1WH6A

Solution structure of the second cut domain of human homeobox protein cux-2
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
101
structure length
101
Chain Sequence
GSSGSSGQYELYMYREVDTLELTRQVKEKLAKNGICQRIFGEKVLGLSQGSVSDMLSRPKPWSKLTQKGREPFIRMQLWLSDQLGQAVGQQPGASSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the second CUT domain of human Homeobox protein Cux-2
rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords Homeobox protein Cux-2
total genus 22
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2004-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02376 CUT CUT domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 1wh6A01
1QQBA 3GN5A 2OR1L 2KEJA 2XCJA 1UXCA 1Y9QA 2LCVA 2XSDC 4Z5CA 2R63A 1LCCA 2PUCA 4Z58A 2PUBA 3IVPA 1ADRA 2PUAA 2BNMA 4OB4A 3BS3A 4Z59A 4GHJA 3G7DA 3GN5B 1QP0A 1PNRA 2PUDA 2HSGA 1PRUA 4J1XA 3CLCA 1ZPQA 1S7EA 4I6UA 3F52A 3OQMA 2LYKA 1LQCA 2XI8A 1HF0A 1L1MA 1BDIA 4YARA 1RZRA 1XWRA 2OFYA 1JWLA 1LMB3 2ICTA 3B7HA 3VK0A 2AW6A 3KXAA 1RIOA 3G5GA 2KPJA 1LLIA 4I8TA 1X2LA 3H5TA 2MEZA 2KZ8A 2L8NA 1UTXA 2GRMA 3SCGA 4X4DA 1PRAA 1PERL 2D5VA 2LYRA 4PU7A 2BNOA 2O38A 2PIJA 2WUSR 2PUGA 2AXUA 3OQOA 2IU7A 4Z5DA 1ZAYA 3ZKCA 1RZRD 1DWKA 4YG1A 3JXDL 1RPEL 3HZIB 4X4IA 1ZZ9A 4X4CA 3D1NI 1WETA 1VPWA 2O4AA 1O4XA 1POUA 2JCGA 2LYJA 4O8BA 2GRLA 1Y7YA 1QP7A 4Y42A 3KJXA 3U3WA 3QWGA 1CJGA 2PUEA 2WIUB 4F8DA 1ZVVA 1WH8A 1PRVA 2EF8A 2GZUA 3TRBA 4X4EA 3BDNA 2HINA 2LYLA 1ZZCA 1ZZ7A 1DW9A 1NEQA 3F6WA 4MCXA 2BNNA 1AU7A 2IVQA 1OCTC 2LYSA 2AXVA 2LYPA 3QF3A 4X4HA 3RZZA 4JCXA 1OSLA 1CQTA 1QP4A 2BJCA 4IWRA 3JXCL 2ICPA 4FN3A 4MCTA 4YG7B 4IVZA 2KEKA 1JFSA 3UFDA 3DNVB 2H8RA 2PUFA 1R69A 1ZUGA 3FYAA 3CECA 4J1WA 1YSEA 3OP9A 1NERA 3MLFA 4I6RA 3L1PA 4I6TA 4X4GA 4PU8A 2CSFA 3PXPA 4Z5HA 2R1JL 3KZ3A 4JQDA 3SCFA 3R1FA 4GQMA 5A7LA 4FBIA 2LYQA 3JXBC 1BDHA 3QQ6A 2KEIA 3BD1A 1GT0C 3CROL 2PE5A 2MQKA 3GBFA 1WIZA 1E3OC 1R63A 1QPZA 3ZHIA 2IV1A 4IA8A 4PU3C 4PU4C 2AUWA 1B0NA 4YBAA 3QYXA 2EBYA 3FYMA 5K98B 1JH9A 3S8QA 4X4BA 1ZS4A 2A6CA 3ZHMA 2B5AA 3OMTA 4JCYA 2O49A 2AWIA 1WH6A 2IUOA 2L49A 4YG4A 3O9XA 3LFPA 2IVBA 1X57A 2PPXA 4NDWA 3SCHA 1QQAA 1ZZ8A 1RZSA 1JFTA 3EUSA 1IC8A 1UXDA 2IVGA 2XIUA 4X4FA 1ZZ6A 1ZZBA 3OQNA 2EWTA 3FMYA 2XJ3A 1LCDA 1SQ8A 2FJRA 2JVLA 3LISA 3F51A 2CROA 2AXZA 1EFAA
