1WHEA

Coagulation factor, nmr, 20 structures
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
86
structure length
73
Chain Sequence
ANSFLVKQGNLRCLACSLARVFDAQTDFWSKYKDGDQCEGHPCLNQGHCKGIGDYTCTCAEGFEGKNCEFSTR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The relative orientation of Gla and EGF domains in coagulation factor X is altered by Ca2+ binding to the first EGF domain. A combined NMR-small angle X-ray scattering study.
pubmed doi rcsb
molecule tags Glycoprotein
molecule keywords COAGULATION FACTOR X
total genus 4
structure length 73
sequence length 86
ec nomenclature ec 3.4.21.6: Coagulation factor Xa.
pdb deposition date 1996-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00008 EGF EGF-like domain
A PF00594 Gla Vitamin K-dependent carboxylation/gamma-carboxyglutamic (GLA) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.25.10 Mainly Beta Ribbon Laminin Laminin 1wheA02
4.10.740.10 Few Secondary Structures Irregular Coagulation Factor IX Coagulation Factor IX 1wheA01
2RA0L 1FAKL 2BOKL 4CUFA 2XC0L 1AUTL 2DDUA 2YGOA 3CFWA 3NT1A 5E8DA 1XKBA 3FCSB 1NFXB 1FJSL 1W7XL 2WG3C 2FLBL 1IQFL 3ZYJB 1PGEA 1IQML 3ASIA 4O02B 3KCGL 1FFMA 1LQDA 2EI7B 2Y38A 3N8YA 3N8ZA 1X7AL 2FLGA 2Y80B 4E1GA 2WFTA 5JVYA 3HO5A 4NA9L 3TK5B 3F6UL 2B7DL 1HZ8A 1PRHA 4X8UL 1LPGA 1WHFA 1OB1C 1Z6EL 1KIGL 3KQDL 5L30L 5KN5C 2J4IB 2W26B 4X8TL 5JW1A 4JZEL 3PGHA 1ATBA 3LTFB 3Q3KB 5JVZA 1IQNL 4Y7AB 2UWLB 1YUKB 1MQ5L 3U7UG 4PH9A 1G2LB 1B9WA 4YT6L 3GCWE 4JZDL 2Y5HL 5EGMB 2PUQL 1CVWL 1COUA 1FAXL 1TPGA 2J2UB 2VJ3A 4XL1A 3LC3B 3TGFA 2J38B 1CQEA 3TH3L 1K36A 3POYA 2I9BA 2VH0B 2VVCK 5IKVA 2VH6B 4Y76B 1HX2A 3HS6A 2WPJE 1IQEL 2I9AA 3V64C 1JBUL 2BOUA 2XBYL 1NFWB 1M1XB 1ZAQA 1JL9A 4G1MB 2BZ6L 3R05A 1HJ7A 5FDQA 2P95L 1UZQA 2W86A 2FD6A 1FE2A 1G1QA 4COXA 3N8WB 2FZZL 4BXWA 2BOHA 1DX5I 1YUFA 4Y7BB 