1WH5A

Solution structure of homeobox domain of arabidopsisthaliana zinc finger homeobox family protein
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
80
structure length
80
Chain Sequence
GSSGSSGSSAEAGGGIRKRHRTKFTAEQKERMLALAERIGWRIQRQDDEVIQRFCQETGVPRQVLKVWLHNNKHSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of homeobox domain of Arabidopsisthaliana zinc finger homeobox family protein
rcsb
source organism Arabidopsis thaliana
molecule tags Dna binding protein
molecule keywords ZF-HD homeobox family protein
total genus 15
structure length 80
sequence length 80
ec nomenclature
pdb deposition date 2004-05-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1wh5A00
2DA4A 1G2HA 2Y9YA 2RAEA 2JN6A 2E19A 2NVTJ 3M3YJ 4UUTA 3ZQCA 1ZR4A 2EZKA 2NVYJ 1ETYA 3S17J 1MH3A 5E3LA 5M3FJ 3TW6A 3IH4A 1PUFA 2P81A 3G1OA 4QIWN 3OSFA 3LNQA 5JLWA 4UUSA 1YRNB 2ME0A 3BTCA 3BR0A 1Y1WJ 3B6AA 3JRHA 3TEDA 1I50J 3HB9A 1IRZA 2CUEA 2LLKA 5GPCA 2LK2A 3DCFA 4BBRJ 2N8GA 2TCTA 3GBGA 2R5YB 4A3DJ 1OFCX 5J1RA 3LSGA 3CQZJ 2JJ7A 5IOYA 2DJNA 5C3EJ 1OCTC 5K7ZA 1GVDA 5F0CA 5FKLA 5GP9A 3UKGA 1P7JA 2DMPA 5IPAA 1ZTRA 4IHYA 1LE8B 1ZK8A 2ELKA 3B6CA 3BG9A 1CQTA 2XRLA 3IH3A 4AC0A 3HOXJ 1RR7A 5F0FA 1WH5A 3I4MJ 2XPUA 4JYKA 5F08A 3JRCA 4DW6A 3OIOA 5EF6A 5F0HA 5EGOA 1OCPA 3HBLA 2D5VA 1JJ8C 3SJMA 1MNMC 1IG7A 3TW7A 5M5WJ 3M4OJ 3RZDJ 2Y31A 2FJ1A 2XGCA 3K7AJ 4G12A 3H3VK 3S1QJ 4A3BJ 2H1KA 4IHXA 4MLOA 3RQIA 1MH4A 3NAUA 2I10A 2VI6A 2DMQA 4MIMA 4AUXA 5M3MJ 3ZQGA 4JP0A 2M2EA 4B3AA 1WGXA 3ZOBA 2R93J 4B4CA 2YUSA 3W6VA 1ETKA 3CCYA 5IP9J 1JT6A 2Y9ZA 1JGGA 2B63J 3GTMJ 3OOUA 2EH3A 2WAQN 2NVQJ 1T33A 2JA6J 5IYCJ 3D1NI 2JA7J 1X58A 1ETXA 3S2DJ 4W97A 3E7LA 4Y7NJ 2IEKA 4JX6A 3LOCA 5E3MA 2R0QC 2M9HA 3BR3A 1ZGWA 3BQYA 5JLXA 1ZQ3P 4Y52J 1QVTA 1RETA 2M0CA 3JRDA 1FTTA 1Z77A 4XK4A 3ZQLA 3GTKJ 4L5EA 5F1JA 3F0CA 3O8HA 4ABZA 4XICA 1O4XA 2DMNA 1VFCA 2Y2ZA 3MVPA 3IV5A 5IP6A 1P7IA 3JRIA 5DTDA 1JKRC 5FJ8J 3ZQIA 4IHWA 2GBYA 1WI3A 2OPTA 5J3LA 1XS9A 1TC3C 3QQAA 4A3GJ 4C3JJ 1EF4A 2CRGA 1JKQC 1BL0A 1UG2A 5FLMJ 2DA1A 5C4JJ 3QPSA 2MGQA 2XGDA 4V2FA 3JR9A 2O9LA 1ITYA 1BA5A 3CMYA 4X1EA 1W0UA 1TWFJ 4M3GA 4M3FA 1LFBA 2CJJA 4A3MJ 1DU6A 3BTJA 1IUFA 1B72B 2QF7A 3MN2A 2JA5J 2AO9A 2O8KA 4XRSG 3CDLA 5E3NA 4A3KJ 4FISA 3GTQJ 5EDNA 1R9TJ 3NARA 4A3CJ 2HOSA 5BNGA 1GV5A 1W0TA 1UHSA 4CYCA 5FLVA 5F04A 2NVXJ 4V2GA 1DU0A 1D5YA 2DA7A 2DA5A 3HM5A 1AKHA 3HGYA 3PO2J 1XC5A 2WB1N 2JWTA 4C3HJ 4DYRA 3C2BA 3PM1A 4A3IJ 3HEFA 2L7MP 1JUPA 2HDDA 3ZQFA 4A3FJ 5J1UA 2DMTA 4RBOA 2KDZA 3GTLJ 1I6HJ 1FTZA 2R5YA 1JTXA 3BR1A 3LSJA 1MBJA 5IYDJ 1X2NA 1Z0XA 2R5ZB 1B8IB 2O7OA 3HOYJ 2LR8A 1PUFB 3GTOJ 2EZHA 1ETOA 2DMUA 5DS9A 1YRNA 1ETWA 2XB0X 4D5CA 2ECBA 1MBEA 2LP0A 1MBKA 1VI0A 3Q0UA 1TWGJ 1I3QJ 5M5XJ 4A3EJ 1ORKA 5C44J 1HF0A 2M8GX 1GV2A 2L0KA 4MO7A 1TWCJ 1JT0A 2ID3A 1E3OC 2YS9A 4DYCA 4M3BA 1AHDP 1HDDC 2AHQA 4FCYA 1NTCA 1Y1VJ 2Y30A 5EG0B 3A01A 1IGNA 3SDGA 3BG3A 1SFOJ 4J19A 2GLOA 2EQRA 2CQQA 2E2JJ 2MSYA 4XRSA 1GDTA 1IDZA 2XSDC 3L1PA 1BW5A 2JMWA 1U8BA 2M34A 4IEJA 5M5YJ 3JREA 1QVUA 5EGOB 1XG1A 1MBFA 4I6ZA 2K9NA 3BQZA 3IH2A 5J1YA 2DA2A 1IJWC 1BW6A 4NDLA 3BTLA 3FK6A 1FJLA 3HOZJ 1TWHJ 1U78A 1F36A 2HOAA 4FE4A 2H8RA 1HDPA 2E2HJ 1GUUA 4S0HB 1ETQA 2L7FP 2HXOA 2FQ4A 3SFIA 2R7ZJ 2ZB9A 1ZKGA 1VNDA 3MKLA 5EYRA 1LE8A 5FKOA 4A69C 3HKZN 2JA8J 4HNVA 2DTZA 5EEAA 1POGA 2L7ZA 3DEWA 2EBIA 1RESA 1RKWA 2X48A 5FKNA 2LY9A 3S16J 2FX0A 4GFBA 1K61A 2GM4A 1QRYA 4B1RA 2R5ZA 4AYBN 1B8IA 5EZHA 5K7HA 3ZQHA 3JRGA 1U9NA 1T56A 1FIAA 4A3LJ 2ME6A 9ANTA 2HXIA 2COBA 3BT9A 4M6VA 4A93J 1NK2P 2L9RA 1IDYA 3I4NJ 1B72A 2DA6A 4C2MJ 3BR5A 5IOZA 1AU7A 1UMQA 2ECCA 4RDUA 4MFDA 4JX4A 2LTPA 1H89C 4QTRA 4BY1J 2NOGA 2CQXA 3Q3SA 1JJ6C 2LFBA 5GPAA 5HODA 1IC8A 2PMZN 2R92J 1HCRA 3A02A 5EG0A 3K2AA 1JUMA 3HGGA 2LKXA 4MFEA 2K9SA 1K83J 3TP3A 2NS7A 3G1MA 2CU7A 2VUMJ 3H0GJ 1IV6A 2HQ5A 1AKHB 1JTYA 2G0EA 2ID6A 1JUSA 3BG5A 3Q0WA 1ZR2A 2VKVA 4BBSJ 4D7NA 3GTJJ 3GTGJ 3Q0VA 2VKEA 2Y0SN 2DA3A 2IBDA 3JRBA 2EZLA 1JKOC 1BJZA 3BR6A 1RPWA 2QCOA 4BY7J 4IHVA 3S1MJ 5K7FA 3LSPA 1Q1VA 3TP0A 4DYQA 2HOTA 4UUSB 1APLC 3S15J 1X2MA 2HYJA 4D7MA 3VPRA 3WHBA 5E3OA 4XIDA 5IYBJ 3BR2A 1MBHA 3O8GA 1NK3P 2FD5A 2YU9J 1QPIA 2X6OA 5FKKA 1ETVA 4CYCB 1SANA 1MSEC 3HOVJ 3FIWA 2LD5A 1MSFC 4A3JJ 1A5JA 3S1NJ 1WH7A 4EEFG 3QPLA 3FISA 5EZGA 2NS8A 4C3IJ 3RKQA 3JRAA 1LFUP 2X9DA 4FE7A 5IP7J 1F43A 1FEXA 1OJLA 1GT0C 2KT0A 1FIPA 3FK7A 3BTIA 5F27A 2HI3A 3OSGA 2K40A 4DZJA 2E2IJ 4DZPA 1WCMJ 4D5FA 3FKIJ 2OF7A 3A01B 1HOMA 1S7EA 1TWAJ 2XB5A 3JRFA 4QSHA 1MBGA 2CUFA 4I76A 3LSRA 5C4XJ 1U9OA 4BXXJ 1H88C 1ENHA 2EZIA 4XRMA 4W1UA 2JK3A 4JX5A 1WPKA 3RZOJ 2XGEA 5FKMA 1H8AC 3A03A 3HDDA 2K9QA 2XPWA 4FTHA 3S14J 2TRTA 2WV1A 2XPVA 4X6AJ 3S2HJ 2E1OA 4M3EA 2IAIA 3WHCA 3S1RJ 2W48A 4LOCA 1JKPC 3GTPJ 1RKTA 2VPRA 2DN0A 1A6IA 2LVSA 3HOUJ 2MW8A 1HLVA 3PO3J 1VF9A 3G1LA 3HOWJ 4M3DA 2MG4A 4BKXA
chains in the Genus database with same CATH superfamily
2L54A 2CO5A 1X3UA 2RAEA 3M3YJ 1M1EB 2L4AA 1KQ0A 3G3ZA 4ITVA 1ZR4A 2EZKA 3LWFA 3IWZA 2JUGA 4ZJZA 1R00A 1MH3A 1E0EA 4E7HA 3F6VA 3TW6A 3ABTA 1XSVA 3IH4A 3SDBA 3LNQA 3T0YA 5GTHC 1YRNB 5L3BA 2X1EA 2EB7A 2CQKA 2KZGA 1OR7C 3BJ6A 3BR0A 3DXJF 3E6MA 4KMUX 1I50J 3T1BA 2A68F 3FWEA 2BY3A 3OYMA 4RGSA 3J80Z 1O7LA 3GUDA 2FSWA 2BXZA 1NH3A 1A31A 5GPCA 1F9NA 1OPCA 1I27A 1TQIA 4IHTA 4A3DJ 3LSGA 1V55H 5IOYA 1OCTC 1IXCA 1XGMA 1JE8A 4PGHA 3WU0A 5IPAA 2X51A 3RKYA 1VQ5I 3J7ZI 1QQIA 1ZN2A 1XDUA 1XCBA 3BG9A 4CCOA 1CQTA 2M30A 2XRLA 4PJLA 3VYRB 4AC0A 1RR7A 3ESWB 3J7YJ 3F72A 3M07A 4KFCA 3QPHA 3DP7A 5F08A 3GXOA 2IGKA 4M6XA 2DOFA 3P9KA 5HLTA 4LFUA 1X3ZB 2YPRA 1IG7A 1FOXA 2X1DA 4YIFA 1YJNI 2Y31A 4WK8F 1SFXA 2FJ1A 2XGCA 3FM3A 2ZMEC 3S2WA 3M1CA 4G6TB 2XROA 5CYVA 1U5TB 3S1QJ 2H1KA 3ZCOA 4PSWA 4IHXA 1V5EA 4MLOA 2M45A 4XORA 1UHMA 2KJBA 3RSNA 3NAUA 2I10A 2VI6A 5D5WB 1ZARA 3DV8A 3PUBA 1Z3YA 2BY0A 3TMOA 1QNTA 4AUXA 4DIQA 5LHHA 2JA2A 1VQOI 2QKMB 1WRJA 3ZOBA 4OMZA 3W6VA 2KKOA 5FLXZ 2A5YB 4A0ZA 4LB6B 2GOXB 4H0EA 1L0OC 4OOIA 4XLAA 1JGGA 4F92B 5K1YA 1BOBA 5HNFA 4L0ZB 2W57A 1SMYF 5B3SH 1T33A 5D4RA 3K10A 3O6BB 3D1NI 2JA7J 3CC2I 2CSOA 1ETXA 4RGUA 3COAC 4Y7NJ 2IEKA 2G9WA 1O57A 2K4JA 1S7AA 4KDPA 1ZQ3P 3BWGA 1RETA 2M0CA 3FMSA 3JRDA 1FTTA 2DQLA 1WZ2A 2F5DA 2V1XA 4CH7A 1TL8A 2R7FA 3H5RA 5LGUA 3ZQLA 3GTKJ 4L5EA 4IOCF 3E6CC 1O4XA 1EA3A 1QZZA 3U1KA 2IA0A 3MVPA 5JFRA 4FX4A 4ZDPA 1LVKA 3HUGB 5H2FC 3GYHX 1QPMA 3J7AO 2HWVA 1TC3C 1HKTA 1W36D 3K6GA 3QQAA 2FBKA 2IW5A 3BZKA 4A6DA 4ZDOA 3LMMA 5FB2A 3WTWC 3RKXA 2F5VA 2HTJA 3T8RA 2E7XA 1EF4A 3KPHA 3I55I 1BL0A 1A36A 2QWWA 2DA1A 2F2EA 5C4JJ 2ZJQF 1N75A 5J8FA 2XGDA 5CKTA 3JR9A 2M7BA 2WAEA 4PK4A 2RQPA 3CDIA 5B5EC 4X1EA 1EH6A 2P5VA 1W0UA 2K02A 3EQLF 1LFBA 2ESHA 5DV5A 1Z21A 3BJAA 3BY6A 2ZNYA 1FBUA 2Z3YA 1ZRFA 3GFJA 3R6SA 3PFYA 4CZZA 5E3NA 1T08B 1E3HA 1QHHD 4HF1A 1JI8A 1R9TJ 2HOSA 3GEZA 5BNGA 1FP1D 3B73A 2VE8A 4A5MA 1DGRM 1YIOA 3LQQA 1TZLA 2VBXA 2VKHA 4KJZA 1IRXA 4M6YA 2IXSA 1S7OA 3DPLC 2W00A 1T0FC 3ZMDA 3PO2J 5ILVA 2RV8A 2PI0A 2JWTA 3K1PA 1V5FA 3OYIA 2XAHA 4XKWA 1HW1A 3U9GA 3OIPA 2D45A 3HKZA 1IRGA 4HOBA 4HSRA 4ON0A 2JPCA 4A6EA 2VIXA 1PUEE 3HRTA 2JSPA 3V7SA 4A3FJ 3GTLJ 1MGTA 1P4WA 1Z6RA 3LA3A 2R7QA 1U2WA 1XCVA 1JTXA 2R5YA 4ENMA 1CF7A 4BQNA 1HKSA 5JHFA 2XAUA 2Q1ZB 3H9JA 2O7OA 2PN6A 4I0BA 1B59A 5JHUA 2EZHA 1ETOA 4OWRB 3O2PE 2Z1DA 3V42A 1YRNA 3I0TA 1OKRA 4IJAA 3WTVC 3E6DA 4HDVA 1O3TA 2CV2A 5BOXA 1MBKA 4P5OA 1VI0A 2OCEA 4AIJA 1I3QJ 5M5XJ 3REOA 1FMVA 4AWXB 5GADJ 3L9FA 2M1BA 3H5AA 3WTUC 1E3OC 1EH7A 1AHDP 3FDYA 4M3BA 4ESBA 4U0WA 4XSXF 1Y1VJ 2Y30A 4E7SA 2VE9A 2DO7A 1K78A 4B8XA 2GWRA 2GLOA 1IUYA 2CQQA 3P9IA 3GMEA 2OZUA 2F5FA 4AIHA 3L1PA 5HVQC 3L2RA 1MDMA 3KZIC 1BW5A 4IEJA 2DXIA 4KT5C 2VJ5A 5EGOB 1XG1A 3K4MA 2KRCA 3LA7A 3BQZA 3IH2A 3KYCB 5J1YA 1FOYA 1W7PB 1FZPB 3TKYA 1J7KA 1FWZA 1ZLJA 4I02A 2DA2A 1RZ4A 1SD6A 1RI7A 3CMEI 3D5RC 3MEXA 4NDLA 3HOZJ 3EYYA 2P7VB 2KHMA 1F36A 2HOAA 4F91B 1FSEA 4FE4A 4R1HA 1T95A 2H8RA 3F8MA 5A2QK 4M73A 2L7FP 2W7NA 2FQ4A 2R7ZJ 3BDDA 3K1MA 3FXUA 5LLQA 2HYFA 3HKZN 5LFAA 1B1BA 3DKXA 2O5RA 5EEAA 1POGA 2JTVA 3DEWA 2EBIA 1SVLA 3HHHA 2XC7A 1RESA 1SAXA 1FYMA 1TT0A 2JQ7A 2O03A 2CGPA 2FX0A 2AS5F 2XHKA 2MH9A 3PNYA 4YRVA 2HTSA 2R5ZA 4B1RA 2P5KA 5KNLA 2F48A 4PZJA 3W6JB 1B8IA 5A2QZ 3ZQHA 2NOJB 3HRMA 6PAXA 2KIMA 2DJIA 1YJWI 1H0MA 1U9NA 1T56A 1TQPA 4I2OA 4A3LJ 1USSA 3L7WA 2M4KA 9ANTA 1J0RA 2COBA 2FMYA 4GYGA 3GCMA 5E1WA 4NC7A 5L3GA 2ZSHB 1NK2P 2L9RA 3CCSI 2CV0A 4HYEA 1B72A 3JCUC 2ZMEA 5D8KB 5JVGF 4C2MJ 4LB5A 2W24A 1Y6IA 1LVAA 1OR7A 1YS6A 2D1VA 3IAM2 4A0XA 4EJOA 4JX4A 3WE2A 3CCMI 3TDUC 1SAUA 2CQXA 5HDKA 4ZDLA 2FUG2 1R5HA 4KIFA 5GPAA 1HCRA 3A02A 5EG0A 5DCFA 1JUMA 1BI3A 2GZWA 4OMYA 1TW2A 3G1MA 1U0JA 1R1TA 4G94A 3LSMA 2AXLA 