chains in the Genus database with same CATH superfamily
3GN5A 3VWSA 4DE8A 3IVPA 2BNMA 2M4HA 3BS3A 4Z59A 5DTMA 1S7EA 3GZCA 1L1MA 4EQZA 1LMB3 2AW6A 3KXAA 2PXTA 2LLWA 4I8TA 2KZ8A 2L8NA 1PERL 1PRAA 2PIJA 2AXUA 1ZAYA 2JQEA 4X4IA 4O8BA 1QP7A 3QFIA 4Y42A 3U3WA 3ZPXA 1PRVA 3TRBA 3BDNA 2J7UA 1NEQA 2BNNA 4X4HA 2LYPA 4IWRA 1OSLA 1CQTA 2BJCA 2ICPA 4IVZA 1NW3A 1JFSA 2PXVA 3DNVB 2PUFA 3FYAA 4J1WA 3DM5A 1YSEA 3OP9A 3MLFA 3L1PA 4I6TA 3QOXA 3KZ3A 2PXPA 4JQDA 2V3CC 2PE5A 3GBFA 1R63A 2IV1A 2ODRD 4PU4C 2AUWA 3QYXA 5K98B 1JH9A 2PXKA 2B5AA 2IUOA 2L49A 2PXUA 3LFPA 5GAGi 2PPXA 1ZZ8A 1RZSA 2XIUA 2EWTA 3LISA 3F51A 2OR1L 1UXCA 1Y9QA 4Z5CA 2R63A 3SX0A 1ADRA 3G7DA 2HSGA 1PRUA 4J1XA 2LNMA 3CLCA 4I6UA 2XI8A 5DTQA 4ER6A 1BDIA 4YARA 1RZRA 2ICTA 1RIOA 3G5GA 3NROA 1X2LA 3H5TA 4X4DA 3SCGA 2GRMA 2D5VA 4Z5DA 1RZRD 1DWKA 2PXLA 3R09A 4EKGA 1WETA 1VPWA 4ER7A 1POUA 2JCGA 1CJGA 2PUEA 4F8DA 2EF8A 3F6WA 1OCTC 1AU7A 2LYSA 2PXDA 3KL4A 4JCXA 1QP4A 3JXCL 4MCTA 4YG7B 4ER3A 3UFDA 3A9YA 2H8RA 1R69A 2HFZA 2R1JL 4GQMA 2XXAA 2J7WA 1BDHA 2KEIA 3ME5A 2MQKA 3M9LA 1QPZA 3OWQA 4PU3C 4YBAA 3FYMA 2YBDA 4X4BA 1ZS4A 3ZHMA 1WH6A 4YG4A 3O9XA 2IVBA 1JFTA 3PE5A 1IC8A 1UXDA 2IVGA 2XXQA 1ZZ6A 3OQNA 3NDBB 5DRTA 1SQ8A 2FJRA 2JVLA 5GAHi 2AXZA 1QQBA 2KEJA 2XCJA 2PUCA 4OB4A 5DRYA 4GHJA 2PUDA 3TELA 1QZXA 3F52A 2LYKA 1LQCA 3A9ZA 2KPJA 1LLIA 2MEZA 3UWPA 3SR4A 4PU7A 2BNOA 2PXBA 3QOWA 2WUSR 3MEJA 5DSXA 3OQOA 3ZKCA 4YG1A 4EK9A 3HZIB 2O4AA 4X4CA 1O4XA 4WVLA 2LYJA 3KJXA 3QWGA 1WH8A 4X4EA 1ZZCA 4MCXA 1DW9A 2AXVA 3QF3A 3RZZA 4EKIA 1U2ZA 3OKZA 4EZIA 1NERA 4I6RA 3TEPA 2CSFA 4Z5HA 3R1FA 4Q2JA 4FBIA 3QQ6A 1E3OC 4ER5A 2A6CA 3OMTA 4JCYA 2O49A 2AWIA 2VEOA 4NDWA 1DULA 4X4FA 1QB2A 3GZDA 2LCVA 2XSDC 1LCCA 4Z58A 2PUBA 2PUAA 2HCNA 1HQ1A 4DE9A 3GN5B 1QP0A 1PNRA 3LQXA 1ZPQA 3OQMA 2L1PA 1HF0A 1XWRA 2OFYA 1JWLA 3VK0A 3B7HA 1UTXA 2LYRA 2O38A 2PUGA 2IU7A 