2MHPA 3SOBB 4OTYA 5IKQA 2UWPB 2P3UA 3N8YB 4CUDA 5CKQA 1APQA 2P3FL 4LORA 1EMOA 3TZIA 4RRWA 4C16A 3QH0A 1APOA 2VVVL 3FBYA 1TOZA 4RUTA 4CUEA 1V3XB 1MOXC 5COXA 5JBAE 4NG9L 1LMJA 1HRFA 1YUGA 1IVOC 1P9JA 1IOXA 2W3KB 1NT0A 2TGFA 2MGRA 2XBWL 4Y6DB 1WU1B 1L5GB 1EPGA 3QMOA 4XBMA 1CFHA 2Q1JB 1EGFA 3HPTA 1O5DL 1IQGL 4X8VL 5JB8E 3TK6B 2J94B 2P93L 2CJIB 1IQHL 3Q7DA 1DQBA 4A7IA 4RRYA 2Y5GL 4JYVL 3ELAL 3M36L 1HREA 1IQJL 4M11A 3ZYGA 4TGFA 4RRZA 2RHPA 1FF7A 2FLRL 4ZXXL 1XKAL 4YZUB 2BQWA 2W2NE 2Y81B 3KQCL 1I0UA 4JYUL 2OYEP 1PTHA 1G2MB 3C9AC 2XC4L 1XFEA 2KL7A 2W3IB 1DIYA 1LPKA 4ZXYL 2P28B 5KIRA 1G1RA 1DDXA 4MMXB 3IJEB 2AYLA 4FM5A 2EI6B 4OTJA 1UZKA 3QCWA 1F0SB 3LIWB 1G1TA 3SOQA 1NFYB 3LTGD 5L2ZL 2WPME 2K2SB 3ZYIB 3NTGA 1UZPA 2WYGB 2NPRA 2W2OE 1CVUA 2Y82B 3LN1A 2WG4B 2W2PE 2BOXA 2UWOB 4CSYA 4Y71B 2VWMK 3H5CB 1PXXA 4RRXA 2MGPA 3SW2A 2KV4A 3P5BL 3HO3A 4Z0KB 2EI8B 4D0EA 3CA7A 1W8BL 3CS7L 3F1SB 3BT2A 2K2TA 3EGFA 2W2ME 1WHEA 1EPIA 3GCXE 1ADXA 5I46L 4ISHL 2WPIE 1F7EA 1F7MA 2VVUL 3KQBL 1YGCL 5IKRA 1K37A 4ZH8B 3HO4A 2WPKE 1IJQA 1SZBA 5IKTA 1EMNA 3FFGL 2GD4A 2F9BL 3SOVA 1IP0A 3N8WA 3GISX 1IQIL 1N7DA 5CKMA 2W2QE 2BQ7A 4D90A 1KLOA 1XDTR 2JKHL 3U73A 1HAFA 4BXSA 2VWOL 5K0HB 2WPHE 1HT8A 1EPJA 1BF9A 1EQHA 2G00L 3LC5B 1CCVA 5JBCE 4JZFL 1U8CB 1YO8A 2ADXA 3CENL 4BTTA 4MMYB 4RS0A 3LAQA 4Z0LA 2PR3B 4NGAL 2RNLA 1ATDA 2YGPA 2P94L 1P0SL 1EZQB 2WFXB 1URKA 2P16L 1HCGB 1HAEA 4Z6AL 3N8VA 4X8SL 1NFUB 1A3PA 3BT1A 1RFNB 3K9XA 1IGZA 1IQLL 1KSNB 4ZAEB 2P3TA 1KLIL 3HS5A 5JB9E 2P26A 3LN0A 1IGXA 2VWLL 3BPSE 2BO2A 2BMGA 1KLJL 3NTBA 4BDXA 5F1AA 2P3FN 1J9CL 2PHBB 3KRKA 4MMZB 1CCFA 1DVAL 3MDLA 2D1JB 4D0FA 3RR3A 1L3YA 2J95B 1U67A 4BTUA 2WYJB 2OYUP 5CISA 1EQGA 1HT5A 2XC5L 1EBVA 1PFXL 2Y7XB 3V65B 1EAIC 2VWNL 1G1SA 1CEJA 1IQKL 3KQEL 2XBXL 3OLUA 1FSBA 3OLTA 1QFKL 1GK5A 5F19A 2J34B 2M74A 3HS7A 4ISIL 1EPHA 3IITB 2Y5FL 1JV2B 4BTIA 5CKNA 1C5MF 4AQTA 1ATAA 5JBBE 2Y7ZB 3MQEA 1UZJA 4Y79B 3NJPC 4O1ZA 5L2YL 1LPZA 1N1IA 4LMFA 1F0RB 2XBVL 3N8XA 1ATEA 1TLEA 3M37L 6COXA 4XLWA 2BQ6A 4BDWA 1NQLB 1CX2A 3ENSA 2KB9A 1NZIA 3KK6A 1Z6CA 2WPLE 4ZHAB 3DEMA 3KL6B 4YT7L 2H9EL 1Q4GA 1NPEB 1IOEL 3TBDA 1MQ6L 4M10A