2QA4I 3C1DA 2VUMJ 3H0GJ 5AIQA 4UXNA 4F93B 2HQ5A 3OWTA 2FOWA 3LFKA 2ID6A 1ZR2A 2QLZA 1J9IA 1RUNA 4ASNA 4D7NA 2IRFG 4LLGF 3ZGKA 3CUOA 1G3SA 4BACA 3JRBA 3NEUA 5BS6A 2CH0A 2WAQA 4HAMA 3KP6A 2HVQA 4CCNA 3EUHA 1TBXA 4IRHA 2X6XA 2Y48A 1EJ9A 1X3WB 3CCRI 2ELHA 1Y0NA 5DD8A 4UUSB 4WX9A 4D7MA 4ZYDA 2BHYA 3TGNA 3OYKA 2LG4A 3S3MA 1NK3P 1IN5A 2X6OA 5FKKA 1ETVA 1MSEC 2XF6A 1TQMA 4A3JJ 1XGOA 3S1NJ 3TBIA 3K4JA 4EEFG 3RPUA 1P4AA 3JRAA 2ISYA 5IP7J 1FEXA 1BR4A 5CQGA 1FIPA 4G9YA 4YEJA 3DKYA 2HI3A 3OSGA 1YITI 4DZJA 2VQGA 5B1BH 3PJRA 1MMDA 3WODF 4JBAA 2IJLA 1YJ9I 2XB5A 2ZC2A 1MBGA 2CUFA 2AQFA 3MZ8A 2R4GA 2ZMEB 1MD0A 4YFNF 2HPIA 3BJOA 1P4XA 1V4RA 2EZIA 3BG6A 2JK3A 4JX5A 3IKTA 1WPKA 1BI2A 1F1ZA 2XGEA 4IL6C 4BEHB 3RZOJ 1E17A 2VT2A 2M8EA 3CCJI 1OCZH 2XPWA 2K9QA 2M4GA 5L3DA 4HF2A 1R22A 2TRTA 2LYCA 4II2A 3HPGA 3TOBA 3H9QA 4IXAA 4KITB 2IA1A 1W36C 3WHCA 3DPTA 3B02A 4LOCA 4R79A 1JKPC 2D2WA 2RDPA 3MFKA 3CP2A 1A6IA 4FHTA 4RS8A 1HLVA 2IGOA 4NC8A 1VF9A 2VL8A 2LH9A 4BKXA 2DA4A 1G2HA 3P5JA 2JN6A 2K9LA 3SEZA 3LSIA 1T8IA 2X6WA 1ZREA 4UUTA 3ZMSA 3H1CA 1ETYA 2UZKA 4LGWA 4RLFA 5E3LA 5HS9A 5M3FJ 1YW8A 3I59B 3FXRA 1PUFA 1FMWA 1KU7A 1TW3A 3G1OA 4QIWN 4OIQF 2XIGA 2X6YA 4EM2A 1USTA 2ME0A 3B6AA 3JRHA 1IRZA 3LSKA 1FYKA 5D6EA 5ICGA 1QZYA 3IKVA 2L9VA 3DCFA 1QZEA 4BBRJ 1Y8QB 4N0BA 2QBYB 3GBGA 2R5YB 2FU4A 4OAZA 2LKSA 3W3CA 2JSCA 5F0CA 2OZ6A 3ECHA 5GP9A 4IKFA 2LREA 3ZQ7A 1P7JA 2QKLB 5ED4A 2JVGA 4BXUA 3B6CA 4UVBA 2FRHA 1N25A 1J2XA 1BC8C 2P6TA 2O0YA 1FY7A 1WH5A 3GW2A 4XLEA 2QENA 2XPUA 3QU6A 1W1WE 1KGSA 2A3SA 4DW6A 3OIOA 1IRFA 1QGPA 5F0HA 5EGOA 2PX9A 4L9NA 1OCPA 4XMYA 1DPRA 4LK0F 3HBLA 2D5VA 4PFPA 2Y0SA 2EWNA 3GX4X 1W7PA 3CJQB 4OIPF 3S93A 1WWXA 3ZP5A 1MKMA 2DT7B 1S5LC 3GO5A 1B6AA 3HSFA 3CO7C 2EIJH 2GA1A 4R8HA 4DBRA 4KIBA 4G12A 3S3OA 4A3BJ 4PGGA 3JW4A 1FNNA 2KZVA 3CF2A 5M3MJ 3I64A 3ZQGA 2K3PA 2R7UA 1TP4A 4GXOA 4CCMA 3KIOA 2VC0A 2RVCA 2YUSA 3MKWB 3ABLH 5BPIA 1BJAA 3LSHA 3VWBA 1JT6A 3IWFA 1ODDA 2B63J 4BJ5C 3PFIA 2E71A 1R6RA 4UUVA 1Z6TA 2HZDA 4QPQA 4XLPF 3I59A 4CICA 2HDWA 2IT0A 3BPVA 3E7LA 3WE3A 2XKPA 4JX6A 2M9HA 3IHUA 4N4NB 3NQOA 3J81K 5HS7A 1J09A 2MLGA 3E5QA 4XK4A 1FOKA 2FF4A 1OYWA 2NYXA 5FFZA 2COMA 4KUMA 1O7FA 2NXNB 2DMNA 4ABZA 4XICA 2R7RA 4BE2A 2GXAA 3R4KA 1REPC 2CWEA 2PJPA 1DP7P 2Y0MA 2KRFA 5FJ8J 1D0XA 3CJNA 4IHWA 2OPTA 4PJ0C 1IW7F 4MEXF 1A6QA 4LG0A 1ZG5A 2A61A 3A4CA 3H0DA 2EFQA 2WY8Q 4XL9A 2HZTA 1LFPA 1UG2A 3ABUA 5FLMJ 3QPSA 3DBHB 4CXFA 3DWLE 3LAPA 1DQUA 4V2FA 2EA2A 3HG9A 3K0LA 2RN7A 2O9LA 5CQEA 4B09A 2VASA 3BLYA 5F64A 1ITYA 3RPQA 3ZMUA 5FD5A 2R7SA 1HW5A 4A3MJ 4M71A 5E18F 1B9MA 3L00A 1IUFA 3ZMTA 2ZXIA 2QQBA 3MN2A 4BHCA 2JA5J 1IN6A 1ZHFA 2NVUB 1JXSA 2HKOA 4HLXA 3FX3A 4FISA 2CFXA 3CUQC 3VDXA 4A3CJ 4EMSA 2IVMA 5DDGA 3JAMK 3E5XA 4O5VA 4CYDA 2LBFB 2M5WA 2FEZA 4XKBA 1R23A 2E35A 1D5YA 5CVRA 1AKHA 2O3FA 3HGYA 1IF1A 1UHWA 4UVCA 3O3KA 4LD5A 1AWCA 3DTIA 3CC7I 1JUPA 1ZELA 3L2QA 2HDDA 2IS6A 4IHSA 3ZQFA 2MH2A 3C7JA 1BI1A 1WHUA 3WG9A 4F3QA 1LEBA 4EQQA 4UVAA 4FT8A 1XSDA 1R71A 1QU3A 1X2NA 3FXMA 1WVRA 2LC2A 2OTLI 2OBPA 4F7ZA 1IO2A 3RQ4A 2QZ8A 4KA4A 3FBNB 2LR8A 1PUFB 1XGSA 3GTOJ 2Z16A 3AFHA 1IN8A 5LBQA 2DMUA 5DS9A 4MNUA 1I1SA 1ETWA 2A05A 4Q48A 3ZRGA 2HNHA 2K9MA 2MLKA 3WGGA 4RAGA 2DCEA 2ECBA 2WB1A 2LP0A 2E34A 3OYLA 3PSIA 2IPQX 2R7VA 4GDFA 1TWGJ 2Z99A 3AL0C 1N77A 4UNOA 3W2WA 2JRTA 2HS5A 2L0KA 3C2HA 4MO7A 1TWCJ 3H5NA 2ID3A 3V8KA 5DCMB 3OYHA 3C3WA 5GTIC 1RC9A 4DYCA 2G7HA 2AHQA 3G73A 4FCYA 1NTCA 1I5ZA 2XF7A 1PDNC 1ZGJA 3HHGA 3A01A 3BPXA 1IGNA 5ICEA 3SDGA 4QLCU 3BG3A 4GCVA 4F52A 4J19A 1K6YA 2EQRA 1GLNA 2H1LA 2EA4A 2H6CA 2KIQA 3BCBA 1S29A 4Y17A 1VQ9I 1IDZA 4XRSA 4NHJA 2XSDC 2CMPA 2JMWA 1YO5C 4RA2A 4XLNF 4XRFA 3I56I 3QOPA 3OYAA 3JREA 3V4GA 3F8BA 2K3FA 1KA8A 2ZXJA 3LQRA 3V8LA 1HA8A 1HXDA 3C18A 2FMLA 5FO5A 1W7PD 3FK6A 2K27A 4L18B 4RAYA 4E7JA 3KZYA 3KCCA 3OYJA 2EIKH 2QQ8A 1VQMI 1A04A 4NUBA 2E2HJ 3SFIA 5HNHA 2OQGA 2XRNA 2ZB9A 1ZKGA 1VNDA 5EYRA 1LE8A 2NAZA 5FKOA 1VQNI 5ILUA 2BBYA 1RKWA 1UB9A 2X48A 1J75A 2K5CA 4RB0A 3S16J 4GFBA 1K61A 5GAEJ 4E70A 2STTA 1WJBA 1YTYA 1QRYA 2QSFX 3ONQA 2OJED 1KQ8A 3OY9A 1FSHA 1O3QA 1MMGA 4AVZA 5E1ZB 5J4VA 3MWMA 2EFPA 2W4SA 2HPMA 2W1OA 5E79C 4ZYEA 1IN7A 3BT9A 4BQAA 4A93J 2CW0F 2R7OA 3OS2A 2P8TA 2BVLA 2DA6A 2DPDA 2XAGA 3RJPA 5IOZA 1BOAA 1UMQA 3F3XA 5DUIA 1OQYA 2ECCA 2XF5A 3CCEI 4MFDA 5KVRA 1T0FA 1H89C 4M9XA 3ZN1A 2QVOA 3Q3SA 2DU9A 2BW3B 2KISA 2STWA 4CCLA 2LFBA 5AIPA 2R92J 2PMZN 4BDZA 2EIMH 2WC2A 2L4MA 3M8FA 4L5IA 3K2AA 3VYTB 2JZYA 4U87A 2ETHA 4MFEA 2K9SA 1K83J 3PL8A 3RYPA 4G6DA 1VQ4I 2IS4A 3DTKA 4EM0B 3DPUA 4XN3A 5FROA 2BZTA 2XGXA 2VKVA 1G3YA 4BBSJ 2PQ8A 5FGMA 1LQ1A 5TJJA 5HDNA 5LRRA 1JGSA 1D0ZA 1BJZA 4HG2A 1Q1HA 3SZGA 4BH9A 2CQ7A 4HZFA 1EV7A 3VOEA 3R0AA 1Z67A 1APLC 3S15J 2HYJA 2FBHA 2VKDA 1AA7A 2MD5A 3VPRA 3CDHA 2DW4A 2WA0A 2DK8A 3O8GA 5BMZA 1FC3A 2XSJC 2DI3A 1SFEA 1QPIA 4Q5SF 5D5XB 4WWCA 3RTRA 3IC7A 2LD5A 1DP3A 3V8JA 2HFHA 2ZKZA 4WCGA 5EZGA 3FISA 1E2XA 3RKQA 1ACIA 2LF7A 3U1DA 5J6XA 4FE7A 1F43A 4BXFA 2GIVA 1Z05A 4N9IA 1OLTA 3I58A 3BTIA 2HGCA 3HUGA 5F27A 3BC8A 2E7WA 3TDZC 4L9TA 2K40A 3DF8A 3I53A 4DZPA 3GZ5A 3A1YA 4KMFA 2BYVE 3KEOA 2OQRA 4ANJA 3FKIJ 1MJAA 3CZ6A 2OF7A 3PIPF 1XGNA 2L02A 1T2KA 1HOMA 1TWAJ 2VXZA 4ZYHA 3JRFA 4ETSA 1K6OA 4I76A 5C4XJ 5B66C 3M1EA 3F23A 3FM5A 3DLLF 5IT9K 3DQVC 3QP5A 2V9VA 1H9TA 4W1UA 2E1MC 3K70D 2A6TA 3DKWA 4U7BA 2VQLA 3VB2A 3F21A 2L5QA 3F9KA 2KIUA 1VQPI 3F22A 2A69F 1G3WA 3RPUD 1BIBA 5J47A 4FTHA 1K4SA 4X6AJ 3S2HJ 4AIKA 1BR1A 3S1RJ 2W48A 3X2QH 1HBXG 2R3SA 2W85A 5FFXA 1VQ6I 3BG7A 4J01A 2LVSA 2MW8A 3BZCA 3G1LA 3IRQA 3IRRA 5DCMA 3J81Z 4M3DA 2MG4A 1W5CC 2HEOA 3OOPA 3HC7A 4B44A 1KYZA 4MQ9F 3N4MA 4L0YB 2E19A 2NVTJ 1U8RA 3OYEA 2V4JC 5EEGA 1HSTA 1ZYRF 2XAFA 4LITA 2MFZA 3S17J 2Z33A 3L2VA 2YU3A 1FOWA 2P81A 3OSFA 4JOMA 5JLWA 2KIFA 3T8TA 1TT5B 4UUSA 4XOTA 3BTCA 1D8JA 4NNJA 2XUBA 5B1AH 3KE2A 4KISA 2Q8KA 3AG2H 2MC3A 1B4AA 4KN7X 5K5RA 2CUEA 2EILH 2GXGA 4BHPA 2BHZA 3MD2A 1W4MA 4PCQA 2LK2A 4RB1A 1MW7A 2N8GA 2CUJA 2TCTA 2PEXA 3TO9A 3G4SI 5J1RA 4MTEA 2JJ7A 5K7ZA 1GVDA 2EK5A 3ZXSA 1RNLA 2DTRA 1YQAA 2OUMA 4HX8A 4IHYA 3ISPA 1LE8B 1ZK8A 2ELKA 1P92A 2VQHA 4WXCA 4LK1F 3IH3A 4M9SA 5TISC 3HOXJ 4UV8A 3RI4A 3I4MJ 2B9SA 3JRCA 1BC7C 3EETA 4U0YA 3SJMA 1MNMC 2VPLA 4NC6A 2NNYA 1I6XA 2BGCA 3TW7A 1R1UA 5M5WJ 4IRIA 3RZDJ 2CFOA 4EJWA 2W82A 4BS9A 3AG1H 3SYTA 3E3VA 3DTEA 2OC6A 1LDJA 3OYDA 5IT3A 1YE9A 3H3VK 4F55A 2E36A 3FXQA 2R7TA 3F8NA 3QP6A 5TRDA 3RQIA 1MH4A 2JVHA 2KP6A 3FHZA 1TNSA 3N05A 4BQOA 4Y3OA 1WJCA 3JTGA 3CD6I 3HTSB 4NQWB 1FP2A 2M2EA 4B3AA 1WGXA 3R0JA 2R93J 1HW2A 3AG4H 4BQQA 1AOYA 3CCYA 5IP9J 2CG4A 3E5UA 4Y15A 2Y9ZA 3GTMJ 1P9QC 2ELJA 3OOUA 2P6SA 5J40A 2EH3A 4ZYGA 3C2GA 2WAQN 1SFKA 2NVQJ 2GA2A 3I4PA 2ZJPF 1X19A 2JA6J 5IYCJ 4D9JA 4C30A 4J00A 4A5NA 4FETA 1MJBA 2V79A 3SXYA 1X58A 4OINF 4RB3C 1E3PA 4W97A 2R0QC 3ERMA 5E3MA 1ZGWA 5JLXA 2ZCWA 4IO9F 1VTNC 2KPMA 4MHGA 1X4PA 4Y52J 5IY5H 4XR6A 4ZC3A 1S72I 3VODA 1D5VA 3K4CA 5JI6A 4EJTA 4GRIA 2LY1A 3OL3A 3F0CA 3O8HA 2QM3A 1ZG1A 2J5OA 4QPOA 1Z1DA 2V6CA 4HQEA 2BV6A 4BUPA 3FF5A 3DFGA 5L3CA 2HQAA 4G8XA 3GZ6A 3IV5A 5IP6A 1RRJA 1P7IA 2BE5F 3HYIA 5EEHA 3JRIA 1LB2A 1WFXA 2IA2A 1K79A 2XDVA 1WI3A 4E7ZA 2AXTC 4XNFA 2FNAA 1UCRA 2V9PA 2VJJA 2F4OB 2MBFA 4A3GJ 2KQRA 4A12A 4C3JJ 1NG6A 2K4BA 4JQFA 2C6YA 1OISA 1HQCA 1YHQI 1DDNA 2OA4A 1HKQA 3OMYA 3VSLA 1X1CA 3ELKA 1BA5A 3ASNH 3OYFA 4M3GA 4M3FA 1IN4A 5KCMA 4RAFA 1DU6A 3BTJA 5LGNA 3OIQA 5H20A 1YOVB 1UELB 2QF7A 2O8KA 2O61A 1C0WA 3CDLA 3LFUA 2PLYA 1KONA 3V7RA 4ZH4F 3GTQJ 4L5JA 3F6OA 3NARA 1KZHA 4B43A 1KYWA 4HV5A 4N9HA 5CVUA 1Z3XA 1GV5A 4ZZDA 1W0TA 3JAMZ 4PDKA 1UJ8A 2PBIA 4AYBA 4DNCA 4OU0A 2P0WA 1DU0A 4LIVA 4IOAF 5HDGA 2DA7A 2DA5A 1FBSA 2WB1N 2PJRB 1D8KA 2X0LA 3C2BA 3ZN0A 4DYRA 1LDDA 1MZBA 2L7MP 3HEFA 4XQFA 2QEXI 4FASD 1R5GA 2CV1A 4BL0B 3D0SA 2DMTA 4RBOA 1I6HJ 1YG2A 2WBMA 5KAIC 3LSJA 4EV0A 3QOEA 1MBJA 3FMRA 2RQQA 1Y56A 3ULQB 5IYDJ 3QWLA 1PYVA 1UFMA 2V7FA 4G7OF 5DM6F 4AD9A 4P9UA 4TV7A 3HOYJ 3FXJA 3FBIB 3R61A 2KL4A 2UWMA 3K4LA 1ZRCA 2XB0X 2MABA 1J59A 3J7AY 3K9TA 3KX2A 4D0PA 3PNTA 4D5CA 3EDPA 1MBEA 4C9YA 2PMHA 3EYIA 1YW7A 3RIRA 3HPHA 2V1DA 1SD5A 5JVTA 2W25A 2I5UA 2DAOA 4ENJA 4CDGA 5D5VB 1X1AA 4HBLA 1Z91A 1ORKA 5C44J 1HF0A 3OV8A 2EV0A 4XBFA 4NBQA 3FZVA 3W2AA 4M72A 3FXLA 3PQKA 4FX0A 2WY7Q 1DUXC 3SHFA 1DPUA 3H92A 2HQNA 5DD4A 2FA5A 1U5TA 1XD7A 1EKEA 2DYRH 2DPUA 2E2JJ 1GDTA 4RAZA 4IQ4A 1G59A 1U8BA 1ULYA 1XX5A 3KFWX 5LRSA 3FXKA 3IP4B 1QVUA 2FE3A 1BM9A 1IZ1A 1MBFA 1GXQA 2I8DA 3ZQQA 3G6EI 1W5TA 3F8CA 1YFHA 3GLLA 3WTTC 2BVMA 2NRAC 5BQTA 4KIGA 1JHHA 4HLYA 3A0BC 1PP8F 1BW6A 2K7LA 2V6EA 2HKXA 3BTLA 4E4HA 1FJLA 4WF2A 1ZGAA 2EFNA 1U78A 3CJTB 3FMQA 3ML6A 3M8JA 2WWYA 3CCVI 4EGYA 5HOOA 