RB0 A;  5IP9 J;  3KPH A;  1S7O A;  1ULY A;  3QYE A;  1JHF A;  5J8C A;  3G4S I;  3KIO A;  2EH3 A;  2DU9 A;  2X6O A;  1KYW A;  2WAQ A;  5LFA A;  4GYI A;  3E6M A;  1LFB A;  2CJJ A;  5DS9 A;  2LF7 A;  3S2D J;  2HQ5 A;  4B1R A;  1SD4 A;  1EH7 A;  3KX2 A;  1W5C C;  2XF6 A;  1HLV A;  2V26 A;  1OMI A;  1Z6T A;  2L9R A;  2L01 A;  5EGO A;  3K4M A;  1RIO H;  3IKV A;  2STW A;  2OZU A;  2BY1 A;  4LIV A;  3OYJ A;  2VOD A;  2XUB A;  4N9H A;  2DOF A;  3D1N I;  4KN4 X;  1Z6R A;  3CLO A;  3SEZ A;  4WXC A;  3RYP A;  3BP8 A;  2LSO A;  4ENK A;  4Q47 A;  4LLN A;  4CA0 A;  1MJB A;  1IXS B;  4A6D A;  2IGO A;  1OLT A;  1IUF A;  2DJI A;  2EFW A;  4HLY A;  3VDX A;  1IW7 F;  4CCK A;  3BOQ A;  1HDP A;  2F2E A;  3BJO A;  1E17 A;  1GVJ A;  2LKS A;  4M9X A;  2VON A;  3EQL F;  3GLX A;  4M71 A;  1TW3 A;  4YEL A;  1GV5 A;  3SXY A;  3QP5 A;  1A6Q A;  4W97 A;  2BBY A;  3CDI A;  4NDL A;  3BCA A;  3EUK L;  1KQ0 A;  3AFH A;  2M7A A;  2P5K A;  2H8R A;  1IG7 A;  3CJN A;  2DT7 B;  4DGW B;  2VPR A;  1B9N A;  2V79 A;  2VBX A;  2XAH A;  1TWA J;  5FLX Z;  3CUQ A;  3PIO F;  5TJJ A;  5D6E A;  5DCM B;  2DAO A;  2IGK A;  2Y9Y A;  4X0G A;  4HF2 A;  4DBR A;  1R23 A;  3KZZ A;  3DBL B;  4M6X A;  2JN6 A;  1ZR4 A;  1A6I A;  2L4M A;  1ZHF A;  4EM2 A;  5E18 F;  3JTG A;  3JRC A;  2GZW A;  2KT0 A;  2OQG A;  1Z21 A;  1YX5 A;  2ECC A;  3PSF A;  4A3M J;  3HPG A;  4CCL A;  2GOX B;  1FMW A;  1IDZ A;  5EG0 B;  3FBN B;  2P5L C;  1QZZ A;  1G6N A;  2HKO A;  4BXF A;  2JSP A;  5JI6 A;  4ESJ A;  4A3K J;  2LD5 A;  2NOJ B;  2LY2 A;  4KN7 X;  4UUT A;  2IVM A;  4XKB A;  2EZI A;  4RB3 C;  3EYI A;  3L1P A;  3AG1 H;  3D5S C;  3BG9 A;  1D1B A;  3OSG A;  1Z3Y A;  1B8I A;  3MCZ A;  4ANJ A;  2RV8 A;  1WVR A;  5HVQ C;  1RRJ A;  2FML A;  5EEG A;  3DEU A;  1D8K A;  3TDU C;  4RLQ A;  3QU6 A;  5F27 A;  3ASO H;  4ZYA A;  2LNB A;  2HFH A;  4JX5 A;  2R5Z A;  2D2W A;  1MMD A;  2LKP A;  4ESF A;  3BZC A;  3LA3 A;  4Q48 A;  4CCN A;  3R60 A;  3SYT A;  3JRF A;  4S04 A;  4HNT A;  1HSJ A;  4J01 A;  4GO1 A;  4DQ2 A;  3CO7 C;  1B9M A;  1W4M A;  3CJT B;  3HRS A;  5A2Q Z;  1XGN A;  2LF8 A;  2WBM A;  1V55 H;  5HDK A;  3AAF A;  3LAP A;  3UR3 C;  3JW4 A;  3ZR8 X;  3A02 A;  3N97 A;  1QA6 A;  3F8B A;  4Q5S F;  2A69 F;  1DDN A;  2X1C A;  4IHW A;  1ZG5 A;  3MEX A;  3CF5 F;  3ZMD A;  1SVL A;  3OOU A;  3BQY A;  3H1C A;  2MGQ A;  5E1W A;  3L00 A;  3ABL H;  3DKX A;  4JX6 A;  1LB2 A;  3D5R C;  1LQ1 A;  2UV1 