chains in the Genus database with same CATH superfamily
2RA0L 1FAKL 2BOKL 4CUFA 2XC0L 1AUTL 2DDUA 2YGOA 3CFWA 3NT1A 5E8DA 1XKBA 3FCSB 1NFXB 1FJSL 1W7XL 2WG3C 2FLBL 1IQFL 3ZYJB 1PGEA 1IQML 3ASIA 3KCGL 4O02B 1FFMA 1LQDA 2EI7B 2Y38A 3N8YA 3N8ZA 1X7AL 2FLGA 1KKEA 2Y80B 4E1GA 2WFTA 5JVYA 3HO5A 2HORA 4NA9L 3TK5B 3F6UL 2B7DL 1HZ8A 1PRHA 4X8UL 1LPGA 1WHFA 1OB1C 1Z6EL 1KIGL 3KQDL 5L30L 5KN5C 2J4IB 2W26B 4X8TL 5JW1A 4JZEL 3PGHA 1ATBA 3LTFB 3Q3KB 5JVZA 1IQNL 4Y7AB 2UWLB 1YUKB 1MQ5L 3U7UG 4PH9A 1G2LB 1B9WA 4YT6L 3GCWE 4JZDL 2Y5HL 5EGMB 2PUQL 1CVWL 1COUA 1FAXL 1TPGA 2J2UB 2VJ3A 4XL1A 3LC3B 3TGFA 2J38B 1CQEA 3TH3L 1K36A 3POYA 2I9BA 2VH0B 2VVCK 5IKVA 2VH6B 4Y76B 1HX2A 3HS6A 2WPJE 1IQEL 2I9AA 2WZPP 2BSFA 3V64C 1JBUL 2BOUA 2XBYL 1NFWB 1M1XB 1ZAQA 1JL9A 4G1MB 2BZ6L 3R05A 1HJ7A 5FDQA 2P95L 1UZQA 2W86A 2FD6A 1FE2A 1G1QA 4COXA 3N8WB 2FZZL 4BXWA 2BOHA 1DX5I 1YUFA 4Y7BB 2MHPA 3SOBB 4OTYA 5IKQA 2UWPB 2P3UA 3N8YB 4CUDA 5CKQA 1APQA 2P3FL 4LORA 1EMOA 3TZIA 4RRWA 4C16A 2H9EC 3QH0A 1APOA 2VVVL 3FBYA 1TOZA 4RUTA 4CUEA 1V3XB 1MOXC 5COXA 5JBAE 4GU4A 4NG9L 1LMJA 1HRFA 1YUGA 1IVOC 1P9JA 1IOXA 2W3KB 1NT0A 2TGFA 2MGRA 1LK9A 2XBWL 4Y6DB 1WU1B 1L5GB 1EPGA 3QMOA 4XBMA 1CFHA 2Q1JB 1EGFA 3HPTA 1O5DL 1IQGL 4X8VL 5JB8E 3TK6B 2J94B 2P93L 2CJIB 1IQHL 3Q7DA 1DQBA 4A7IA 4RRYA 2Y5GL 3ELAL 3M36L 4JYVL 1HREA 1IQJL 4M11A 3ZYGA 4TGFA 4RRZA 2RHPA 1FF7A 2FLRL 4ZXXL 1XKAL 4YZUB 2BQWA 2W2NE 2Y81B 3KQCL 1I0UA 1V1IA 4JYUL 2OYEP 4GU3A 1PTHA 3S6XA 1G2MB 3C9AC 2XC4L 1XFEA 2KL7A 2W3IB 1DIYA 1LPKA 4ZXYL 2P28B 5KIRA 1G1RA 1DDXA 4MMXB 3IJEB 2AYLA 4FM5A 2EI6B 