3WTSC 2ZFUA 3H35A 5KK1A 3TO7A 2O6GE 2VC1A 4S0HB 4II3A 2Z2SB 1K4TA 4CGZA 3MKYB 2HXOA 2QQAA 2VBYA 3NRVA 1D3YA 4A69C 5K5QA 1JHFA 4HV6A 4IX7A 2MD0A 5D5UB 3WG7H 2DTZA 4Q47A 4HW0A 4B48A 1Z7LA 4L9JA 4Z6YA 4ZYAA 4IVNA 4E7IA 4ENNA 2VOPA 1UZCA 3CCUI 1B9NA 4AYBN 1VQ7I 1F4KA 2HU9A 2LMDA 2LNBA 4V19K 2YX7A 1R4MB 1WSUA 3JRGA 1NHAA 4DJAA 4HX4A 3MZYA 2HR3A 1FIAA 2B7EA 4P96A 3H3UA 4WXDA 2FQ3A 2DDAA 2HXIA 3H36A 1Z9CA 2CQNA 1TTYA 2JUCA 2BOLA 4IPAA 2DQRA 4YFXF 4EVIA 1IDYA 3I4NJ 4Y33A 3KYLA 2VXDA 5HS8A 3I71A 4B3XA 4HNUA 1ZRDA 1XMKA 3HIFA 2IS1A 3OYBA 4RDUA 3NWSA 2LTPA 4QTRA 1ONVA 4PJMA 3DLAA 3V7CA 1EH8A 2ZFWA 4MQVA 1JJ6C 1P2FA 1FPQA 2MC4A 4XKVA 5HODA 4LG3A 3KLNA 1ZG3A 3AG3H 4BE1A 2FBIA 2LKXA 4U0VA 4M74A 2V9KA 2NS7A 1WJAA 1U3EM 1L3LA 1FT9A 3GZNB 4XLHA 3ROUA 1FLIA 2GOMA 4CZCA 2G7UA 2RNJA 1AKHB 2HVSA 2VQCA 3KZZA 1JTYA 2G0EA 1IAWA 3BG5A 3WTYC 3CCQI 1MMNA 2JPBA 3GTGJ 4NQWA 3Q0VA 2KFDA 4ESFA 2A5WA 2Y0SN 2DA3A 2DBBA 2MYSA 3QAHA 1JKOC 1RPWA 4BY7J 2E1CA 4IHVA 3S1MJ 4EM1A 3ZMZA 2UXXA 5FRNA 5ICFA 4I99C 4HQMA 2VODA 4DYQA 3I9V2 3KP2A 4AIDA 2M87A 5D4SA 3MCZA 4UB8C 3WHBA 5E3OA 5IYBJ 3BR2A 1MBHA 3LL7A 2YU9J 1IXRC 5LGTA 2VN2A 1BR2A 4CYCB 2P5LC 3ABMH 1XMAA 3A0HC 4EATA 1T98A 1MIJA 1YS7A 2NS8A 3CLQA 4DBQA 4C3IJ 2QYOA 2LOOA 3VEPA 1LFUP 2ICWG 3K1NA 1G3TA 2HDCA 2ADUA 3FK7A 4I7HA 5FLXK 3IUOA 3WGHA 2CW7A 2XVCA 3QYEA 2E2IJ 2DFFA 2HOEA 3TOAA 1WCMJ 5K5OA 4BU2A 5TGTA 4D5FA 3KP5A 4GGGA 2KJCA 1S7EA 3WGIA 4QSHA 1XMXA 3LSRA 2IGNA 4Q4ZF 1KQ9A 4K2EA 4LIUA 4U7DA 4EGZA 1SD4A 1ZLKA 3CMAI 3MZHA 3E0JB 4UY8I 3VFZA 2VB6A 2ZBKA 1S6LA 3ZPLA 5E8GA 2DDBA 1H8AC 3HDDA 1G4DA 2EFOA 2LKPA 2RNGA 2CS3A 2XPVA 2WV1A 2GQQA 3HOTA 1VQLI 2E1OA 3S32A 4M3EA 3P7NA 4S04A 3HZJA 4G7ZF 2OV7A 2H6BA 3AAFA 1WQ2A 4G7HF 2QGUA 3IAS2 4MGRA 1R36A 4UHTA 2TDXA 4JK1X 1QA6A 3GTPJ 3HOUJ 3PO3J 2Z5UA 4UV9A 1STZA 4YIRX 2F4MB 1ZAOA 1S9HA 2HYGD 2Y9YA 5D8LB 3K4KA 3ERED 1IXSB 3L2WA 1MNEA 4YG2F 5GAHJ 3ZQCA 2NVYJ 2XASA 2E1MB 4Y13A 3RYRA 4E7KA 4P1WA 2PFBA 3I54A 1QHGA 4HSTA 2WV0A 1Y0UA 3HSEA 4O6JA 2ACJA 4Z2YA 4ZTFA 3L2CA 2L7KA 3LA2A 2PJRA 2M0MA 2ZNZA 3QPTA 2M3AA 3I3LA 2LBFA 3TEDA 1YYVA 3DEEA 3HB9A 2Q2EB 4OIRF 3PSFA 5HLIA 4XN0A 5EJCA 2LLKA 4OAYA 3AKZA 1LNWA 3OR2C 2DYSH 2KDOA 1OFCX 4RGRA 3CQZJ 3CC4I 2DJNA 5C3EJ 2WTEA 2X4HA 5FKLA 2FNPA 2CUZA 1VQKI 1UAAA 1BBYA 4XLFA 3UKGA 1A35A 2DMPA 1X4OA 3KEQA 2XAJA 3ZR8X 4CCJA 1K7AA 1ZTRA 2K85A 2L3DA 1ON1A 3HTUA 2EPFA 4O3MA 5BPDA 1QO0D 3M9AA 3NWTA 5DUKA 5F0FA 4JYKA 3EUAA 1KU2A 4HDUA 5EF6A 2EV6A 3L2UA 3M8EA 4IZZA 2IS2A 3MKZA 1JJ8C 5CLSA 3EPZA 1RIOH 4IQJA 5KAFC 3OR1C 3TO6A 3M4OJ 3T5XA 1H9GA 3OS1A 1TNTA 1NG7A 2BY2A 3FHNA 4U88A 3FKJA 3K7AJ 2NNNA 1I3AA 1V54H 1T38A 5E20A 4C2TA 1ERDA 1BI0A 1FX7A 1YX5A 5CPRB 4PJJA 1MMSA 4XM3A 3F8FA 3KLOA 2KLOA 2DMQA 4MIMA 3W2VA 2R7WA 2R7DA 2CYYA 4P9FA 3TL4X 2L9SA 5LEKA 4JP0A 2ZJRF 1XDSA 3GWZA 3VYSB 5ERIA 5CVIA 4B4CA 2EFWA 1ETKA 1R58A 2GXBA 2BEOA 2LF8A 3HXLA 1SVOA 3Q9SA 2L01A 3VSKA 2Z9OA 4KN4X 2OCCH 5CVVA 1PP7U 5HLGA 5LD2C 1R7JA 2EJRA 3UNGC 2BY1A 3G2BA 2D1HA 4PSXA 3CTAA 1LJ9A 4DQ2A 1HSJA 2VJ4A 3S2DJ 5F6FA 1MNDA 1U5TC 3D5LA 1I1GA 3LOCA 4XKCA 4Y4RA 3SEQA 3BR3A 3BQYA 4CUGA 4A0YA 3HOSA 1QVTA 4E7LA 1Z77A 3CLOA 3PUFA 4RLQA 1YIJI 3WTZA 4RGXA 2H8WA 5E1XA 5F1RA 2Y69H 4RM3A 1BIAA 1OYYA 2OD5A 5F1JA 4IRGA 2PMUA 1CF7B 1GXPA 1VFCA 4RM2A 2Y2ZA 4ZZLA 2OTJI 4CHUA 3D5SC 2KRHA 3TQNA 5DTDA 2WADA 2LDUA 5H6RA 3OYNA 1JKRC 1T6SA 2A07F 1OMIA 2X1CA 3MAJA 3ZQIA 1OCCH 2GBYA 2V1NA 1F5TA 5J3LA 3CP8A 1XS9A 4YELA 3G71I 1GHCA 3CUQB 3S8PA 3KP3A 1SD7A 1LUJB 2CRGA 1JKQC 5H6QA 2FXAA 1SC7A 1IV8A 2KMUA 2MGQA 1WJDA 3GFMA 3SQNA 4MEYF 3J80K 2F5CA 4OIOF 3CMYA 4ENKA 1TWFJ 3BROA 2CJJA 4I98B 2O8XA 2DFHA 2V26A 2ZSIB 3K70C 2FOKA 1B72B 2F6CA 2YR2A 2AO9A 4XRSG 1MDMB 2LSOA 2E5ZA 1S8NA 4A3KJ 3S3NA 4GYIA 2A6EF 5L3FA 1D1BA 5EDNA 5FRMA 4XLCA 2DOEA 2CW8A 4A2UA 2BW3A 2F5EA 3K2ZA 4M9ZA 1UHSA 4CYCA 3RDIA 4E6KG 3QYBA 5FLVA 3GVAA 3Q9VA 5F04A 2NVXJ 4V2GA 1X1PA 4D1QA 2BXYA 4XONA 2H09A 4BDYA 3HM5A 1Z7UA 2HQRA 1WJFA 1XC5A 2MA3A 2QQ9A 4C3HJ 2H27A 1WJ5A 1XSXA 1WKMA 3PM1A 4CA0A 4A3IJ 3R60A 3CJRB 1PVEA 3H9GA 3ABKH 1N78A 2ZXHA 3HJEA 2ZXWH 2ZO4A 3A2KA 4C2UA 3PIOF 2OU2A 5J1UA 2WAFA 2KDZA 4ESJA 1FTZA 2P7CB 2AQEA 3BR1A 3HRUA 1Z0XA 4WXHA 2R5ZB 3BOQA 4UB6C 1SMTA 2E60A 1B8IB 1OYIA 3QODA 3GFLA 1V3FA 4G6QA 2EV5A 2IGMA 1D1CA 2XKOA 2HVRA 2DFEA 3DBRB 1G6NA 2DT5A 1XN7A 2B0LA 4XOPA 1WI9A 1ZH5A 3Q0UA 4MTDA 1VQ8I 3ASOH 4A3EJ 3I5UA 2M8GX 1GV2A 1G8XA 4HPQA 4LJZF 2RC4A 1FBQA 5KHDA 1JT0A 1R49A 4YFKF 4X0GA 2YS9A 3CF5F 1YI2I 1QBJA 1HDDC 4PUSA 4YIIA 3KP4A 4EJUA 3CO6C 1YLFA 5EG0B 2VBWA 3DEUA 3L09A 4BE0A 2YX4A 4LLNA 4CO8A 1SFOJ 1ON2A 2QSHX 4BJTA 3IL2A 2MSYA 2M34A 5M5YJ 3RKWA 1OCOH 2DODA 2XAQA 4I6ZA 3EUKL 2K9NA 3WU1B 5E17F 2JRMA 5ILSA 4BYYA 1VZ0A 4BGDA 1S3JA 3GF2A 1IJWC 2H94A 2Q0OA 2M7AA 3PQJA 4DGWB 3KETA 1TWHJ 5LEJA 5J4YA 2LY2A 2R7XA 3K4NA 3DU5A 4N4OB 5L3EA 1SVMA 4ZTJA 4KYWA 1HDPA 1GUUA 4XSZF 1ETQA 1KU9A 3LSTA 1UG0A 4IF4A 5E8IA 3SZTA 3MKLA 2JA8J 4HNVA 2NS0A 2IP2A 2L7ZA 4HF0A 2PMZA 5D6FA 4CCKA 5FKNA 2Q2EA 2LY9A 2K86A 4CSWA 4KT6A 2GM4A 5LHIA 2L9NA 1D1AA 1J5YA 1X1BA 5EZHA 5K7HA 1P6RA 3QYFA 3OS0A 2VLAA 3HRSA 3P9CA 3EUHC 3KEYA 2QUFA 5J8CA 4PFOA 2ME6A 1U6GA 3CMMA 2X85A 3BZ6A 2DK5A 1SEUA 2QBYA 4M6VA 4H4KC 1LPQA 1RUOA 1I39A 4HA8A 2J5PA 3ECOA 4BAYA 2QSGX 3QU3A 2E1NA 1R4NB 4DOZA 1Y1WJ 1CGPA 4LLLA 1OCRH 2RREA 3BR5A 1V5GA 1Y8RB 1AU7A 3PNVA 3E1SA 3E97A 3K69A 2DOAA 4BEHA 5ICCA 4BY1J 1LKXA 2JT1A 2NOGA 5DYMA 2W84A 2DLLA 4I01A 2F4IA 1IC8A 3AL0B 3HGGA 3FXOA 3OL4A 3CUQA 3K4BA 1WJEA 1GVJA 2LRDA 4HX7A 3TP3A 4HNTA 5IT9Z 2EINH 2CU7A 2VT3A 1IV6A 3HL2A 2L2OA 5DM7F 2GIZA 1XPXA 3JTHA 3U21A 4EJVA 1JUSA 3Q0WA 4LMYA 3CCLI 3HSRA 3GTJJ 3W6KB 3WTXC 3JSPA 2VKEA 2IBDA 4FQGA 4HEA2 1LDKB 2EZLA 3BR6A 2QCOA 4PJNA 5K7FA 3LSPA 4B47A 4RMNA 1Q1VA 1R1VA 5CJ9A 3TP0A 4BNCA 2ISZA 1T39A 1RR8C 2HOTA 3KP7A 1XB4A 2P4WA 1X2MA 4KNYA 1MMAA 1R5ID 2DFIA 4P55A 4XIDA 2FD5A 2ZJ2A 2UV1A 2E5NA 3OYGA 1BN5A 1SANA 3HOVJ 3U2RA 3FIWA 4AU7A 3DBLB 1MSFC 2DT6A 3BP8A 1A5JA 3SZPA 1WH7A 3CESA 1HC8A 1MJ9A 3WU2C 2VJIA 3QPLA 4AM3A 3GLXA 5DEQA 4GO1A 2UXNA 2X9DA 5CVJA 1D0YA 4QWQA 1OJLA 3MQ0A 2YSRA 2KT0A 5FD6A 5JR3A 1SFUA 1GT0C 1X1DA 4I09A 3H3ZA 1XTAA 4BHBA 4AVPA 2XV4S 2Y75A 2VOOA 3LAJA 2GAUA 3A01B 2A6HF 3SFZA 3Q5FA 2PG4A 4L9VA 2OAZA 1Y39A 2ESNA 1TLHB 5HLHA 1U9OA 5AONA 3UR3C 4BJ6C 2V1UA 4BXXJ 3GFIA 4HRIA 1PJRA 1W5SA 1ENHA 1H88C 4XRMA 4S05A 5LHGA 3RCOA 4NB5A 3JSOA 4LG0B 5FKMA 2RKHA 4KICA 1K78B 3M7GA 3MMYB 3BCAA 3A03A 3S14J 4I0AA 1FYLA 3DU6A 1YX3A 2IAIA 2UUZA 3KYDB 2VBZA 4RB2C 3ZMVA 1LEAA 2RGVA 3N97A 2VONA 1RKTA 2VPRA 1DGWY 1KU3A 2DN0A 5GAGJ 3VYUB 3OYCA 3QRFF 1YW9A 3HOWJ 1O3RA 3E6BA 1O3SA
chains in the Genus database with same CATH topology
2DA4A 1G2HA 2Y9YA 2RAEA 2JN6A 2E19A 2NVTJ 3M3YJ 4UUTA 3ZQCA 1ZR4A 2EZKA 2NVYJ 1ETYA 3S17J 1MH3A 5E3LA 5M3FJ 3TW6A 3IH4A 1PUFA 2P81A 3G1OA 4QIWN 3OSFA 3LNQA 5JLWA 4UUSA 1YRNB 2ME0A 3BTCA 3BR0A 1Y1WJ 3B6AA 3JRHA 3TEDA 1I50J 3HB9A 1IRZA 2CUEA 2LLKA 5GPCA 2LK2A 3DCFA 4BBRJ 2N8GA 2TCTA 3GBGA 2R5YB 4A3DJ 1OFCX 5J1RA 3LSGA 3CQZJ 2JJ7A 5IOYA 2DJNA 5C3EJ 1OCTC 5K7ZA 1GVDA 5F0CA 5FKLA 5GP9A 3UKGA 1P7JA 2DMPA 5IPAA 1ZTRA 4IHYA 1LE8B 1ZK8A 2ELKA 3B6CA 3BG9A 1CQTA 2XRLA 3IH3A 4AC0A 3HOXJ 1RR7A 5F0FA 1WH5A 3I4MJ 2XPUA 4JYKA 5F08A 3JRCA 4DW6A 3OIOA 5EF6A 5F0HA 5EGOA 1OCPA 3HBLA 2D5VA 1JJ8C 3SJMA 1MNMC 1IG7A 3TW7A 5M5WJ 3M4OJ 3RZDJ 2Y31A 2FJ1A 2XGCA 3K7AJ 4G12A 3H3VK 3S1QJ 4A3BJ 2H1KA 4IHXA 4MLOA 3RQIA 1MH4A 3NAUA 2I10A 2VI6A 2DMQA 4MIMA 4AUXA 5M3MJ 3ZQGA 4JP0A 2M2EA 4B3AA 1WGXA 3ZOBA 2R93J 4B4CA 2YUSA 3W6VA 1ETKA 3CCYA 5IP9J 1JT6A 2Y9ZA 1JGGA 2B63J 3GTMJ 3OOUA 2EH3A 2WAQN 2NVQJ 1T33A 2JA6J 5IYCJ 3D1NI 2JA7J 1X58A 1ETXA 3S2DJ 4W97A 3E7LA 4Y7NJ 2IEKA 4JX6A 3LOCA 5E3MA 2R0QC 2M9HA 3BR3A 1ZGWA 3BQYA 5JLXA 1ZQ3P 4Y52J 1QVTA 1RETA 2M0CA 3JRDA 1FTTA 1Z77A 4XK4A 3ZQLA 3GTKJ 4L5EA 5F1JA 3F0CA 3O8HA 4ABZA 4XICA 1O4XA 2DMNA 1VFCA 2Y2ZA 3MVPA 3IV5A 5IP6A 1P7IA 3JRIA 5DTDA 1JKRC 5FJ8J 3ZQIA 4IHWA 2GBYA 1WI3A 2OPTA 5J3LA 1XS9A 1TC3C 3QQAA 4A3GJ 4C3JJ 1EF4A 2CRGA 1JKQC 1BL0A 1UG2A 5FLMJ 2DA1A 5C4JJ 3QPSA 2MGQA 2XGDA 4V2FA 3JR9A 2O9LA 1ITYA 1BA5A 3CMYA 4X1EA 1W0UA 1TWFJ 4M3GA 4M3FA 1LFBA 2CJJA 4A3MJ 1DU6A 3BTJA 1IUFA 1B72B 2QF7A 3MN2A 2JA5J 2AO9A 2O8KA 4XRSG 3CDLA 5E3NA 4A3KJ 4FISA 3GTQJ 5EDNA 1R9TJ 3NARA 4A3CJ 2HOSA 5BNGA 1GV5A 1W0TA 1UHSA 4CYCA 5FLVA 5F04A 2NVXJ 4V2GA 1DU0A 1D5YA 2DA7A 2DA5A 3HM5A 1AKHA 3HGYA 3PO2J 1XC5A 2WB1N 2JWTA 4C3HJ 4DYRA 3C2BA 3PM1A 4A3IJ 3HEFA 2L7MP 1JUPA 2HDDA 3ZQFA 4A3FJ 5J1UA 2DMTA 4RBOA 2KDZA 3GTLJ 1I6HJ 1FTZA 2R5YA 1JTXA 3BR1A 3LSJA 1MBJA 5IYDJ 1X2NA 1Z0XA 2R5ZB 1B8IB 2O7OA 3HOYJ 2LR8A 1PUFB 3GTOJ 2EZHA 1ETOA 2DMUA 5DS9A 1YRNA 1ETWA 2XB0X 4D5CA 2ECBA 