1WH5A

Solution structure of homeobox domain of arabidopsisthaliana zinc finger homeobox family protein
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
80
structure length
80
Chain Sequence
GSSGSSGSSAEAGGGIRKRHRTKFTAEQKERMLALAERIGWRIQRQDDEVIQRFCQETGVPRQVLKVWLHNNKHSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ZF-HD homeobox family protein
publication title Solution structure of homeobox domain of Arabidopsisthaliana zinc finger homeobox family protein
rcsb
source organism Arabidopsis thaliana
molecule tags Dna binding protein
total genus 15
structure length 80
sequence length 80
ec nomenclature
pdb deposition date 2004-05-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1wh5A00
3JRCA 3JRIA 3Q3SA 5IP7J 5EGOA 5M5WJ 5J1YA 4Y52J 4BBSJ 3ZQIA 1MSEC 1JUSA 1Y1VJ 1PUFA 4B1RA 5M5YJ 1FEXA 2AHQA 3BR6A 2X48A 2DMUA 3E7LA 4A69C 2E2JJ 3PO2J 2R5ZB 1POGA 4DZPA 3Q0WA 4B4CA 1IV6A 3D1NI 4UUTA 1HLVA 5HODA 1JJ8C 3FKIJ 3HDDA 2HXIA 2WB1N 4JX5A 4RDUA 1JUMA 4C3HJ 4M3EA 3O8GA 2L7ZA 2LR8A 3WHCA 2XSDC 4FCYA 4XIDA 1JTYA 2LVSA 4JX6A 2M34A 1LE8B 1A5JA 5F0CA 2ECBA 2EQRA 4C3JJ 4D7NA 2EZKA 1TWAJ 1ETYA 3I4MJ 2DMTA 3ZQLA 5J1UA 1RKTA 4NDLA 5C4JJ 3TP0A 1CQTA 1OFCX 1SANA 2ME0A 5K7FA 3JRGA 1NK3P 2XGCA 2R92J 1I3QJ 1RR7A 1U78A 4M3BA 1B8IB 1ORKA 1H88C 3GTKJ 4BY7J 1JGGA 4RBOA 2K9NA 4IHYA 1BL0A 3FIWA 1VI0A 3A03A 4BBRJ 1F43A 2XB5A 3ZQGA 3JR9A 2DA4A 4X1EA 4EEFG 4A3MJ 3G1LA 4JP0A 4XRSG 3VPRA 2LY9A 3BTIA 1DU0A 2H1KA 2ELKA 5IP6A 1NK2P 3NARA 2O8KA 4M3GA 1QRYA 1H89C 2Y31A 1IC8A 2JN6A 1B72B 3BTJA 4A3LJ 2TRTA 1B8IA 1D5YA 5IOZA 3G1OA 2NVTJ 4V2GA 3S1QJ 1GUUA 1ZKGA 5F0FA 2OF7A 2JA6J 1TWCJ 3GTLJ 3BT9A 3K7AJ 3SFIA 4QIWN 3GTOJ 3HB9A 4L5EA 1YRNA 5FLVA 5K7ZA 4M3FA 2FJ1A 1A6IA 1BW6A 2ID6A 3ZQFA 2R5YB 1IDYA 4A3JJ 2DMQA 3BR3A 1MBJA 3C2BA 2NOGA 5DS9A 2GM4A 1IG7A 1JKPC 2O7OA 2WV1A 2X9DA 5GPAA 4BY1J 3OIOA 4JX4A 4I6ZA 2HOAA 2MGQA 1OCTC 1MH4A 1BJZA 3B6CA 1MNMC 3JRAA 3HOVJ 1HOMA 3WHBA 5EZGA 5FKLA 1RKWA 5FKKA 3HOYJ 3S2HJ 2DN0A 5EG0A 1VFCA 1RETA 2WAQN 3BTLA 1I50J 5M5XJ 4DW6A 4DYCA 3BQZA 2XGEA 1AKHB 3A01B 2VKEA 3IH3A 2CU7A 4LOCA 4D5CA 4XICA 5JLXA 2ID3A 5M3FJ 3HKZN 1U8BA 3IH4A 1BW5A 1MBFA 3IV5A 4IHWA 3LSPA 2N8GA 1IJWC 2FQ4A 1WH5A 1QPIA 1JKQC 1Z77A 2NVQJ 1IRZA 2K40A 1HDPA 2PMZN 3F0CA 2LLKA 3HGGA 4A3CJ 4A3EJ 2EZIA 1ZGWA 1F36A 2XRLA 4S0HB 2VKVA 1OJLA 2HQ5A 3JRFA 1GV5A 1ZTRA 2M0CA 4XRMA 5EEAA 2L9RA 4MIMA 3TW6A 1UHSA 2MG4A 1E3OC 4AC0A 2MSYA 4JYKA 3L1PA 2R5ZA 4XRSA 1AKHA 5IYCJ 5F27A 3A01A 1H8AC 3H0GJ 1WH7A 2FD5A 1NTCA 4CYCB 5EZHA 1RESA 3BG9A 2B63J 2IAIA 2R7ZJ 2DA5A 4FISA 3SDGA 2LFBA 3SJMA 3M4OJ 1OCPA 2Y30A 4Y7NJ 4A93J 2VPRA 3HOWJ 9ANTA 1U9OA 2M9HA 3S14J 2EBIA 3NAUA 2X6OA 1EF4A 3TEDA 3LSJA 3OOUA 3O8HA 5E3LA 1LE8A 3TW7A 2DTZA 3BQYA 5C3EJ 2NVXJ 1ETXA 3BR1A 5GP9A 1MBKA 4GFBA 3GTQJ 1P7IA 5IYBJ 2YUSA 4MO7A 2EZLA 2ZB9A 2EZHA 2OPTA 1JTXA 4IHXA 1FIAA 3HOXJ 3UKGA 2DA2A 3LSGA 1G2HA 4A3BJ 3Q0UA 1WI3A 2LD5A 3G1MA 2CUFA 2XGDA 3S2DJ 3ZOBA 5FLMJ 3S17J 1FTTA 1VNDA 1Q1VA 2HOTA 4V2FA 4IHVA 2Y0SN 1BA5A 2CUEA 4W1UA 1SFOJ 3M3YJ 4BKXA 1Y1WJ 3Q0VA 5C4XJ 3GTMJ 4QSHA 1O4XA 4QTRA 2YU9J 3CQZJ 2L7MP 2K9QA 4MLOA 3LSRA 3RKQA 2ECCA 3RZOJ 1FTZA 1XG1A 1IGNA 2COBA 2DA6A 3BG3A 3CCYA 3ZQHA 2EH3A 4B3AA 2HDDA 4W97A 5EGOB 4A3IJ 2YS9A 3BTCA 3BR0A 1S7EA 1WGXA 4AYBN 4ABZA 1B72A 2L7FP 2M2EA 1HF0A 5K7HA 3RZDJ 3BR2A 1GV2A 1HDDC 1ETVA 3GTGJ 4FE7A 1VF9A 5BNGA 1JUPA 2KT0A 3B6AA 2DA1A 2L0KA 3PO3J 3JRDA 3JRHA 1ETKA 1K83J 3ZQCA 3H3VK 3S1NJ 5EYRA 1IUFA 5M3MJ 1TWGJ 3HM5A 1X2MA 1JKOC 4M3DA 3K2AA 2GLOA 2JA7J 1Z0XA 3OSGA 2DA7A 3CMYA 2R5YA 3S15J 5GPCA 3S16J 4AUXA 3IH2A 2D5VA 3DEWA 5FKMA 2R0QC 2HOSA 4UUSB 2E2HJ 1JT6A 1X2NA 1R9TJ 3HOUJ 2QF7A 4XK4A 1U9NA 3A02A 1ZR4A 2VUMJ 1MSFC 3HGYA 2ME6A 2M8GX 2CRGA 3HOZJ 4M6VA 1MBEA 4A3DJ 1FJLA 1ENHA 2XPUA 2LKXA 5FKOA 1ETQA 4IEJA 1AU7A 1I6HJ 4G12A 2IBDA 4A3FJ 1RPWA 1ZK8A 2E2IJ 4BXXJ 1T33A 5FKNA 2XPVA 1XC5A 1ETOA 1XS9A 3RQIA 2GBYA 2I10A 4UUSA 5E3NA 1LFBA 1QVUA 1TWFJ 3QPLA 3LOCA 1ZR2A 1AHDP 2LTPA 2KDZA 2HYJA 2K9SA 5J3LA 1X58A 3GTJJ 1W0UA 5F08A 5IOYA 1P7JA 1UMQA 3S1MJ 2LK2A 1W0TA 5F0HA 1WCMJ 2DJNA 2E1OA 5EF6A 4D5FA 4J19A 2CQXA 5JLWA 4C3IJ 1MBHA 4D7MA 2JWTA 2JA8J 5F04A 1HCRA 4X6AJ 5E3OA 3I4NJ 3GBGA 1JJ6C 4CYCA 2E19A 4DZJA 4A3KJ 1GT0C 1DU6A 1FIPA 1YRNB 1QVTA 5IYDJ 1ETWA 3QPSA 2JMWA 3MVPA 4FTHA 2G0EA 1MH3A 2HXOA 1GDTA 2LP0A 1MBGA 1ZQ3P 2FX0A 3TP3A 2Y2ZA 2CQQA 3LNQA 3MN2A 3FK7A 5IPAA 1APLC 2IEKA 2JA5J 1WPKA 3HEFA 1TWHJ 5E3MA 3S1RJ 3JRBA 5FJ8J 1TC3C 2Y9YA 2NS8A 1JT0A 2CJJA 4DYQA 2NVYJ 3CDLA 3JREA 1LFUP 4C2MJ 3PM1A 3MKLA 2R93J 2XB0X 3BR5A 3DCFA 1IDZA 2NS7A 3FISA 2HI3A 2XPWA 1PUFB 5F1JA 2JK3A 2H8RA 5EG0B 2QCOA 2W48A 2RAEA 3FK6A 2TCTA 2P81A 2DA3A 2MW8A 5IP9J 5C44J 3GTPJ 2VI6A 2DMNA 4MFDA 4I76A 2Y9ZA 1ITYA 3QQAA 4A3GJ 1UG2A 1T56A 4MFEA 5DTDA 2JJ7A 4HNVA 2AO9A 4DYRA 5J1RA 3OSFA 1GVDA 1K61A 1JKRC 2DMPA 3HBLA 2O9LA 5EDNA 4FE4A 3BG5A 3W6VA
chains in the Genus database with same CATH superfamily
3TQNA 3KYLA 3Q3SA 5M5WJ 2MH2A 1JUSA 3N4MA 2RDPA 1YW7A 3GEZA 4N4NB 1MW7A 5CVVA 3BR6A 3NEUA 4BJ6C 3ERED 5ICGA 1ZG3A 4A69C 2Y48A 2ZXWH 3AL0C 1GHCA 3KP3A 1XTAA 4RAYA 2IPQX 3I4PA 1IV6A 3H5NA 2K3FA 4ASNA 1QQIA 3DLAA 1FOXA 3QOEA 4E7HA 2LKPA 3FKIJ 3HDDA 1VQMI 3M7GA 3CJQB 3S32A 2I5UA 4HNTA 3EYIA 1MJBA 3OYHA 1JUMA 3E6DA 3MQ0A 4C3HJ 2HQRA 2L7ZA 1N78A 4JK1X 2ELJA 4S05A 2M34A 1LE8B 3AG2H 4BEHA 5TRDA 1HA8A 1R36A 1SD7A 4EJTA 2DMTA 3OY9A 5J1UA 2O0YA 3ZQLA 1BJAA 2O5RA 4S04A 3DEUA 4Y4RA 3ZMVA 2V1XA 3VYTB 1K4SA 1CQTA 2QEXI 1SANA 1K78B 1NK3P 5LBQA 3O3KA 4NB5A 2KKOA 2KMUA 2R92J 3ZMSA 1IN6A 1LKXA 2DLLA 2ZKZA 1SVMA 2JVGA 2EINH 3LA3A 4RB1A 1O3QA 3LSHA 2DFFA 4XOTA 2K9NA 4KMFA 2FNPA 2H27A 4YFKF 3B73A 4KNYA 1J75A 3J7AY 4L9TA 3GFJA 4B8XA 4PUSA 4MEYF 5DUKA 3VPRA 2FXAA 3BTIA 4F93B 3JSOA 1Y0UA 1L3LA 1DU0A 2H1KA 3GZ6A 1EH6A 3H35A 4YRVA 4DBQA 2NNYA 1BC8C 2H09A 3AG3H 2AS5F 1D1BA 1QRYA 2KP6A 2Y31A 4ITVA 3TDUC 3WE2A 2PJRB 1D5YA 3DBHB 5IOZA 3G1OA 2XROA 2BOLA 5CQGA 1GUUA 3K4JA 2OQGA 2HPMA 1YX5A 4ENNA 2QUFA 1YE9A 1B9MA 4LK0F 3SFIA 4GO1A 4QIWN 3OYMA 4L5EA 1FBUA 1YRNA 5K7ZA 2FJ1A 1A04A 2VXDA 4XBFA 2JTVA 4UB8C 3ZQFA 4I7HA 4Z2YA 1Y39A 1OR7C 2DT5A 3ZGKA 2DAOA 2DMQA 3KEOA 1MBJA 1KZHA 2VN2A 3GW2A 2NOGA 1I1SA 2GM4A 1IG7A 2F4IA 2O7OA 3B02A 5FD6A 3OYLA 4ESFA 2Y69H 4R79A 4E7KA 3BP8A 2QSGX 4LB5A 3SDBA 2ZNZA 1E3PA 4UV9A 3HOVJ 1KU7A 5JFRA 2CMPA 3QYEA 4HSTA 5KAFC 1YO5C 1AA7A 3Q5FA 1RUNA 4GDFA 3I58A 4Y3OA 3HOYJ 1ON1A 4A0XA 2ZSIB 1WWXA 3IKVA 3OS1A 2ESNA 2XF7A 3OWTA 3MD2A 5EG0A 3PNYA 2QKMB 4WXCA 4HLYA 1FWZA 3MZYA 3RPUA 4LD5A 1AKHB 5LHGA 3FMRA 3IH3A 4LOCA 4OIOF 3K69A 2XAGA 4PFOA 1SD5A 4NQWB 3V7CA 1BW5A 1MBFA 1SAXA 4IHWA 2DDBA 1R5ID 3SZPA 1JKQC 1Z77A 3HXLA 4BNCA 2CYYA 3HRSA 2PMZN 2CGPA 2F5VA 1KYZA 4A3EJ 2DODA 3H3ZA 3PNVA 4DNCA 5BPIA 1F36A 3R6SA 4S0HB 1U5TA 1V3FA 1GV5A 5EEAA 2LY2A 1UB9A 4BHCA 3HTSB 3V8JA 3TW6A 1UHSA 2MG4A 3O6BB 1E3OC 2E71A 1ZLKA 2MSYA 4RM3A 2BW3B 2DQRA 4M73A 5HVQC 2K02A 4ZZLA 3CCJI 1VQ5I 2YSRA 4HLXA 4H4KC 3IWZA 4HQEA 4MTDA 2MD0A 4XKVA 3GZNB 1DGRM 2J5OA 2P5LC 2G9WA 3OMYA 3SDGA 1X1DA 4KISA 5E1WA 4RMNA 1N77A 3HOWJ 3F3XA 3A1YA 1U9OA 3S8PA 3LAJA 3S14J 3KE2A 3NAUA 2OQRA 2W4SA 2X6WA 4BL0B 1P4XA 1YW9A 1PJRA 2X6OA 2BHZA 3F8MA 1SFUA 3J80Z 2Q1ZB 4GGGA 3SEQA 2DTZA 4DQ2A 2P5KA 2NVXJ 3LFUA 1ETXA 3MCZA 4UXNA 3DV8A 4HDUA 1MBKA 1CF7B 4GFBA 4ETSA 2P5VA 1I6XA 1P2FA 2BHYA 3OYAA 3FZVA 3FM5A 4LJZF 2YUSA 1LB2A 1H9TA 2DFHA 2EZHA 2MC4A 4IVNA 1SEUA 1JTXA 2IP2A 1FIAA 1RZ4A 2DA2A 1G2HA 2LD5A 2ZXJA 3I64A 4DIQA 2CUFA 2VQLA 1KU9A 5D6EA 2XKPA 3QPTA 2M45A 2EIJH 3D0SA 2W1OA 3DKWA 4QWQA 1TW2A 1BA5A 1DP7P 1U6GA 4W1UA 2UWMA 1Z1DA 1SFOJ 3M3YJ 1Y1WJ 3Q0VA 5C4XJ 2D1HA 3GTMJ 2F48A 5L3GA 1LDDA 1SVLA 2IGMA 4II3A 3CQZJ 3DWLE 3I71A 2ZMEB 2L7MP 1D1CA 4KN7X 3RKQA 3LSRA 1X1AA 2ECCA 1XMXA 1IXCA 5IT9Z 3BLYA 4HX4A 4M9ZA 2E36A 2L9SA 4PCQA 2RREA 5GADJ 3NRVA 4HZFA 1B72A 1IF1A 4MQ9F 5KHDA 4RGUA 3C7JA 3T1BA 3OYNA 3GYHX 2M30A 1EJ9A 3ABTA 5JHFA 1GV2A 1OCZH 4C30A 4AM3A 1IV8A 5BNGA 3HPGA 2DA1A 2L0KA 1QBJA 1K83J 1QHGA 2RNGA 4CDGA 5M3MJ 1TWGJ 3VYUB 4N9HA 4BHBA 4GYIA 1LDJA 4G7HF 3JAMZ 3SZTA 3WTTC 4M3DA 3S3MA 1NG7A 4XORA 4XLPF 3F6OA 1S8NA 3CCLI 2XDVA 3OSGA 3QOPA 2DA7A 5K1YA 5GPCA 3HYIA 1S7OA 3GF2A 3QU3A 3E6CC 5E17F 2LYCA 2D5VA 5D4SA 2JT1A 1WKMA 3DEWA 3CJRB 1HSJA 2E1MB 3OOPA 3QRFF 1JT6A 5D6FA 3FMQA 5FLXZ 3RYPA 3ZQ7A 2I8DA 5FFZA 1Z3YA 3QYFA 1R9TJ 1V5GA 2WC2A 3UNGC 4CHUA 3K10A 3W3CA 2V26A 2EFOA 4HNUA 4XLHA 1E0EA 2ME6A 5JVTA 1SFXA 4OIQF 2CRGA 3HOZJ 3F6VA 4KIBA 1ENHA 5L3FA 2BYVE 1NG6A 4AU7A 4HV6A 4KDPA 5DEQA 2CQ7A 2BGCA 4UVCA 5DYMA 1I6HJ 2Z5UA 4P55A 3RTRA 1MGTA 2WY8Q 5J8CA 2IBDA 4OMYA 2KRHA 1RPWA 4ZDLA 1R1VA 3J7AO 4NNJA 3TOBA 1PP8F 1I39A 4HRIA 3ZPLA 6PAXA 3OYIA 2QSFX 3CUQA 4U7BA 1XS9A 