1RPEL 3JXDL 3GZDC 1ZZ9A 3D1NI 2PXEA 2XXPA 5DTRA 2GRLA 1Y7YA 4OBMA 2MXDA 2WIUB 1ZVVA 4ER0A 2GZUA 2HINA 2LYLA 1ZZ7A 3G0TA 2IVQA 4FN3A 5JUWA 2KEKA 1ZUGA 3CECA 3NZLA 4X4GA 4PU8A 2LLVA 3PXPA 3SCFA 5DT2A 3TFLA 2FFHA 5A7LA 2LYQA 3JXBC 3BD1A 1GT0C 3CROL 1WIZA 3NXHA 3ZHIA 4IA8A 2HCSA 1B0NA 2EBYA 3A9XA 3S8QA 1QQAA 1X57A 3SCHA 2PXFA 3EUSA 1ZZBA 1MFQC 3FMYA 2XJ3A 4HRAA 1LCDA 3GUUA 2PXQA 2CROA 1EFAA
chains in the Genus database with same CATH topology
1QQBA 3GN5A 2OR1L 2KEJA 2XCJA 1UXCA 1Y9QA 2LCVA 2XSDC 4Z5CA 2R63A 1LCCA 2PUCA 4Z58A 2PUBA 3IVPA 1ADRA 2PUAA 2BNMA 4OB4A 3BS3A 4Z59A 4GHJA 3G7DA 3GN5B 1QP0A 1PNRA 2PUDA 2HSGA 1PRUA 4J1XA 3CLCA 1ZPQA 1S7EA 4I6UA 3F52A 3OQMA 2LYKA 1LQCA 2XI8A 1HF0A 1L1MA 1BDIA 4YARA 1RZRA 1XWRA 2OFYA 1JWLA 1LMB3 2ICTA 3B7HA 3VK0A 2AW6A 3KXAA 1RIOA 3G5GA 2KPJA 1LLIA 4I8TA 1X2LA 3H5TA 2MEZA 2KZ8A 2L8NA 1UTXA 2GRMA 3SCGA 4X4DA 1PRAA 1PERL 2D5VA 2LYRA 4PU7A 2BNOA 2O38A 2PIJA 2WUSR 2PUGA 2AXUA 3OQOA 2IU7A 4Z5DA 1ZAYA 3ZKCA 1RZRD 1DWKA 4YG1A 3JXDL 1RPEL 3HZIB 4X4IA 1ZZ9A 4X4CA 3D1NI 1WETA 1VPWA 2O4AA 1O4XA 1POUA 2JCGA 2LYJA 4O8BA 2GRLA 1Y7YA 1QP7A 4Y42A 3KJXA 3U3WA 3QWGA 1CJGA 2PUEA 2WIUB 4F8DA 1ZVVA 1WH8A 1PRVA 2EF8A 2GZUA 3TRBA 4X4EA 3BDNA 2HINA 2LYLA 1ZZCA 1ZZ7A 1DW9A 1NEQA 3F6WA 4MCXA 2BNNA 1AU7A 2IVQA 1OCTC 2LYSA 2AXVA 2LYPA 3QF3A 4X4HA 3RZZA 4JCXA 1OSLA 1CQTA 1QP4A 2BJCA 4IWRA 3JXCL 2ICPA 4FN3A 4MCTA 4YG7B 4IVZA 2KEKA 1JFSA 3UFDA 3DNVB 2H8RA 2PUFA 1R69A 1ZUGA 3FYAA 3CECA 4J1WA 1YSEA 3OP9A 1NERA 3MLFA 4I6RA 3L1PA 4I6TA 4X4GA 4PU8A 2CSFA 3PXPA 4Z5HA 2R1JL 3KZ3A 4JQDA 3SCFA 3R1FA 4GQMA 5A7LA 4FBIA 2LYQA 3JXBC 1BDHA 3QQ6A 2KEIA 3BD1A 1GT0C 3CROL 2PE5A 2MQKA 3GBFA 1WIZA 1E3OC 1R63A 1QPZA 3ZHIA 2IV1A 4IA8A 4PU3C 4PU4C 2AUWA 1B0NA 4YBAA 3QYXA 2EBYA 3FYMA 5K98B 1JH9A 3S8QA 4X4BA 1ZS4A 2A6CA 3ZHMA 2B5AA 3OMTA 4JCYA 2O49A 2AWIA 1WH6A 2IUOA 2L49A 4YG4A 3O9XA 3LFPA 2IVBA 1X57A 2PPXA 4NDWA 3SCHA 1QQAA 1ZZ8A 1RZSA 1JFTA 3EUSA 1IC8A 1UXDA 2IVGA 2XIUA 4X4FA 1ZZ6A 1ZZBA 3OQNA 2EWTA 3FMYA 2XJ3A 1LCDA 1SQ8A 2FJRA 2JVLA 3LISA 3F51A 2CROA 2AXZA 1EFAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QQB A;  3GN5 A;  2OR1 L;  2KEJ A;  2XCJ A;  1UXC A;  1Y9Q A;  2LCV A;  2XSD C;  4Z5C A;  2R63 A;  1LCC A;  2PUC A;  4Z58 A;  2PUB A;  3IVP A;  1ADR A;  2PUA A;  2BNM A;  4OB4 A;  3BS3 A;  4Z59 A;  4GHJ A;  3G7D A;  3GN5 B;  1QP0 A;  1PNR A;  2PUD A;  2HSG A;  1PRU A;  4J1X A;  3CLC A;  1ZPQ A;  1S7E A;  4I6U A;  3F52 A;  3OQM A;  2LYK A;  1LQC A;  2XI8 A;  1HF0 A;  1L1M A;  1BDI A;  4YAR A;  1RZR A;  1XWR A;  2OFY A;  1JWL A;  1LMB 3;  2ICT A;  3B7H A;  3VK0 A;  2AW6 A;  3KXA A;  1RIO A;  3G5G A;  2KPJ A;  1LLI A;  4I8T A;  1X2L A;  3H5T A;  2MEZ A;  2KZ8 A;  2L8N A;  1UTX A;  2GRM A;  3SCG A;  4X4D A;  1PRA A;  1PER L;  2D5V A;  2LYR A;  4PU7 A;  2BNO A;  2O38 A;  2PIJ A;  2WUS R;  2PUG A;  2AXU A;  3OQO A;  2IU7 A;  4Z5D A;  1ZAY A;  3ZKC A;  1RZR D;  1DWK A;  4YG1 A;  3JXD L;  1RPE L;  3HZI B;  4X4I A;  1ZZ9 A;  4X4C A;  3D1N I;  1WET A;  1VPW A;  2O4A A;  1O4X A;  1POU A;  2JCG A;  2LYJ A;  4O8B A;  2GRL A;  1Y7Y A;  1QP7 A;  4Y42 A;  3KJX A;  3U3W A;  3QWG A;  1CJG A;  2PUE A;  2WIU B;  4F8D A;  1ZVV A;  1WH8 A;  1PRV A;  2EF8 A;  2GZU A;  3TRB A;  4X4E A;  3BDN A;  2HIN A;  2LYL A;  1ZZC A;  1ZZ7 A;  1DW9 A;  1NEQ A;  3F6W A;  4MCX A;  2BNN A;  1AU7 A;  2IVQ A;  1OCT C;  2LYS A;  2AXV A;  2LYP A;  3QF3 A;  4X4H A;  3RZZ A;  4JCX A;  1OSL A;  1CQT A;  1QP4 A;  2BJC A;  4IWR A;  3JXC L;  2ICP A;  4FN3 A;  4MCT A;  4YG7 B;  4IVZ A;  2KEK A;  1JFS A;  3UFD A;  3DNV B;  2H8R A;  2PUF A;  1R69 A;  1ZUG A;  3FYA A;  3CEC A;  4J1W A;  1YSE A;  3OP9 A;  1NER A;  3MLF A;  4I6R A;  3L1P A;  4I6T A;  4X4G A;  4PU8 A;  2CSF A;  3PXP A;  4Z5H A;  2R1J L;  3KZ3 A;  4JQD A;  3SCF A;  3R1F A;  4GQM A;  5A7L A;  4FBI A;  2LYQ A;  3JXB C;  1BDH A;  3QQ6 A;  2KEI A;  3BD1 A;  1GT0 C;  3CRO L;  2PE5 A;  2MQK A;  3GBF A;  1WIZ A;  1E3O C;  1R63 A;  1QPZ A;  3ZHI A;  2IV1 A;  4IA8 A;  4PU3 C;  4PU4 C;  2AUW A;  1B0N A;  4YBA A;  3QYX A;  2EBY A;  3FYM A;  5K98 B;  1JH9 A;  3S8Q A;  4X4B A;  1ZS4 A;  2A6C A;  3ZHM A;  2B5A A;  3OMT A;  4JCY A;  