A;  2W1O A;  3K1P A;  3C1D A;  1N77 A;  1VQL I;  1F43 A;  4NQW A;  1WJD A;  1U8R A;  2O6G E;  2HI3 A;  3Q3S A;  1Z9C A;  3ZQC A;  2DLL A;  2M1B A;  1B72 A;  1HCR A;  3JAM Z;  2EV5 A;  4OOI A;  3R0J A;  4WXD A;  5GAH J;  2A5W A;  4CGZ A;  4HX8 A;  4S0H B;  2PJR B;  2L2O A;  1MDM A;  3NAU A;  5CQG A;  2V6E A;  4KIB A;  3S1M J;  2ESH A;  3KP7 A;  3FWE A;  3RZD J;  3LSM A;  3CP8 A;  5M5Y J;  3J81 Z;  3ZMT A;  1R6R A;  1TP4 A;  1J75 A;  4BDZ A;  3QOP A;  4HLX A;  4BGD A;  1OIS A;  3I58 A;  3CDH A;  1Y8Q B;  2H27 A;  1XSV A;  2KJB A;  2IJL A;  2JVH A;  5AIQ A;  4OIP F;  1MMN A;  2NNN A;  5ICE A;  3A2K A;  1WJB A;  3CCQ I;  5B5E C;  1XG1 A;  3GTG J;  1D3Y A;  2M34 A;  4XLH A;  5CVU A;  4CDG A;  1UHM A;  2H6B A;  2DMP A;  1YG2 A;  4D1Q A;  1TC3 C;  4IOA F;  2IS2 A;  2DDA A;  2HDD A;  1B4A A;  3QOD A;  2O3F A;  3FDY A;  3DPU A;  2W7N A;  3LSP A;  1ZRF A;  2XB0 X;  5J8F A;  3V8K A;  5ERI A;  1YIO A;  4XOT A;  4OMZ A;  3WTS C;  2GIZ A;  1B59 A;  1NTC A;  4BKX A;  1R1U A;  1XGS A;  3FKJ A;  3GFM A;  4L18 B;  4BEH A;  4RAF A; 
#chains in the Genus database with same CATH homology
 2EBI A;  3BTL A;  1FIA A;  1FTT A;  2JMW A;  3QPS A;  3CMY A;  1MBH A;  2E2I J;  5FJ8 J;  2HOT A;  1I6H J;  2LLK A;  1OJL A;  5F04 A;  5J1Y A;  2YUS A;  1S7E A;  3LSG A;  1PUF A;  4IEJ A;  1DU0 A;  2GM4 A;  3ZQH A;  4C3J J;  4C3I J;  1LFU P;  2EZH A;  2K9N A;  1ZR2 A;  3IV5 A;  2ECB A;  5C44 J;  3GTM J;  2CRG A;  5EGO B;  4FE7 A;  1HDD C;  2JWT A;  5IYD J;  2DMU A;  1GDT A;  4FIS A;  3DCF A;  3HBL A;  4DZP A;  4J19 A;  4FTH A;  4X1E A;  5EZG A;  3TP0 A;  2RAE A;  4Y52 J;  1P7J A;  5IP7 J;  2HXO A;  3BG5 A;  2R92 J;  1U9N A;  4D7N A;  4QTR A;  3GTQ J;  5DTD A;  1A5J A;  2VUM J;  5FKO A;  1JUS A;  3GTK J;  3WHC A;  4AYB N;  1K83 J;  1QRY A;  1MSE C;  1XS9 A;  1UHS A;  2IAI A;  4L5E A;  1UG2 A;  1IC8 A;  2K9Q A;  3BG3 A;  2NVY J;  2G0E A;  1ETW A;  3Q0U A;  3CCY A;  3FK7 A;  4JP0 A;  4DYC A;  1MSF C;  1Y1V J;  1U78 A;  2FQ4 A;  2QCO A;  4JX4 A;  5JLW A;  2R0Q C;  3MVP A;  2H1K A;  1WCM J;  4IHX A;  3PO2 J;  1BA5 A;  3WHB A;  1ZTR A;  1O4X A;  2JA6 J;  5E3L A;  3W6V A;  1CQT A;  1T33 A;  4CYC A;  4A3E J;  3OIO A;  5FKL A;  1U9O A;  1ETX A;  2CQX A;  3TW7 A;  5E3N A;  5F0H A;  3C2B A;  1JT0 A;  1JJ6 C;  1FEX A;  1VFC A;  4A3I J;  4A3B J;  4DYR A;  3MN2 A;  4EEF G;  2DA5 A;  1RKW A;  2HOA A;  3Q0W A;  4DZJ A;  4XRM A;  1U8B A;  2JA5 J;  2DA6 