3WU1B 2GBYA 2I10A 4UUSA 3HZJA 1QVUA 4XLEA 3DBRB 1ZR2A 1MDMB 2YU3A 4BDZA 4BUPA 2CS3A 3J81Z 2DI3A 3KZZA 4P5OA 2HDCA 2W84A 1SC7A 1P7JA 2E7WA 1BOAA 1D0YA 2HWVA 4ZYDA 2LK2A 3OL3A 5H2FC 4PDKA 3HIFA 4RLFA 4J19A 5JLWA 1D0ZA 2V79A 4D7MA 2L01A 4BQQA 1K6OA 1K7AA 2A61A 2ZJRF 1KYWA 2KPMA 3ELKA 4BE0A 2LRDA 5E3OA 4ZYGA 2LG4A 2V7FA 2DQLA 2VBWA 1J7KA 3GBGA 2VQCA 1VQ4I 4CYCA 4LLGF 2E19A 1GT0C 3JCUC 4ZDOA 2JA2A 1FIPA 4G6TB 1YRNB 4F7ZA 2XF6A 4RGRA 3BJOA 3BCAA 2GIVA 4FTHA 4AWXB 4GCVA 1MH3A 1VQLI 3ISPA 2NNNA 2MLGA 4MNUA 1YS6A 1ZQ3P 5HLGA 3K1MA 2X4HA 5CVRA 3TP3A 1XN7A 2HOEA 3QYBA 1YJNI 2JA5J 4E7ZA 2A68F 2VONA 1WPKA 3S1RJ 1RIOH 4CCNA 3S2WA 3FXQA 1F4KA 1JT0A 2CJJA 2JZYA 2NVYJ 3PM1A 3CC2I 2R93J 3PIOF 2AXLA 2EV5A 1F9NA 2NS7A 4PJLA 1GXPA 3FISA 1SVOA 2STTA 2XPWA 3BG7A 3X2QH 4CCOA 1WJDA 5LRSA 2H8RA 5EG0B 4CICA 1GLNA 5FFXA 2X1DA 2DU9A 3CP2A 1XPXA 2ZCWA 4HQMA 2R7UA 1C0WA 2MW8A 3GTPJ 2VI6A 4PGHA 4G9YA 4LGWA 1ERDA 2AQEA 2PFBA 2E1CA 1Z6RA 3T8TA 2XAQA 4M74A 1HQCA 4QPQA 2RNJA 2K4JA 5E8IA 3A0HC 3RKXA 1MJ9A 1T56A 4ZDPA 4HNVA 4DYRA 3OSFA 1GVDA 2O9LA 2GXAA 2P6TA 1G6NA 3V8KA 4RM2A 3W6VA 3JRIA 3TL4X 5IP7J 4Y52J 4L5JA 4BBSJ 1MSEC 1U5TB 2HS5A 2M4KA 1IZ1A 1YIJI 2OZUA 3GO5A 2PEXA 3A2KA 2EIKH 2DMUA 3FXUA 4Y15A 4C9YA 2PMUA 5D5UB 2E2JJ 1OISA 1R71A 2UV1A 1POGA 4DZPA 4CSWA 2GOMA 3DQVC 3H9QA 5ILSA 4GRIA 3K4BA 1ZRCA 4FHTA 3WTVC 2VXZA 1JHHA 3ULQB 4OIPF 2HXIA 2FUG2 1UAAA 3K9TA 4RDUA 1FP1D 1WQ2A 3FKJA 1T2KA 3O8GA 1JI8A 2WTEA 4ENKA 5KVRA 2OTJI 3LSTA 3G3ZA 4FCYA 1VQ7I 2DYRH 2MA3A 3RDIA 2P8TA 4XIDA 5LEJA 1TQIA 2BV6A 4CCMA 3WTSC 2FMYA 4XRFA 4JX6A 1ZARA 5B1AH 4IQ4A 1T0FC 1Y6IA 5F6FA 4C2UA 2XKOA 4EM1A 1SFKA 2L02A 1R22A 1RKTA 2R7XA 3K6GA 5C4JJ 1OPCA 5DCMA 2A05A 3TP0A 1OFCX 2ME0A 3F8BA 1BM9A 1QHHD 3G2BA 3I5UA 3HL2A 1HBXG 4HW0A 1RR7A 1QZZA 2COMA 1TNSA 1B4AA 2CW7A 1B8IB 2CUJA 2OAZA 1N75A 4OU0A 4JQFA 4E6KG 2CFXA 4GXOA 1JGGA 1Q1HA 4P9FA 2FNAA 1BL0A 3FIWA 2YR2A 2O03A 1EA3A 4BBRJ 4IO9F 2WBMA 3JR9A 1IN8A 2DA4A 4PSXA 4B3XA 4EEFG 4OINF 3G6EI 4JP0A 2LY9A 3CMMA 4KFCA 5L3EA 3PFYA 3H3UA 3L2WA 3F21A 2IGKA 1Y56A 2PJPA 4D0PA 4DBRA 2O8KA 2MFZA 2D2WA 4L9NA 1YTYA 1H89C 3RSNA 1B59A 5KK1A 3C3WA 1B72B 2OZ6A 5J4VA 2VT3A 4V2GA 1Y8QB 2HZDA 4CGZA 1ZKGA 2OF7A 1FOKA 2G7UA 2KZVA 2TDXA 2DK5A 1QZEA 4BH9A 4G94A 3RI4A 1FBSA 3GTLJ 3V7SA 2BE5F 3BJ6A 5JR3A 3HB9A 2BY0A 3I0TA 3I56I 5GAGJ 1QPMA 3CDHA 2W25A 2CV0A 4UVBA 2A3SA 2V9VA 3BC8A 2W24A 2KDOA 1U0JA 4HX8A 2FU4A 5HS7A 4PJJA 1UHMA 5BQTA 1JKPC 4OWRB 2X9DA 2WY7Q 3BJAA 3OIOA 4BY1J 4HF2A 4JX4A 4I6ZA 4XSZF 2IS1A 3TMOA 3U1DA 1OCTC 3HHHA 4BAYA 2MC3A 3RPQA 3DLLF 1WSUA 1L0OC 3ZR8X 3W2VA 5HS8A 3WHBA 2L7KA 3F8FA 5AONA 5EZGA 5FKLA 1RKWA 4K2EA 4E7IA 4HPQA 4XN0A 2HTSA 1T6SA 3HOSA 1TZLA 4CO8A 2M7BA 2IS2A 2WAQN 3HUGB 2UUZA 1ZGAA 3AG4H 4A5MA 5D8KB 1KU2A 4DW6A 2PG4A 2XGEA 4UVAA 2A5YB 1MMSA 4HV5A 1SD4A 3FM3A 2CU7A 1U8RA 4D5CA 3GMEA 3P9IA 2ID3A 5JLXA 4OMZA 2P0WA 3FMSA 1J09A 3HKZN 1U8BA 2XAJA 2VJ5A 3IH4A 3E0JB 1V4RA 1QPIA 1QGPA 2BXZA 4HBLA 1IRZA 2WADA 3F0CA 4AYBA 4A3CJ 5CJ9A 2R7SA 4EMSA 2HZTA 3TDZC 4U0VA 2NYXA 4HX7A 2HQ5A 3VDXA 1A35A 2M0CA 3LSMA 4XRMA 3HTUA 5HNHA 1ACIA 5J47A 2HNHA 3C18A 5EJCA 4FQGA 2R5ZA 5IYCJ 3A01A 1VQ6I 2XUBA 3ML6A 3W6JB 2QLZA 2FD5A 4KT6A 1NTCA 3I53A 4CYCB 3L2VA 3KYCB 1MNEA 2RQPA 1DGWY 3BG9A 1B9NA 2XC7A 3QP6A 1MMGA 2FEZA 2IAIA 2VQGA 1KQ8A 2R7ZJ 3W6KB 3KP4A 2CFOA 3SJMA 3EPZA 3LSKA 3IUOA 3M4OJ 2GXGA 2Y30A 4Y7NJ 4A93J 1OYWA 4WF2A 2XAHA 2V1UA 5K5OA 5LD2C 2EBIA 3VYSB 3CCQI 1YS7A 3OYCA 2LBFA 5GTHC 5E3LA 5E20A 3WTWC 2PMZA 1P9QC 2IJLA 5ICCA 2KFDA 2MD5A 2L3DA 1R4MB 3QODA 1Z05A 3ECHA 4MO7A 3ZMZA 2CV1A 3MFKA 3LSGA 4EVIA 2LKSA 5HLHA 1T8IA 3MMYB 4YEJA 5E79C 5KCMA 2XGDA 3HSRA 4PJNA 1VQOI 3KP7A 4N9IA 4XR6A 3ZOBA 3L2UA 4ESJA 3RYRA 3BZCA 2ISYA 2L9NA 2RN7A 1TT0A 4V2FA 1G3TA 2NXNB 2HOTA 2QBYB 1BOBA 2Y0SN 3QAHA 5DM6F 3LAPA 3COAC 1SAUA 2GXBA 3FXJA 1MNDA 4I99C 4KA4A 2EILH 2YU9J 2Q8KA 2K9QA 4MLOA 3WGGA 1WJAA 3RZOJ 4OAYA 1IGNA 2COBA 2E1NA 3BG3A 3E5XA 4MTEA 3RPUD 4B3AA 2HDDA 4A3IJ 1IN7A 3BR0A 5CQEA 4AYBN 2DPDA 4WWCA 2VODA 4AD9A 5K7HA 3OS2A 3I55I 1R6RA 1RNLA 3J7YJ 1HDDC 1YITI 1VF9A 2EA2A 4Y17A 3PO3J 2A5WA 1ETKA 3ZQCA 5LEKA 4L9JA 5K5RA 3LQQA 1UCRA 3L09A 1X2MA 1JKOC 2EV0A 2VKHA 2X85A 3F8NA 4ZZDA 4QLCU 2CQNA 1KQ0A 3J80K 2GLOA 1KGSA 5D8LB 1TP4A 4E4HA 3FXLA 3HPHA 3S15J 2IGOA 4PZJA 2IS6A 1I3AA 4AUXA 5GAHJ 1ZRDA 2BY2A 3DPUA 1YJWI 1MJAA 2F5DA 5FKMA 5FROA 4I0BA 3DU6A 4FX0A 2X6YA 5HNFA 1PYVA 1W1WE 2JPBA 3MEXA 2PLYA 4LG0B 2NS0A 2WAEA 3G73A 1MKMA 4XK4A 4UV8A 5L3BA 1FY7A 2BZTA 1ZR4A 2VUMJ 4F52A 1FX7A 1JGSA 4IZZA 4L18B 2M8GX 2BY3A 4IRGA 2VT2A 1BI0A 3P7NA 5DCMB 4I0AA 2H6CA 4ZYEA 3K70D 5D4RA 1MMNA 1U2WA 5AIQA 3PQJA 4XONA 1ETQA 1TNTA 5D5XB 3H92A 5ED4A 2QQ8A 3CMEI 2VC0A 3EUKL 2RV8A 4E7JA 4XN3A 1P92A 2KRCA 5KNLA 4BE1A 4YFNF 3ESWB 2V1NA 5BOXA 3RQIA 3M1CA 5E3NA 1LFBA 2A6HF 3FBNB 3IHUA 1TWFJ 5LFAA 2G7HA 2Y75A 5BPDA 2F6CA 4RS8A 1AHDP 2LTPA 2KDZA 4BHPA 4EQQA 4WXHA 1D5VA 4A6EA 5LHIA 3BDDA 2KHMA 2QWWA 5F08A 5IOYA 1ZLJA 1XDSA 2VKDA 5F0HA 2KLOA 1O3TA 4L5IA 3L9FA 4D5FA 2JA8J 2GA2A 1HCRA 3JAMK 2B7EA 1W7PA 1YYVA 1RUOA 4HA8A 3H5AA 2FSWA 3RQ4A 1OQYA 1HKTA 5DDGA 3I4NJ 4DZJA 4B48A 4E7SA 4BGDA 5IYDJ 3HSEA 1IAWA 2EIMH 1ETWA 2KJBA 3QPSA 4ANJA 2JMWA 2LMDA 2G0EA 1BC7C 3OR1C 5CVUA 3NWTA 3BY6A 2VJIA 5K5QA 1LQ1A 2ETHA 2HXOA 2E35A 2IGNA 2LP0A 1E3HA 4ZC3A 3H9JA 2FX0A 1OKRA 3DTKA 1UZCA 2Y2ZA 3JSPA 2FF4A 1OYYA 1UG0A 3CLOA 2LC2A 2P7VB 1UFMA 2OJED 3FK7A 3IRQA 1BIBA 3ABKH 2DW4A 4BXFA 2M4GA 3HOTA 4A0YA 2Z33A 3CO7C 2D45A 4M72A 3JREA 5IT3A 3MKLA 4M9SA 4CUGA 2KIUA 1UHWA 4CA0A 1VQKI 3DP7A 1TTYA 5F1JA 4YIIA 1R1TA 2EFQA 4U0YA 2LNBA 2QCOA 2DDAA 4KT5C 3JTGA 2W48A 1S7AA 3FK6A 3K1NA 3D5LA 1IRFA 2DA3A 2ZFUA 3FWEA 4MFDA 3KP6A 4I76A 3U1KA 1ITYA 3S3OA 3QQAA 1BI2A 3HHGA 3OYDA 1UG2A 3SZGA 3UR3C 3M8EA 2RKHA 3GX4X 1YJ9I 3CC7I 3V7RA 2AO9A 3OL4A 3HBLA 2QSHX 4A2UA 3JRCA 5J1YA 3ZQIA 1BI1A 1YOVB 4BQOA 4BEHB 1PUFA 4O3MA 1FEXA 1I5ZA 4XNFA 2HVSA 2JUGA 4LLLA 4G7ZF 2HGCA 3P9KA 4I01A 2R5ZB 1Z3XA 3Q0WA 5CPRB 3N05A 3D1NI 4MEXF 1Z67A 2VC1A 4UUTA 3V42A 1HLVA 5HS9A 3VWBA 1PP7U 3OIPA 1G3WA 3RJPA 4RB3C 5HLTA 4IRIA 2V1DA 4JX5A 3IAM2 2P6SA 1FBQA 4PJ0C 5E1XA 2BEOA 3BPVA 3F72A 1U3EM 3KIOA 1LEAA 3BROA 4M3EA 3SFZA 2OC6A 2LR8A 2VIXA 3DEEA 3WHCA 4NBQA 2L9VA 3VODA 1K4TA 3HC7A 3IL2A 2ZMEC 2F4OB 2LVSA 1A5JA 3DU5A 1XGMA 1X3ZB 2ECBA 1GXQA 1LVAA 2EQRA 2ZXIA 3RCOA 1TL8A 1ETYA 5FO5A 3I4MJ 4UB6C 1W36D 2R7OA 2OV7A 4NDLA 4RB0A 2MLKA 3Q9VA 1BR1A 3JRGA 4YIRX 2HTJA 1RI7A 3DXJF 1UJ8A 1DPRA 3AFHA 3KLNA 4M3BA 4IXAA 5DUIA 1H88C 2BBYA 2XV4S 2YX7A 4BY7J 4NC6A 2R7DA 2PX9A 1M1EB 3LSIA 3A0BC 4R8HA 3ZQQA 3A03A 2XB5A 3ZQGA 1OR7A 4LB6B 4B09A 2VB6A 4A3MJ 3OYEA 1XSDA 1RC9A 1IUYA 4XRSG 2DOAA 2ADUA 2E1MC 1J0RA 3WTZA 1W5TA 2ESHA 2GWRA 4G6DA 2ELKA 4B44A 5L3CA 2WV0A 3NARA 4BJ5C 4M3GA 2P4WA 1HC8A 1H0MA 3VSLA 4XMYA 1K78A 1V54H 4U87A 3L7WA 4A3LJ 2TRTA 1MZBA 3CCVI 2NVTJ 5E1ZB 3S1QJ 1BN5A 5F0FA 4WCGA 2JA6J 5B5EC 1SMTA 1TWCJ 4XSXF 4XM3A 3IP4B 4Q47A 3EDPA 3K7AJ 3GTOJ 3FXOA 2HPIA 2XF5A 1J5YA 1D0XA 2EFWA 2X1CA 1F1ZA 1BBYA 1IDYA 4BQAA 2XSJC 4A3JJ 2FOKA 4KIGA 2GQQA 1XSVA 4A6DA 4C2TA 2ZXHA 1YG2A 4BQNA 1V5EA 2R7TA 3KYDB 2PBIA 1R7JA 2HOAA 2MGQA 3PSIA 4ZYHA 4CCLA 1MNMC 2EK5A 3JRAA 1HOMA 3D5RC 5J6XA 1DP3A 3FBIB 5FKKA 3A4CA 1VQNI 2VOPA 3R61A 1S72I 3S2HJ 1S3JA 2DN0A 3H1CA 4IL6C 1VFCA 5DCFA 1RETA 3F9KA 4AIHA 2K5CA 4KUMA 4DYCA 2VKEA 3LFKA 3T8RA 3R0JA 3DFGA 4CYDA 2PN6A 3LL7A 5M3FJ 3GUDA 4OIRF 5ERIA 2ZNYA 1S29A 5IY5H 2OCEA 1WJ5A 1IJWC 2FQ4A 1WH5A 3ZMUA 4M71A 4UUVA 4QPOA 2O6GE 4XKCA 4EGYA 2LLKA 2EZIA 1ZGWA 2CO5A 3VB2A 4WX9A 1YQAA 2XRLA 2VKVA 1FNNA 1OJLA 4M6XA 3JRFA 1QO0D 4HEA2 4M9XA 2GIZA 2BXYA 2IA1A 4MIMA 4Q5SF 1W7PB 3FDYA 2E7XA 2V6EA 3TBIA 3L1PA 2W00A 3CD6I 4XRSA 4OAZA 4Q48A 5A2QK 5F27A 3FXRA 3RKYA 1AKHA 1H8AC 1XCBA 3PUBA 5LHHA 1USTA 1WJEA 3FXKA 4I02A 5JVGF 2WAQA 3ASNH 1T38A 2K85A 4LG3A 1RESA 1E2XA 1X1BA 3Q9SA 1EH7A 4EATA 1TT5B 5CVIA 3I59A 3QPHA 1TLHB 1Y8RB 2ICWG 5HLIA 1KQ9A 2VPRA 4RGXA 2M87A 3HKZA 4BXUA 1Z9CA 9ANTA 2M9HA 4PGGA 2FBKA 5HDGA 2UXNA 3CC4I 2OA4A 2DYSH 2F5FA 1EF4A 3K0LA 3TEDA 3L2CA 3O8HA 1T08B 2HDWA 3GFMA 3BQYA 5C3EJ 3BR1A 3RKWA 5GP9A 3TOAA 1FSHA 1Z7UA 1S6LA 3GTQJ 1U5TC 2CV2A 2BW3A 2O8XA 5IYBJ 4HOBA 2ZFWA 4KN4X 5J4YA 3AL0B 3FX3A 3E1SA 2M1BA 4IHXA 4FX4A 3UKGA 3W2WA 4GYGA 4BE2A 2JUCA 5HDNA 4CXFA 3BPXA 4E7LA 3G71I 3CCSI 3S2DJ 1EH8A 3S17J 2K4BA 4EJWA 3LWFA 1VNDA 1Q1VA 3ZCOA 3F8CA 3HG9A 1ZRFA 3I9V2 4XKBA 2CUEA 3KLOA 3ONQA 1LUJB 4N0BA 4QSHA 2X1EA 4XLFA 1O4XA 3EYYA 3E3VA 3SYTA 4QTRA 3K70C 2M8EA 2HKXA 4HYEA 1ZN2A 3KEQA 1CF7A 4CCJA 3CCYA 2OU2A 3ZQHA 1QU3A 2DOEA 4A0ZA 4W97A 3CJNA 2YS9A 3VFZA 1S7EA 1WGXA 3PIPF 3K4CA 3G4SI 4ABZA 1RRJA 2IT0A 4CZCA 2L7FP 1FLIA 1YI2I 4KITB 4PJMA 4JBAA 2M0MA 