4OTJA 1UZKA 3QCWA 1F0SB 2JJLA 3LIWB 1G1TA 3SOQA 1NFYB 3LTGD 5L2ZL 2WPME 2K2SB 3ZYIB 2VRSA 3NTGA 1UZPA 2WYGB 2NPRA 2W2OE 1CVUA 2Y82B 3LN1A 2WG4B 2W2PE 2BOXA 2UWOB 4CSYA 4Y71B 2VWMK 3H5CB 1PXXA 4RRXA 2MGPA 3SW2A 2KV4A 3P5BL 3HO3A 4Z0KB 2EI8B 4D0EA 4A94C 3CA7A 1W8BL 3CS7L 3F1SB 3BT2A 2K2TA 3EGFA 2W2ME 1WHEA 1EPIA 3GCXE 1ADXA 5I46L 4ISHL 2WPIE 1F7EA 1F7MA 2VVUL 3KQBL 1YGCL 5IKRA 1K37A 2BT7A 4ZH8B 3HO4A 2WPKE 1IJQA 1SZBA 5IKTA 1EMNA 3FFGL 2GD4A 2F9BL 3SOVA 2BT8A 1IP0A 3N8WA 3GISX 1IQIL 1N7DA 5CKMA 2HOXA 2YGQA 2W2QE 2BQ7A 4D90A 1KLOA 1XDTR 2JKHL 3U73A 1HAFA 4BXSA 2VWOL 1QIUA 5K0HB 2WPHE 1HT8A 1EPJA 1BF9A 1EQHA 2G00L 3LC5B 1CCVA 5JBCE 4JZFL 1U8CB 1YO8A 2ADXA 3CENL 4BTTA 4MMYB 4RS0A 3LAQA 4Z0LA 2PR3B 4NGAL 2RNLA 1ATDA 2YGPA 2P94L 1P0SL 1EZQB 2WFXB 1URKA 2P16L 1HCGB 1HAEA 4Z6AL 3N8VA 4X8SL 1NFUB 1A3PA 3BT1A 1RFNB 3K9XA 1IGZA 1V1HA 1IQLL 1KSNB 4ZAEB 2P3TA 1KLIL 3HS5A 5JB9E 1LMMA 2P26A 3LN0A 1IGXA 2VWLL 3BPSE 2BO2A 2BMGA 1KLJL 3NTBA 4BDXA 5F1AA 2P3FN 1J9CL 2PHBB 3KRKA 4MMZB 1CCFA 1DVAL 3MDLA 2D1JB 4D0FA 3RR3A 1L3YA 2J95B 1U67A 4BTUA 2WYJB 2OYUP 5CISA 1EQGA 1HT5A 2XC5L 1EBVA 1PFXL 2Y7XB 3V65B 1EAIC 2VWNL 1G1SA 1CEJA 1IQKL 3KQEL 2XBXL 3OLUA 1FSBA 3OLTA 1QFKL 1GK5A 5F19A 2J34B 2M74A 3HS7A 4ISIL 1EPHA 3IITB 2Y5FL 1JV2B 4BTIA 5CKNA 2KNIA 1C5MF 4AQTA 1ATAA 5JBBE 2Y7ZB 3MQEA 1UZJA 4Y79B 3NJPC 4O1ZA 5L2YL 1LPZA 1N1IA 4LMFA 1F0RB 2XBVL 3N8XA 1ATEA 1TLEA 3M37L 6COXA 4XLWA 2BQ6A 4BDWA 1NQLB 1CX2A 3ENSA 2KB9A 1NZIA 3KK6A 1Z6CA 2WPLE 4ZHAB 3DEMA 3KL6B 4YT7L 2H9EL 1Q4GA 1NPEB 1IOEL 3TBDA 1MQ6L 4M10A
chains in the Genus database with same CATH topology