2O49 A;  2AWI A;  1WH6 A;  2IUO A;  2L49 A;  4YG4 A;  3O9X A;  3LFP A;  2IVB A;  1X57 A;  2PPX A;  4NDW A;  3SCH A;  1QQA A;  1ZZ8 A;  1RZS A;  1JFT A;  3EUS A;  1IC8 A;  1UXD A;  2IVG A;  2XIU A;  4X4F A;  1ZZ6 A;  1ZZB A;  3OQN A;  2EWT A;  3FMY A;  2XJ3 A;  1LCD A;  1SQ8 A;  2FJR A;  2JVL A;  3LIS A;  3F51 A;  2CRO A;  2AXZ A;  1EFA A; 
#chains in the Genus database with same CATH topology
 3GN5 A;  3VWS A;  4DE8 A;  3IVP A;  2BNM A;  2M4H A;  3BS3 A;  4Z59 A;  5DTM A;  1S7E A;  3GZC A;  1L1M A;  4EQZ A;  1LMB 3;  2AW6 A;  3KXA A;  2PXT A;  2LLW A;  4I8T A;  2KZ8 A;  2L8N A;  1PER L;  1PRA A;  2PIJ A;  2AXU A;  1ZAY A;  2JQE A;  4X4I A;  4O8B A;  1QP7 A;  3QFI A;  4Y42 A;  3U3W A;  3ZPX A;  1PRV A;  3TRB A;  3BDN A;  2J7U A;  1NEQ A;  2BNN A;  4X4H A;  2LYP A;  4IWR A;  1OSL A;  1CQT A;  2BJC A;  2ICP A;  4IVZ A;  1NW3 A;  1JFS A;  2PXV A;  3DNV B;  2PUF A;  3FYA A;  4J1W A;  3DM5 A;  1YSE A;  3OP9 A;  3MLF A;  3L1P A;  4I6T A;  3QOX A;  3KZ3 A;  2PXP A;  4JQD A;  2V3C C;  2PE5 A;  3GBF A;  1R63 A;  2IV1 A;  2ODR D;  4PU4 C;  2AUW A;  3QYX A;  5K98 B;  1JH9 A;  2PXK A;  2B5A A;  2IUO A;  2L49 A;  2PXU A;  3LFP A;  5GAG i;  2PPX A;  1ZZ8 A;  1RZS A;  2XIU A;  2EWT A;  3LIS A;  3F51 A;  2OR1 L;  1UXC A;  1Y9Q A;  4Z5C A;  2R63 A;  3SX0 A;  1ADR A;  3G7D A;  2HSG A;  1PRU A;  4J1X A;  2LNM A;  3CLC A;  4I6U A;  2XI8 A;  5DTQ A;  4ER6 A;  1BDI A;  4YAR A;  1RZR A;  2ICT A;  1RIO A;  3G5G A;  3NRO A;  1X2L A;  3H5T A;  4X4D A;  3SCG A;  2GRM A;  2D5V A;  4Z5D A;  1RZR D;  1DWK A;  2PXL A;  3R09 A;  4EKG A;  1WET A;  1VPW A;  4ER7 A;  1POU A;  2JCG A;  1CJG A;  2PUE A;  4F8D A;  2EF8 A;  3F6W A;  1OCT C;  1AU7 A;  2LYS A;  2PXD A;  3KL4 A;  4JCX A;  1QP4 A;  3JXC L;  4MCT A;  4YG7 B;  4ER3 A;  3UFD A;  3A9Y A;  2H8R A;  1R69 A;  2HFZ A;  2R1J L;  4GQM A;  2XXA A;  2J7W A;  1BDH A;  2KEI A;  3ME5 A;  2MQK A;  3M9L A;  1QPZ A;  3OWQ A;  4PU3 C;  4YBA A;  3FYM A;  2YBD A;  4X4B A;  1ZS4 A;  3ZHM A;  1WH6 A;  4YG4 A;  3O9X A;  2IVB A;  1JFT A;  3PE5 A;  1IC8 A;  1UXD