2Z16A 3BR2A 1ETVA 5DD8A 2B9SA 4YFXF 4LLNA 4FE7A 3GTGJ 1JUPA 3B6AA 1T39A 3H3VK 2HYFA 5EYRA 1IUFA 2HQAA 3DF8A 2F4MB 3H36A 2LSOA 2V6CA 4WXDA 3EUHC 4U88A 2KIQA 4I98B 2IVMA 3QP5A 4ZTFA 3SEZA 1X4PA 2LDUA 3MAJA 3HRTA 3NWSA 4YELA 1FZPB 1Z0XA 3DKXA 3E6BA 2Y0SA 3CMYA 2R5YA 1O57A 4IHSA 3GLXA 4P1WA 3OYFA 2A07F 1HW1A 3IH2A 1VQ9I 4F91B 2R0QC 1W4MA 2HOSA 3CUQB 4IF4A 2VJJA 4UUSB 2E2HJ 4IPAA 4G8XA 1X2NA 3W2AA 2QF7A 1U9NA 1MSFC 2VLAA 3HGYA 1OCCH 2ZC2A 1AWCA 3NQOA 3R0AA 3GZ5A 4M6VA 2WWYA 2BY1A 4RB2C 3ZN0A 2NOJB 3EETA 2LY1A 3E6MA 1FJLA 1WJBA 2CWEA 4RLQA 4A3DJ 5F1RA 1FOYA 3VYRB 3CDIA 2AQFA 1ODDA 5EEHA 4IEJA 1AU7A 2X51A 2XASA 2HKOA 3ROUA 3SXYA 4EM0B 1T33A 5FKNA 4EV0A 2K27A 2M7AA 2OUMA 2XPVA 4CH7A 2EJRA 1Y0NA 2MBFA 3L2QA 3QPLA 3WTYC 3E5UA 3LOCA 1A36A 2DFIA 1XB4A 1LJ9A 2HYJA 4AIDA 2H8WA 1FSEA 4RA2A 5J3LA 3ZP5A 2DPUA 1ZAOA 2E5ZA 2QYOA 3GTJJ 5CYVA 1W0UA 4B43A 3FF5A 2H94A 2VBZA 1KA8A 3JTHA 3DPTA 2FBHA 1UMQA 3S1MJ 2JRMA 3IKTA 3LMMA 1WCMJ 2DJNA 2E1OA 5H6RA 5EF6A 3V4GA 3OIQA 2M5WA 5ILUA 2JWTA 5F04A 1ZREA 2MABA 4O5VA 1R00A 2K7LA 3C1DA 1ZG1A 2PQ8A 1K79A 4OOIA 4XLAA 1VTNC 2IW5A 2KJCA 1JJ6C 5B1BH 1XDUA 4A3KJ 2WB1A 1DU6A 1QVTA 4HSRA 1V55H 1N25A 3U9GA 2VBYA 4ZYAA 1QA6A 3DPLC 1J2XA 3MVPA 1MDMA 2KL4A 2HVRA 1O7LA 3WGHA 3CUQC 3ABUA 1XCVA 2QA4I 5LGUA 2FA5A 3VEPA 1HW5A 1MBGA 5J8FA 1MIJA 1FMWA 2V9KA 2AXTC 4NUBA 2CQQA 3LNQA 2JPCA 3ABMH 5IPAA 3WTXC 1APLC 3TO7A 5E3MA 3VOEA 1OLTA 2GA1A 2LF8A 4BU2A 4XQFA 1TC3C 4XOPA 2NS8A 1YIOA 1XGSA 4DYQA 3CDLA 3BG6A 3K4NA 1TQMA 3S3NA 2QGUA 3PFIA 3BR5A 3CP8A 1IDZA 2HI3A 5TJJA 5D5WB 3WGIA 3M8JA 4FASD 2JK3A 3MZ8A 1ZHFA 1D8JA 2Z3YA 3GLLA 1USSA 3E97A 2Q2EA 3WG7H 1V5FA 3D5SC 3J7ZI 2DFEA 2RAEA 1UELB 3ZMTA 3MWMA 5DV5A 5C44J 2FE3A 3KP5A 2E60A 4AVZA 1KONA 1W36C 5FB2A 1TQPA 4A3GJ 3M1EA 1YFHA 4MFEA 5DTDA 5J1RA 1XX5A 2V9PA 1I27A 3GFIA 1K61A 1JKRC 4IHYA 2DMPA 5D5VB 4EJOA 3ZMDA 5EDNA 4FE4A 4MGRA 3BG5A 1T0FA 3M8FA 5EGOA 4U0WA 4A5NA 5B66C 3F22A 4B47A 1Y1VJ 2V4JC 3WE3A 3N97A 2JSCA 3K4MA 1XMKA 2FQ3A 4B1RA 5M5YJ 3EQLF 2AHQA 2X48A 1LPQA 2ISZA 4LIUA 3E7LA 5ILVA 4HG2A 3PO2J 2O3FA 4XLCA 2KZGA 3MKYB 4B4CA 1HSTA 1HKSA 4AVPA 4EJVA 3PSFA 3H5RA 1Z91A 3K4LA 5HODA 1JJ8C 2EFNA 1O7FA 2WB1N 3TKYA 3CF2A 1R5GA 2R7FA 3K2ZA 1JE8A 1W7PD 2XGXA 3I59B 3IRRA 1G8XA 1MMAA 3O2PE 2FOWA 1R4NB 2XSDC 5IT9K 3C2GA 4KMUX 3CCMI 4H0EA 2QKLB 2Q0OA 2ZSHB 1BR2A 1JTYA 2CG4A 5F0CA 1G3SA 4C3JJ 4D7NA 2EZKA 3GXOA 1TWAJ 5HOOA 1P4AA 1G3YA 4LITA 2STWA 2QVOA 2OTLI 2UZKA 4F3QA 2DCEA 5K7FA 2XGCA 1I3QJ 1U78A 1ORKA 2BVLA 3KCCA 3GWZA 3GTKJ 2F5CA 2W7NA 3GFLA 4BYYA 1DPUA 2X6XA 1CGPA 4RBOA 2CSOA 1VI0A 2VOOA 1F43A 5FGMA 1HW2A 2CUZA 1P6RA 5FLXK 4X1EA 3LA2A 4IJAA 3G1LA 2B0LA 5IP6A 3BZ6A 1NK2P 1WZ2A 3BOQA 1IW7F 1IC8A 2JN6A 2EA4A 5JI6A 1T98A 5E8GA 1YW8A 2R3SA 3BTJA 2JSPA 1OYIA 1B8IA 4L0YB 1FYLA 3PQKA 4ENJA 2ZBKA 1WHUA 3EUHA 3HRUA 1X4OA 4AIJA 3CO6C 2GAUA 4RGSA 1S5LC 3BT9A 1ON2A 5FLVA 4RAZA 3KPHA 4M3FA 2DBBA 1A6IA 2GZWA 2HYGD 2R7VA 3DTEA 1BW6A 2OCCH 2ID6A 2K9MA 5GAEJ 3OYBA 1JXSA 2R5YB 3J81K 2RQQA 2PMHA 2J5PA 2LREA 3BR3A 3C2BA 3I3LA 1ZGJA 5DS9A 4F55A 4KYWA 3C2HA 3DBLB 2WV1A 3OS0A 5GPAA 4E70A 3OV8A 3OYJA 3T0YA 2ACJA 1F5TA 1IRGA 5LRRA 2ZJPF 4D9JA 1QZYA 3CZ6A 2R7WA 1MH4A 1BJZA 2X0LA 2ZJ2A 2XRNA 3B6CA 2CW8A 3P5JA 5LGTA 2C6YA 1E17A 3T5XA 5FD5A 3TO9A 1SMYF 5DD4A 2IA0A 3OYKA 1AOYA 4XKWA 2WA0A 1LFPA 2EWNA 2VE9A 2YPRA 1WRJA 1ONVA 1X3UA 3BTLA 1XMAA 1I50J 4Z6YA 5M5XJ 4U7DA 3IC7A 3BQZA 1ZH5A 2A6EF 1LVKA 3A01B 2EPFA 3E5QA 4ZH4F 3LA7A 4XICA 1D3YA 2K86A 2Z99A 4PK4A 4FETA 2F5EA 3SHFA 1BR4A 1TW3A 1ZELA 3L00A 3IV5A 3LSPA 5CVJA 4IRHA 1FC3A 2N8GA 2NVQJ 1Z7LA 4UHTA 4BJTA 2K40A 1HDPA 1R1UA 3HGGA 4LIVA 3CCEI 1MMDA 5EEGA 5ICEA 3V8LA 3PUFA 4MQVA 2LBFB 1R5HA 1WVRA 2JRTA 1LDKB 2KQRA 1ZTRA 2Y0MA 4RAGA 2YX4A 3CESA 5KAIC 4DOZA 2QQAA 1NHAA 2QENA 2HVQA 2L9RA 2O61A 3R4KA 4AC0A 3HUGA 3CMAI 4JYKA 1EV7A 3OR2C 2HEOA 2IA2A 3QWLA 4EM2A 2LH9A 4JOMA 1J9IA 4KIFA 3H0GJ 1WH7A 3TO6A 5EZHA 3SQNA 4M6YA 1IXRC 2ZO4A 3FHNA 2B63J 1OMIA 2H6BA 1XGNA 2DA5A 1FPQA 1FT9A 4FISA 4BDYA 2LFBA 1IXSB 2NAZA 2VBXA 4LFUA 1OCPA 2DXIA 2L5QA 5B3SH 1FYKA 1WI9A 1NH3A 1H9GA 2FMLA 4KICA 4V19K 3ERMA 4PFPA 1K6YA 3DKYA 3PJRA 2VASA 5CLSA 1IN4A 3LSJA 3OOUA 4XLNF 1LE8A 2K3PA 3TW7A 4TV7A 3LQRA 4MHGA 2A6TA 3M9AA 3BCBA 4NC7A 1MD0A 4O6JA 1D1AA 1P7IA 2ELHA 2Z1DA 4AIKA 2LF7A 3GCMA 2EZLA 2ZB9A 2L4MA 2OPTA 3M07A 1VZ0A 1P4WA 4P96A 3HOXJ 5LGNA 2IXSA 2L4AA 1WFXA 4A3BJ 3Q0UA 1WI3A 4IOCF 3EUAA 2FBIA 2L54A 3ECOA 4P9UA 3G1MA 1KU3A 2VE8A 2Q2EB 2VQHA 2QQBA 1DUXC 4NC8A 3H9GA 5FLMJ 1FTTA 2DTRA 4Y13A 4LK1F 2RC4A 1G59A 2R7RA 1R58A 2R7QA 4A12A 4IHVA 4D1QA 3K1PA 4ZJZA 1IRXA 4HAMA 4FT8A 4BKXA 1A31A 1S9HA 2XHKA 4I09A 1XGOA 1XG1A 2F2EA 3KZYA 2JQ7A 1FTZA 2CW0F 2DA6A 1Z21A 3KETA 1O3SA 2EH3A 4UNOA 5EGOB 1ULYA 3BTCA 2VPLA 1PDNC 3AAFA 2M2EA 2H1LA 2PJRA 1HF0A 1X1CA 3P9CA 4DJAA 3RZDJ 2NRAC 4L0ZB 1SD6A 3MZHA 2JVHA 5DM7F 3H0DA 3AKZA 2KT0A 3QU6A 5E18F 3JRDA 5HDKA 2QM3A 3JRHA 2ZJQF 3S1NJ 2QBYA 3KZIC 5H20A 3HM5A 2XVCA 2RGVA 4KJZA 3ASOH 1G4DA 3GVAA 2JA7J 3K2AA 1IN5A 4HDVA 5J40A 1J59A 3S16J 3L2RA 2OBPA 3KX2A 2FRHA 3WU0A 2R4GA 5CKTA 5LLQA 5AIPA 1WJCA 2IS4A 4NHJA 3CF5F 4L9VA 3BZKA 3BWGA 4LMYA 4ENMA 1EKEA 4IOAF 3HJEA 1Z6TA 5BMZA 3HOUJ 3WU2C 5JHUA 3A02A 1D8KA 1W5CC 2W82A 4R1HA 1O3RA 2VJ4A 3MKZA 2PI0A 3DTIA 1GVJA 2HR3A 3FXMA 1MBEA 2KIMA 4CCKA 2XPUA 2LKXA 5FKOA 4F92B 4EJUA 1LEBA 1YLFA 2D1VA 1R49A 4G12A 2DT6A 1BIAA 2WAFA 3CCRI 4A3FJ 2MH9A 3HSFA 1W5SA 4Y33A 1ZK8A 1FMVA 5GTIC 2E2IJ 2P7CB 4BXXJ 2BVMA 1B6AA 1XC5A 1XSXA 4HF0A 1ETOA 1B1BA 3U2RA 1I1GA 3ZN1A 4UY8I 4YIFA 3IAS2 3KP2A 4NQWA 2DJIA 3REOA 3U21A 2NVUB 4LG0A 3PL8A 2HFHA 1REPC 2A69F 2DO7A 2K9SA 4ESBA 1X58A 1WJFA 1HKQA 3WTUC 3CLQA 2K9LA 1OCOH 2W85A 3IWFA 2QZ8A 4II2A 2CQKA 3MKWB 1W0TA 1DQUA 2CQXA 3ZXSA 1OCRH 3ABLH 2KRFA 4XL9A 4C3IJ 1MBHA 4WK8F 4J01A 3KEYA 2IRFG 4X6AJ 2XAFA 4HF1A 2LOOA 2QQ9A 4J00A 3OYGA 1JHFA 4YG2F 4I2OA 4EGZA 4IQJA 4N4OB 3ZRGA 2KIFA 5ICFA 2EB7A 4RAFA 2GOXB 3K4KA 2DK8A 4IHTA 1FYMA 1VQPI 3AG1H 1PVEA 1HXDA 1SFEA 2M3AA 4DGWB 1X19A 4X0GA 4ZTJA 3WG9A 1QNTA 1GDTA 1VQ8I 1DDNA 4ON0A 1LNWA 1X1PA 3FHZA 3CUOA 1STZA 2Z9OA 1IO2A 1YX3A 2HU9A 4IX7A 5TGTA 1ZYRF 3MN2A 2IEKA 1TBXA 1TWHJ 3HEFA 3JW4A 2VL8A 5FJ8J 1XD7A 3JRBA 2Y9YA 2Z2SB 1LFUP 3F23A 3TGNA 2E34A 2XAUA 4C2MJ 5TISC 4CZZA 1YHQI 2OD5A 1RR8C 2XB0X 2W57A 5FRNA 3DCFA 4PSWA 4BACA 1T95A 1PUFB 1FOWA 3KFWX 5F64A 3CCUI 4G7OF 3PNTA 5BS6A 2KISA 1X3WB 3WODF 4BS9A 2UXXA 4Q4ZF 4IKFA 3S93A 1ZG5A 3VSKA 4G6QA 3CJTB 1BI3A 3I54A 5A2QZ 2TCTA 2P81A 5L3DA 5H6QA 5IP9J 2RVCA 3CTAA 1FP2A 1R23A 3HRMA 2DMNA 2MYSA 1PUEE 2EFPA 1A6QA 2E5NA 2Y9ZA 3RIRA 2CH0A 2XIGA 2ZMEA 2JJ7A 2DOFA 2L2OA 2EV6A 2HQNA 2DT7B 5FRMA 3R60A
chains in the Genus database with same CATH topology
3JRCA 3JRIA 3Q3SA 5IP7J 5EGOA 5M5WJ 5J1YA 4Y52J 4BBSJ 3ZQIA 1MSEC 1JUSA 1Y1VJ 1PUFA 4B1RA 5M5YJ 1FEXA 2AHQA 3BR6A 2X48A 2DMUA 3E7LA 4A69C 2E2JJ 3PO2J 2R5ZB 1POGA 4DZPA 3Q0WA 4B4CA 1IV6A 3D1NI 4UUTA 1HLVA 5HODA 1JJ8C 3FKIJ 3HDDA 2HXIA 2WB1N 4JX5A 4RDUA 1JUMA 4C3HJ 4M3EA 3O8GA 2L7ZA 2LR8A 3WHCA 2XSDC 4FCYA 4XIDA 1JTYA 2LVSA 4JX6A 2M34A 1LE8B 1A5JA 5F0CA 2ECBA 2EQRA 4C3JJ 4D7NA 2EZKA 1TWAJ 1ETYA 3I4MJ 2DMTA 3ZQLA 5J1UA 1RKTA 4NDLA 5C4JJ 3TP0A 1CQTA 1OFCX 1SANA 2ME0A 5K7FA 3JRGA 1NK3P 2XGCA 2R92J 1I3QJ 1RR7A 1U78A 4M3BA 1B8IB 1ORKA 1H88C 3GTKJ 4BY7J 1JGGA 4RBOA 2K9NA 4IHYA 1BL0A 3FIWA 1VI0A 3A03A 4BBRJ 1F43A 2XB5A 3ZQGA 3JR9A 2DA4A 4X1EA 4EEFG 4A3MJ 3G1LA 4JP0A 4XRSG 3VPRA 2LY9A 3BTIA 1DU0A 2H1KA 2ELKA 5IP6A 1NK2P 3NARA 2O8KA 4M3GA 1QRYA 1H89C 2Y31A 1IC8A 2JN6A 1B72B 3BTJA 4A3LJ 2TRTA 1B8IA 1D5YA 5IOZA 3G1OA 2NVTJ 4V2GA 3S1QJ 1GUUA 1ZKGA 5F0FA 2OF7A 2JA6J 1TWCJ 3GTLJ 3BT9A 3K7AJ 3SFIA 4QIWN 3GTOJ 3HB9A 4L5EA 1YRNA 5FLVA 5K7ZA 4M3FA 2FJ1A 1A6IA 1BW6A 2ID6A 3ZQFA 2R5YB 1IDYA 4A3JJ 2DMQA 3BR3A 1MBJA 3C2BA 2NOGA 5DS9A 2GM4A 1IG7A 1JKPC 2O7OA 2WV1A 2X9DA 5GPAA 4BY1J 3OIOA 4JX4A 4I6ZA 2HOAA 2MGQA 1OCTC 1MH4A 1BJZA 3B6CA 1MNMC 3JRAA 3HOVJ 1HOMA 3WHBA 5EZGA 5FKLA 1RKWA 5FKKA 3HOYJ 3S2HJ 2DN0A 5EG0A 1VFCA 1RETA 2WAQN 3BTLA 1I50J 5M5XJ 4DW6A 4DYCA 3BQZA 2XGEA 1AKHB 3A01B 2VKEA 3IH3A 2CU7A 4LOCA 4D5CA 4XICA 5JLXA 2ID3A 5M3FJ 3HKZN 1U8BA 3IH4A 1BW5A 1MBFA 3IV5A 4IHWA 3LSPA 2N8GA 1IJWC 2FQ4A 1WH5A 1QPIA 1JKQC 1Z77A 2NVQJ 1IRZA 2K40A 1HDPA 2PMZN 3F0CA 2LLKA 3HGGA 4A3CJ 4A3EJ 2EZIA 1ZGWA 1F36A 2XRLA 4S0HB 2VKVA 1OJLA 2HQ5A 3JRFA 1GV5A 1ZTRA 2M0CA 4XRMA 5EEAA 2L9RA 4MIMA 3TW6A 1UHSA 2MG4A 1E3OC 4AC0A 2MSYA 4JYKA 3L1PA 2R5ZA 4XRSA 1AKHA 5IYCJ 5F27A 3A01A 1H8AC 3H0GJ 1WH7A 2FD5A 1NTCA 4CYCB 5EZHA 1RESA 3BG9A 2B63J 2IAIA 2R7ZJ 2DA5A 4FISA 3SDGA 2LFBA 3SJMA 3M4OJ 1OCPA 2Y30A 4Y7NJ 4A93J 2VPRA 3HOWJ 9ANTA 1U9OA 2M9HA 3S14J 2EBIA 3NAUA 2X6OA 1EF4A 3TEDA 3LSJA 3OOUA 