2RA0L 1FAKL 2BOKL 4CUFA 2XC0L 1AUTL 2DDUA 2YGOA 3CFWA 3NT1A 5E8DA 1XKBA 3FCSB 1NFXB 1FJSL 1W7XL 2WG3C 2FLBL 1IQFL 3ZYJB 1PGEA 1IQML 3ASIA 3KCGL 4O02B 1FFMA 1LQDA 2EI7B 2Y38A 3N8YA 3N8ZA 1X7AL 2FLGA 2Y80B 4E1GA 2WFTA 5JVYA 3HO5A 4NA9L 3TK5B 3F6UL 2B7DL 1HZ8A 1PRHA 4X8UL 1LPGA 1WHFA 1OB1C 1Z6EL 1KIGL 3KQDL 5L30L 5KN5C 2J4IB 2W26B 4X8TL 5JW1A 4JZEL 3PGHA 1ATBA 3LTFB 3Q3KB 5JVZA 1IQNL 4Y7AB 2UWLB 1YUKB 1MQ5L 3U7UG 4PH9A 1G2LB 1B9WA 4YT6L 3GCWE 4JZDL 2Y5HL 5EGMB 2PUQL 1CVWL 1COUA 1FAXL 1TPGA 2J2UB 2VJ3A 4XL1A 3LC3B 3TGFA 2J38B 1CQEA 3TH3L 1K36A 3POYA 2I9BA 2VH0B 2VVCK 5IKVA 2VH6B 4Y76B 1HX2A 3HS6A 2WPJE 1IQEL 2I9AA 2WZPP 3V64C 1JBUL 2BOUA 2XBYL 1NFWB 1M1XB 1ZAQA 1JL9A 4G1MB 2BZ6L 3R05A 1HJ7A 5FDQA 2P95L 1UZQA 2W86A 2FD6A 1FE2A 1G1QA 4COXA 3N8WB 2FZZL 4BXWA 2BOHA 1DX5I 1YUFA 4Y7BB 2MHPA 3SOBB 4OTYA 5IKQA 2UWPB 2P3UA 3N8YB 4CUDA 5CKQA 1APQA 2P3FL 4LORA 1EMOA 3TZIA 4RRWA 4C16A 2H9EC 3QH0A 1APOA 2VVVL 3FBYA 1TOZA 4RUTA 4CUEA 1V3XB 1MOXC 5COXA 5JBAE 4NG9L 1LMJA 1HRFA 1YUGA 1IVOC 1P9JA 1IOXA 2W3KB 1NT0A 2TGFA 2MGRA 2XBWL 4Y6DB 1WU1B 1L5GB 1EPGA 3QMOA 4XBMA 1CFHA 2Q1JB 1EGFA 3HPTA 1O5DL 1IQGL 4X8VL 5JB8E 3TK6B 2J94B 2P93L 2CJIB 1IQHL 3Q7DA 1DQBA 4A7IA 4RRYA 2Y5GL 4JYVL 3ELAL 3M36L 1HREA 1IQJL 4M11A 3ZYGA 4TGFA 4RRZA 2RHPA 1FF7A 2FLRL 4ZXXL 1XKAL 4YZUB 2BQWA 2W2NE 2Y81B 3KQCL 1I0UA 4JYUL 2OYEP 1PTHA 3S6XA 1G2MB 3C9AC 2XC4L 1XFEA 2KL7A 2W3IB 1DIYA 1LPKA 4ZXYL 2P28B 5KIRA 1G1RA 1DDXA 4MMXB 3IJEB 2AYLA 4FM5A 2EI6B 4OTJA 1UZKA 3QCWA 1F0SB 3LIWB 1G1TA 3SOQA 1NFYB 3LTGD 5L2ZL 2WPME 2K2SB 3ZYIB 3NTGA 1UZPA 2WYGB 2NPRA 2W2OE 1CVUA 2Y82B 3LN1A 2WG4B 2W2PE 2BOXA 2UWOB 4CSYA 4Y71B 2VWMK 3H5CB 1PXXA 4RRXA 2MGPA 3SW2A 2KV4A 3P5BL 3HO3A 4Z0KB 2EI8B 4D0EA 4A94C 3CA7A 1W8BL 3CS7L 3F1SB 3BT2A 2K2TA 3EGFA 2W2ME 1WHEA 1EPIA 3GCXE 1ADXA 5I46L 4ISHL 2WPIE 1F7EA 1F7MA 2VVUL 3KQBL 1YGCL 5IKRA 1K37A 4ZH8B 3HO4A 2WPKE 1IJQA 1SZBA 5IKTA 1EMNA 3FFGL 2GD4A 2F9BL 3SOVA 1IP0A 3N8WA 3GISX 1IQIL 1N7DA 5CKMA 2YGQA 2W2QE 2BQ7A 4D90A 1KLOA 1XDTR 2JKHL 3U73A 1HAFA 4BXSA 2VWOL 5K0HB 2WPHE 1HT8A 1EPJA 1BF9A 1EQHA 2G00L 3LC5B 1CCVA 5JBCE 4JZFL 