A;  2IVG A;  2XXQ A;  1ZZ6 A;  3OQN A;  3NDB B;  5DRT A;  1SQ8 A;  2FJR A;  2JVL A;  5GAH i;  2AXZ A;  1QQB A;  2KEJ A;  2XCJ A;  2PUC A;  4OB4 A;  5DRY A;  4GHJ A;  2PUD A;  3TEL A;  1QZX A;  3F52 A;  2LYK A;  1LQC A;  3A9Z A;  2KPJ A;  1LLI A;  2MEZ A;  3UWP A;  3SR4 A;  4PU7 A;  2BNO A;  2PXB A;  3QOW A;  2WUS R;  3MEJ A;  5DSX A;  3OQO A;  3ZKC A;  4YG1 A;  4EK9 A;  3HZI B;  2O4A A;  4X4C A;  1O4X A;  4WVL A;  2LYJ A;  3KJX A;  3QWG A;  1WH8 A;  4X4E A;  1ZZC A;  4MCX A;  1DW9 A;  2AXV A;  3QF3 A;  3RZZ A;  4EKI A;  1U2Z A;  3OKZ A;  4EZI A;  1NER A;  4I6R A;  3TEP A;  2CSF A;  4Z5H A;  3R1F A;  4Q2J A;  4FBI A;  3QQ6 A;  1E3O C;  4ER5 A;  2A6C A;  3OMT A;  4JCY A;  2O49 A;  2AWI A;  2VEO A;  4NDW A;  1DUL A;  4X4F A;  1QB2 A;  3GZD A;  2LCV A;  2XSD C;  1LCC A;  4Z58 A;  2PUB A;  2PUA A;  2HCN A;  1HQ1 A;  4DE9 A;  3GN5 B;  1QP0 A;  1PNR A;  3LQX A;  1ZPQ A;  3OQM A;  2L1P A;  1HF0 A;  1XWR A;  2OFY A;  1JWL A;  3VK0 A;  3B7H A;  1UTX A;  2LYR A;  2O38 A;  2PUG A;  2IU7 A;  1RPE L;  3JXD L;  3GZD C;  1ZZ9 A;  3D1N I;  2PXE A;  2XXP A;  5DTR A;  2GRL A;  1Y7Y A;  4OBM A;  2MXD A;  2WIU B;  1ZVV A;  4ER0 A;  2GZU A;  2HIN A;  2LYL A;  1ZZ7 A;  3G0T A;  2IVQ A;  4FN3 A;  5JUW A;  2KEK A;  1ZUG A;  3CEC A;  3NZL A;  4X4G A;  4PU8 A;  2LLV A;  3PXP A;  3SCF A;  5DT2 A;  3TFL A;  2FFH A;  5A7L A;  2LYQ A;  3JXB C;  3BD1 A;  1GT0 C;  3CRO L;  1WIZ A;  3NXH A;  3ZHI A;  4IA8 A;  2HCS A;  1B0N A;  2EBY A;  3A9X A;  3S8Q A;  1QQA A;  1X57 A;  3SCH A;  2PXF A;  3EUS A;  1ZZB A;  1MFQ C;  3FMY A;  2XJ3 A;  4HRA A;  1LCD A;  3GUU A;  2PXQ A;  2CRO A;  1EFA A; 
#chains in the Genus database with same CATH homology
 1QQB A;  3GN5 A;  2OR1 L;  2KEJ A;  2XCJ A;  1UXC A;  1Y9Q A;  2LCV A;  2XSD C;  4Z5C A;  2R63 A;  1LCC A;  2PUC A;  4Z58 A;  2PUB A;  3IVP A;  1ADR A;  2PUA A;  2BNM A;  4OB4 A;  3BS3 A;  4Z59 A;  4GHJ A;  3G7D A;  3GN5 B;  1QP0 A;  1PNR A;  2PUD A;  2HSG A;  1PRU A;  4J1X A;  3CLC A;  1ZPQ A;  1S7E A;  4I6U A;  3F52 A;  3OQM A;  2LYK A;  1LQC A;  2XI8 A;  