3O8HA 5E3LA 1LE8A 3TW7A 2DTZA 3BQYA 5C3EJ 2NVXJ 1ETXA 3BR1A 5GP9A 1MBKA 4GFBA 3GTQJ 1P7IA 5IYBJ 2YUSA 4MO7A 2EZLA 2ZB9A 2EZHA 2OPTA 1JTXA 4IHXA 1FIAA 3HOXJ 3UKGA 2DA2A 3LSGA 1G2HA 4A3BJ 3Q0UA 1WI3A 2LD5A 3G1MA 2CUFA 2XGDA 3S2DJ 3ZOBA 5FLMJ 3S17J 1FTTA 1VNDA 1Q1VA 2HOTA 4V2FA 4IHVA 2Y0SN 1BA5A 2CUEA 4W1UA 1SFOJ 3M3YJ 4BKXA 1Y1WJ 3Q0VA 5C4XJ 3GTMJ 4QSHA 1O4XA 4QTRA 2YU9J 3CQZJ 2L7MP 2K9QA 4MLOA 3LSRA 3RKQA 2ECCA 3RZOJ 1FTZA 1XG1A 1IGNA 2COBA 2DA6A 3BG3A 3CCYA 3ZQHA 2EH3A 4B3AA 2HDDA 4W97A 5EGOB 4A3IJ 2YS9A 3BTCA 3BR0A 1S7EA 1WGXA 4AYBN 4ABZA 1B72A 2L7FP 2M2EA 1HF0A 5K7HA 3RZDJ 3BR2A 1GV2A 1HDDC 1ETVA 3GTGJ 4FE7A 1VF9A 5BNGA 1JUPA 2KT0A 3B6AA 2DA1A 2L0KA 3PO3J 3JRDA 3JRHA 1ETKA 1K83J 3ZQCA 3H3VK 3S1NJ 5EYRA 1IUFA 5M3MJ 1TWGJ 3HM5A 1X2MA 1JKOC 4M3DA 3K2AA 2GLOA 2JA7J 1Z0XA 3OSGA 2DA7A 3CMYA 2R5YA 3S15J 5GPCA 3S16J 4AUXA 3IH2A 2D5VA 3DEWA 5FKMA 2R0QC 2HOSA 4UUSB 2E2HJ 1JT6A 1X2NA 1R9TJ 3HOUJ 2QF7A 4XK4A 1U9NA 3A02A 1ZR4A 2VUMJ 1MSFC 3HGYA 2ME6A 2M8GX 2CRGA 3HOZJ 4M6VA 1MBEA 4A3DJ 1FJLA 1ENHA 2XPUA 2LKXA 5FKOA 1ETQA 4IEJA 1AU7A 1I6HJ 4G12A 2IBDA 4A3FJ 1RPWA 1ZK8A 2E2IJ 4BXXJ 1T33A 5FKNA 2XPVA 1XC5A 1ETOA 1XS9A 3RQIA 2GBYA 2I10A 4UUSA 5E3NA 1LFBA 1QVUA 1TWFJ 3QPLA 3LOCA 1ZR2A 1AHDP 2LTPA 2KDZA 2HYJA 2K9SA 5J3LA 1X58A 3GTJJ 1W0UA 5F08A 5IOYA 1P7JA 1UMQA 3S1MJ 2LK2A 1W0TA 5F0HA 1WCMJ 2DJNA 2E1OA 5EF6A 4D5FA 4J19A 2CQXA 5JLWA 4C3IJ 1MBHA 4D7MA 2JWTA 2JA8J 5F04A 1HCRA 4X6AJ 5E3OA 3I4NJ 3GBGA 1JJ6C 4CYCA 2E19A 4DZJA 4A3KJ 1GT0C 1DU6A 1FIPA 1YRNB 1QVTA 5IYDJ 1ETWA 3QPSA 2JMWA 3MVPA 4FTHA 2G0EA 1MH3A 2HXOA 1GDTA 2LP0A 1MBGA 1ZQ3P 2FX0A 3TP3A 2Y2ZA 2CQQA 3LNQA 3MN2A 3FK7A 5IPAA 1APLC 2IEKA 2JA5J 1WPKA 3HEFA 1TWHJ 5E3MA 3S1RJ 3JRBA 5FJ8J 1TC3C 2Y9YA 2NS8A 1JT0A 2CJJA 4DYQA 2NVYJ 3CDLA 3JREA 1LFUP 4C2MJ 3PM1A 3MKLA 2R93J 2XB0X 3BR5A 3DCFA 1IDZA 2NS7A 3FISA 2HI3A 2XPWA 1PUFB 5F1JA 2JK3A 2H8RA 5EG0B 2QCOA 2W48A 2RAEA 3FK6A 2TCTA 2P81A 2DA3A 2MW8A 5IP9J 5C44J 3GTPJ 2VI6A 2DMNA 4MFDA 4I76A 2Y9ZA 1ITYA 3QQAA 4A3GJ 1UG2A 1T56A 4MFEA 5DTDA 2JJ7A 4HNVA 2AO9A 4DYRA 5J1RA 3OSFA 1GVDA 1K61A 1JKRC 2DMPA 3HBLA 2O9LA 5EDNA 4FE4A 3BG5A 3W6VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JRC A;  3JRI A;  3Q3S A;  5IP7 J;  5EGO A;  5M5W J;  5J1Y A;  4Y52 J;  4BBS J;  3ZQI A;  1MSE C;  1JUS A;  1Y1V J;  1PUF A;  4B1R A;  5M5Y J;  1FEX A;  2AHQ A;  3BR6 A;  2X48 A;  2DMU A;  3E7L A;  4A69 C;  2E2J J;  3PO2 J;  2R5Z B;  1POG A;  4DZP A;  3Q0W A;  4B4C A;  1IV6 A;  3D1N I;  4UUT A;  1HLV A;  5HOD A;  1JJ8 C;  3FKI J;  3HDD A;  2HXI A;  2WB1 N;  4JX5 A;  4RDU A;  1JUM A;  4C3H J;  4M3E A;  3O8G A;  2L7Z A;  2LR8 A;  3WHC A;  2XSD C;  4FCY A;  4XID A;  1JTY A;  2LVS A;  4JX6 A;  2M34 A;  1LE8 B;  1A5J A;  5F0C A;  2ECB A;  2EQR A;  4C3J J;  4D7N A;  2EZK A;  1TWA J;  1ETY A;  3I4M J;  2DMT A;  3ZQL A;  5J1U A;  1RKT A;  4NDL A;  5C4J J;  3TP0 A;  1CQT A;  1OFC X;  1SAN A;  2ME0 A;  5K7F A;  3JRG A;  1NK3 P;  2XGC A;  2R92 J;  1I3Q J;  1RR7 A;  1U78 A;  4M3B A;  1B8I B;  1ORK A;  1H88 C;  3GTK J;  4BY7 J;  1JGG A;  4RBO A;  2K9N A;  4IHY A;  1BL0 A;  3FIW A;  1VI0 A;  3A03 A;  4BBR J;  1F43 A;  2XB5 A;  3ZQG A;  3JR9 A;  2DA4 A;  4X1E A;  4EEF G;  4A3M J;  3G1L A;  4JP0 A;  4XRS G;  3VPR A;  2LY9 A;  3BTI A;  1DU0 A;  2H1K A;  2ELK A;  5IP6 A;  1NK2 P;  3NAR A;  2O8K A;  4M3G A;  1QRY A;  1H89 C;  2Y31 A;  1IC8 A;  2JN6 A;  1B72 B;  3BTJ A;  4A3L J;  2TRT A;  1B8I A;  1D5Y A;  5IOZ A;  3G1O A;  2NVT J;  4V2G A;  3S1Q J;  1GUU A;  1ZKG A;  5F0F A;  2OF7 A;  2JA6 J;  1TWC J;  3GTL J;  3BT9 A;  3K7A J;  3SFI A;  4QIW N;  3GTO J;  3HB9 A;  4L5E A;  1YRN A;  5FLV A;  5K7Z A;  4M3F A;  2FJ1 A;  1A6I A;  1BW6 A;  2ID6 A;  3ZQF A;  2R5Y B;  1IDY A;  4A3J J;  2DMQ A;  3BR3 A;  1MBJ A;  3C2B A;  2NOG A;  5DS9 A;  2GM4 A;  1IG7 A;  1JKP C;  2O7O A;  2WV1 A;  2X9D A;  5GPA A;  4BY1 J;  3OIO A;  4JX4 A;  4I6Z A;  2HOA A;  2MGQ A;  1OCT C;  1MH4 A;  1BJZ A;  3B6C A;  1MNM C;  3JRA A;  3HOV J;  1HOM A;  3WHB A;  5EZG A;  5FKL A;  1RKW A;  5FKK A;  3HOY J;  3S2H J;  2DN0 A;  5EG0 A;  1VFC A;  1RET A;  2WAQ N;  3BTL A;  1I50 J;  5M5X J;  4DW6 A;  4DYC A;  3BQZ A;  2XGE A;  1AKH B;  3A01 B;  2VKE A;  3IH3 A;  2CU7 A;  4LOC A;  4D5C A;  4XIC A;  5JLX A;  2ID3 A;  5M3F J;  3HKZ N;  1U8B A;  3IH4 A;  1BW5 A;  1MBF A;  3IV5 A;  4IHW A;  3LSP A;  2N8G A;  1IJW C;  2FQ4 A;  1WH5 A;  1QPI A;  1JKQ C;  1Z77 A;  2NVQ J;  1IRZ A;  2K40 A;  1HDP A;  2PMZ N;  3F0C A;  2LLK A;  3HGG A;  4A3C J;  4A3E J;  2EZI A;  1ZGW A;  1F36 A;  2XRL A;  4S0H B;  2VKV A;  1OJL A;  2HQ5 A;  3JRF A;  1GV5 A;  1ZTR A;  2M0C A;  4XRM A;  5EEA A;  2L9R A;  4MIM A;  3TW6 A;  1UHS A;  2MG4 A;  1E3O C;  4AC0 A;  2MSY A;  4JYK A;  3L1P A;  2R5Z A;  4XRS A;  1AKH A;  5IYC J;  5F27 A;  3A01 A;  1H8A C;  3H0G J;  1WH7 A;  2FD5 A;  1NTC A;  4CYC B;  5EZH A;  1RES A;  3BG9 A;  2B63 J;  2IAI A;  2R7Z J;  2DA5 A;  4FIS A;  3SDG A;  2LFB A;  3SJM A;  3M4O J;  1OCP A;  2Y30 A;  4Y7N J;  4A93 J;  2VPR A;  3HOW J;  9ANT A;  1U9O A;  2M9H A;  3S14 J;  2EBI A;  3NAU A;  2X6O A;  1EF4 A;  3TED A;  3LSJ A;  3OOU A;  3O8H A;  5E3L A;  1LE8 A;  3TW7 A;  2DTZ A;  3BQY A;  5C3E J;  2NVX J;  1ETX A;  3BR1 A;  5GP9 A;  1MBK A;  4GFB A;  3GTQ J;  1P7I A;  5IYB J;  2YUS A;  4MO7 A;  2EZL A;  2ZB9 A;  2EZH A;  2OPT A;  1JTX A;  4IHX A;  1FIA A;  3HOX J;  3UKG A;  2DA2 A;  3LSG A;  1G2H A;  4A3B J;  3Q0U A;  1WI3 A;  2LD5 A;  3G1M A;  2CUF A;  2XGD A;  3S2D J;  3ZOB A;  5FLM J;  3S17 J;  1FTT A;  1VND A;  1Q1V A;  2HOT A;  4V2F A;  4IHV A;  2Y0S N;  1BA5 A;  2CUE A;  4W1U A;  1SFO J;  3M3Y J;  4BKX A;  1Y1W J;  3Q0V A;  5C4X J;  3GTM J;  4QSH A;  1O4X A;  4QTR A;  2YU9 J;  3CQZ J;  2L7M P;  2K9Q A;  4MLO A;  3LSR A;  3RKQ A;  2ECC A;  3RZO J;  1FTZ A;  1XG1 A;  1IGN A;  2COB A;  2DA6 A;  3BG3 A;  3CCY A;  3ZQH A;  2EH3 A;  4B3A A;  2HDD A;  4W97 A;  5EGO B;  4A3I J;  2YS9 A;  3BTC A;  3BR0 A;  1S7E A;  1WGX A;  4AYB N;  4ABZ A;  1B72 A;  2L7F P;  2M2E A;  1HF0 A;  5K7H A;  3RZD J;  3BR2 A;  1GV2 A;  1HDD C;  1ETV A;  3GTG J;  4FE7 A;  1VF9 A;  5BNG A;  1JUP A;  2KT0 A;  3B6A A;  2DA1 A;  2L0K A;  3PO3 J;  3JRD A;  3JRH A;  1ETK A;  1K83 J;  3ZQC A;  3H3V K;  3S1N J;  5EYR A;  1IUF A;  5M3M J;  1TWG J;  3HM5 A;  1X2M A;  1JKO C;  4M3D A;  3K2A A;  2GLO A;  2JA7 J;  1Z0X A;  3OSG A;  2DA7 A;  3CMY A;  2R5Y A;  3S15 J;  5GPC A;  3S16 J;  4AUX A;  3IH2 A;  2D5V A;  3DEW A;  5FKM A;  2R0Q C;  2HOS A;  4UUS B;  2E2H J;  1JT6 A;  1X2N A;  1R9T J;  3HOU J;  2QF7 A;  4XK4 A;  1U9N A;  3A02 A;  1ZR4 A;  2VUM J;  1MSF C;  3HGY A;  2ME6 A;  2M8G X;  2CRG A;  3HOZ J;  4M6V A;  1MBE A;  4A3D J;  1FJL A;  1ENH A;  2XPU A;  2LKX A;  5FKO A;  1ETQ A;  4IEJ A;  1AU7 A;  1I6H J;  4G12 A;  2IBD A;  4A3F J;  1RPW A;  1ZK8 A;  2E2I J;  4BXX J;  1T33 A;  5FKN A;  2XPV A;  1XC5 A;  1ETO A;  1XS9 A;  3RQI A;  2GBY A;  2I10 A;  4UUS A;  5E3N A;  1LFB A;  1QVU A;  1TWF J;  3QPL A;  3LOC A;  1ZR2 A;  1AHD P;  2LTP A;  2KDZ A;  2HYJ A;  2K9S A;  5J3L A;  1X58 A;  3GTJ J;  1W0U A;  5F08 A;  5IOY A;  1P7J A;  1UMQ A;  3S1M J;  2LK2 A;  1W0T A;  5F0H A;  1WCM J;  2DJN A;  2E1O A;  5EF6 A;  4D5F A;  4J19 A;  2CQX A;  5JLW A;  4C3I J;  1MBH A;  4D7M A;  2JWT A;  2JA8 J;  5F04 A;  1HCR A;  4X6A J;  5E3O A;  3I4N J;  3GBG A;  1JJ6 C;  4CYC A;  2E19 A;  4DZJ A;  4A3K J;  1GT0 C;  1DU6 A;  1FIP A;  1YRN B;  1QVT A;  5IYD J;  1ETW A;  3QPS A;  2JMW A;  3MVP A;  4FTH A;  2G0E A;  1MH3 A;  2HXO A;  1GDT A;  2LP0 A;  1MBG A;  1ZQ3 P;  2FX0 A;  3TP3 A;  2Y2Z A;  2CQQ A;  3LNQ A;  3MN2 A;  3FK7 A;  5IPA A;  1APL C;  2IEK A;  2JA5 J;  1WPK A;  3HEF A;  1TWH J;  5E3M A;  3S1R J;  3JRB A;  5FJ8 J;  1TC3 C;  2Y9Y A;  2NS8 A;  1JT0 A;  2CJJ A;  4DYQ A;  2NVY J;  3CDL A;  3JRE A;  1LFU P;  4C2M J;  3PM1 A;  3MKL A;  2R93 J;  2XB0 X;  3BR5 A;  3DCF A;  1IDZ A;  2NS7 A;  3FIS A;  2HI3 A;  2XPW A;  1PUF B;  5F1J A;  2JK3 A;  2H8R A;  5EG0 B;  2QCO A;  2W48 A;  2RAE A;  3FK6 A;  2TCT A;  2P81 A;  2DA3 A;  2MW8 A;  5IP9 J;  5C44 J;  3GTP J;  2VI6 A;  2DMN A;  4MFD A;  4I76 A;  2Y9Z A;  1ITY A;  3QQA A;  4A3G J;  1UG2 A;  1T56 A;  4MFE A;  5DTD A;  2JJ7 A;  4HNV A;  2AO9 A;  4DYR A;  5J1R A;  3OSF A;  1GVD A;  1K61 A;  1JKR C;  2DMP A;  3HBL A;  2O9L A;  5EDN A;  4FE4 A;  3BG5 A;  3W6V A; 
#chains in the Genus database with same CATH topology