1U8CB 1YO8A 2ADXA 3CENL 4BTTA 4MMYB 4RS0A 3LAQA 4Z0LA 2PR3B 4NGAL 2RNLA 1ATDA 2YGPA 2P94L 1P0SL 1EZQB 2WFXB 1URKA 2P16L 1HCGB 1HAEA 4Z6AL 3N8VA 4X8SL 1NFUB 1A3PA 3BT1A 1RFNB 3K9XA 1IGZA 1IQLL 1KSNB 4ZAEB 2P3TA 1KLIL 3HS5A 5JB9E 1LMMA 2P26A 3LN0A 1IGXA 2VWLL 3BPSE 2BO2A 2BMGA 1KLJL 3NTBA 4BDXA 5F1AA 2P3FN 1J9CL 2PHBB 3KRKA 4MMZB 1CCFA 1DVAL 3MDLA 2D1JB 4D0FA 3RR3A 1L3YA 2J95B 1U67A 4BTUA 2WYJB 2OYUP 5CISA 1EQGA 1HT5A 2XC5L 1EBVA 1PFXL 2Y7XB 3V65B 1EAIC 2VWNL 1G1SA 1CEJA 1IQKL 3KQEL 2XBXL 3OLUA 1FSBA 3OLTA 1QFKL 1GK5A 5F19A 2J34B 2M74A 3HS7A 4ISIL 1EPHA 3IITB 2Y5FL 1JV2B 4BTIA 5CKNA 2KNIA 1C5MF 4AQTA 1ATAA 5JBBE 2Y7ZB 3MQEA 1UZJA 4Y79B 3NJPC 4O1ZA 5L2YL 1LPZA 1N1IA 4LMFA 1F0RB 2XBVL 3N8XA 1ATEA 1TLEA 3M37L 6COXA 4XLWA 2BQ6A 4BDWA 1NQLB 1CX2A 3ENSA 2KB9A 1NZIA 3KK6A 1Z6CA 2WPLE 4ZHAB 3DEMA 3KL6B 4YT7L 2H9EL 1Q4GA 1NPEB 1IOEL 3TBDA 1MQ6L 4M10A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RA0 L;  1FAK L;  2BOK L;  4CUF A;  2XC0 L;  1AUT L;  2DDU A;  2YGO A;  3CFW A;  3NT1 A;  5E8D A;  1XKB A;  3FCS B;  1NFX B;  1FJS L;  1W7X L;  2WG3 C;  2FLB L;  1IQF L;  3ZYJ B;  1PGE A;  1IQM L;  3ASI A;  4O02 B;  3KCG L;  1FFM A;  1LQD A;  2EI7 B;  2Y38 A;  3N8Y A;  3N8Z A;  1X7A L;  2FLG A;  2Y80 B;  4E1G A;  2WFT A;  5JVY A;  3HO5 A;  4NA9 L;  3TK5 B;  3F6U L;  2B7D L;  1HZ8 A;  1PRH A;  4X8U L;  1LPG A;  1WHF A;  1OB1 C;  1Z6E L;  1KIG L;  3KQD L;  5L30 L;  5KN5 C;  2J4I B;  2W26 B;  4X8T L;  5JW1 A;  4JZE L;  3PGH A;  1ATB A;  3LTF B;  3Q3K B;  5JVZ A;  1IQN L;  4Y7A B;  2UWL B;  1YUK B;  1MQ5 L;  3U7U G;  4PH9 A;  1G2L B;  1B9W A;  4YT6 L;  3GCW E;  4JZD L;  2Y5H L;  5EGM B;  2PUQ L;  1CVW L;  1COU A;  1FAX L;  1TPG A;  2J2U B;  2VJ3 A;  4XL1 A;  3LC3 B;  3TGF A;  2J38 B;  1CQE A;  3TH3 L;  1K36 A;  3POY A;  2I9B A;  2VH0 B;  2VVC K;  5IKV A;  2VH6 B;  4Y76 B;  