A;  4M6V A;  3MKL A;  2VI6 A;  1JKP C;  2GBY A;  2LVS A;  2I10 A;  3TW6 A;  3DEW A;  3GTP J;  4A3G J;  4JYK A;  3SFI A;  1X58 A;  1WGX A;  1ETO A;  2KDZ A;  5GPA A;  5EG0 A;  4BBS J;  3FK6 A;  2GLO A;  4QIW N;  3O8H A;  3SDG A;  1MBE A;  2XB5 A;  4B3A A;  1QVT A;  3LSJ A;  3A03 A;  5K7Z A;  2JK3 A;  1TWC J;  5M5X J;  3NAR A;  3BTJ A;  1SAN A;  3M3Y J;  3ZQL A;  2O8K A;  1I50 J;  2OF7 A;  3I4M J;  1ETY A;  4A3C J;  1APL C;  2NOG A;  5BNG A;  1IRZ A;  2O7O A;  5IOZ A;  1T56 A;  3BR6 A;  4XID A;  2DA7 A;  3VPR A;  3BR2 A;  5EEA A;  3BTC A;  4X6A J;  3SJM A;  1GT0 C;  2R5Z B;  3ZOB A;  2E2H J;  2DN0 A;  5FKN A;  4A3F J;  1E3O C;  5HOD A;  5FKK A;  3S16 J;  2FX0 A;  2E1O A;  4V2G A;  2TRT A;  3HB9 A;  5F0F A;  2R7Z J;  2ME0 A;  1D5Y A;  1IGN A;  4ABZ A;  2DA1 A;  3FIW A;  3JR9 A;  4D5F A;  4A3L J;  1W0U A;  5FLV A;  2ZB9 A;  4HNV A;  3HOZ J;  1HOM A;  3LOC A;  1ETQ A;  4UUS A;  1BL0 A;  3S15 J;  3G1O A;  4W1U A;  1ZKG A;  3H3V K;  3FKI J;  5J1U A;  4C3H J;  3Q0V A;  3JRE A;  2FJ1 A;  1FTZ A;  3PM1 A;  1Z77 A;  2LP0 A;  3LNQ A;  3K2A A;  3A01 A;  1WH7 A;  2LK2 A;  3JRG A;  2NVQ J;  1POG A;  3JRD A;  2L7M P;  3JRB A;  1LE8 A;  2JA7 J;  1W0T A;  4A69 C;  4I76 A;  3TP3 A;  2E19 A;  4G12 A;  2LTP A;  2VKE A;  1IDY A;  3S1R J;  4BBR J;  1TWG J;  2K40 A;  3H0G J;  2IEK A;  4M3D A;  1JJ8 C;  1B72 B;  4IHY A;  1Y1W J;  2LY9 A;  3RKQ A;  2Y30 A;  2M0C A;  1YRN A;  5F1J A;  1VI0 A;  2LR8 A;  1NK3 P;  4M3E A;  1JTY A;  4B4C A;  2EZL A;  2Y31 A;  5IYC J;  4XRS A;  3QQA A;  2XPV A;  2DMT A;  4DW6 A;  1RET A;  2L7F P;  1ZGW A;  1RPW A;  2XGC A;  1FJL A;  5GP9 A;  2DMN A;  1K61 A;  1TWH J;  1BW6 A;  1AU7 A;  2CUF A;  4AC0 A;  5IPA A;  1ETK A;  2L0K A;  4RBO A;  1GUU A;  1P7I A;  4C2M J;  2L7Z A;  3GTJ J;  1MNM C;  3BR1 A;  3CDL A;  5IOY A;  4MFE A;  4A3J J;  3GTO J;  2P81 A;  2JA8 J;  2ME6 A;  2XRL A;  1AKH A;  2R5Y A;  2N8G A;  2IBD A;  3UKG A;  4Y7N J;  2MSY A;  4XRS G;  2EQR A;  1JKQ C;  3S2H J;  4MO7 A;  5EDN A;  5J1R A;  5IP9 J;  4QSH A;  2EH3 A;  2X6O A;  2XPW A;  1H89 C;  4M3F A;  1LFB A;  2CJJ A;  2CUE A;  5DS9 A;  3S2D J;  3GBG A;  1BW5 A;  2DJN A;  2HQ5 A;  3IH4 A;  4B1R A;  2YS9 A;  1OCP A;  5M5W J;  4M3G A;  3HGY A;  3S1N J;  2DA3 A;  1HLV A;  3HKZ N;  3S17 J;  3HOW J;  2PMZ N;  2L9R A;  1H8A C;  5EGO A;  2X48 A;  3IH2 A;  1MBG A;  1FIP A;  3GTL J;  5IYB J;  3D1N I;  4A93 J;  1B8I B;  2CQQ A;  1BJZ A;  