 3TQN A;  3KYL A;  3Q3S A;  5M5W J;  2MH2 A;  1JUS A;  3N4M A;  2RDP A;  1YW7 A;  3GEZ A;  4N4N B;  1MW7 A;  5CVV A;  3BR6 A;  3NEU A;  4BJ6 C;  3ERE D;  5ICG A;  1ZG3 A;  4A69 C;  2Y48 A;  2ZXW H;  3AL0 C;  1GHC A;  3KP3 A;  1XTA A;  4RAY A;  2IPQ X;  3I4P A;  1IV6 A;  3H5N A;  2K3F A;  4ASN A;  1QQI A;  3DLA A;  1FOX A;  3QOE A;  4E7H A;  2LKP A;  3FKI J;  3HDD A;  1VQM I;  3M7G A;  3CJQ B;  3S32 A;  2I5U A;  4HNT A;  3EYI A;  1MJB A;  3OYH A;  1JUM A;  3E6D A;  3MQ0 A;  4C3H J;  2HQR A;  2L7Z A;  1N78 A;  4JK1 X;  2ELJ A;  4S05 A;  2M34 A;  1LE8 B;  3AG2 H;  4BEH A;  5TRD A;  1HA8 A;  1R36 A;  1SD7 A;  4EJT A;  2DMT A;  3OY9 A;  5J1U A;  2O0Y A;  3ZQL A;  1BJA A;  2O5R A;  4S04 A;  3DEU A;  4Y4R A;  3ZMV A;  2V1X A;  3VYT B;  1K4S A;  1CQT A;  2QEX I;  1SAN A;  1K78 B;  1NK3 P;  5LBQ A;  3O3K A;  4NB5 A;  2KKO A;  2KMU A;  2R92 J;  3ZMS A;  1IN6 A;  1LKX A;  2DLL A;  2ZKZ A;  1SVM A;  2JVG A;  2EIN H;  3LA3 A;  4RB1 A;  1O3Q A;  3LSH A;  2DFF A;  4XOT A;  2K9N A;  4KMF A;  2FNP A;  2H27 A;  4YFK F;  3B73 A;  4KNY A;  1J75 A;  3J7A Y;  4L9T A;  3GFJ A;  4B8X A;  4PUS A;  4MEY F;  5DUK A;  3VPR A;  2FXA A;  3BTI A;  4F93 B;  3JSO A;  1Y0U A;  1L3L A;  1DU0 A;  2H1K A;  3GZ6 A;  1EH6 A;  3H35 A;  4YRV A;  4DBQ A;  2NNY A;  1BC8 C;  2H09 A;  3AG3 H;  2AS5 F;  1D1B A;  1QRY A;  2KP6 A;  2Y31 A;  4ITV A;  3TDU C;  3WE2 A;  2PJR B;  1D5Y A;  3DBH B;  5IOZ A;  3G1O A;  2XRO A;  2BOL A;  5CQG A;  1GUU A;  3K4J A;  2OQG A;  2HPM A;  1YX5 A;  4ENN A;  2QUF A;  1YE9 A;  1B9M A;  4LK0 F;  3SFI A;  4GO1 A;  4QIW N;  3OYM A;  4L5E A;  1FBU A;  1YRN A;  5K7Z A;  2FJ1 A;  1A04 A;  2VXD A;  4XBF A;  2JTV A;  4UB8 C;  3ZQF A;  4I7H A;  4Z2Y A;  1Y39 A;  1OR7 C;  2DT5 A;  3ZGK A;  2DAO A;  2DMQ A;  3KEO A;  1MBJ A;  1KZH A;  2VN2 A;  3GW2 A;  2NOG A;  1I1S A;  2GM4 A;  1IG7 A;  2F4I A;  2O7O A;  3B02 A;  5FD6 A;  3OYL A;  4ESF A;  2Y69 H;  4R79 A;  4E7K A;  3BP8 A;  2QSG X;  4LB5 A;  3SDB A;  2ZNZ A;  1E3P A;  4UV9 A;  3HOV J;  1KU7 A;  5JFR A;  2CMP A;  3QYE A;  4HST A;  5KAF C;  1YO5 C;  1AA7 A;  3Q5F A;  1RUN A;  4GDF A;  3I58 A;  4Y3O A;  3HOY J;  1ON1 A;  4A0X A;  2ZSI B;  1WWX A;  3IKV A;  3OS1 A;  2ESN A;  2XF7 A;  3OWT A;  3MD2 A;  5EG0 A;  3PNY A;  2QKM B;  4WXC A;  4HLY A;  1FWZ A;  3MZY A;  3RPU A;  4LD5 A;  1AKH B;  5LHG A;  3FMR A;  3IH3 A;  4LOC A;  4OIO F;  3K69 A;  2XAG A;  4PFO A;  1SD5 A;  4NQW B;  3V7C A;  1BW5 A;  1MBF A;  1SAX A;  4IHW A;  2DDB A;  1R5I D;  3SZP A;  1JKQ C;  1Z77 A;  3HXL A;  4BNC A;  2CYY A;  3HRS A;  2PMZ N;  2CGP A;  2F5V A;  1KYZ A;  4A3E J;  2DOD A;  3H3Z A;  3PNV A;  4DNC A;  5BPI A;  1F36 A;  3R6S A;  4S0H B;  1U5T A;  1V3F A;  1GV5 A;  5EEA A;  2LY2 A;  1UB9 A;  4BHC A;  3HTS B;  3V8J A;  3TW6 A;  1UHS A;  2MG4 A;  3O6B B;  1E3O C;  2E71 A;  1ZLK A;  2MSY A;  4RM3 A;  2BW3 B;  2DQR A;  4M73 A;  5HVQ C;  2K02 A;  4ZZL A;  3CCJ I;  1VQ5 I;  2YSR A;  4HLX A;  4H4K C;  3IWZ A;  4HQE A;  4MTD A;  2MD0 A;  4XKV A;  3GZN B;  1DGR M;  2J5O A;  2P5L C;  2G9W A;  3OMY A;  3SDG A;  1X1D A;  4KIS A;  5E1W A;  4RMN A;  1N77 A;  3HOW J;  3F3X A;  3A1Y A;  1U9O A;  3S8P A;  3LAJ A;  3S14 J;  3KE2 A;  3NAU A;  2OQR A;  2W4S A;  2X6W A;  4BL0 B;  1P4X A;  1YW9 A;  1PJR A;  2X6O A;  2BHZ A;  3F8M A;  1SFU A;  3J80 Z;  2Q1Z B;  4GGG A;  3SEQ A;  2DTZ A;  4DQ2 A;  2P5K A;  2NVX J;  3LFU A;  1ETX A;  3MCZ A;  4UXN A;  3DV8 A;  4HDU A;  1MBK A;  1CF7 B;  4GFB A;  4ETS A;  2P5V A;  1I6X A;  1P2F A;  2BHY A;  3OYA A;  3FZV A;  3FM5 A;  4LJZ F;  2YUS A;  1LB2 A;  1H9T A;  2DFH A;  2EZH A;  2MC4 A;  4IVN A;  1SEU A;  1JTX A;  2IP2 A;  1FIA A;  1RZ4 A;  2DA2 A;  1G2H A;  2LD5 A;  2ZXJ A;  3I64 A;  4DIQ A;  2CUF A;  2VQL A;  1KU9 A;  5D6E A;  2XKP A;  3QPT A;  2M45 A;  2EIJ H;  3D0S A;  2W1O A;  3DKW A;  4QWQ A;  1TW2 A;  1BA5 A;  1DP7 P;  1U6G A;  4W1U A;  2UWM A;  1Z1D A;  1SFO J;  3M3Y J;  1Y1W J;  3Q0V A;  5C4X J;  2D1H A;  3GTM J;  2F48 A;  5L3G A;  1LDD A;  1SVL A;  2IGM A;  4II3 A;  3CQZ J;  3DWL E;  3I71 A;  2ZME B;  2L7M P;  1D1C A;  4KN7 X;  3RKQ A;  3LSR A;  1X1A A;  2ECC A;  1XMX A;  1IXC A;  5IT9 Z;  3BLY A;  4HX4 A;  4M9Z A;  2E36 A;  2L9S A;  4PCQ A;  2RRE A;  5GAD J;  3NRV A;  4HZF A;  1B72 A;  1IF1 A;  4MQ9 F;  5KHD A;  4RGU A;  3C7J A;  3T1B A;  3OYN A;  3GYH X;  2M30 A;  1EJ9 A;  3ABT A;  5JHF A;  1GV2 A;  1OCZ H;  4C30 A;  4AM3 A;  1IV8 A;  5BNG A;  3HPG A;  2DA1 A;  2L0K A;  1QBJ A;  1K83 J;  1QHG A;  2RNG A;  4CDG A;  5M3M J;  1TWG J;  3VYU B;  4N9H A;  4BHB A;  4GYI A;  1LDJ A;  4G7H F;  3JAM Z;  3SZT A;  3WTT C;  4M3D A;  3S3M A;  1NG7 A;  4XOR A;  4XLP F;  3F6O A;  1S8N A;  3CCL I;  2XDV A;  3OSG A;  3QOP A;  2DA7 A;  5K1Y A;  5GPC A;  3HYI A;  1S7O A;  3GF2 A;  3QU3 A;  3E6C C;  5E17 F;  2LYC A;  2D5V A;  5D4S A;  2JT1 A;  1WKM A;  3DEW A;  3CJR B;  1HSJ A;  2E1M B;  3OOP A;  3QRF F;  1JT6 A;  5D6F A;  3FMQ A;  5FLX Z;  3RYP A;  3ZQ7 A;  2I8D A;  5FFZ A;  1Z3Y A;  3QYF A;  1R9T J;  1V5G A;  2WC2 A;  3UNG C;  4CHU A;  3K10 A;  3W3C A;  2V26 A;  2EFO A;  4HNU A;  4XLH A;  1E0E A;  2ME6 A;  5JVT A;  1SFX A;  4OIQ F;  2CRG A;  3HOZ J;  3F6V A;  4KIB A;  1ENH A;  5L3F A;  2BYV E;  1NG6 A;  4AU7 A;  4HV6 A;  4KDP A;  5DEQ A;  2CQ7 A;  2BGC A;  4UVC A;  5DYM A;  1I6H J;  2Z5U A;  4P55 A;  3RTR A;  1MGT A;  2WY8 Q;  5J8C A;  2IBD A;  4OMY A;  2KRH A;  1RPW A;  4ZDL A;  1R1V A;  3J7A O;  4NNJ A;  3TOB A;  1PP8 F;  1I39 A;  4HRI A;  3ZPL A;  6PAX A;  3OYI A;  2QSF X;  3CUQ A;  4U7B A;  1XS9 A;  3WU1 B;  2GBY A;  2I10 A;  4UUS A;  3HZJ A;  1QVU A;  4XLE A;  3DBR B;  1ZR2 A;  1MDM B;  2YU3 A;  4BDZ A;  4BUP A;  2CS3 A;  3J81 Z;  2DI3 A;  3KZZ A;  4P5O A;  2HDC A;  2W84 A;  1SC7 A;  1P7J A;  2E7W A;  1BOA A;  1D0Y A;  2HWV A;  4ZYD A;  2LK2 A;  3OL3 A;  5H2F C;  4PDK A;  3HIF A;  4RLF A;  4J19 A;  5JLW A;  1D0Z A;  2V79 A;  4D7M A;  2L01 A;  4BQQ A;  1K6O A;  1K7A A;  2A61 A;  2ZJR F;  1KYW A;  2KPM A;  3ELK A;  4BE0 A;  2LRD A;  5E3O A;  4ZYG A;  2LG4 A;  2V7F A;  2DQL A;  2VBW A;  1J7K A;  3GBG A;  2VQC A;  1VQ4 I;  4CYC A;  4LLG F;  2E19 A;  1GT0 C;  3JCU C;  4ZDO A;  2JA2 A;  1FIP A;  4G6T B;  1YRN B;  4F7Z A;  2XF6 A;  4RGR A;  3BJO A;  3BCA A;  2GIV A;  4FTH A;  4AWX B;  4GCV A;  1MH3 A;  1VQL I;  3ISP A;  2NNN A;  2MLG A;  4MNU A;  1YS6 A;  1ZQ3 P;  5HLG A;  3K1M A;  2X4H A;  5CVR A;  3TP3 A;  1XN7 A;  2HOE A;  3QYB A;  1YJN I;  2JA5 J;  4E7Z A;  2A68 F;  2VON A;  1WPK A;  3S1R J;  1RIO H;  4CCN A;  3S2W A;  3FXQ A;  1F4K A;  1JT0 A;  2CJJ A;  2JZY A;  2NVY J;  3PM1 A;  3CC2 I;  2R93 J;  3PIO F;  2AXL A;  2EV5 A;  1F9N A;  2NS7 A;  4PJL A;  1GXP A;  3FIS A;  1SVO A;  2STT A;  2XPW A;  3BG7 A;  3X2Q H;  4CCO A;  1WJD A;  5LRS A;  2H8R A;  5EG0 B;  4CIC A;  1GLN A;  5FFX A;  2X1D A;  2DU9 A;  3CP2 A;  1XPX A;  2ZCW A;  4HQM A;  2R7U A;  1C0W A;  2MW8 A;  3GTP J;  2VI6 A;  4PGH A;  4G9Y A;  4LGW A;  1ERD A;  2AQE A;  2PFB A;  2E1C A;  1Z6R A;  3T8T A;  2XAQ A;  4M74 A;  1HQC A;  4QPQ A;  2RNJ A;  2K4J A;  5E8I A;  3A0H C;  3RKX A;  1MJ9 A;  1T56 A;  4ZDP A;  4HNV A;  4DYR A;  3OSF A;  1GVD A;  2O9L A;  2GXA A;  2P6T A;  1G6N A;  3V8K A;  4RM2 A;  3W6V A;  3JRI A;  3TL4 X;  5IP7 J;  4Y52 J;  4L5J A;  4BBS J;  1MSE C;  1U5T B;  2HS5 A;  2M4K A;  1IZ1 A;  1YIJ I;  2OZU A;  3GO5 A;  2PEX A;  3A2K A;  2EIK H;  2DMU A;  3FXU A;  4Y15 A;  4C9Y A;  2PMU A;  5D5U B;  2E2J J;  1OIS A;  1R71 A;  2UV1 A;  1POG A;  4DZP A;  4CSW A;  2GOM A;  3DQV C;  3H9Q A;  5ILS A;  4GRI A;  3K4B A;  1ZRC A;  4FHT A;  3WTV C;  2VXZ A;  1JHH A;  3ULQ B;  4OIP F;  2HXI A;  2FUG 2;  1UAA A;  3K9T A;  4RDU A;  1FP1 D;  1WQ2 A;  3FKJ A;  1T2K A;  3O8G A;  1JI8 A;  2WTE A;  4ENK A;  5KVR A;  2OTJ I;  3LST A;  3G3Z A;  4FCY A;  1VQ7 I;  2DYR H;  2MA3 A;  3RDI A;  2P8T A;  4XID A;  5LEJ A;  1TQI A;  2BV6 A;  4CCM A;  3WTS C;  2FMY A;  4XRF A;  4JX6 A;  1ZAR A;  5B1A H;  4IQ4 A;  1T0F C;  1Y6I A;  5F6F A;  4C2U A;  2XKO A;  4EM1 A;  1SFK A;  2L02 A;  1R22 A;  1RKT A;  2R7X A;  3K6G A;  5C4J J;  1OPC A;  5DCM A;  2A05 A;  3TP0 A;  1OFC X;  2ME0 A;  3F8B A;  1BM9 A;  1QHH D;  3G2B A;  3I5U A;  3HL2 A;  1HBX G;  4HW0 A;  1RR7 A;  1QZZ A;  2COM A;  1TNS A;  1B4A A;  2CW7 A;  1B8I B;  2CUJ A;  2OAZ A;  1N75 A;  4OU0 A;  4JQF A;  4E6K G;  2CFX A;  4GXO A;  1JGG A;  1Q1H A;  4P9F A;  2FNA A;  1BL0 A;  3FIW A;  2YR2 A;  2O03 A;  1EA3 A;  4BBR J;  4IO9 F;  2WBM A;  3JR9 A;  1IN8 A;  2DA4 A;  4PSX A;  4B3X A;  4EEF G;  4OIN F;  3G6E I;  4JP0 A;  2LY9 A;  3CMM A;  4KFC A;  5L3E A;  3PFY A;  3H3U A;  3L2W A;  3F21 A;  2IGK A;  1Y56 A;  2PJP A;  4D0P A;  4DBR A;  2O8K A;  2MFZ A;  2D2W A;  4L9N A;  1YTY A;  1H89 C;  3RSN A;  1B59 A;  5KK1 A;  3C3W A;  1B72 B;  2OZ6 A;  5J4V A;  