1HX2 A;  3HS6 A;  2WPJ E;  1IQE L;  2I9A A;  3V64 C;  1JBU L;  2BOU A;  2XBY L;  1NFW B;  1M1X B;  1ZAQ A;  1JL9 A;  4G1M B;  2BZ6 L;  3R05 A;  1HJ7 A;  5FDQ A;  2P95 L;  1UZQ A;  2W86 A;  2FD6 A;  1FE2 A;  1G1Q A;  4COX A;  3N8W B;  2FZZ L;  4BXW A;  2BOH A;  1DX5 I;  1YUF A;  4Y7B B;  2MHP A;  3SOB B;  4OTY A;  5IKQ A;  2UWP B;  2P3U A;  3N8Y B;  4CUD A;  5CKQ A;  1APQ A;  2P3F L;  4LOR A;  1EMO A;  3TZI A;  4RRW A;  4C16 A;  3QH0 A;  1APO A;  2VVV L;  3FBY A;  1TOZ A;  4RUT A;  4CUE A;  1V3X B;  1MOX C;  5COX A;  5JBA E;  4NG9 L;  1LMJ A;  1HRF A;  1YUG A;  1IVO C;  1P9J A;  1IOX A;  2W3K B;  1NT0 A;  2TGF A;  2MGR A;  2XBW L;  4Y6D B;  1WU1 B;  1L5G B;  1EPG A;  3QMO A;  4XBM A;  1CFH A;  2Q1J B;  1EGF A;  3HPT A;  1O5D L;  1IQG L;  4X8V L;  5JB8 E;  3TK6 B;  2J94 B;  2P93 L;  2CJI B;  1IQH L;  3Q7D A;  1DQB A;  4A7I A;  4RRY A;  2Y5G L;  4JYV L;  3ELA L;  3M36 L;  1HRE A;  1IQJ L;  4M11 A;  3ZYG A;  4TGF A;  4RRZ A;  2RHP A;  1FF7 A;  2FLR L;  4ZXX L;  1XKA L;  4YZU B;  2BQW A;  2W2N E;  2Y81 B;  3KQC L;  1I0U A;  4JYU L;  2OYE P;  1PTH A;  1G2M B;  3C9A C;  2XC4 L;  1XFE A;  2KL7 A;  2W3I B;  1DIY A;  1LPK A;  4ZXY L;  2P28 B;  5KIR A;  1G1R A;  1DDX A;  4MMX B;  3IJE B;  2AYL A;  4FM5 A;  2EI6 B;  4OTJ A;  1UZK A;  3QCW A;  1F0S B;  3LIW B;  1G1T A;  3SOQ A;  1NFY B;  3LTG D;  5L2Z L;  2WPM E;  2K2S B;  3ZYI B;  3NTG A;  1UZP A;  2WYG B;  2NPR A;  2W2O E;  1CVU A;  2Y82 B;  3LN1 A;  2WG4 B;  2W2P E;  2BOX A;  2UWO B;  4CSY A;  4Y71 B;  2VWM K;  3H5C B;  1PXX A;  4RRX A;  2MGP A;  3SW2 A;  2KV4 A;  3P5B L;  3HO3 A;  4Z0K B;  2EI8 B;  4D0E A;  3CA7 A;  1W8B L;  3CS7 L;  3F1S B;  3BT2 A;  2K2T A;  3EGF A;  2W2M E;  1WHE A;  1EPI A;  3GCX E;  1ADX A;  5I46 L;  4ISH L;  2WPI E;  1F7E A;  1F7M A;  2VVU L;  3KQB L;  1YGC L;  5IKR A;  1K37 A;  4ZH8 B;  3HO4 A;  