1MBEA 2LP0A 1MBKA 1VI0A 3Q0UA 1TWGJ 1I3QJ 5M5XJ 4A3EJ 1ORKA 5C44J 1HF0A 2M8GX 1GV2A 2L0KA 4MO7A 1TWCJ 1JT0A 2ID3A 1E3OC 2YS9A 4DYCA 4M3BA 1AHDP 1HDDC 2AHQA 4FCYA 1NTCA 1Y1VJ 2Y30A 5EG0B 3A01A 1IGNA 3SDGA 3BG3A 1SFOJ 4J19A 2GLOA 2EQRA 2CQQA 2E2JJ 2MSYA 4XRSA 1GDTA 1IDZA 2XSDC 3L1PA 1BW5A 2JMWA 1U8BA 2M34A 4IEJA 5M5YJ 3JREA 1QVUA 5EGOB 1XG1A 1MBFA 4I6ZA 2K9NA 3BQZA 3IH2A 5J1YA 2DA2A 1IJWC 1BW6A 4NDLA 3BTLA 3FK6A 1FJLA 3HOZJ 1TWHJ 1U78A 1F36A 2HOAA 4FE4A 2H8RA 1HDPA 2E2HJ 1GUUA 4S0HB 1ETQA 2L7FP 2HXOA 2FQ4A 3SFIA 2R7ZJ 2ZB9A 1ZKGA 1VNDA 3MKLA 5EYRA 1LE8A 5FKOA 4A69C 3HKZN 2JA8J 4HNVA 2DTZA 5EEAA 1POGA 2L7ZA 3DEWA 2EBIA 1RESA 1RKWA 2X48A 5FKNA 2LY9A 3S16J 2FX0A 4GFBA 1K61A 2GM4A 1QRYA 4B1RA 2R5ZA 4AYBN 1B8IA 5EZHA 5K7HA 3ZQHA 3JRGA 1U9NA 1T56A 1FIAA 4A3LJ 2ME6A 9ANTA 2HXIA 2COBA 3BT9A 4M6VA 4A93J 1NK2P 2L9RA 1IDYA 3I4NJ 1B72A 2DA6A 4C2MJ 3BR5A 5IOZA 1AU7A 1UMQA 2ECCA 4RDUA 4MFDA 4JX4A 2LTPA 1H89C 4QTRA 4BY1J 2NOGA 2CQXA 3Q3SA 1JJ6C 2LFBA 5GPAA 5HODA 1IC8A 2PMZN 2R92J 1HCRA 3A02A 5EG0A 3K2AA 1JUMA 3HGGA 2LKXA 4MFEA 2K9SA 1K83J 3TP3A 2NS7A 3G1MA 2CU7A 2VUMJ 3H0GJ 1IV6A 2HQ5A 1AKHB 1JTYA 2G0EA 2ID6A 1JUSA 3BG5A 3Q0WA 1ZR2A 2VKVA 4BBSJ 4D7NA 3GTJJ 3GTGJ 3Q0VA 2VKEA 2Y0SN 2DA3A 2IBDA 3JRBA 2EZLA 1JKOC 1BJZA 3BR6A 1RPWA 2QCOA 4BY7J 4IHVA 3S1MJ 5K7FA 3LSPA 1Q1VA 3TP0A 4DYQA 2HOTA 4UUSB 1APLC 3S15J 1X2MA 2HYJA 4D7MA 3VPRA 3WHBA 5E3OA 4XIDA 5IYBJ 3BR2A 1MBHA 3O8GA 1NK3P 2FD5A 2YU9J 1QPIA 2X6OA 5FKKA 1ETVA 4CYCB 1SANA 1MSEC 3HOVJ 3FIWA 2LD5A 1MSFC 4A3JJ 1A5JA 3S1NJ 1WH7A 4EEFG 3QPLA 3FISA 5EZGA 2NS8A 4C3IJ 3RKQA 3JRAA 1LFUP 2X9DA 4FE7A 5IP7J 1F43A 1FEXA 1OJLA 1GT0C 2KT0A 1FIPA 3FK7A 3BTIA 5F27A 2HI3A 3OSGA 2K40A 4DZJA 2E2IJ 4DZPA 1WCMJ 4D5FA 3FKIJ 2OF7A 3A01B 1HOMA 1S7EA 1TWAJ 2XB5A 3JRFA 4QSHA 1MBGA 2CUFA 4I76A 3LSRA 5C4XJ 1U9OA 4BXXJ 1H88C 1ENHA 2EZIA 4XRMA 4W1UA 2JK3A 4JX5A 1WPKA 3RZOJ 2XGEA 5FKMA 1H8AC 3A03A 3HDDA 2K9QA 2XPWA 4FTHA 3S14J 2TRTA 2WV1A 2XPVA 4X6AJ 3S2HJ 2E1OA 4M3EA 2IAIA 3WHCA 3S1RJ 2W48A 4LOCA 1JKPC 3GTPJ 1RKTA 2VPRA 2DN0A 1A6IA 2LVSA 3HOUJ 2MW8A 1HLVA 3PO3J 1VF9A 3G1LA 3HOWJ 4M3DA 2MG4A 4BKXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DA4 A;  1G2H A;  2Y9Y A;  2RAE A;  2JN6 A;  2E19 A;  2NVT J;  3M3Y J;  4UUT A;  3ZQC A;  1ZR4 A;  2EZK A;  2NVY J;  1ETY A;  3S17 J;  1MH3 A;  5E3L A;  5M3F J;  3TW6 A;  3IH4 A;  1PUF A;  2P81 A;  3G1O A;  4QIW N;  3OSF A;  3LNQ A;  5JLW A;  4UUS A;  1YRN B;  2ME0 A;  3BTC A;  3BR0 A;  1Y1W J;  3B6A A;  3JRH A;  3TED A;  1I50 J;  3HB9 A;  1IRZ A;  2CUE A;  2LLK A;  5GPC A;  2LK2 A;  3DCF A;  4BBR J;  2N8G A;  2TCT A;  3GBG A;  2R5Y B;  4A3D J;  1OFC X;  5J1R A;  3LSG A;  3CQZ J;  2JJ7 A;  5IOY A;  2DJN A;  5C3E J;  1OCT C;  5K7Z A;  1GVD A;  5F0C A;  5FKL A;  5GP9 A;  3UKG A;  1P7J A;  2DMP A;  5IPA A;  1ZTR A;  4IHY A;  1LE8 B;  1ZK8 A;  2ELK A;  3B6C A;  3BG9 A;  1CQT A;  2XRL A;  3IH3 A;  4AC0 A;  3HOX J;  1RR7 A;  5F0F A;  1WH5 A;  3I4M J;  2XPU A;  4JYK A;  5F08 A;  3JRC A;  4DW6 A;  3OIO A;  5EF6 A;  5F0H A;  5EGO A;  1OCP A;  3HBL A;  2D5V A;  1JJ8 C;  3SJM A;  1MNM C;  1IG7 A;  3TW7 A;  5M5W J;  3M4O J;  3RZD J;  2Y31 A;  2FJ1 A;  2XGC A;  3K7A J;  4G12 A;  3H3V K;  3S1Q J;  4A3B J;  2H1K A;  4IHX A;  4MLO A;  3RQI A;  1MH4 A;  3NAU A;  2I10 A;  2VI6 A;  2DMQ A;  4MIM A;  4AUX A;  5M3M J;  3ZQG A;  4JP0 A;  2M2E A;  4B3A A;  1WGX A;  3ZOB A;  2R93 J;  4B4C A;  2YUS A;  3W6V A;  1ETK A;  3CCY A;  5IP9 J;  1JT6 A;  2Y9Z A;  1JGG A;  2B63 J;  3GTM J;  3OOU A;  2EH3 A;  2WAQ N;  2NVQ J;  1T33 A;  2JA6 J;  5IYC J;  3D1N I;  2JA7 J;  1X58 A;  1ETX A;  3S2D J;  4W97 A;  3E7L A;  4Y7N J;  2IEK A;  4JX6 A;  3LOC A;  5E3M A;  2R0Q C;  2M9H A;  3BR3 A;  1ZGW A;  3BQY A;  5JLX A;  1ZQ3 P;  4Y52 J;  1QVT A;  1RET A;  2M0C A;  3JRD A;  1FTT A;  1Z77 A;  4XK4 A;  3ZQL A;  3GTK J;  4L5E A;  5F1J A;  3F0C A;  3O8H A;  4ABZ A;  4XIC A;  1O4X A;  2DMN A;  1VFC A;  2Y2Z A;  3MVP A;  3IV5 A;  5IP6 A;  1P7I A;  3JRI A;  5DTD A;  1JKR C;  5FJ8 J;  3ZQI A;  4IHW A;  2GBY A;  1WI3 A;  2OPT A;  5J3L A;  1XS9 A;  1TC3 C;  3QQA A;  4A3G J;  4C3J J;  1EF4 A;  2CRG A;  1JKQ C;  1BL0 A;  1UG2 A;  5FLM J;  2DA1 A;  5C4J J;  3QPS A;  2MGQ A;  2XGD A;  4V2F A;  3JR9 A;  2O9L A;  1ITY A;  1BA5 A;  3CMY A;  4X1E A;  1W0U A;  1TWF J;  4M3G A;  4M3F A;  1LFB A;  2CJJ A;  4A3M J;  1DU6 A;  3BTJ A;  1IUF A;  1B72 B;  2QF7 A;  3MN2 A;  2JA5 J;  2AO9 A;  2O8K A;  4XRS G;  3CDL A;  5E3N A;  4A3K J;  4FIS A;  3GTQ J;  5EDN A;  1R9T J;  3NAR A;  4A3C J;  2HOS A;  5BNG A;  1GV5 A;  1W0T A;  1UHS A;  4CYC A;  5FLV A;  5F04 A;  2NVX J;  4V2G A;  1DU0 A;  1D5Y A;  2DA7 A;  2DA5 A;  3HM5 A;  1AKH A;  3HGY A;  3PO2 J;  1XC5 A;  2WB1 N;  2JWT A;  4C3H J;  4DYR A;  3C2B A;  3PM1 A;  4A3I J;  3HEF A;  2L7M P;  1JUP A;  2HDD A;  3ZQF A;  4A3F J;  5J1U A;  2DMT A;  4RBO A;  2KDZ A;  3GTL J;  1I6H J;  1FTZ A;  2R5Y A;  1JTX A;  3BR1 A;  3LSJ A;  1MBJ A;  5IYD J;  1X2N A;  1Z0X A;  2R5Z B;  1B8I B;  2O7O A;  3HOY J;  2LR8 A;  1PUF B;  3GTO J;  2EZH A;  1ETO A;  2DMU A;  5DS9 A;  1YRN A;  1ETW A;  2XB0 X;  4D5C A;  2ECB A;  1MBE A;  2LP0 A;  1MBK A;  1VI0 A;  3Q0U A;  1TWG J;  1I3Q J;  5M5X J;  4A3E J;  1ORK A;  5C44 J;  1HF0 A;  2M8G X;  1GV2 A;  2L0K A;  4MO7 A;  1TWC J;  1JT0 A;  2ID3 A;  1E3O C;  2YS9 A;  4DYC A;  4M3B A;  1AHD P;  1HDD C;  2AHQ A;  4FCY A;  1NTC A;  1Y1V J;  2Y30 A;  5EG0 B;  3A01 A;  1IGN A;  3SDG A;  3BG3 A;  1SFO J;  4J19 A;  2GLO A;  2EQR A;  2CQQ A;  2E2J J;  2MSY A;  4XRS A;  1GDT A;  1IDZ A;  2XSD C;  3L1P A;  1BW5 A;  2JMW A;  1U8B A;  2M34 A;  4IEJ A;  5M5Y J;  3JRE A;  1QVU A;  5EGO B;  1XG1 A;  1MBF A;  4I6Z A;  2K9N A;  3BQZ A;  3IH2 A;  5J1Y A;  2DA2 A;  1IJW C;  1BW6 A;  4NDL A;  3BTL A;  3FK6 A;  1FJL A;  3HOZ J;  1TWH J;  1U78 A;  1F36 A;  2HOA A;  4FE4 A;  2H8R A;  1HDP A;  2E2H J;  1GUU A;  4S0H B;  1ETQ A;  2L7F P;  2HXO A;  2FQ4 A;  3SFI A;  2R7Z J;  2ZB9 A;  1ZKG A;  1VND A;  3MKL A;  5EYR A;  1LE8 A;  5FKO A;  4A69 C;  3HKZ N;  2JA8 J;  4HNV A;  2DTZ A;  5EEA A;  1POG A;  2L7Z A;  3DEW A;  2EBI A;  1RES A;  1RKW A;  2X48 A;  5FKN A;  2LY9 A;  3S16 J;  2FX0 A;  4GFB A;  1K61 A;  2GM4 A;  1QRY A;  4B1R A;  2R5Z A;  4AYB N;  1B8I A;  5EZH A;  5K7H A;  3ZQH A;  3JRG A;  1U9N A;  1T56 A;  1FIA A;  4A3L J;  2ME6 A;  9ANT A;  2HXI A;  2COB A;  3BT9 A;  4M6V A;  4A93 J;  1NK2 P;  2L9R A;  1IDY A;  3I4N J;  1B72 A;  2DA6 A;  4C2M J;  3BR5 A;  5IOZ A;  1AU7 A;  1UMQ A;  2ECC A;  4RDU A;  4MFD A;  4JX4 A;  2LTP A;  1H89 C;  4QTR A;  4BY1 J;  2NOG A;  2CQX A;  3Q3S A;  1JJ6 C;  2LFB A;  5GPA A;  5HOD A;  1IC8 A;  2PMZ N;  2R92 J;  1HCR A;  3A02 A;  5EG0 A;  3K2A A;  1JUM A;  3HGG A;  2LKX A;  4MFE A;  2K9S A;  1K83 J;  3TP3 A;  2NS7 A;  3G1M A;  2CU7 A;  2VUM J;  3H0G J;  1IV6 A;  2HQ5 A;  1AKH B;  1JTY A;  2G0E A;  2ID6 A;  1JUS A;  3BG5 A;  3Q0W A;  1ZR2 A;  2VKV A;  4BBS J;  4D7N A;  3GTJ J;  3GTG J;  3Q0V A;  2VKE A;  2Y0S N;  2DA3 A;  2IBD A;  3JRB A;  2EZL A;  1JKO C;  1BJZ A;  3BR6 A;  1RPW A;  2QCO A;  4BY7 J;  4IHV A;  3S1M J;  5K7F A;  3LSP A;  1Q1V A;  3TP0 A;  4DYQ A;  2HOT A;  4UUS B;  1APL C;  3S15 J;  1X2M A;  2HYJ A;  4D7M A;  3VPR A;  3WHB A;  5E3O A;  4XID A;  5IYB J;  3BR2 A;  1MBH A;  3O8G A;  1NK3 P;  2FD5 A;  2YU9 J;  1QPI A;  2X6O A;  5FKK A;  1ETV A;  4CYC B;  1SAN A;  1MSE C;  3HOV J;  3FIW A;  2LD5 A;  1MSF C;  4A3J J;  1A5J A;  3S1N J;  1WH7 A;  4EEF G;  3QPL A;  3FIS A;  5EZG A;  2NS8 A;  4C3I J;  3RKQ A;  3JRA A;  1LFU P;  2X9D A;  4FE7 A;  5IP7 J;  1F43 A;  1FEX A;  1OJL A;  1GT0 C;  2KT0 A;  1FIP A;  3FK7 A;  3BTI A;  5F27 A;  2HI3 A;  3OSG A;  2K40 A;  4DZJ A;  2E2I J;  4DZP A;  1WCM J;  4D5F A;  3FKI J;  2OF7 A;  3A01 B;  1HOM A;  1S7E A;  1TWA J;  2XB5 A;  3JRF A;  4QSH A;  1MBG A;  2CUF A;  4I76 A;  3LSR A;  5C4X J;  1U9O A;  4BXX J;  1H88 C;  1ENH A;  2EZI A;  4XRM A;  4W1U A;  2JK3 A;  4JX5 A;  1WPK A;  3RZO J;  2XGE A;  5FKM A;  1H8A C;  3A03 A;  3HDD A;  2K9Q A;  2XPW A;  4FTH A;  3S14 J;  2TRT A;  2WV1 A;  2XPV A;  4X6A J;  3S2H J;  2E1O A;  4M3E A;  2IAI A;  3WHC A;  3S1R J;  2W48 A;  4LOC A;  1JKP C;  3GTP J;  1RKT A;  2VPR A;  2DN0 A;  1A6I A;  2LVS A;  3HOU J;  2MW8 A;  1HLV A;  3PO3 J;  1VF9 A;  3G1L A;  3HOW J;  4M3D A;  2MG4 A;  4BKX A; 
#chains in the Genus database with same CATH topology