2VT3 A;  4V2G A;  1Y8Q B;  2HZD A;  4CGZ A;  1ZKG A;  2OF7 A;  1FOK A;  2G7U A;  2KZV A;  2TDX A;  2DK5 A;  1QZE A;  4BH9 A;  4G94 A;  3RI4 A;  1FBS A;  3GTL J;  3V7S A;  2BE5 F;  3BJ6 A;  5JR3 A;  3HB9 A;  2BY0 A;  3I0T A;  3I56 I;  5GAG J;  1QPM A;  3CDH A;  2W25 A;  2CV0 A;  4UVB A;  2A3S A;  2V9V A;  3BC8 A;  2W24 A;  2KDO A;  1U0J A;  4HX8 A;  2FU4 A;  5HS7 A;  4PJJ A;  1UHM A;  5BQT A;  1JKP C;  4OWR B;  2X9D A;  2WY7 Q;  3BJA A;  3OIO A;  4BY1 J;  4HF2 A;  4JX4 A;  4I6Z A;  4XSZ F;  2IS1 A;  3TMO A;  3U1D A;  1OCT C;  3HHH A;  4BAY A;  2MC3 A;  3RPQ A;  3DLL F;  1WSU A;  1L0O C;  3ZR8 X;  3W2V A;  5HS8 A;  3WHB A;  2L7K A;  3F8F A;  5AON A;  5EZG A;  5FKL A;  1RKW A;  4K2E A;  4E7I A;  4HPQ A;  4XN0 A;  2HTS A;  1T6S A;  3HOS A;  1TZL A;  4CO8 A;  2M7B A;  2IS2 A;  2WAQ N;  3HUG B;  2UUZ A;  1ZGA A;  3AG4 H;  4A5M A;  5D8K B;  1KU2 A;  4DW6 A;  2PG4 A;  2XGE A;  4UVA A;  2A5Y B;  1MMS A;  4HV5 A;  1SD4 A;  3FM3 A;  2CU7 A;  1U8R A;  4D5C A;  3GME A;  3P9I A;  2ID3 A;  5JLX A;  4OMZ A;  2P0W A;  3FMS A;  1J09 A;  3HKZ N;  1U8B A;  2XAJ A;  2VJ5 A;  3IH4 A;  3E0J B;  1V4R A;  1QPI A;  1QGP A;  2BXZ A;  4HBL A;  1IRZ A;  2WAD A;  3F0C A;  4AYB A;  4A3C J;  5CJ9 A;  2R7S A;  4EMS A;  2HZT A;  3TDZ C;  4U0V A;  2NYX A;  4HX7 A;  2HQ5 A;  3VDX A;  1A35 A;  2M0C A;  3LSM A;  4XRM A;  3HTU A;  5HNH A;  1ACI A;  5J47 A;  2HNH A;  3C18 A;  5EJC A;  4FQG A;  2R5Z A;  5IYC J;  3A01 A;  1VQ6 I;  2XUB A;  3ML6 A;  3W6J B;  2QLZ A;  2FD5 A;  4KT6 A;  1NTC A;  3I53 A;  4CYC B;  3L2V A;  3KYC B;  1MNE A;  2RQP A;  1DGW Y;  3BG9 A;  1B9N A;  2XC7 A;  3QP6 A;  1MMG A;  2FEZ A;  2IAI A;  2VQG A;  1KQ8 A;  2R7Z J;  3W6K B;  3KP4 A;  2CFO A;  3SJM A;  3EPZ A;  3LSK A;  3IUO A;  3M4O J;  2GXG A;  2Y30 A;  4Y7N J;  4A93 J;  1OYW A;  4WF2 A;  2XAH A;  2V1U A;  5K5O A;  5LD2 C;  2EBI A;  3VYS B;  3CCQ I;  1YS7 A;  3OYC A;  2LBF A;  5GTH C;  5E3L A;  5E20 A;  3WTW C;  2PMZ A;  1P9Q C;  2IJL A;  5ICC A;  2KFD A;  2MD5 A;  2L3D A;  1R4M B;  3QOD A;  1Z05 A;  3ECH A;  4MO7 A;  3ZMZ A;  2CV1 A;  3MFK A;  3LSG A;  4EVI A;  2LKS A;  5HLH A;  1T8I A;  3MMY B;  4YEJ A;  5E79 C;  5KCM A;  2XGD A;  3HSR A;  4PJN A;  1VQO I;  3KP7 A;  4N9I A;  4XR6 A;  3ZOB A;  3L2U A;  4ESJ A;  3RYR A;  3BZC A;  2ISY A;  2L9N A;  2RN7 A;  1TT0 A;  4V2F A;  1G3T A;  2NXN B;  2HOT A;  2QBY B;  1BOB A;  2Y0S N;  3QAH A;  5DM6 F;  3LAP A;  3COA C;  1SAU A;  2GXB A;  3FXJ A;  1MND A;  4I99 C;  4KA4 A;  2EIL H;  2YU9 J;  2Q8K A;  2K9Q A;  4MLO A;  3WGG A;  1WJA A;  3RZO J;  4OAY A;  1IGN A;  2COB A;  2E1N A;  3BG3 A;  3E5X A;  4MTE A;  3RPU D;  4B3A A;  2HDD A;  4A3I J;  1IN7 A;  3BR0 A;  5CQE A;  4AYB N;  2DPD A;  4WWC A;  2VOD A;  4AD9 A;  5K7H A;  3OS2 A;  3I55 I;  1R6R A;  1RNL A;  3J7Y J;  1HDD C;  1YIT I;  1VF9 A;  2EA2 A;  4Y17 A;  3PO3 J;  2A5W A;  1ETK A;  3ZQC A;  5LEK A;  4L9J A;  5K5R A;  3LQQ A;  1UCR A;  3L09 A;  1X2M A;  1JKO C;  2EV0 A;  2VKH A;  2X85 A;  3F8N A;  4ZZD A;  4QLC U;  2CQN A;  1KQ0 A;  3J80 K;  2GLO A;  1KGS A;  5D8L B;  1TP4 A;  4E4H A;  3FXL A;  3HPH A;  3S15 J;  2IGO A;  4PZJ A;  2IS6 A;  1I3A A;  4AUX A;  5GAH J;  1ZRD A;  2BY2 A;  3DPU A;  1YJW I;  1MJA A;  2F5D A;  5FKM A;  5FRO A;  4I0B A;  3DU6 A;  4FX0 A;  2X6Y A;  5HNF A;  1PYV A;  1W1W E;  2JPB A;  3MEX A;  2PLY A;  4LG0 B;  2NS0 A;  2WAE A;  3G73 A;  1MKM A;  4XK4 A;  4UV8 A;  5L3B A;  1FY7 A;  2BZT A;  1ZR4 A;  2VUM J;  4F52 A;  1FX7 A;  1JGS A;  4IZZ A;  4L18 B;  2M8G X;  2BY3 A;  4IRG A;  2VT2 A;  1BI0 A;  3P7N A;  5DCM B;  4I0A A;  2H6C A;  4ZYE A;  3K70 D;  5D4R A;  1MMN A;  1U2W A;  5AIQ A;  3PQJ A;  4XON A;  1ETQ A;  1TNT A;  5D5X B;  3H92 A;  5ED4 A;  2QQ8 A;  3CME I;  2VC0 A;  3EUK L;  2RV8 A;  4E7J A;  4XN3 A;  1P92 A;  2KRC A;  5KNL A;  4BE1 A;  4YFN F;  3ESW B;  2V1N A;  5BOX A;  3RQI A;  3M1C A;  5E3N A;  1LFB A;  2A6H F;  3FBN B;  3IHU A;  1TWF J;  5LFA A;  2G7H A;  2Y75 A;  5BPD A;  2F6C A;  4RS8 A;  1AHD P;  2LTP A;  2KDZ A;  4BHP A;  4EQQ A;  4WXH A;  1D5V A;  4A6E A;  5LHI A;  3BDD A;  2KHM A;  2QWW A;  5F08 A;  5IOY A;  1ZLJ A;  1XDS A;  2VKD A;  5F0H A;  2KLO A;  1O3T A;  4L5I A;  3L9F A;  4D5F A;  2JA8 J;  2GA2 A;  1HCR A;  3JAM K;  2B7E A;  1W7P A;  1YYV A;  1RUO A;  4HA8 A;  3H5A A;  2FSW A;  3RQ4 A;  1OQY A;  1HKT A;  5DDG A;  3I4N J;  4DZJ A;  4B48 A;  4E7S A;  4BGD A;  5IYD J;  3HSE A;  1IAW A;  2EIM H;  1ETW A;  2KJB A;  3QPS A;  4ANJ A;  2JMW A;  2LMD A;  2G0E A;  1BC7 C;  3OR1 C;  5CVU A;  3NWT A;  3BY6 A;  2VJI A;  5K5Q A;  1LQ1 A;  2ETH A;  2HXO A;  2E35 A;  2IGN A;  2LP0 A;  1E3H A;  4ZC3 A;  3H9J A;  2FX0 A;  1OKR A;  3DTK A;  1UZC A;  2Y2Z A;  3JSP A;  2FF4 A;  1OYY A;  1UG0 A;  3CLO A;  2LC2 A;  2P7V B;  1UFM A;  2OJE D;  3FK7 A;  3IRQ A;  1BIB A;  3ABK H;  2DW4 A;  4BXF A;  2M4G A;  3HOT A;  4A0Y A;  2Z33 A;  3CO7 C;  2D45 A;  4M72 A;  3JRE A;  5IT3 A;  3MKL A;  4M9S A;  4CUG A;  2KIU A;  1UHW A;  4CA0 A;  1VQK I;  3DP7 A;  1TTY A;  5F1J A;  4YII A;  1R1T A;  2EFQ A;  4U0Y A;  2LNB A;  2QCO A;  2DDA A;  4KT5 C;  3JTG A;  2W48 A;  1S7A A;  3FK6 A;  3K1N A;  3D5L A;  1IRF A;  2DA3 A;  2ZFU A;  3FWE A;  4MFD A;  3KP6 A;  4I76 A;  3U1K A;  1ITY A;  3S3O A;  3QQA A;  1BI2 A;  3HHG A;  3OYD A;  1UG2 A;  3SZG A;  3UR3 C;  3M8E A;  2RKH A;  3GX4 X;  1YJ9 I;  3CC7 I;  3V7R A;  2AO9 A;  3OL4 A;  3HBL A;  2QSH X;  4A2U A;  3JRC A;  5J1Y A;  3ZQI A;  1BI1 A;  1YOV B;  4BQO A;  4BEH B;  1PUF A;  4O3M A;  1FEX A;  1I5Z A;  4XNF A;  2HVS A;  2JUG A;  4LLL A;  4G7Z F;  2HGC A;  3P9K A;  4I01 A;  2R5Z B;  1Z3X A;  3Q0W A;  5CPR B;  3N05 A;  3D1N I;  4MEX F;  1Z67 A;  2VC1 A;  4UUT A;  3V42 A;  1HLV A;  5HS9 A;  3VWB A;  1PP7 U;  3OIP A;  1G3W A;  3RJP A;  4RB3 C;  5HLT A;  4IRI A;  2V1D A;  4JX5 A;  3IAM 2;  2P6S A;  1FBQ A;  4PJ0 C;  5E1X A;  2BEO A;  3BPV A;  3F72 A;  1U3E M;  3KIO A;  1LEA A;  3BRO A;  4M3E A;  3SFZ A;  2OC6 A;  2LR8 A;  2VIX A;  3DEE A;  3WHC A;  4NBQ A;  2L9V A;  3VOD A;  1K4T A;  3HC7 A;  3IL2 A;  2ZME C;  2F4O B;  2LVS A;  1A5J A;  3DU5 A;  1XGM A;  1X3Z B;  2ECB A;  1GXQ A;  1LVA A;  2EQR A;  2ZXI A;  3RCO A;  1TL8 A;  1ETY A;  5FO5 A;  3I4M J;  4UB6 C;  1W36 D;  2R7O A;  2OV7 A;  4NDL A;  4RB0 A;  2MLK A;  3Q9V A;  1BR1 A;  3JRG A;  4YIR X;  2HTJ A;  1RI7 A;  3DXJ F;  1UJ8 A;  1DPR A;  3AFH A;  3KLN A;  4M3B A;  4IXA A;  5DUI A;  1H88 C;  2BBY A;  2XV4 S;  2YX7 A;  4BY7 J;  4NC6 A;  2R7D A;  2PX9 A;  1M1E B;  3LSI A;  3A0B C;  4R8H A;  3ZQQ A;  3A03 A;  2XB5 A;  3ZQG A;  1OR7 A;  4LB6 B;  4B09 A;  2VB6 A;  4A3M J;  3OYE A;  1XSD A;  1RC9 A;  1IUY A;  4XRS G;  2DOA A;  2ADU A;  2E1M C;  1J0R A;  3WTZ A;  1W5T A;  2ESH A;  2GWR A;  4G6D A;  2ELK A;  4B44 A;  5L3C A;  2WV0 A;  3NAR A;  4BJ5 C;  4M3G A;  2P4W A;  1HC8 A;  1H0M A;  3VSL A;  4XMY A;  1K78 A;  1V54 H;  4U87 A;  3L7W A;  4A3L J;  2TRT A;  1MZB A;  3CCV I;  2NVT J;  5E1Z B;  3S1Q J;  1BN5 A;  5F0F A;  4WCG A;  2JA6 J;  5B5E C;  1SMT A;  1TWC J;  4XSX F;  4XM3 A;  3IP4 B;  4Q47 A;  3EDP A;  3K7A J;  3GTO J;  3FXO A;  2HPI A;  2XF5 A;  1J5Y A;  1D0X A;  2EFW A;  2X1C A;  1F1Z A;  1BBY A;  1IDY A;  4BQA A;  2XSJ C;  4A3J J;  2FOK A;  4KIG A;  2GQQ A;  1XSV A;  4A6D A;  4C2T A;  2ZXH A;  1YG2 A;  4BQN A;  1V5E A;  2R7T A;  3KYD B;  2PBI A;  1R7J A;  2HOA A;  2MGQ A;  3PSI A;  4ZYH A;  4CCL A;  1MNM C;  2EK5 A;  3JRA A;  1HOM A;  3D5R C;  5J6X A;  1DP3 A;  3FBI B;  5FKK A;  3A4C A;  1VQN I;  2VOP A;  3R61 A;  1S72 I;  3S2H J;  1S3J A;  2DN0 A;  3H1C A;  4IL6 C;  1VFC A;  5DCF A;  1RET A;  3F9K A;  4AIH A;  2K5C A;  4KUM A;  4DYC A;  2VKE A;  3LFK A;  3T8R A;  3R0J A;  3DFG A;  4CYD A;  2PN6 A;  3LL7 A;  5M3F J;  3GUD A;  4OIR F;  5ERI A;  2ZNY A;  1S29 A;  5IY5 H;  2OCE A;  1WJ5 A;  1IJW C;  2FQ4 A;  1WH5 A;  3ZMU A;  4M71 A;  4UUV A;  4QPO A;  2O6G E;  4XKC A;  4EGY A;  2LLK A;  2EZI A;  1ZGW A;  2CO5 A;  3VB2 A;  4WX9 A;  1YQA A;  2XRL A;  2VKV A;  1FNN A;  1OJL A;  4M6X A;  3JRF A;  1QO0 D;  4HEA 2;  4M9X A;  2GIZ A;  2BXY A;  2IA1 A;  4MIM A;  4Q5S F;  1W7P B;  3FDY A;  2E7X A;  2V6E A;  3TBI A;  3L1P A;  2W00 A;  3CD6 I;  4XRS A;  4OAZ A;  4Q48 A;  5A2Q K;  5F27 A;  3FXR A;  3RKY A;  1AKH A;  1H8A C;  1XCB A;  3PUB A;  5LHH A;  1UST A;  1WJE A;  3FXK A;  4I02 A;  5JVG F;  2WAQ A;  3ASN H;  1T38 A;  2K85 A;  4LG3 A;  1RES A;  1E2X A;  1X1B A;  3Q9S A;  1EH7 A;  4EAT A;  1TT5 B;  5CVI A;  3I59 A;  3QPH A;  1TLH B;  1Y8R B;  2ICW G;  5HLI A;  1KQ9 A;  2VPR A;  4RGX A;  2M87 A;  3HKZ A;  4BXU A;  1Z9C A;  9ANT A;  2M9H A;  4PGG