1HF0 A;  1L1M A;  1BDI A;  4YAR A;  1RZR A;  1XWR A;  2OFY A;  1JWL A;  1LMB 3;  2ICT A;  3B7H A;  3VK0 A;  2AW6 A;  3KXA A;  1RIO A;  3G5G A;  2KPJ A;  1LLI A;  4I8T A;  1X2L A;  3H5T A;  2MEZ A;  2KZ8 A;  2L8N A;  1UTX A;  2GRM A;  3SCG A;  4X4D A;  1PRA A;  1PER L;  2D5V A;  2LYR A;  4PU7 A;  2BNO A;  2O38 A;  2PIJ A;  2WUS R;  2PUG A;  2AXU A;  3OQO A;  2IU7 A;  4Z5D A;  1ZAY A;  3ZKC A;  1RZR D;  1DWK A;  4YG1 A;  3JXD L;  1RPE L;  3HZI B;  4X4I A;  1ZZ9 A;  4X4C A;  3D1N I;  1WET A;  1VPW A;  2O4A A;  1O4X A;  1POU A;  2JCG A;  2LYJ A;  4O8B A;  2GRL A;  1Y7Y A;  1QP7 A;  4Y42 A;  3KJX A;  3U3W A;  3QWG A;  1CJG A;  2PUE A;  2WIU B;  4F8D A;  1ZVV A;  1WH8 A;  1PRV A;  2EF8 A;  2GZU A;  3TRB A;  4X4E A;  3BDN A;  2HIN A;  2LYL A;  1ZZC A;  1ZZ7 A;  1DW9 A;  1NEQ A;  3F6W A;  4MCX A;  2BNN A;  1AU7 A;  2IVQ A;  1OCT C;  2LYS A;  2AXV A;  2LYP A;  3QF3 A;  4X4H A;  3RZZ A;  4JCX A;  1OSL A;  1CQT A;  1QP4 A;  2BJC A;  4IWR A;  3JXC L;  2ICP A;  4FN3 A;  4MCT A;  4YG7 B;  4IVZ A;  2KEK A;  1JFS A;  3UFD A;  3DNV B;  2H8R A;  2PUF A;  1R69 A;  1ZUG A;  3FYA A;  3CEC A;  4J1W A;  1YSE A;  3OP9 A;  1NER A;  3MLF A;  4I6R A;  3L1P A;  4I6T A;  4X4G A;  4PU8 A;  2CSF A;  3PXP A;  4Z5H A;  2R1J L;  3KZ3 A;  4JQD A;  3SCF A;  3R1F A;  4GQM A;  5A7L A;  4FBI A;  2LYQ A;  3JXB C;  1BDH A;  3QQ6 A;  2KEI A;  3BD1 A;  1GT0 C;  3CRO L;  2PE5 A;  2MQK A;  3GBF A;  1WIZ A;  1E3O C;  1R63 A;  1QPZ A;  3ZHI A;  2IV1 A;  4IA8 A;  4PU3 C;  4PU4 C;  2AUW A;  1B0N A;  4YBA A;  3QYX A;  2EBY A;  3FYM A;  5K98 B;  1JH9 A;  3S8Q A;  4X4B A;  1ZS4 A;  2A6C A;  3ZHM A;  2B5A A;  3OMT A;  4JCY A;  2O49 A;  2AWI A;  1WH6 A;  2IUO A;  2L49 A;  4YG4 A;  3O9X A;  3LFP A;  2IVB A;  1X57 A;  2PPX A;  4NDW A;  3SCH A;  1QQA A;  1ZZ8 A;  1RZS A;  1JFT A;  3EUS A;  1IC8 A;  1UXD A;  2IVG A;  2XIU A;  4X4F A;  1ZZ6 A;  1ZZB A;  3OQN A;  2EWT A;  3FMY A;  2XJ3 A;  1LCD A;  1SQ8 A;  2FJR A;  2JVL A;  3LIS A;  3F51 A;  2CRO A;  2AXZ A;  1EFA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...