 2L54 A;  2CO5 A;  1X3U A;  2RAE A;  3M3Y J;  1M1E B;  2L4A A;  1KQ0 A;  3G3Z A;  4ITV A;  1ZR4 A;  2EZK A;  3LWF A;  3IWZ A;  2JUG A;  4ZJZ A;  1R00 A;  1MH3 A;  1E0E A;  4E7H A;  3F6V A;  3TW6 A;  3ABT A;  1XSV A;  3IH4 A;  3SDB A;  3LNQ A;  3T0Y A;  5GTH C;  1YRN B;  5L3B A;  2X1E A;  2EB7 A;  2CQK A;  2KZG A;  1OR7 C;  3BJ6 A;  3BR0 A;  3DXJ F;  3E6M A;  4KMU X;  1I50 J;  3T1B A;  2A68 F;  3FWE A;  2BY3 A;  3OYM A;  4RGS A;  3J80 Z;  1O7L A;  3GUD A;  2FSW A;  2BXZ A;  1NH3 A;  1A31 A;  5GPC A;  1F9N A;  1OPC A;  1I27 A;  1TQI A;  4IHT A;  4A3D J;  3LSG A;  1V55 H;  5IOY A;  1OCT C;  1IXC A;  1XGM A;  1JE8 A;  4PGH A;  3WU0 A;  5IPA A;  2X51 A;  3RKY A;  1VQ5 I;  3J7Z I;  1QQI A;  1ZN2 A;  1XDU A;  1XCB A;  3BG9 A;  4CCO A;  1CQT A;  2M30 A;  2XRL A;  4PJL A;  3VYR B;  4AC0 A;  1RR7 A;  3ESW B;  3J7Y J;  3F72 A;  3M07 A;  4KFC A;  3QPH A;  3DP7 A;  5F08 A;  3GXO A;  2IGK A;  4M6X A;  2DOF A;  3P9K A;  5HLT A;  4LFU A;  1X3Z B;  2YPR A;  1IG7 A;  1FOX A;  2X1D A;  4YIF A;  1YJN I;  2Y31 A;  4WK8 F;  1SFX A;  2FJ1 A;  2XGC A;  3FM3 A;  2ZME C;  3S2W A;  3M1C A;  4G6T B;  2XRO A;  5CYV A;  1U5T B;  3S1Q J;  2H1K A;  3ZCO A;  4PSW A;  4IHX A;  1V5E A;  4MLO A;  2M45 A;  4XOR A;  1UHM A;  2KJB A;  3RSN A;  3NAU A;  2I10 A;  2VI6 A;  5D5W B;  1ZAR A;  3DV8 A;  3PUB A;  1Z3Y A;  2BY0 A;  3TMO A;  1QNT A;  4AUX A;  4DIQ A;  5LHH A;  2JA2 A;  1VQO I;  2QKM B;  1WRJ A;  3ZOB A;  4OMZ A;  3W6V A;  2KKO A;  5FLX Z;  2A5Y B;  4A0Z A;  4LB6 B;  2GOX B;  4H0E A;  1L0O C;  4OOI A;  4XLA A;  1JGG A;  4F92 B;  5K1Y A;  1BOB A;  5HNF A;  4L0Z B;  2W57 A;  1SMY F;  5B3S H;  1T33 A;  5D4R A;  3K10 A;  3O6B B;  3D1N I;  2JA7 J;  3CC2 I;  2CSO A;  1ETX A;  4RGU A;  3COA C;  4Y7N J;  2IEK A;  2G9W A;  1O57 A;  2K4J A;  1S7A A;  4KDP A;  1ZQ3 P;  3BWG A;  1RET A;  2M0C A;  3FMS A;  3JRD A;  1FTT A;  2DQL A;  1WZ2 A;  2F5D A;  2V1X A;  4CH7 A;  1TL8 A;  2R7F A;  3H5R A;  5LGU A;  3ZQL A;  3GTK J;  4L5E A;  4IOC F;  3E6C C;  1O4X A;  1EA3 A;  1QZZ A;  3U1K A;  2IA0 A;  3MVP A;  5JFR A;  4FX4 A;  4ZDP A;  1LVK A;  3HUG B;  5H2F C;  3GYH X;  1QPM A;  3J7A O;  2HWV A;  1TC3 C;  1HKT A;  1W36 D;  3K6G A;  3QQA A;  2FBK A;  2IW5 A;  3BZK A;  4A6D A;  4ZDO A;  3LMM A;  5FB2 A;  3WTW C;  3RKX A;  2F5V A;  2HTJ A;  3T8R A;  2E7X A;  1EF4 A;  3KPH A;  3I55 I;  1BL0 A;  1A36 A;  2QWW A;  2DA1 A;  2F2E A;  5C4J J;  2ZJQ F;  1N75 A;  5J8F A;  2XGD A;  5CKT A;  3JR9 A;  2M7B A;  2WAE A;  4PK4 A;  2RQP A;  3CDI A;  5B5E C;  4X1E A;  1EH6 A;  2P5V A;  1W0U A;  2K02 A;  3EQL F;  1LFB A;  2ESH A;  5DV5 A;  1Z21 A;  3BJA A;  3BY6 A;  2ZNY A;  1FBU A;  2Z3Y A;  1ZRF A;  3GFJ A;  3R6S A;  3PFY A;  4CZZ A;  5E3N A;  1T08 B;  1E3H A;  1QHH D;  4HF1 A;  1JI8 A;  1R9T J;  2HOS A;  3GEZ A;  5BNG A;  1FP1 D;  3B73 A;  2VE8 A;  4A5M A;  1DGR M;  1YIO A;  3LQQ A;  1TZL A;  2VBX A;  2VKH A;  4KJZ A;  1IRX A;  4M6Y A;  2IXS A;  1S7O A;  3DPL C;  2W00 A;  1T0F C;  3ZMD A;  3PO2 J;  5ILV A;  2RV8 A;  2PI0 A;  2JWT A;  3K1P A;  1V5F A;  3OYI A;  2XAH A;  4XKW A;  1HW1 A;  3U9G A;  3OIP A;  2D45 A;  3HKZ A;  1IRG A;  4HOB A;  4HSR A;  4ON0 A;  2JPC A;  4A6E A;  2VIX A;  1PUE E;  3HRT A;  2JSP A;  3V7S A;  4A3F J;  3GTL J;  1MGT A;  1P4W A;  1Z6R A;  3LA3 A;  2R7Q A;  1U2W A;  1XCV A;  1JTX A;  2R5Y A;  4ENM A;  1CF7 A;  4BQN A;  1HKS A;  5JHF A;  2XAU A;  2Q1Z B;  3H9J A;  2O7O A;  2PN6 A;  4I0B A;  1B59 A;  5JHU A;  2EZH A;  1ETO A;  4OWR B;  3O2P E;  2Z1D A;  3V42 A;  1YRN A;  3I0T A;  1OKR A;  4IJA A;  3WTV C;  3E6D A;  4HDV A;  1O3T A;  2CV2 A;  5BOX A;  1MBK A;  4P5O A;  1VI0 A;  2OCE A;  4AIJ A;  1I3Q J;  5M5X J;  3REO A;  1FMV A;  4AWX B;  5GAD J;  3L9F A;  2M1B A;  3H5A A;  3WTU C;  1E3O C;  1EH7 A;  1AHD P;  3FDY A;  4M3B A;  4ESB A;  4U0W A;  4XSX F;  1Y1V J;  2Y30 A;  4E7S A;  2VE9 A;  2DO7 A;  1K78 A;  4B8X A;  2GWR A;  2GLO A;  1IUY A;  2CQQ A;  3P9I A;  3GME A;  2OZU A;  2F5F A;  4AIH A;  3L1P A;  5HVQ C;  3L2R A;  1MDM A;  3KZI C;  1BW5 A;  4IEJ A;  2DXI A;  4KT5 C;  2VJ5 A;  5EGO B;  1XG1 A;  3K4M A;  2KRC A;  3LA7 A;  3BQZ A;  3IH2 A;  3KYC B;  5J1Y A;  1FOY A;  1W7P B;  1FZP B;  3TKY A;  1J7K A;  1FWZ A;  1ZLJ A;  4I02 A;  2DA2 A;  1RZ4 A;  1SD6 A;  1RI7 A;  3CME I;  3D5R C;  3MEX A;  4NDL A;  3HOZ J;  3EYY A;  2P7V B;  2KHM A;  1F36 A;  2HOA A;  4F91 B;  1FSE A;  4FE4 A;  4R1H A;  1T95 A;  2H8R A;  3F8M A;  5A2Q K;  4M73 A;  2L7F P;  2W7N A;  2FQ4 A;  2R7Z J;  3BDD A;  3K1M A;  3FXU A;  5LLQ A;  2HYF A;  3HKZ N;  5LFA A;  1B1B A;  3DKX A;  2O5R A;  5EEA A;  1POG A;  2JTV A;  3DEW A;  2EBI A;  1SVL A;  3HHH A;  2XC7 A;  1RES A;  1SAX A;  1FYM A;  1TT0 A;  2JQ7 A;  2O03 A;  2CGP A;  2FX0 A;  2AS5 F;  2XHK A;  2MH9 A;  3PNY A;  4YRV A;  2HTS A;  2R5Z A;  4B1R A;  2P5K A;  5KNL A;  2F48 A;  4PZJ A;  3W6J B;  1B8I A;  5A2Q Z;  3ZQH A;  2NOJ B;  3HRM A;  6PAX A;  2KIM A;  2DJI A;  1YJW I;  1H0M A;  1U9N A;  1T56 A;  1TQP A;  4I2O A;  4A3L J;  1USS A;  3L7W A;  2M4K A;  9ANT A;  1J0R A;  2COB A;  2FMY A;  4GYG A;  3GCM A;  5E1W A;  4NC7 A;  5L3G A;  2ZSH B;  1NK2 P;  2L9R A;  3CCS I;  2CV0 A;  4HYE A;  1B72 A;  3JCU C;  2ZME A;  5D8K B;  5JVG F;  4C2M J;  4LB5 A;  2W24 A;  1Y6I A;  1LVA A;  1OR7 A;  1YS6 A;  2D1V A;  3IAM 2;  4A0X A;  4EJO A;  4JX4 A;  3WE2 A;  3CCM I;  3TDU C;  1SAU A;  2CQX A;  5HDK A;  4ZDL A;  2FUG 2;  1R5H A;  4KIF A;  5GPA A;  1HCR A;  3A02 A;  5EG0 A;  5DCF A;  1JUM A;  1BI3 A;  2GZW A;  4OMY A;  1TW2 A;  3G1M A;  1U0J A;  1R1T A;  4G94 A;  3LSM A;  2AXL A;  2QA4 I;  3C1D A;  2VUM J;  3H0G J;  5AIQ A;  4UXN A;  4F93 B;  2HQ5 A;  3OWT A;  2FOW A;  3LFK A;  2ID6 A;  1ZR2 A;  2QLZ A;  1J9I A;  1RUN A;  4ASN A;  4D7N A;  2IRF G;  4LLG F;  3ZGK A;  3CUO A;  1G3S A;  4BAC A;  3JRB A;  3NEU A;  5BS6 A;  2CH0 A;  2WAQ A;  4HAM A;  3KP6 A;  2HVQ A;  4CCN A;  3EUH A;  1TBX A;  4IRH A;  2X6X A;  2Y48 A;  1EJ9 A;  1X3W B;  3CCR I;  2ELH A;  1Y0N A;  5DD8 A;  4UUS B;  4WX9 A;  4D7M A;  4ZYD A;  2BHY A;  3TGN A;  3OYK A;  2LG4 A;  3S3M A;  1NK3 P;  1IN5 A;  2X6O A;  5FKK A;  1ETV A;  1MSE C;  2XF6 A;  1TQM A;  4A3J J;  1XGO A;  3S1N J;  3TBI A;  3K4J A;  4EEF G;  3RPU A;  1P4A A;  3JRA A;  2ISY A;  5IP7 J;  1FEX A;  1BR4 A;  5CQG A;  1FIP A;  4G9Y A;  4YEJ A;  3DKY A;  2HI3 A;  3OSG A;  1YIT I;  4DZJ A;  2VQG A;  5B1B H;  3PJR A;  1MMD A;  3WOD F;  4JBA A;  2IJL A;  1YJ9 I;  2XB5 A;  2ZC2 A;  1MBG A;  2CUF A;  2AQF A;  3MZ8 A;  2R4G A;  2ZME B;  1MD0 A;  4YFN F;  2HPI A;  3BJO A;  1P4X A;  1V4R A;  2EZI A;  3BG6 A;  2JK3 A;  4JX5 A;  3IKT A;  1WPK A;  1BI2 A;  1F1Z A;  2XGE A;  4IL6 C;  4BEH B;  3RZO J;  1E17 A;  2VT2 A;  2M8E A;  3CCJ I;  1OCZ H;  2XPW A;  2K9Q A;  2M4G A;  5L3D A;  4HF2 A;  1R22 A;  2TRT A;  2LYC A;  4II2 A;  3HPG A;  3TOB A;  3H9Q A;  4IXA A;  4KIT B;  2IA1 A;  1W36 C;  3WHC A;  3DPT A;  3B02 A;  4LOC A;  4R79 A;  1JKP C;  2D2W A;  2RDP A;  3MFK A;  3CP2 A;  1A6I A;  4FHT A;  4RS8 A;  1HLV A;  2IGO A;  4NC8 A;  1VF9 A;  2VL8 A;  2LH9 A;  4BKX A;  2DA4 A;  1G2H A;  3P5J A;  2JN6 A;  2K9L A;  3SEZ A;  3LSI A;  1T8I A;  2X6W A;  1ZRE A;  4UUT A;  3ZMS A;  3H1C A;  1ETY A;  2UZK A;  4LGW A;  4RLF A;  5E3L A;  5HS9 A;  5M3F J;  1YW8 A;  3I59 B;  3FXR A;  1PUF A;  1FMW A;  1KU7 A;  1TW3 A;  3G1O A;  4QIW N;  4OIQ F;  2XIG A;  2X6Y A;  4EM2 A;  1UST A;  2ME0 A;  3B6A A;  3JRH A;  1IRZ A;  3LSK A;  1FYK A;  5D6E A;  5ICG A;  1QZY A;  3IKV A;  2L9V A;  3DCF A;  1QZE A;  4BBR J;  1Y8Q B;  4N0B A;  2QBY B;  3GBG A;  2R5Y B;  2FU4 A;  4OAZ A;  2LKS A;  3W3C A;  2JSC A;  5F0C A;  2OZ6 A;  3ECH A;  5GP9 A;  4IKF A;  2LRE A;  3ZQ7 A;  1P7J A;  2QKL B;  5ED4 A;  2JVG A;  4BXU A;  3B6C A;  4UVB A;  2FRH A;  1N25 A;  1J2X A;  1BC8 C;  2P6T A;  2O0Y A;  1FY7 A;  1WH5 A;  3GW2 A;  4XLE A;  2QEN A;  2XPU A;  3QU6 A;  1W1W E;  1KGS A;  2A3S A;  4DW6 A;  3OIO A;  1IRF A;  1QGP A;  5F0H A;  5EGO A;  2PX9 A;  4L9N A;  1OCP A;  4XMY A;  1DPR A;  4LK0 F;  3HBL A;  2D5V A;  4PFP A;  2Y0S A;  2EWN A;  3GX4 X;  1W7P A;  3CJQ B;  4OIP F;  3S93 A;  1WWX A;  3ZP5 A;  1MKM A;  2DT7 B;  1S5L C;  3GO5 A;  1B6A A;  3HSF A;  3CO7 C;  2EIJ H;  2GA1 A;  4R8H A;  4DBR A;  4KIB A;  4G12 A;  3S3O A;  4A3B J;  4PGG A;  3JW4 A;  1FNN A;  2KZV A;  3CF2 A;  5M3M J;  3I64 A;  3ZQG A;  2K3P A;  2R7U A;  1TP4 A;  4GXO A;  4CCM A;  3KIO A;  2VC0 A;  2RVC A;  2YUS A;  3MKW B;  3ABL H;  5BPI A;  1BJA A;  3LSH A;  3VWB A;  1JT6 A;  3IWF A;  1ODD A;  2B63 J;  4BJ5 C;  3PFI A;  2E71 A;  1R6R A;  4UUV A;  1Z6T A;  2HZD A;  4QPQ A;  4XLP F;  3I59 A;  4CIC A;  2HDW A;  2IT0 A;  3BPV A;  3E7L A;  3WE3 A;  2XKP A;  4JX6 A;  2M9H A;  3IHU A;  4N4N B;  3NQO A;  3J81 K;  5HS7 A;  1J09 A;  2MLG A;  3E5Q A;  4XK4 A;  1FOK A;  2FF4 A;  