A;  2FBK A;  5HDG A;  2UXN A;  3CC4 I;  2OA4 A;  2DYS H;  2F5F A;  1EF4 A;  3K0L A;  3TED A;  3L2C A;  3O8H A;  1T08 B;  2HDW A;  3GFM A;  3BQY A;  5C3E J;  3BR1 A;  3RKW A;  5GP9 A;  3TOA A;  1FSH A;  1Z7U A;  1S6L A;  3GTQ J;  1U5T C;  2CV2 A;  2BW3 A;  2O8X A;  5IYB J;  4HOB A;  2ZFW A;  4KN4 X;  5J4Y A;  3AL0 B;  3FX3 A;  3E1S A;  2M1B A;  4IHX A;  4FX4 A;  3UKG A;  3W2W A;  4GYG A;  4BE2 A;  2JUC A;  5HDN A;  4CXF A;  3BPX A;  4E7L A;  3G71 I;  3CCS I;  3S2D J;  1EH8 A;  3S17 J;  2K4B A;  4EJW A;  3LWF A;  1VND A;  1Q1V A;  3ZCO A;  3F8C A;  3HG9 A;  1ZRF A;  3I9V 2;  4XKB A;  2CUE A;  3KLO A;  3ONQ A;  1LUJ B;  4N0B A;  4QSH A;  2X1E A;  4XLF A;  1O4X A;  3EYY A;  3E3V A;  3SYT A;  4QTR A;  3K70 C;  2M8E A;  2HKX A;  4HYE A;  1ZN2 A;  3KEQ A;  1CF7 A;  4CCJ A;  3CCY A;  2OU2 A;  3ZQH A;  1QU3 A;  2DOE A;  4A0Z A;  4W97 A;  3CJN A;  2YS9 A;  3VFZ A;  1S7E A;  1WGX A;  3PIP F;  3K4C A;  3G4S I;  4ABZ A;  1RRJ A;  2IT0 A;  4CZC A;  2L7F P;  1FLI A;  1YI2 I;  4KIT B;  4PJM A;  4JBA A;  2M0M A;  2Z16 A;  3BR2 A;  1ETV A;  5DD8 A;  2B9S A;  4YFX F;  4LLN A;  4FE7 A;  3GTG J;  1JUP A;  3B6A A;  1T39 A;  3H3V K;  2HYF A;  5EYR A;  1IUF A;  2HQA A;  3DF8 A;  2F4M B;  3H36 A;  2LSO A;  2V6C A;  4WXD A;  3EUH C;  4U88 A;  2KIQ A;  4I98 B;  2IVM A;  3QP5 A;  4ZTF A;  3SEZ A;  1X4P A;  2LDU A;  3MAJ A;  3HRT A;  3NWS A;  4YEL A;  1FZP B;  1Z0X A;  3DKX A;  3E6B A;  2Y0S A;  3CMY A;  2R5Y A;  1O57 A;  4IHS A;  3GLX A;  4P1W A;  3OYF A;  2A07 F;  1HW1 A;  3IH2 A;  1VQ9 I;  4F91 B;  2R0Q C;  1W4M A;  2HOS A;  3CUQ B;  4IF4 A;  2VJJ A;  4UUS B;  2E2H J;  4IPA A;  4G8X A;  1X2N A;  3W2A A;  2QF7 A;  1U9N A;  1MSF C;  2VLA A;  3HGY A;  1OCC H;  2ZC2 A;  1AWC A;  3NQO A;  3R0A A;  3GZ5 A;  4M6V A;  2WWY A;  2BY1 A;  4RB2 C;  3ZN0 A;  2NOJ B;  3EET A;  2LY1 A;  3E6M A;  1FJL A;  1WJB A;  2CWE A;  4RLQ A;  4A3D J;  5F1R A;  1FOY A;  3VYR B;  3CDI A;  2AQF A;  1ODD A;  5EEH A;  4IEJ A;  1AU7 A;  2X51 A;  2XAS A;  2HKO A;  3ROU A;  3SXY A;  4EM0 B;  1T33 A;  5FKN A;  4EV0 A;  2K27 A;  2M7A A;  2OUM A;  2XPV A;  4CH7 A;  2EJR A;  1Y0N A;  2MBF A;  3L2Q A;  3QPL A;  3WTY C;  3E5U A;  3LOC A;  1A36 A;  2DFI A;  1XB4 A;  1LJ9 A;  2HYJ A;  4AID A;  2H8W A;  1FSE A;  4RA2 A;  5J3L A;  3ZP5 A;  2DPU A;  1ZAO A;  2E5Z A;  2QYO A;  3GTJ J;  5CYV A;  1W0U A;  4B43 A;  3FF5 A;  2H94 A;  2VBZ A;  1KA8 A;  3JTH A;  3DPT A;  2FBH A;  1UMQ A;  3S1M J;  2JRM A;  3IKT A;  3LMM A;  1WCM J;  2DJN A;  2E1O A;  5H6R A;  5EF6 A;  3V4G A;  3OIQ A;  2M5W A;  5ILU A;  2JWT A;  5F04 A;  1ZRE A;  2MAB A;  4O5V A;  1R00 A;  2K7L A;  3C1D A;  1ZG1 A;  2PQ8 A;  1K79 A;  4OOI A;  4XLA A;  1VTN C;  2IW5 A;  2KJC A;  1JJ6 C;  5B1B H;  1XDU A;  4A3K J;  2WB1 A;  1DU6 A;  1QVT A;  4HSR A;  1V55 H;  1N25 A;  3U9G A;  2VBY A;  4ZYA A;  1QA6 A;  3DPL C;  1J2X A;  3MVP A;  1MDM A;  2KL4 A;  2HVR A;  1O7L A;  3WGH A;  3CUQ C;  3ABU A;  1XCV A;  2QA4 I;  5LGU A;  2FA5 A;  3VEP A;  1HW5 A;  1MBG A;  5J8F A;  1MIJ A;  1FMW A;  2V9K A;  2AXT C;  4NUB A;  2CQQ A;  3LNQ A;  2JPC A;  3ABM H;  5IPA A;  3WTX C;  1APL C;  3TO7 A;  5E3M A;  3VOE A;  1OLT A;  2GA1 A;  2LF8 A;  4BU2 A;  4XQF A;  1TC3 C;  4XOP A;  2NS8 A;  1YIO A;  1XGS A;  4DYQ A;  3CDL A;  3BG6 A;  3K4N A;  1TQM A;  3S3N A;  2QGU A;  3PFI A;  3BR5 A;  3CP8 A;  1IDZ A;  2HI3 A;  5TJJ A;  5D5W B;  3WGI A;  3M8J A;  4FAS D;  2JK3 A;  3MZ8 A;  1ZHF A;  1D8J A;  2Z3Y A;  3GLL A;  1USS A;  3E97 A;  2Q2E A;  3WG7 H;  1V5F A;  3D5S C;  3J7Z I;  2DFE A;  2RAE A;  1UEL B;  3ZMT A;  3MWM A;  5DV5 A;  5C44 J;  2FE3 A;  3KP5 A;  2E60 A;  4AVZ A;  1KON A;  1W36 C;  5FB2 A;  1TQP A;  4A3G J;  3M1E A;  1YFH A;  4MFE A;  5DTD A;  5J1R A;  1XX5 A;  2V9P A;  1I27 A;  3GFI A;  1K61 A;  1JKR C;  4IHY A;  2DMP A;  5D5V B;  4EJO A;  3ZMD A;  5EDN A;  4FE4 A;  4MGR A;  3BG5 A;  1T0F A;  3M8F A;  5EGO A;  4U0W A;  4A5N A;  5B66 C;  3F22 A;  4B47 A;  1Y1V J;  2V4J C;  3WE3 A;  3N97 A;  2JSC A;  3K4M A;  1XMK A;  2FQ3 A;  4B1R A;  5M5Y J;  3EQL F;  2AHQ A;  2X48 A;  1LPQ A;  2ISZ A;  4LIU A;  3E7L A;  5ILV A;  4HG2 A;  3PO2 J;  2O3F A;  4XLC A;  2KZG A;  3MKY B;  4B4C A;  1HST A;  1HKS A;  4AVP A;  4EJV A;  3PSF A;  3H5R A;  1Z91 A;  3K4L A;  5HOD A;  1JJ8 C;  2EFN A;  1O7F A;  2WB1 N;  3TKY A;  3CF2 A;  1R5G A;  2R7F A;  3K2Z A;  1JE8 A;  1W7P D;  2XGX A;  3I59 B;  3IRR A;  1G8X A;  1MMA A;  3O2P E;  2FOW A;  1R4N B;  2XSD C;  5IT9 K;  3C2G A;  4KMU X;  3CCM I;  4H0E A;  2QKL B;  2Q0O A;  2ZSH B;  1BR2 A;  1JTY A;  2CG4 A;  5F0C A;  1G3S A;  4C3J J;  4D7N A;  2EZK A;  3GXO A;  1TWA J;  5HOO A;  1P4A A;  1G3Y A;  4LIT A;  2STW A;  2QVO A;  2OTL I;  2UZK A;  4F3Q A;  2DCE A;  5K7F A;  2XGC A;  1I3Q J;  1U78 A;  1ORK A;  2BVL A;  3KCC A;  3GWZ A;  3GTK J;  2F5C A;  2W7N A;  3GFL A;  4BYY A;  1DPU A;  2X6X A;  1CGP A;  4RBO A;  2CSO A;  1VI0 A;  2VOO A;  1F43 A;  5FGM A;  1HW2 A;  2CUZ A;  1P6R A;  5FLX K;  4X1E A;  3LA2 A;  4IJA A;  3G1L A;  2B0L A;  5IP6 A;  3BZ6 A;  1NK2 P;  1WZ2 A;  3BOQ A;  1IW7 F;  1IC8 A;  2JN6 A;  2EA4 A;  5JI6 A;  1T98 A;  5E8G A;  1YW8 A;  2R3S A;  3BTJ A;  2JSP A;  1OYI A;  1B8I A;  4L0Y B;  1FYL A;  3PQK A;  4ENJ A;  2ZBK A;  1WHU A;  3EUH A;  3HRU A;  1X4O A;  4AIJ A;  3CO6 C;  2GAU A;  4RGS A;  1S5L C;  3BT9 A;  1ON2 A;  5FLV A;  4RAZ A;  3KPH A;  4M3F A;  2DBB A;  1A6I A;  2GZW A;  2HYG D;  2R7V A;  3DTE A;  1BW6 A;  2OCC H;  2ID6 A;  2K9M A;  5GAE J;  3OYB A;  1JXS A;  2R5Y B;  3J81 K;  2RQQ A;  2PMH A;  2J5P A;  2LRE A;  3BR3 A;  3C2B A;  3I3L A;  1ZGJ A;  5DS9 A;  4F55 A;  4KYW A;  3C2H A;  3DBL B;  2WV1 A;  3OS0 A;  5GPA A;  4E70 A;  3OV8 A;  3OYJ A;  3T0Y A;  2ACJ A;  1F5T A;  1IRG A;  5LRR A;  2ZJP F;  4D9J A;  1QZY A;  3CZ6 A;  2R7W A;  1MH4 A;  1BJZ A;  2X0L A;  2ZJ2 A;  2XRN A;  3B6C A;  2CW8 A;  3P5J A;  5LGT A;  2C6Y A;  1E17 A;  3T5X A;  5FD5 A;  3TO9 A;  1SMY F;  5DD4 A;  2IA0 A;  3OYK A;  1AOY A;  4XKW A;  2WA0 A;  1LFP A;  2EWN A;  2VE9 A;  2YPR A;  1WRJ A;  1ONV A;  1X3U A;  3BTL A;  1XMA A;  1I50 J;  4Z6Y A;  5M5X J;  4U7D A;  3IC7 A;  3BQZ A;  1ZH5 A;  2A6E F;  1LVK A;  3A01 B;  2EPF A;  3E5Q A;  4ZH4 F;  3LA7 A;  4XIC A;  1D3Y A;  2K86 A;  2Z99 A;  4PK4 A;  4FET A;  2F5E A;  3SHF A;  1BR4 A;  1TW3 A;  1ZEL A;  3L00 A;  3IV5 A;  3LSP A;  5CVJ A;  4IRH A;  1FC3 A;  2N8G A;  2NVQ J;  1Z7L A;  4UHT A;  4BJT A;  2K40 A;  1HDP A;  1R1U A;  3HGG A;  4LIV A;  3CCE I;  1MMD A;  5EEG A;  5ICE A;  3V8L A;  3PUF A;  4MQV A;  2LBF B;  1R5H A;  1WVR A;  2JRT A;  1LDK B;  2KQR A;  1ZTR A;  2Y0M A;  4RAG A;  2YX4 A;  3CES A;  5KAI C;  4DOZ A;  2QQA A;  1NHA A;  2QEN A;  2HVQ A;  2L9R A;  2O61 A;  3R4K A;  4AC0 A;  3HUG A;  3CMA I;  4JYK A;  1EV7 A;  3OR2 C;  2HEO A;  2IA2 A;  3QWL A;  4EM2 A;  2LH9 A;  4JOM A;  1J9I A;  4KIF A;  3H0G J;  1WH7 A;  3TO6 A;  5EZH A;  3SQN A;  4M6Y A;  1IXR C;  2ZO4 A;  3FHN A;  2B63 J;  1OMI A;  2H6B A;  1XGN A;  2DA5 A;  1FPQ A;  1FT9 A;  4FIS A;  4BDY A;  2LFB A;  1IXS B;  2NAZ A;  2VBX A;  4LFU A;  1OCP A;  2DXI A;  2L5Q A;  5B3S H;  1FYK A;  1WI9 A;  1NH3 A;  1H9G A;  2FML A;  4KIC A;  4V19 K;  3ERM A;  4PFP A;  1K6Y A;  3DKY A;  3PJR A;  2VAS A;  5CLS A;  1IN4 A;  3LSJ A;  3OOU A;  4XLN F;  1LE8 A;  2K3P A;  3TW7 A;  4TV7 A;  3LQR A;  4MHG A;  2A6T A;  3M9A A;  3BCB A;  4NC7 A;  1MD0 A;  4O6J A;  1D1A A;  1P7I A;  2ELH A;  2Z1D A;  4AIK A;  2LF7 A;  3GCM A;  2EZL A;  2ZB9 A;  2L4M A;  2OPT A;  3M07 A;  1VZ0 A;  1P4W A;  4P96 A;  3HOX J;  5LGN A;  2IXS A;  2L4A A;  1WFX A;  4A3B J;  3Q0U A;  1WI3 A;  4IOC F;  3EUA A;  2FBI A;  2L54 A;  3ECO A;  4P9U A;  3G1M A;  1KU3 A;  2VE8 A;  2Q2E B;  2VQH A;  2QQB A;  1DUX C;  4NC8 A;  3H9G A;  5FLM J;  1FTT A;  2DTR A;  4Y13 A;  4LK1 F;  2RC4 A;  1G59 A;  2R7R A;  1R58 A;  2R7Q A;  4A12 A;  4IHV A;  4D1Q A;  3K1P A;  4ZJZ A;  1IRX A;  4HAM A;  4FT8 A;  4BKX A;  1A31 A;  1S9H A;  2XHK A;  4I09 A;  1XGO A;  1XG1 A;  2F2E A;  3KZY A;  2JQ7 A;  1FTZ A;  2CW0 F;  2DA6 A;  1Z21 A;  3KET A;  1O3S A;  2EH3 A;  4UNO A;  5EGO B;  1ULY A;  3BTC A;  2VPL A;  1PDN C;  3AAF A;  2M2E A;  2H1L A;  2PJR A;  1HF0 A;  1X1C A;  3P9C A;  4DJA A;  3RZD J;  2NRA C;  4L0Z B;  1SD6 A;  3MZH A;  2JVH A;  5DM7 F;  3H0D A;  3AKZ A;  2KT0 A;  3QU6 A;  5E18 F;  3JRD A;  5HDK A;  2QM3 A;  3JRH A;  2ZJQ F;  3S1N J;  2QBY A;  3KZI C;  5H20 A;  3HM5 A;  2XVC A;  2RGV A;  4KJZ A;  3ASO H;  1G4D A;  3GVA A;  2JA7 J;  3K2A A;  1IN5 A;  4HDV A;  5J40 A;  1J59 A;  3S16 J;  3L2R A;  2OBP A;  3KX2 A;  2FRH A;  3WU0 A;  2R4G