3HOV J;  1GV2 A;  2VKV A;  2M2E A;  2QF7 A;  1IUF A;  5EYR A;  4BY1 J;  1HDP A;  3ZQG A;  1DU6 A;  3BT9 A;  1R9T J;  4BXX J;  2MG4 A;  4DYQ A;  2R93 J;  2Y0S N;  1XC5 A;  2ID6 A;  2HYJ A;  3RQI A;  2DTZ A;  4XK4 A;  1GV5 A;  5M3M J;  4W97 A;  1Z0X A;  4MFD A;  1ENH A;  3S1Q J;  4NDL A;  2OPT A;  2EZK A;  2DMQ A;  1GVD A;  2XPU A;  2H8R A;  1IG7 A;  1RES A;  2W48 A;  1ITY A;  2K9S A;  2VPR A;  1TWA J;  1VND A;  2CU7 A;  2NVX J;  5C4J J;  1SFO J;  2Y9Y A;  1Q1V A;  1JKR C;  1MBK A;  1OFC X;  4A3D J;  5FLM J;  2JN6 A;  5E3O A;  2E2J J;  1TWF J;  3G1M A;  5EZH A;  3BQZ A;  5C3E J;  1ZR4 A;  1EF4 A;  1A6I A;  1X2M A;  4MLO A;  1MH4 A;  9ANT A;  3E7L A;  2AO9 A;  3JRC A;  2KT0 A;  3HDD A;  3G1L A;  1JGG A;  2ECC A;  3RZO J;  4A3M J;  3S14 J;  5K7H A;  1JUP A;  2HOS A;  1UMQ A;  1IDZ A;  3IH3 A;  1VF9 A;  5EG0 B;  4A3K J;  1AHD P;  2LD5 A;  3K7A J;  4UUT A;  2EZI A;  2FD5 A;  3L1P A;  1X2N A;  3BR3 A;  3BG9 A;  1MBF A;  3OSG A;  3QPL A;  1B8I A;  1MBJ A;  1MH3 A;  3I4N J;  3ZQF A;  2Y2Z A;  3FIS A;  1IJW C;  5F27 A;  3OSF A;  2AHQ A;  2TCT A;  4M3B A;  5FKM A;  4I6Z A;  3O8G A;  4JX5 A;  2R5Z A;  4RDU A;  4BY7 J;  4LOC A;  2WB1 N;  1H88 C;  3B6A A;  2XGD A;  3JRF A;  2COB A;  1HF0 A;  3PO3 J;  2WAQ N;  2M8G X;  5IP6 A;  4MIM A;  1I3Q J;  2DA4 A;  5C4X J;  3B6C A;  2LKX A;  2JJ7 A;  1JKO C;  1QVU A;  1WI3 A;  1RKT A;  3A02 A;  3ZQI A;  1OCT C;  2YU9 J;  3HOX J;  2NS8 A;  1IV6 A;  1NK2 P;  2B63 J;  4IHW A;  4UUS B;  3HM5 A;  2D5V A;  1JUM A;  2MW8 A;  5F08 A;  2HXI A;  1JTX A;  1PUF B;  3OOU A;  3BQY A;  3BR5 A;  2MGQ A;  5GPC A;  3JRA A;  3A01 B;  4JX6 A;  4FE4 A;  2NS7 A;  3M4O J;  3HEF A;  1F43 A;  1LE8 B;  2HI3 A;  3Q3S A;  3ZQC A;  5JLX A;  2DA2 A;  3HGG A;  1B72 A;  1HCR A;  2ELK A;  5K7F A;  4AUX A;  4S0H B;  3HOY J;  3S1M J;  3NAU A;  1RR7 A;  1ORK A;  4IHV A;  5J3L A;  3RZD J;  5M5Y J;  3BTI A;  4D5C A;  2O9L A;  1YRN B;  1ETV A;  2M9H A;  2WV1 A;  5E3M A;  4V2F A;  4GFB A;  2NVT J;  3LSR A;  1QPI A;  3JRH A;  3TED A;  3F0C A;  3HOU J;  1JT6 A;  1XG1 A;  1ZQ3 P;  3GTG J;  2M34 A;  3BR0 A;  1WPK A;  4CYC B;  2DMP A;  2LFB A;  5EF6 A;  1TC3 C;  4D7M A;  2HDD A;  2Y9Z A;  2XGE A;  1WH5 A;  1ZK8 A;  5F0C A;  3JRI A;  3LSP A;  2XSD C;  2XB0 X;  1AKH B;  2R5Y B;  3CQZ J;  1G2H A;  2ID3 A;  5M3F J;  1NTC A;  4BKX A;  2X9D A;  1F36 A;  4XIC A;  4FCY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...