1OYW A;  2NYX A;  5FFZ A;  2COM A;  4KUM A;  1O7F A;  2NXN B;  2DMN A;  4ABZ A;  4XIC A;  2R7R A;  4BE2 A;  2GXA A;  3R4K A;  1REP C;  2CWE A;  2PJP A;  1DP7 P;  2Y0M A;  2KRF A;  5FJ8 J;  1D0X A;  3CJN A;  4IHW A;  2OPT A;  4PJ0 C;  1IW7 F;  4MEX F;  1A6Q A;  4LG0 A;  1ZG5 A;  2A61 A;  3A4C A;  3H0D A;  2EFQ A;  2WY8 Q;  4XL9 A;  2HZT A;  1LFP A;  1UG2 A;  3ABU A;  5FLM J;  3QPS A;  3DBH B;  4CXF A;  3DWL E;  3LAP A;  1DQU A;  4V2F A;  2EA2 A;  3HG9 A;  3K0L A;  2RN7 A;  2O9L A;  5CQE A;  4B09 A;  2VAS A;  3BLY A;  5F64 A;  1ITY A;  3RPQ A;  3ZMU A;  5FD5 A;  2R7S A;  1HW5 A;  4A3M J;  4M71 A;  5E18 F;  1B9M A;  3L00 A;  1IUF A;  3ZMT A;  2ZXI A;  2QQB A;  3MN2 A;  4BHC A;  2JA5 J;  1IN6 A;  1ZHF A;  2NVU B;  1JXS A;  2HKO A;  4HLX A;  3FX3 A;  4FIS A;  2CFX A;  3CUQ C;  3VDX A;  4A3C J;  4EMS A;  2IVM A;  5DDG A;  3JAM K;  3E5X A;  4O5V A;  4CYD A;  2LBF B;  2M5W A;  2FEZ A;  4XKB A;  1R23 A;  2E35 A;  1D5Y A;  5CVR A;  1AKH A;  2O3F A;  3HGY A;  1IF1 A;  1UHW A;  4UVC A;  3O3K A;  4LD5 A;  1AWC A;  3DTI A;  3CC7 I;  1JUP A;  1ZEL A;  3L2Q A;  2HDD A;  2IS6 A;  4IHS A;  3ZQF A;  2MH2 A;  3C7J A;  1BI1 A;  1WHU A;  3WG9 A;  4F3Q A;  1LEB A;  4EQQ A;  4UVA A;  4FT8 A;  1XSD A;  1R71 A;  1QU3 A;  1X2N A;  3FXM A;  1WVR A;  2LC2 A;  2OTL I;  2OBP A;  4F7Z A;  1IO2 A;  3RQ4 A;  2QZ8 A;  4KA4 A;  3FBN B;  2LR8 A;  1PUF B;  1XGS A;  3GTO J;  2Z16 A;  3AFH A;  1IN8 A;  5LBQ A;  2DMU A;  5DS9 A;  4MNU A;  1I1S A;  1ETW A;  2A05 A;  4Q48 A;  3ZRG A;  2HNH A;  2K9M A;  2MLK A;  3WGG A;  4RAG A;  2DCE A;  2ECB A;  2WB1 A;  2LP0 A;  2E34 A;  3OYL A;  3PSI A;  2IPQ X;  2R7V A;  4GDF A;  1TWG J;  2Z99 A;  3AL0 C;  1N77 A;  4UNO A;  3W2W A;  2JRT A;  2HS5 A;  2L0K A;  3C2H A;  4MO7 A;  1TWC J;  3H5N A;  2ID3 A;  3V8K A;  5DCM B;  3OYH A;  3C3W A;  5GTI C;  1RC9 A;  4DYC A;  2G7H A;  2AHQ A;  3G73 A;  4FCY A;  1NTC A;  1I5Z A;  2XF7 A;  1PDN C;  1ZGJ A;  3HHG A;  3A01 A;  3BPX A;  1IGN A;  5ICE A;  3SDG A;  4QLC U;  3BG3 A;  4GCV A;  4F52 A;  4J19 A;  1K6Y A;  2EQR A;  1GLN A;  2H1L A;  2EA4 A;  2H6C A;  2KIQ A;  3BCB A;  1S29 A;  4Y17 A;  1VQ9 I;  1IDZ A;  4XRS A;  4NHJ A;  2XSD C;  2CMP A;  2JMW A;  1YO5 C;  4RA2 A;  4XLN F;  4XRF A;  3I56 I;  3QOP A;  3OYA A;  3JRE A;  3V4G A;  3F8B A;  2K3F A;  1KA8 A;  2ZXJ A;  3LQR A;  3V8L A;  1HA8 A;  1HXD A;  3C18 A;  2FML A;  5FO5 A;  1W7P D;  3FK6 A;  2K27 A;  4L18 B;  4RAY A;  4E7J A;  3KZY A;  3KCC A;  3OYJ A;  2EIK H;  2QQ8 A;  1VQM I;  1A04 A;  4NUB A;  2E2H J;  3SFI A;  5HNH A;  2OQG A;  2XRN A;  2ZB9 A;  1ZKG A;  1VND A;  5EYR A;  1LE8 A;  2NAZ A;  5FKO A;  1VQN I;  5ILU A;  2BBY A;  1RKW A;  1UB9 A;  2X48 A;  1J75 A;  2K5C A;  4RB0 A;  3S16 J;  4GFB A;  1K61 A;  5GAE J;  4E70 A;  2STT A;  1WJB A;  1YTY A;  1QRY A;  2QSF X;  3ONQ A;  2OJE D;  1KQ8 A;  3OY9 A;  1FSH A;  1O3Q A;  1MMG A;  4AVZ A;  5E1Z B;  5J4V A;  3MWM A;  2EFP A;  2W4S A;  2HPM A;  2W1O A;  5E79 C;  4ZYE A;  1IN7 A;  3BT9 A;  4BQA A;  4A93 J;  2CW0 F;  2R7O A;  3OS2 A;  2P8T A;  2BVL A;  2DA6 A;  2DPD A;  2XAG A;  3RJP A;  5IOZ A;  1BOA A;  1UMQ A;  3F3X A;  5DUI A;  1OQY A;  2ECC A;  2XF5 A;  3CCE I;  4MFD A;  5KVR A;  1T0F A;  1H89 C;  4M9X A;  3ZN1 A;  2QVO A;  3Q3S A;  2DU9 A;  2BW3 B;  2KIS A;  2STW A;  4CCL A;  2LFB A;  5AIP A;  2R92 J;  2PMZ N;  4BDZ A;  2EIM H;  2WC2 A;  2L4M A;  3M8F A;  4L5I A;  3K2A A;  3VYT B;  2JZY A;  4U87 A;  2ETH A;  4MFE A;  2K9S A;  1K83 J;  3PL8 A;  3RYP A;  4G6D A;  1VQ4 I;  2IS4 A;  3DTK A;  4EM0 B;  3DPU A;  4XN3 A;  5FRO A;  2BZT A;  2XGX A;  2VKV A;  1G3Y A;  4BBS J;  2PQ8 A;  5FGM A;  1LQ1 A;  5TJJ A;  5HDN A;  5LRR A;  1JGS A;  1D0Z A;  1BJZ A;  4HG2 A;  1Q1H A;  3SZG A;  4BH9 A;  2CQ7 A;  4HZF A;  1EV7 A;  3VOE A;  3R0A A;  1Z67 A;  1APL C;  3S15 J;  2HYJ A;  2FBH A;  2VKD A;  1AA7 A;  2MD5 A;  3VPR A;  3CDH A;  2DW4 A;  2WA0 A;  2DK8 A;  3O8G A;  5BMZ A;  1FC3 A;  2XSJ C;  2DI3 A;  1SFE A;  1QPI A;  4Q5S F;  5D5X B;  4WWC A;  3RTR A;  3IC7 A;  2LD5 A;  1DP3 A;  3V8J A;  2HFH A;  2ZKZ A;  4WCG A;  5EZG A;  3FIS A;  1E2X A;  3RKQ A;  1ACI A;  2LF7 A;  3U1D A;  5J6X A;  4FE7 A;  1F43 A;  4BXF A;  2GIV A;  1Z05 A;  4N9I A;  1OLT A;  3I58 A;  3BTI A;  2HGC A;  3HUG A;  5F27 A;  3BC8 A;  2E7W A;  3TDZ C;  4L9T A;  2K40 A;  3DF8 A;  3I53 A;  4DZP A;  3GZ5 A;  3A1Y A;  4KMF A;  2BYV E;  3KEO A;  2OQR A;  4ANJ A;  3FKI J;  1MJA A;  3CZ6 A;  2OF7 A;  3PIP F;  1XGN A;  2L02 A;  1T2K A;  1HOM A;  1TWA J;  2VXZ A;  4ZYH A;  3JRF A;  4ETS A;  1K6O A;  4I76 A;  5C4X J;  5B66 C;  3M1E A;  3F23 A;  3FM5 A;  3DLL F;  5IT9 K;  3DQV C;  3QP5 A;  2V9V A;  1H9T A;  4W1U A;  2E1M C;  3K70 D;  2A6T A;  3DKW A;  4U7B A;  2VQL A;  3VB2 A;  3F21 A;  2L5Q A;  3F9K A;  2KIU A;  1VQP I;  3F22 A;  2A69 F;  1G3W A;  3RPU D;  1BIB A;  5J47 A;  4FTH A;  1K4S A;  4X6A J;  3S2H J;  4AIK A;  1BR1 A;  3S1R J;  2W48 A;  3X2Q H;  1HBX G;  2R3S A;  2W85 A;  5FFX A;  1VQ6 I;  3BG7 A;  4J01 A;  2LVS A;  2MW8 A;  3BZC A;  3G1L A;  3IRQ A;  3IRR A;  5DCM A;  3J81 Z;  4M3D A;  2MG4 A;  1W5C C;  2HEO A;  3OOP A;  3HC7 A;  4B44 A;  1KYZ A;  4MQ9 F;  3N4M A;  4L0Y B;  2E19 A;  2NVT J;  1U8R A;  3OYE A;  2V4J C;  5EEG A;  1HST A;  1ZYR F;  2XAF A;  4LIT A;  2MFZ A;  3S17 J;  2Z33 A;  3L2V A;  2YU3 A;  1FOW A;  2P81 A;  3OSF A;  4JOM A;  5JLW A;  2KIF A;  3T8T A;  1TT5 B;  4UUS A;  4XOT A;  3BTC A;  1D8J A;  4NNJ A;  2XUB A;  5B1A H;  3KE2 A;  4KIS A;  2Q8K A;  3AG2 H;  2MC3 A;  1B4A A;  4KN7 X;  5K5R A;  2CUE A;  2EIL H;  2GXG A;  4BHP A;  2BHZ A;  3MD2 A;  1W4M A;  4PCQ A;  2LK2 A;  4RB1 A;  1MW7 A;  2N8G A;  2CUJ A;  2TCT A;  2PEX A;  3TO9 A;  3G4S I;  5J1R A;  4MTE A;  2JJ7 A;  5K7Z A;  1GVD A;  2EK5 A;  3ZXS A;  1RNL A;  2DTR A;  1YQA A;  2OUM A;  4HX8 A;  4IHY A;  3ISP A;  1LE8 B;  1ZK8 A;  2ELK A;  1P92 A;  2VQH A;  4WXC A;  4LK1 F;  3IH3 A;  4M9S A;  5TIS C;  3HOX J;  4UV8 A;  3RI4 A;  3I4M J;  2B9S A;  3JRC A;  1BC7 C;  3EET A;  4U0Y A;  3SJM A;  1MNM C;  2VPL A;  4NC6 A;  2NNY A;  1I6X A;  2BGC A;  3TW7 A;  1R1U A;  5M5W J;  4IRI A;  3RZD J;  2CFO A;  4EJW A;  2W82 A;  4BS9 A;  3AG1 H;  3SYT A;  3E3V A;  3DTE A;  2OC6 A;  1LDJ A;  3OYD A;  5IT3 A;  1YE9 A;  3H3V K;  4F55 A;  2E36 A;  3FXQ A;  2R7T A;  3F8N A;  3QP6 A;  5TRD A;  3RQI A;  1MH4 A;  2JVH A;  2KP6 A;  3FHZ A;  1TNS A;  3N05 A;  4BQO A;  4Y3O A;  1WJC A;  3JTG A;  3CD6 I;  3HTS B;  4NQW B;  1FP2 A;  2M2E A;  4B3A A;  1WGX A;  3R0J A;  2R93 J;  1HW2 A;  3AG4 H;  4BQQ A;  1AOY A;  3CCY A;  5IP9 J;  2CG4 A;  3E5U A;  4Y15 A;  2Y9Z A;  3GTM J;  1P9Q C;  2ELJ A;  3OOU A;  2P6S A;  5J40 A;  2EH3 A;  4ZYG A;  3C2G A;  2WAQ N;  1SFK A;  2NVQ J;  2GA2 A;  3I4P A;  2ZJP F;  1X19 A;  2JA6 J;  5IYC J;  4D9J A;  4C30 A;  4J00 A;  4A5N A;  4FET A;  1MJB A;  2V79 A;  3SXY A;  1X58 A;  4OIN F;  4RB3 C;  1E3P A;  4W97 A;  2R0Q C;  3ERM A;  5E3M A;  1ZGW A;  5JLX A;  2ZCW A;  4IO9 F;  1VTN C;  2KPM A;  4MHG A;  1X4P A;  4Y52 J;  5IY5 H;  4XR6 A;  4ZC3 A;  1S72 I;  3VOD A;  1D5V A;  3K4C A;  5JI6 A;  4EJT A;  4GRI A;  2LY1 A;  3OL3 A;  3F0C A;  3O8H A;  2QM3 A;  1ZG1 A;  2J5O A;  4QPO A;  1Z1D A;  2V6C A;  4HQE A;  2BV6 A;  4BUP A;  3FF5 A;  3DFG A;  5L3C A;  2HQA A;  4G8X A;  3GZ6 A;  3IV5 A;  5IP6 A;  1RRJ A;  1P7I A;  2BE5 F;  3HYI A;  5EEH A;  3JRI A;  1LB2 A;  1WFX A;  2IA2 A;  1K79 A;  2XDV A;  1WI3 A;  4E7Z A;  2AXT C;  4XNF A;  2FNA A;  1UCR A;  2V9P A;  2VJJ A;  2F4O B;  2MBF A;  4A3G J;  2KQR A;  4A12 A;  4C3J J;  1NG6 A;  2K4B A;  4JQF A;  2C6Y A;  1OIS A;  1HQC A;  1YHQ I;  1DDN A;  2OA4 A;  1HKQ A;  3OMY A;  3VSL A;  1X1C A;  3ELK A;  1BA5 A;  3ASN H;  3OYF A;  4M3G A;  4M3F A;  1IN4 A;  5KCM A;  4RAF A;  1DU6 A;  3BTJ A;  5LGN A;  3OIQ A;  5H20 A;  1YOV B;  1UEL B;  2QF7 A;  2O8K A;  2O61 A;  1C0W A;  3CDL A;  3LFU A;  2PLY A;  1KON A;  3V7R A;  4ZH4 F;  3GTQ J;  4L5J A;  3F6O A;  3NAR A;  1KZH A;  4B43 A;  1KYW A;  4HV5 A;  4N9H A;  5CVU A;  1Z3X A;  1GV5 A;  4ZZD A;  1W0T A;  3JAM Z;  4PDK A;  1UJ8 A;  2PBI A;  4AYB A;  4DNC A;  4OU0 A;  2P0W A;  1DU0 A;  4LIV A;  4IOA F;  5HDG A;  2DA7 A;  2DA5 A;  1FBS A;  2WB1 N;  2PJR B;  1D8K A;  2X0L A;  3C2B A;  3ZN0 A;  4DYR A;  1LDD A;  1MZB A;  2L7M P;  3HEF A;  4XQF A;  2QEX I;  4FAS D;  1R5G A;  2CV1 A;  4BL0 B;  3D0S A;  2DMT A;  4RBO A;  1I6H J;  1YG2 A;  2WBM A;  5KAI C;  3LSJ A;  4EV0 A;  3QOE A;  1MBJ A;  3FMR A;  2RQQ A;  1Y56 A;  3ULQ B;  5IYD J;  3QWL A;  1PYV A;  1UFM A;  2V7F A;  4G7O F;  5DM6 F;  4AD9 A;  4P9U A;  4TV7 A;  3HOY J;  3FXJ A;  