A;  5CKT A;  5LLQ A;  5AIP A;  1WJC A;  2IS4 A;  4NHJ A;  3CF5 F;  4L9V A;  3BZK A;  3BWG A;  4LMY A;  4ENM A;  1EKE A;  4IOA F;  3HJE A;  1Z6T A;  5BMZ A;  3HOU J;  3WU2 C;  5JHU A;  3A02 A;  1D8K A;  1W5C C;  2W82 A;  4R1H A;  1O3R A;  2VJ4 A;  3MKZ A;  2PI0 A;  3DTI A;  1GVJ A;  2HR3 A;  3FXM A;  1MBE A;  2KIM A;  4CCK A;  2XPU A;  2LKX A;  5FKO A;  4F92 B;  4EJU A;  1LEB A;  1YLF A;  2D1V A;  1R49 A;  4G12 A;  2DT6 A;  1BIA A;  2WAF A;  3CCR I;  4A3F J;  2MH9 A;  3HSF A;  1W5S A;  4Y33 A;  1ZK8 A;  1FMV A;  5GTI C;  2E2I J;  2P7C B;  4BXX J;  2BVM A;  1B6A A;  1XC5 A;  1XSX A;  4HF0 A;  1ETO A;  1B1B A;  3U2R A;  1I1G A;  3ZN1 A;  4UY8 I;  4YIF A;  3IAS 2;  3KP2 A;  4NQW A;  2DJI A;  3REO A;  3U21 A;  2NVU B;  4LG0 A;  3PL8 A;  2HFH A;  1REP C;  2A69 F;  2DO7 A;  2K9S A;  4ESB A;  1X58 A;  1WJF A;  1HKQ A;  3WTU C;  3CLQ A;  2K9L A;  1OCO H;  2W85 A;  3IWF A;  2QZ8 A;  4II2 A;  2CQK A;  3MKW B;  1W0T A;  1DQU A;  2CQX A;  3ZXS A;  1OCR H;  3ABL H;  2KRF A;  4XL9 A;  4C3I J;  1MBH A;  4WK8 F;  4J01 A;  3KEY A;  2IRF G;  4X6A J;  2XAF A;  4HF1 A;  2LOO A;  2QQ9 A;  4J00 A;  3OYG A;  1JHF A;  4YG2 F;  4I2O A;  4EGZ A;  4IQJ A;  4N4O B;  3ZRG A;  2KIF A;  5ICF A;  2EB7 A;  4RAF A;  2GOX B;  3K4K A;  2DK8 A;  4IHT A;  1FYM A;  1VQP I;  3AG1 H;  1PVE A;  1HXD A;  1SFE A;  2M3A A;  4DGW B;  1X19 A;  4X0G A;  4ZTJ A;  3WG9 A;  1QNT A;  1GDT A;  1VQ8 I;  1DDN A;  4ON0 A;  1LNW A;  1X1P A;  3FHZ A;  3CUO A;  1STZ A;  2Z9O A;  1IO2 A;  1YX3 A;  2HU9 A;  4IX7 A;  5TGT A;  1ZYR F;  3MN2 A;  2IEK A;  1TBX A;  1TWH J;  3HEF A;  3JW4 A;  2VL8 A;  5FJ8 J;  1XD7 A;  3JRB A;  2Y9Y A;  2Z2S B;  1LFU P;  3F23 A;  3TGN A;  2E34 A;  2XAU A;  4C2M J;  5TIS C;  4CZZ A;  1YHQ I;  2OD5 A;  1RR8 C;  2XB0 X;  2W57 A;  5FRN A;  3DCF A;  4PSW A;  4BAC A;  1T95 A;  1PUF B;  1FOW A;  3KFW X;  5F64 A;  3CCU I;  4G7O F;  3PNT A;  5BS6 A;  2KIS A;  1X3W B;  3WOD F;  4BS9 A;  2UXX A;  4Q4Z F;  4IKF A;  3S93 A;  1ZG5 A;  3VSK A;  4G6Q A;  3CJT B;  1BI3 A;  3I54 A;  5A2Q Z;  2TCT A;  2P81 A;  5L3D A;  5H6Q A;  5IP9 J;  2RVC A;  3CTA A;  1FP2 A;  1R23 A;  3HRM A;  2DMN A;  2MYS A;  1PUE E;  2EFP A;  1A6Q A;  2E5N A;  2Y9Z A;  3RIR A;  2CH0 A;  2XIG A;  2ZME A;  2JJ7 A;  2DOF A;  2L2O A;  2EV6 A;  2HQN A;  2DT7 B;  5FRM A;  3R60 A; 
#chains in the Genus database with same CATH homology
 3JRC A;  3JRI A;  3Q3S A;  5IP7 J;  5EGO A;  5M5W J;  5J1Y A;  4Y52 J;  4BBS J;  3ZQI A;  1MSE C;  1JUS A;  1Y1V J;  1PUF A;  4B1R A;  5M5Y J;  1FEX A;  2AHQ A;  3BR6 A;  2X48 A;  2DMU A;  3E7L A;  4A69 C;  2E2J J;  3PO2 J;  2R5Z B;  1POG A;  4DZP A;  3Q0W A;  4B4C A;  1IV6 A;  3D1N I;  4UUT A;  1HLV A;  5HOD A;  1JJ8 C;  3FKI J;  3HDD A;  2HXI A;  2WB1 N;  4JX5 A;  4RDU A;  1JUM A;  4C3H J;  4M3E A;  3O8G A;  2L7Z A;  2LR8 A;  3WHC A;  2XSD C;  4FCY A;  4XID A;  1JTY A;  2LVS A;  4JX6 A;  2M34 A;  1LE8 B;  1A5J A;  5F0C A;  2ECB A;  2EQR A;  4C3J J;  4D7N A;  2EZK A;  1TWA J;  1ETY A;  3I4M J;  2DMT A;  3ZQL A;  5J1U A;  1RKT A;  4NDL A;  5C4J J;  3TP0 A;  1CQT A;  1OFC X;  1SAN A;  2ME0 A;  5K7F A;  3JRG A;  1NK3 P;  2XGC A;  2R92 J;  1I3Q J;  1RR7 A;  1U78 A;  4M3B A;  1B8I B;  1ORK A;  1H88 C;  3GTK J;  4BY7 J;  1JGG A;  4RBO A;  2K9N A;  4IHY A;  1BL0 A;  3FIW A;  1VI0 A;  3A03 A;  4BBR J;  1F43 A;  2XB5 A;  3ZQG A;  3JR9 A;  2DA4 A;  4X1E A;  4EEF G;  4A3M J;  3G1L A;  4JP0 A;  4XRS G;  3VPR A;  2LY9 A;  3BTI A;  1DU0 A;  2H1K A;  2ELK A;  5IP6 A;  1NK2 P;  3NAR A;  2O8K A;  4M3G A;  1QRY A;  1H89 C;  2Y31 A;  1IC8 A;  2JN6 A;  1B72 B;  3BTJ A;  4A3L J;  2TRT A;  1B8I A;  1D5Y A;  5IOZ A;  3G1O A;  2NVT J;  4V2G A;  3S1Q J;  1GUU A;  1ZKG A;  5F0F A;  2OF7 A;  2JA6 J;  1TWC J;  3GTL J;  3BT9 A;  3K7A J;  3SFI A;  4QIW N;  3GTO J;  3HB9 A;  4L5E A;  1YRN A;  5FLV A;  5K7Z A;  4M3F A;  2FJ1 A;  1A6I A;  1BW6 A;  2ID6 A;  3ZQF A;  2R5Y B;  1IDY A;  4A3J J;  2DMQ A;  3BR3 A;  1MBJ A;  3C2B A;  2NOG A;  5DS9 A;  2GM4 A;  1IG7 A;  1JKP C;  2O7O A;  2WV1 A;  2X9D A;  5GPA A;  4BY1 J;  3OIO A;  4JX4 A;  4I6Z A;  2HOA A;  2MGQ A;  1OCT C;  1MH4 A;  1BJZ A;  3B6C A;  1MNM C;  3JRA A;  3HOV J;  1HOM A;  3WHB A;  5EZG A;  5FKL A;  1RKW A;  5FKK A;  3HOY J;  3S2H J;  2DN0 A;  5EG0 A;  1VFC A;  1RET A;  2WAQ N;  3BTL A;  1I50 J;  5M5X J;  4DW6 A;  4DYC A;  3BQZ A;  2XGE A;  1AKH B;  3A01 B;  2VKE A;  3IH3 A;  2CU7 A;  4LOC A;  4D5C A;  4XIC A;  5JLX A;  2ID3 A;  5M3F J;  3HKZ N;  1U8B A;  3IH4 A;  1BW5 A;  1MBF A;  3IV5 A;  4IHW A;  3LSP A;  2N8G A;  1IJW C;  2FQ4 A;  1WH5 A;  1QPI A;  1JKQ C;  1Z77 A;  2NVQ J;  1IRZ A;  2K40 A;  1HDP A;  2PMZ N;  3F0C A;  2LLK A;  3HGG A;  4A3C J;  4A3E J;  2EZI A;  1ZGW A;  1F36 A;  2XRL A;  4S0H B;  2VKV A;  1OJL A;  2HQ5 A;  3JRF A;  1GV5 A;  1ZTR A;  2M0C A;  4XRM A;  5EEA A;  2L9R A;  4MIM A;  3TW6 A;  1UHS A;  2MG4 A;  1E3O C;  4AC0 A;  2MSY A;  4JYK A;  3L1P A;  2R5Z A;  4XRS A;  1AKH A;  5IYC J;  5F27 A;  3A01 A;  1H8A C;  3H0G J;  1WH7 A;  2FD5 A;  1NTC A;  4CYC B;  5EZH A;  1RES A;  3BG9 A;  2B63 J;  2IAI A;  2R7Z J;  2DA5 A;  4FIS A;  3SDG A;  2LFB A;  3SJM A;  3M4O J;  1OCP A;  2Y30 A;  4Y7N J;  4A93 J;  2VPR A;  3HOW J;  9ANT A;  1U9O A;  2M9H A;  3S14 J;  2EBI A;  3NAU A;  2X6O A;  1EF4 A;  3TED A;  3LSJ A;  3OOU A;  3O8H A;  5E3L A;  1LE8 A;  3TW7 A;  2DTZ A;  3BQY A;  5C3E J;  2NVX J;  1ETX A;  3BR1 A;  5GP9 A;  1MBK A;  4GFB A;  3GTQ J;  1P7I A;  5IYB J;  2YUS A;  4MO7 A;  2EZL A;  2ZB9 A;  2EZH A;  2OPT A;  1JTX A;  4IHX A;  1FIA A;  3HOX J;  3UKG A;  2DA2 A;  3LSG A;  1G2H A;  4A3B J;  3Q0U A;  1WI3 A;  2LD5 A;  3G1M A;  2CUF A;  2XGD A;  3S2D J;  3ZOB A;  5FLM J;  3S17 J;  1FTT A;  1VND A;  1Q1V A;  2HOT A;  4V2F A;  4IHV A;  2Y0S N;  1BA5 A;  2CUE A;  4W1U A;  1SFO J;  3M3Y J;  4BKX A;  1Y1W J;  3Q0V A;  5C4X J;  3GTM J;  4QSH A;  1O4X A;  4QTR A;  2YU9 J;  3CQZ J;  2L7M P;  2K9Q A;  4MLO A;  3LSR A;  3RKQ A;  2ECC A;  3RZO J;  1FTZ A;  1XG1 A;  1IGN A;  2COB A;  2DA6 A;  3BG3 A;  3CCY A;  3ZQH A;  2EH3 A;  4B3A A;  2HDD A;  4W97 A;  5EGO B;  4A3I J;  2YS9 A;  3BTC A;  3BR0 A;  1S7E A;  1WGX A;  4AYB N;  4ABZ A;  1B72 A;  2L7F P;  2M2E A;  1HF0 A;  5K7H A;  3RZD J;  3BR2 A;  1GV2 A;  1HDD C;  1ETV A;  3GTG J;  4FE7 A;  1VF9 A;  5BNG A;  1JUP A;  2KT0 A;  3B6A A;  2DA1 A;  2L0K A;  3PO3 J;  3JRD A;  3JRH A;  1ETK A;  1K83 J;  3ZQC A;  3H3V K;  3S1N J;  5EYR A;  1IUF A;  5M3M J;  1TWG J;  3HM5 A;  1X2M A;  1JKO C;  4M3D A;  3K2A A;  2GLO A;  2JA7 J;  1Z0X A;  3OSG A;  2DA7 A;  3CMY A;  2R5Y A;  3S15 J;  5GPC A;  3S16 J;  4AUX A;  3IH2 A;  2D5V A;  3DEW A;  5FKM A;  2R0Q C;  2HOS A;  4UUS B;  2E2H J;  1JT6 A;  1X2N A;  1R9T J;  3HOU J;  2QF7 A;  4XK4 A;  1U9N A;  3A02 A;  1ZR4 A;  2VUM J;  1MSF C;  3HGY A;  2ME6 A;  2M8G X;  2CRG A;  3HOZ J;  4M6V A;  1MBE A;  4A3D J;  1FJL A;  1ENH A;  2XPU A;  2LKX A;  5FKO A;  1ETQ A;  4IEJ A;  1AU7 A;  1I6H J;  4G12 A;  2IBD A;  4A3F J;  1RPW A;  1ZK8 A;  2E2I J;  4BXX J;  1T33 A;  5FKN A;  2XPV A;  1XC5 A;  1ETO A;  1XS9 A;  3RQI A;  2GBY A;  2I10 A;  4UUS A;  5E3N A;  1LFB A;  1QVU A;  1TWF J;  3QPL A;  3LOC A;  1ZR2 A;  1AHD P;  2LTP A;  2KDZ A;  2HYJ A;  2K9S A;  5J3L A;  1X58 A;  3GTJ J;  1W0U A;  5F08 A;  5IOY A;  1P7J A;  1UMQ A;  3S1M J;  2LK2 A;  1W0T A;  5F0H A;  1WCM J;  2DJN A;  2E1O A;  5EF6 A;  4D5F A;  4J19 A;  2CQX A;  5JLW A;  4C3I J;  1MBH A;  4D7M A;  2JWT A;  2JA8 J;  5F04 A;  1HCR A;  4X6A J;  5E3O A;  3I4N J;  3GBG A;  1JJ6 C;  4CYC A;  2E19 A;  4DZJ A;  4A3K J;  1GT0 C;  1DU6 A;  1FIP A;  1YRN B;  1QVT A;  5IYD J;  1ETW A;  3QPS A;  2JMW A;  3MVP A;  4FTH A;  2G0E A;  1MH3 A;  2HXO A;  1GDT A;  2LP0 A;  1MBG A;  1ZQ3 P;  2FX0 A;  3TP3 A;  2Y2Z A;  2CQQ A;  3LNQ A;  3MN2 A;  3FK7 A;  5IPA A;  1APL C;  2IEK A;  2JA5 J;  1WPK A;  3HEF A;  1TWH J;  5E3M A;  3S1R J;  3JRB A;  5FJ8 J;  1TC3 C;  2Y9Y A;  2NS8 A;  1JT0 A;  2CJJ A;  4DYQ A;  2NVY J;  3CDL A;  3JRE A;  1LFU P;  4C2M J;  3PM1 A;  3MKL A;  2R93 J;  2XB0 X;  3BR5 A;  3DCF A;  1IDZ A;  2NS7 A;  3FIS A;  2HI3 A;  2XPW A;  1PUF B;  5F1J A;  2JK3 A;  2H8R A;  5EG0 B;  2QCO A;  2W48 A;  2RAE A;  3FK6 A;  2TCT A;  2P81 A;  2DA3 A;  2MW8 A;  5IP9 J;  5C44 J;  3GTP J;  2VI6 A;  2DMN A;  4MFD A;  4I76 A;  2Y9Z A;  1ITY A;  3QQA A;  4A3G J;  1UG2 A;  1T56 A;  4MFE A;  5DTD A;  2JJ7 A;  4HNV A;  2AO9 A;  4DYR A;  5J1R A;  3OSF A;  1GVD A;  1K61 A;  1JKR C;  2DMP A;  3HBL A;  2O9L A;  5EDN A;  4FE4 A;  3BG5 A;  3W6V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...