3FBI B;  3R61 A;  2KL4 A;  2UWM A;  3K4L A;  1ZRC A;  2XB0 X;  2MAB A;  1J59 A;  3J7A Y;  3K9T A;  3KX2 A;  4D0P A;  3PNT A;  4D5C A;  3EDP A;  1MBE A;  4C9Y A;  2PMH A;  3EYI A;  1YW7 A;  3RIR A;  3HPH A;  2V1D A;  1SD5 A;  5JVT A;  2W25 A;  2I5U A;  2DAO A;  4ENJ A;  4CDG A;  5D5V B;  1X1A A;  4HBL A;  1Z91 A;  1ORK A;  5C44 J;  1HF0 A;  3OV8 A;  2EV0 A;  4XBF A;  4NBQ A;  3FZV A;  3W2A A;  4M72 A;  3FXL A;  3PQK A;  4FX0 A;  2WY7 Q;  1DUX C;  3SHF A;  1DPU A;  3H92 A;  2HQN A;  5DD4 A;  2FA5 A;  1U5T A;  1XD7 A;  1EKE A;  2DYR H;  2DPU A;  2E2J J;  1GDT A;  4RAZ A;  4IQ4 A;  1G59 A;  1U8B A;  1ULY A;  1XX5 A;  3KFW X;  5LRS A;  3FXK A;  3IP4 B;  1QVU A;  2FE3 A;  1BM9 A;  1IZ1 A;  1MBF A;  1GXQ A;  2I8D A;  3ZQQ A;  3G6E I;  1W5T A;  3F8C A;  1YFH A;  3GLL A;  3WTT C;  2BVM A;  2NRA C;  5BQT A;  4KIG A;  1JHH A;  4HLY A;  3A0B C;  1PP8 F;  1BW6 A;  2K7L A;  2V6E A;  2HKX A;  3BTL A;  4E4H A;  1FJL A;  4WF2 A;  1ZGA A;  2EFN A;  1U78 A;  3CJT B;  3FMQ A;  3ML6 A;  3M8J A;  2WWY A;  3CCV I;  4EGY A;  5HOO A;  3WTS C;  2ZFU A;  3H35 A;  5KK1 A;  3TO7 A;  2O6G E;  2VC1 A;  4S0H B;  4II3 A;  2Z2S B;  1K4T A;  4CGZ A;  3MKY B;  2HXO A;  2QQA A;  2VBY A;  3NRV A;  1D3Y A;  4A69 C;  5K5Q A;  1JHF A;  4HV6 A;  4IX7 A;  2MD0 A;  5D5U B;  3WG7 H;  2DTZ A;  4Q47 A;  4HW0 A;  4B48 A;  1Z7L A;  4L9J A;  4Z6Y A;  4ZYA A;  4IVN A;  4E7I A;  4ENN A;  2VOP A;  1UZC A;  3CCU I;  1B9N A;  4AYB N;  1VQ7 I;  1F4K A;  2HU9 A;  2LMD A;  2LNB A;  4V19 K;  2YX7 A;  1R4M B;  1WSU A;  3JRG A;  1NHA A;  4DJA A;  4HX4 A;  3MZY A;  2HR3 A;  1FIA A;  2B7E A;  4P96 A;  3H3U A;  4WXD A;  2FQ3 A;  2DDA A;  2HXI A;  3H36 A;  1Z9C A;  2CQN A;  1TTY A;  2JUC A;  2BOL A;  4IPA A;  2DQR A;  4YFX F;  4EVI A;  1IDY A;  3I4N J;  4Y33 A;  3KYL A;  2VXD A;  5HS8 A;  3I71 A;  4B3X A;  4HNU A;  1ZRD A;  1XMK A;  3HIF A;  2IS1 A;  3OYB A;  4RDU A;  3NWS A;  2LTP A;  4QTR A;  1ONV A;  4PJM A;  3DLA A;  3V7C A;  1EH8 A;  2ZFW A;  4MQV A;  1JJ6 C;  1P2F A;  1FPQ A;  2MC4 A;  4XKV A;  5HOD A;  4LG3 A;  3KLN A;  1ZG3 A;  3AG3 H;  4BE1 A;  2FBI A;  2LKX A;  4U0V A;  4M74 A;  2V9K A;  2NS7 A;  1WJA A;  1U3E M;  1L3L A;  1FT9 A;  3GZN B;  4XLH A;  3ROU A;  1FLI A;  2GOM A;  4CZC A;  2G7U A;  2RNJ A;  1AKH B;  2HVS A;  2VQC A;  3KZZ A;  1JTY A;  2G0E A;  1IAW A;  3BG5 A;  3WTY C;  3CCQ I;  1MMN A;  2JPB A;  3GTG J;  4NQW A;  3Q0V A;  2KFD A;  4ESF A;  2A5W A;  2Y0S N;  2DA3 A;  2DBB A;  2MYS A;  3QAH A;  1JKO C;  1RPW A;  4BY7 J;  2E1C A;  4IHV A;  3S1M J;  4EM1 A;  3ZMZ A;  2UXX A;  5FRN A;  5ICF A;  4I99 C;  4HQM A;  2VOD A;  4DYQ A;  3I9V 2;  3KP2 A;  4AID A;  2M87 A;  5D4S A;  3MCZ A;  4UB8 C;  3WHB A;  5E3O A;  5IYB J;  3BR2 A;  1MBH A;  3LL7 A;  2YU9 J;  1IXR C;  5LGT A;  2VN2 A;  1BR2 A;  4CYC B;  2P5L C;  3ABM H;  1XMA A;  3A0H C;  4EAT A;  1T98 A;  1MIJ A;  1YS7 A;  2NS8 A;  3CLQ A;  4DBQ A;  4C3I J;  2QYO A;  2LOO A;  3VEP A;  1LFU P;  2ICW G;  3K1N A;  1G3T A;  2HDC A;  2ADU A;  3FK7 A;  4I7H A;  5FLX K;  3IUO A;  3WGH A;  2CW7 A;  2XVC A;  3QYE A;  2E2I J;  2DFF A;  2HOE A;  3TOA A;  1WCM J;  5K5O A;  4BU2 A;  5TGT A;  4D5F A;  3KP5 A;  4GGG A;  2KJC A;  1S7E A;  3WGI A;  4QSH A;  1XMX A;  3LSR A;  2IGN A;  4Q4Z F;  1KQ9 A;  4K2E A;  4LIU A;  4U7D A;  4EGZ A;  1SD4 A;  1ZLK A;  3CMA I;  3MZH A;  3E0J B;  4UY8 I;  3VFZ A;  2VB6 A;  2ZBK A;  1S6L A;  3ZPL A;  5E8G A;  2DDB A;  1H8A C;  3HDD A;  1G4D A;  2EFO A;  2LKP A;  2RNG A;  2CS3 A;  2XPV A;  2WV1 A;  2GQQ A;  3HOT A;  1VQL I;  2E1O A;  3S32 A;  4M3E A;  3P7N A;  4S04 A;  3HZJ A;  4G7Z F;  2OV7 A;  2H6B A;  3AAF A;  1WQ2 A;  4G7H F;  2QGU A;  3IAS 2;  4MGR A;  1R36 A;  4UHT A;  2TDX A;  4JK1 X;  1QA6 A;  3GTP J;  3HOU J;  3PO3 J;  2Z5U A;  4UV9 A;  1STZ A;  4YIR X;  2F4M B;  1ZAO A;  1S9H A;  2HYG D;  2Y9Y A;  5D8L B;  3K4K A;  3ERE D;  1IXS B;  3L2W A;  1MNE A;  4YG2 F;  5GAH J;  3ZQC A;  2NVY J;  2XAS A;  2E1M B;  4Y13 A;  3RYR A;  4E7K A;  4P1W A;  2PFB A;  3I54 A;  1QHG A;  4HST A;  2WV0 A;  1Y0U A;  3HSE A;  4O6J A;  2ACJ A;  4Z2Y A;  4ZTF A;  3L2C A;  2L7K A;  3LA2 A;  2PJR A;  2M0M A;  2ZNZ A;  3QPT A;  2M3A A;  3I3L A;  2LBF A;  3TED A;  1YYV A;  3DEE A;  3HB9 A;  2Q2E B;  4OIR F;  3PSF A;  5HLI A;  4XN0 A;  5EJC A;  2LLK A;  4OAY A;  3AKZ A;  1LNW A;  3OR2 C;  2DYS H;  2KDO A;  1OFC X;  4RGR A;  3CQZ J;  3CC4 I;  2DJN A;  5C3E J;  2WTE A;  2X4H A;  5FKL A;  2FNP A;  2CUZ A;  1VQK I;  1UAA A;  1BBY A;  4XLF A;  3UKG A;  1A35 A;  2DMP A;  1X4O A;  3KEQ A;  2XAJ A;  3ZR8 X;  4CCJ A;  1K7A A;  1ZTR A;  2K85 A;  2L3D A;  1ON1 A;  3HTU A;  2EPF A;  4O3M A;  5BPD A;  1QO0 D;  3M9A A;  3NWT A;  5DUK A;  5F0F A;  4JYK A;  3EUA A;  1KU2 A;  4HDU A;  5EF6 A;  2EV6 A;  3L2U A;  3M8E A;  4IZZ A;  2IS2 A;  3MKZ A;  1JJ8 C;  5CLS A;  3EPZ A;  1RIO H;  4IQJ A;  5KAF C;  3OR1 C;  3TO6 A;  3M4O J;  3T5X A;  1H9G A;  3OS1 A;  1TNT A;  1NG7 A;  2BY2 A;  3FHN A;  4U88 A;  3FKJ A;  3K7A J;  2NNN A;  1I3A A;  1V54 H;  1T38 A;  5E20 A;  4C2T A;  1ERD A;  1BI0 A;  1FX7 A;  1YX5 A;  5CPR B;  4PJJ A;  1MMS A;  4XM3 A;  3F8F A;  3KLO A;  2KLO A;  2DMQ A;  4MIM A;  3W2V A;  2R7W A;  2R7D A;  2CYY A;  4P9F A;  3TL4 X;  2L9S A;  5LEK A;  4JP0 A;  2ZJR F;  1XDS A;  3GWZ A;  3VYS B;  5ERI A;  5CVI A;  4B4C A;  2EFW A;  1ETK A;  1R58 A;  2GXB A;  2BEO A;  2LF8 A;  3HXL A;  1SVO A;  3Q9S A;  2L01 A;  3VSK A;  2Z9O A;  4KN4 X;  2OCC H;  5CVV A;  1PP7 U;  5HLG A;  5LD2 C;  1R7J A;  2EJR A;  3UNG C;  2BY1 A;  3G2B A;  2D1H A;  4PSX A;  3CTA A;  1LJ9 A;  4DQ2 A;  1HSJ A;  2VJ4 A;  3S2D J;  5F6F A;  1MND A;  1U5T C;  3D5L A;  1I1G A;  3LOC A;  4XKC A;  4Y4R A;  3SEQ A;  3BR3 A;  3BQY A;  4CUG A;  4A0Y A;  3HOS A;  1QVT A;  4E7L A;  1Z77 A;  3CLO A;  3PUF A;  4RLQ A;  1YIJ I;  3WTZ A;  4RGX A;  2H8W A;  5E1X A;  5F1R A;  2Y69 H;  4RM3 A;  1BIA A;  1OYY A;  2OD5 A;  5F1J A;  4IRG A;  2PMU A;  1CF7 B;  1GXP A;  1VFC A;  4RM2 A;  2Y2Z A;  4ZZL A;  2OTJ I;  4CHU A;  3D5S C;  2KRH A;  3TQN A;  5DTD A;  2WAD A;  2LDU A;  5H6R A;  3OYN A;  1JKR C;  1T6S A;  2A07 F;  1OMI A;  2X1C A;  3MAJ A;  3ZQI A;  1OCC H;  2GBY A;  2V1N A;  1F5T A;  5J3L A;  3CP8 A;  1XS9 A;  4YEL A;  3G71 I;  1GHC A;  3CUQ B;  3S8P A;  3KP3 A;  1SD7 A;  1LUJ B;  2CRG A;  1JKQ C;  5H6Q A;  2FXA A;  1SC7 A;  1IV8 A;  2KMU A;  2MGQ A;  1WJD A;  3GFM A;  3SQN A;  4MEY F;  3J80 K;  2F5C A;  4OIO F;  3CMY A;  4ENK A;  1TWF J;  3BRO A;  2CJJ A;  4I98 B;  2O8X A;  2DFH A;  2V26 A;  2ZSI B;  3K70 C;  2FOK A;  1B72 B;  2F6C A;  2YR2 A;  2AO9 A;  4XRS G;  1MDM B;  2LSO A;  2E5Z A;  1S8N A;  4A3K J;  3S3N A;  4GYI A;  2A6E F;  5L3F A;  1D1B A;  5EDN A;  5FRM A;  4XLC A;  2DOE A;  2CW8 A;  4A2U A;  2BW3 A;  2F5E A;  3K2Z A;  4M9Z A;  1UHS A;  4CYC A;  3RDI A;  4E6K G;  3QYB A;  5FLV A;  3GVA A;  3Q9V A;  5F04 A;  2NVX J;  4V2G A;  1X1P A;  4D1Q A;  2BXY A;  4XON A;  2H09 A;  4BDY A;  3HM5 A;  1Z7U A;  2HQR A;  1WJF A;  1XC5 A;  2MA3 A;  2QQ9 A;  4C3H J;  2H27 A;  1WJ5 A;  1XSX A;  1WKM A;  3PM1 A;  4CA0 A;  4A3I J;  3R60 A;  3CJR B;  1PVE A;  3H9G A;  3ABK H;  1N78 A;  2ZXH A;  3HJE A;  2ZXW H;  2ZO4 A;  3A2K A;  4C2U A;  3PIO F;  2OU2 A;  5J1U A;  2WAF A;  2KDZ A;  4ESJ A;  1FTZ A;  2P7C B;  2AQE A;  3BR1 A;  3HRU A;  1Z0X A;  4WXH A;  2R5Z B;  3BOQ A;  4UB6 C;  1SMT A;  2E60 A;  1B8I B;  1OYI A;  3QOD A;  3GFL A;  1V3F A;  4G6Q A;  2EV5 A;  2IGM A;  1D1C A;  2XKO A;  2HVR A;  2DFE A;  3DBR B;  1G6N A;  2DT5 A;  1XN7 A;  2B0L A;  4XOP A;  1WI9 A;  1ZH5 A;  3Q0U A;  4MTD A;  1VQ8 I;  3ASO H;  4A3E J;  3I5U A;  2M8G X;  1GV2 A;  1G8X A;  4HPQ A;  4LJZ F;  2RC4 A;  1FBQ A;  5KHD A;  1JT0 A;  1R49 A;  4YFK F;  4X0G A;  2YS9 A;  3CF5 F;  1YI2 I;  1QBJ A;  1HDD C;  4PUS A;  4YII A;  3KP4 A;  4EJU A;  3CO6 C;  1YLF A;  5EG0 B;  2VBW A;  3DEU A;  3L09 A;  4BE0 A;  2YX4 A;  4LLN A;  4CO8 A;  1SFO J;  1ON2 A;  2QSH X;  4BJT A;  3IL2 A;  2MSY A;  2M34 A;  5M5Y J;  3RKW A;  1OCO H;  2DOD A;  2XAQ A;  4I6Z A;  3EUK L;  2K9N A;  3WU1 B;  5E17 F;  2JRM A;  5ILS A;  4BYY A;  1VZ0 A;  4BGD A;  1S3J A;  3GF2 A;  1IJW C;  2H94 A;  2Q0O A;  2M7A A;  3PQJ A;  4DGW B;  3KET A;  1TWH J;  5LEJ A;  5J4Y A;  2LY2 A;  2R7X A;  3K4N A;  3DU5 A;  4N4O B;  5L3E A;  1SVM A;  4ZTJ A;  4KYW A;  1HDP A;  1GUU A;  4XSZ F;  1ETQ A;  1KU9 A;  3LST A;  1UG0 A;  4IF4 A;  5E8I A;  3SZT A;  3MKL A;  2JA8 J;  4HNV A;  2NS0 A;  2IP2 A;  2L7Z A;  4HF0 A;  2PMZ A;  5D6F A;  4CCK A;  5FKN A;  2Q2E A;  2LY9 A;  2K86 A;  4CSW A;  4KT6 A;  2GM4 A;  5LHI A;  2L9N A;  1D1A A;  1J5Y A;  1X1B A;  5EZH A;  5K7H A;  1P6R A;  3QYF A;  3OS0 A;  2VLA A;  3HRS A;  3P9C A;  3EUH C;  3KEY A;  2QUF A;  5J8C A;  4PFO A;  2ME6 A;  1U6G A;  3CMM A;  2X85 A;  3BZ6 A;  2DK5 A;  1SEU A;  2QBY A;  4M6V A;  4H4K C;  1LPQ A;  1RUO A;  1I39 A;  4HA8 A;  2J5P A;  3ECO A;  4BAY A;  2QSG X;  3QU3 A;  2E1N A;  1R4N B;  4DOZ A;  1Y1W J;  1CGP A;  4LLL A;  1OCR H;  2RRE A;  3BR5 A;  1V5G A;  1Y8R B;  1AU7 A;  3PNV A;  3E1S A;  3E97 A;  3K69 A;  2DOA A;  4BEH A;  5ICC A;  4BY1 J;  1LKX A;  2JT1 A;  2NOG A;  5DYM A;  2W84 A;  2DLL A;  4I01 A;  2F4I A;  1IC8 A;  3AL0 B;  3HGG A;  3FXO A;  3OL4 A;  3CUQ A;  3K4B A;  1WJE A;  1GVJ A;  2LRD A;  4HX7 A;  3TP3 A;  4HNT A;  5IT9 Z;  2EIN H;  2CU7 A;  2VT3 A;  1IV6 A;  3HL2 A;  2L2O A;  5DM7 F;  2GIZ A;  1XPX A;  3JTH A;  3U21 A;  4EJV A;  1JUS A;  3Q0W A;  4LMY A;  3CCL I;  3HSR A;  3GTJ J;  3W6K B;  3WTX C;  3JSP A;  2VKE A;  2IBD A;  4FQG A;  4HEA 2;  1LDK B;  2EZL A;  3BR6 A;  2QCO A;  4PJN A;  5K7F A;  3LSP A;  4B47 A;  4RMN A;  1Q1V A;  1R1V A;  5CJ9 A;  3TP0 A;  4BNC A;  2ISZ A;  1T39 A;  1RR8 C;  2HOT A;  3KP7 A;  1XB4 A;  2P4W A;  1X2M A;  4KNY A;  1MMA A;  1R5I D;  2DFI A;  4P55 A;  4XID A;  2FD5 A;  2ZJ2 A;  2UV1 A;  2E5N A;  3OYG A;  1BN5 A;  1SAN A;  3HOV J;  3U2R A;  3FIW A;  4AU7 A;  3DBL B;  1MSF C;  2DT6 A;  3BP8 A;  1A5J A;  3SZP A;  1WH7 A;  3CES A;  1HC8 A;  1MJ9 A;  3WU2 C;  2VJI A;  3QPL A;  4AM3 A;  3GLX A;  5DEQ A;  4GO1 A;  2UXN A;  2X9D A;  5CVJ A;  1D0Y A;  4QWQ A;  1OJL A;  3MQ0 A;  2YSR A;  2KT0 A;  5FD6 A;  5JR3 A;  1SFU A;  1GT0 C;  1X1D A;  4I09 A;  3H3Z A;  1XTA A;  4BHB A;  4AVP A;  2XV4 S;  2Y75 A;  2VOO A;  3LAJ A;  2GAU A;  3A01 B;  2A6H F;  3SFZ A;  3Q5F A;  2PG4 A;  4L9V A;  2OAZ A;  1Y39 A;  2ESN A;  1TLH B;  5HLH A;  1U9O A;  5AON A;  3UR3 C;  4BJ6 C;  2V1U A;  4BXX J;  3GFI A;  4HRI A;  1PJR A;  1W5S A;  1ENH A;  1H88 C;  4XRM A;  4S05 A;  5LHG A;  3RCO A;  4NB5 A;  3JSO A;  4LG0 B;  5FKM A;  2RKH A;  4KIC A;  1K78 B;  3M7G A;  3MMY B;  3BCA A;  3A03 A;  3S14 J;  4I0A A;  1FYL A;  3DU6 A;  1YX3 A;  2IAI A;  2UUZ A;  3KYD B;  2VBZ A;  4RB2 C;  3ZMV A;  1LEA A;  2RGV A;  3N97 A;  2VON A;  1RKT A;  2VPR A;  1DGW Y;  1KU3 A;  2DN0 A;  5GAG J;  3VYU B;  3OYC A;  3QRF F;  1YW9 A;  3HOW J;  1O3R A;  3E6B A;  1O3S A; 
#chains in the Genus database with same CATH homology
 2DA4 A;  1G2H A;  2Y9Y A;  2RAE A;  2JN6 A;  2E19 A;  2NVT J;  3M3Y J;  4UUT A;  3ZQC A;  1ZR4 A;  2EZK A;  2NVY J;  1ETY A;  3S17 J;  1MH3 A;  5E3L A;  5M3F J;  3TW6 A;  3IH4 A;  1PUF A;  2P81 A;  3G1O A;  4QIW N;  3OSF A;  3LNQ A;  5JLW A;  4UUS A;  1YRN B;  2ME0 A;  3BTC A;  3BR0 A;  1Y1W J;  3B6A A;  3JRH A;  3TED A;  1I50 J;  3HB9 A;  1IRZ A;  2CUE A;  2LLK A;  5GPC A;  2LK2 A;  3DCF A;  4BBR J;  2N8G A;  2TCT A;  3GBG A;  2R5Y B;  4A3D J;  1OFC X;  5J1R A;  3LSG A;  3CQZ J;  2JJ7 A;  5IOY A;  2DJN A;  5C3E J;  1OCT C;  5K7Z A;  1GVD A;  5F0C A;  5FKL A;  5GP9 A;  3UKG A;  1P7J A;  2DMP A;  5IPA A;  1ZTR A;  4IHY A;  1LE8 B;  1ZK8 A;  2ELK A;  3B6C A;  3BG9 A;  1CQT A;  2XRL A;  3IH3 A;  4AC0 A;  3HOX J;  1RR7 A;  5F0F A;  1WH5 A;  3I4M J;  2XPU A;  4JYK A;  5F08 A;  3JRC A;  4DW6 A;  3OIO A;  5EF6 A;  5F0H A;  5EGO A;  1OCP A;  3HBL A;  2D5V A;  1JJ8 C;  3SJM A;  1MNM C;  1IG7 A;  3TW7 A;  5M5W J;  3M4O J;  3RZD J;  2Y31 A;  2FJ1 A;  2XGC A;  3K7A J;  4G12 A;  3H3V K;  3S1Q J;  4A3B J;  2H1K A;  4IHX A;  4MLO A;  3RQI A;  1MH4 A;  3NAU A;  2I10 A;  2VI6 A;  2DMQ A;  4MIM A;  4AUX A;  5M3M J;  3ZQG A;  4JP0 A;  2M2E A;  4B3A A;  1WGX A;  3ZOB A;  2R93 J;  4B4C A;  2YUS A;  3W6V A;  1ETK A;  3CCY A;  5IP9 J;  1JT6 A;  2Y9Z A;  1JGG A;  2B63 J;  3GTM J;  3OOU A;  2EH3 A;  2WAQ N;  2NVQ J;  1T33 A;  2JA6 J;  5IYC J;  3D1N I;  2JA7 J;  1X58 A;  1ETX A;  3S2D J;  4W97 A;  3E7L A;  4Y7N J;  2IEK A;  4JX6 A;  3LOC A;  5E3M A;  2R0Q C;  2M9H A;  3BR3 A;  1ZGW A;  3BQY A;  5JLX A;  1ZQ3 P;  4Y52 J;  1QVT A;  1RET A;  2M0C A;  3JRD A;  1FTT A;  1Z77 A;  4XK4 A;  3ZQL A;  3GTK J;  4L5E A;  5F1J A;  3F0C A;  3O8H A;  4ABZ A;  4XIC A;  1O4X A;  2DMN A;  1VFC A;  2Y2Z A;  3MVP A;  3IV5 A;  5IP6 A;  1P7I A;  3JRI A;  5DTD A;  1JKR C;  5FJ8 J;  3ZQI A;  4IHW A;  2GBY A;  1WI3 A;  2OPT A;  5J3L A;  1XS9 A;  1TC3 C;  3QQA A;  4A3G J;  4C3J J;  1EF4 A;  2CRG A;  1JKQ C;  1BL0 A;  1UG2 A;  5FLM J;  2DA1 A;  5C4J J;  3QPS A;  2MGQ A;  2XGD A;  4V2F A;  3JR9 A;  2O9L A;  1ITY A;  1BA5 A;  3CMY A;  4X1E A;  1W0U A;  1TWF J;  4M3G A;  4M3F A;  1LFB A;  2CJJ A;  4A3M J;  1DU6 A;  3BTJ A;  1IUF A;  1B72 B;  2QF7 A;  3MN2 A;  2JA5 J;  2AO9 A;  2O8K A;  4XRS G;  3CDL A;  5E3N A;  4A3K J;  4FIS A;  3GTQ J;  5EDN A;  1R9T J;  3NAR A;  4A3C J;  2HOS A;  5BNG A;  1GV5 A;  1W0T A;  1UHS A;  4CYC A;  5FLV A;  5F04 A;  2NVX J;  4V2G A;  1DU0 A;  1D5Y A;  2DA7 A;  2DA5 A;  3HM5 A;  1AKH A;  3HGY A;  3PO2 J;  1XC5 A;  2WB1 N;  2JWT A;  4C3H J;  4DYR A;  3C2B A;  3PM1 A;  4A3I J;  3HEF A;  2L7M P;  1JUP A;  2HDD A;  3ZQF A;  4A3F J;  5J1U A;  2DMT A;  4RBO A;  2KDZ A;  3GTL J;  1I6H J;  1FTZ A;  2R5Y A;  1JTX A;  3BR1 A;  3LSJ A;  1MBJ A;  5IYD J;  1X2N A;  1Z0X A;  2R5Z B;  1B8I B;  2O7O A;  3HOY J;  2LR8 A;  1PUF B;  3GTO J;  2EZH A;  1ETO A;  2DMU A;  5DS9 A;  1YRN A;  1ETW A;  2XB0 X;  4D5C A;  2ECB A;  1MBE A;  2LP0 A;  1MBK A;  1VI0 A;  3Q0U A;  1TWG J;  1I3Q J;  5M5X J;  4A3E J;  1ORK A;  5C44 J;  1HF0 A;  2M8G X;  1GV2 A;  2L0K A;  4MO7 A;  1TWC J;  1JT0 A;  2ID3 A;  1E3O C;  2YS9 A;  4DYC A;  4M3B A;  1AHD P;  1HDD C;  2AHQ A;  4FCY A;  1NTC A;  1Y1V J;  2Y30 A;  5EG0 B;  3A01 A;  1IGN A;  3SDG A;  3BG3 A;  1SFO J;  4J19 A;  2GLO A;  2EQR A;  2CQQ A;  2E2J J;  2MSY A;  4XRS A;  1GDT A;  1IDZ A;  2XSD C;  3L1P A;  1BW5 A;  2JMW A;  1U8B A;  2M34 A;  4IEJ A;  5M5Y J;  3JRE A;  1QVU A;  5EGO B;  1XG1 A;  1MBF A;  4I6Z A;  2K9N A;  3BQZ A;  3IH2 A;  5J1Y A;  2DA2 A;  1IJW C;  1BW6 A;  4NDL A;  3BTL A;  3FK6 A;  1FJL A;  3HOZ J;  1TWH J;  1U78 A;  1F36 A;  2HOA A;  4FE4 A;  2H8R A;  1HDP A;  2E2H J;  1GUU A;  4S0H B;  1ETQ A;  2L7F P;  2HXO A;  2FQ4 A;  3SFI A;  2R7Z J;  2ZB9 A;  1ZKG A;  1VND A;  3MKL A;  5EYR A;  1LE8 A;  5FKO A;  4A69 C;  3HKZ N;  2JA8 J;  4HNV A;  2DTZ A;  5EEA A;  1POG A;  2L7Z A;  3DEW A;  2EBI A;  1RES A;  1RKW A;  2X48 A;  5FKN A;  2LY9 A;  3S16 J;  2FX0 A;  4GFB A;  1K61 A;  2GM4 A;  1QRY A;  4B1R A;  2R5Z A;  4AYB N;  1B8I A;  5EZH A;  5K7H A;  3ZQH A;  3JRG A;  1U9N A;  1T56 A;  1FIA A;  4A3L J;  2ME6 A;  9ANT A;  2HXI A;  2COB A;  3BT9 A;  4M6V A;  4A93 J;  1NK2 P;  2L9R A;  1IDY A;  3I4N J;  1B72 A;  2DA6 A;  4C2M J;  3BR5 A;  5IOZ A;  1AU7 A;  1UMQ A;  2ECC A;  4RDU A;  4MFD A;  4JX4 A;  2LTP A;  1H89 C;  4QTR A;  4BY1 J;  2NOG A;  2CQX A;  3Q3S A;  1JJ6 C;  2LFB A;  5GPA A;  5HOD A;  1IC8 A;  2PMZ N;  2R92 J;  1HCR A;  3A02 A;  5EG0 A;  3K2A A;  1JUM A;  3HGG A;  2LKX A;  4MFE A;  2K9S A;  1K83 J;  3TP3 A;  2NS7 A;  3G1M A;  2CU7 A;  2VUM J;  3H0G J;  1IV6 A;  2HQ5 A;  1AKH B;  1JTY A;  2G0E A;  2ID6 A;  1JUS A;  3BG5 A;  3Q0W A;  1ZR2 A;  2VKV A;  4BBS J;  4D7N A;  3GTJ J;  3GTG J;  3Q0V A;  2VKE A;  2Y0S N;  2DA3 A;  2IBD A;  3JRB A;  2EZL A;  1JKO C;  1BJZ A;  3BR6 A;  1RPW A;  2QCO A;  4BY7 J;  4IHV A;  3S1M J;  5K7F A;  3LSP A;  1Q1V A;  3TP0 A;  4DYQ A;  2HOT A;  4UUS B;  1APL C;  3S15 J;  1X2M A;  2HYJ A;  4D7M A;  3VPR A;  3WHB A;  5E3O A;  4XID A;  5IYB J;  3BR2 A;  1MBH A;  3O8G A;  1NK3 P;  2FD5 A;  2YU9 J;  1QPI A;  2X6O A;  5FKK A;  1ETV A;  4CYC B;  1SAN A;  1MSE C;  3HOV J;  3FIW A;  2LD5 A;  1MSF C;  4A3J J;  1A5J A;  3S1N J;  1WH7 A;  4EEF G;  3QPL A;  3FIS A;  5EZG A;  2NS8 A;  4C3I J;  3RKQ A;  3JRA A;  1LFU P;  2X9D A;  4FE7 A;  5IP7 J;  1F43 A;  1FEX A;  1OJL A;  1GT0 C;  2KT0 A;  1FIP A;  3FK7 A;  3BTI A;  5F27 A;  2HI3 A;  3OSG A;  2K40 A;  4DZJ A;  2E2I J;  4DZP A;  1WCM J;  4D5F A;  3FKI J;  2OF7 A;  3A01 B;  1HOM A;  1S7E A;  1TWA J;  2XB5 A;  3JRF A;  4QSH A;  1MBG A;  2CUF A;  4I76 A;  3LSR A;  5C4X J;  1U9O A;  4BXX J;  1H88 C;  1ENH A;  2EZI A;  4XRM A;  4W1U A;  2JK3 A;  4JX5 A;  1WPK A;  3RZO J;  2XGE A;  5FKM A;  1H8A C;  3A03 A;  3HDD A;  2K9Q A;  2XPW A;  4FTH A;  3S14 J;  2TRT A;  2WV1 A;  2XPV A;  4X6A J;  3S2H J;  2E1O A;  4M3E A;  2IAI A;  3WHC A;  3S1R J;  2W48 A;  4LOC A;  1JKP C;  3GTP J;  1RKT A;  2VPR A;  2DN0 A;  1A6I A;  2LVS A;  3HOU J;  2MW8 A;  1HLV A;  3PO3 J;  1VF9 A;  3G1L A;  3HOW J;  4M3D A;  2MG4 A;  4BKX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...