2WPK E;  1IJQ A;  1SZB A;  5IKT A;  1EMN A;  3FFG L;  2GD4 A;  2F9B L;  3SOV A;  1IP0 A;  3N8W A;  3GIS X;  1IQI L;  1N7D A;  5CKM A;  2W2Q E;  2BQ7 A;  4D90 A;  1KLO A;  1XDT R;  2JKH L;  3U73 A;  1HAF A;  4BXS A;  2VWO L;  5K0H B;  2WPH E;  1HT8 A;  1EPJ A;  1BF9 A;  1EQH A;  2G00 L;  3LC5 B;  1CCV A;  5JBC E;  4JZF L;  1U8C B;  1YO8 A;  2ADX A;  3CEN L;  4BTT A;  4MMY B;  4RS0 A;  3LAQ A;  4Z0L A;  2PR3 B;  4NGA L;  2RNL A;  1ATD A;  2YGP A;  2P94 L;  1P0S L;  1EZQ B;  2WFX B;  1URK A;  2P16 L;  1HCG B;  1HAE A;  4Z6A L;  3N8V A;  4X8S L;  1NFU B;  1A3P A;  3BT1 A;  1RFN B;  3K9X A;  1IGZ A;  1IQL L;  1KSN B;  4ZAE B;  2P3T A;  1KLI L;  3HS5 A;  5JB9 E;  2P26 A;  3LN0 A;  1IGX A;  2VWL L;  3BPS E;  2BO2 A;  2BMG A;  1KLJ L;  3NTB A;  4BDX A;  5F1A A;  2P3F N;  1J9C L;  2PHB B;  3KRK A;  4MMZ B;  1CCF A;  1DVA L;  3MDL A;  2D1J B;  4D0F A;  3RR3 A;  1L3Y A;  2J95 B;  1U67 A;  4BTU A;  2WYJ B;  2OYU P;  5CIS A;  1EQG A;  1HT5 A;  2XC5 L;  1EBV A;  1PFX L;  2Y7X B;  3V65 B;  1EAI C;  2VWN L;  1G1S A;  1CEJ A;  1IQK L;  3KQE L;  2XBX L;  3OLU A;  1FSB A;  3OLT A;  1QFK L;  1GK5 A;  5F19 A;  2J34 B;  2M74 A;  3HS7 A;  4ISI L;  1EPH A;  3IIT B;  2Y5F L;  1JV2 B;  4BTI A;  5CKN A;  1C5M F;  4AQT A;  1ATA A;  5JBB E;  2Y7Z B;  3MQE A;  1UZJ A;  4Y79 B;  3NJP C;  4O1Z A;  5L2Y L;  1LPZ A;  1N1I A;  4LMF A;  1F0R B;  2XBV L;  3N8X A;  1ATE A;  1TLE A;  3M37 L;  6COX A;  4XLW A;  2BQ6 A;  4BDW A;  1NQL B;  1CX2 A;  3ENS A;  2KB9 A;  1NZI A;  3KK6 A;  1Z6C A;  2WPL E;  4ZHA B;  3DEM A;  3KL6 B;  4YT7 L;  2H9E L;  1Q4G A;  1NPE B;  1IOE L;  3TBD A;  1MQ6 L;  4M10 A; 
#chains in the Genus database with same CATH topology
 2RA0 L;  1FAK L;  2BOK L;  4CUF A;  2XC0 L;  1AUT L;  2DDU A;  2YGO A;  3CFW A;  3NT1 A;  5E8D A;  1XKB A;  3FCS B;  1NFX B;  1FJS L;  1W7X L;  2WG3 C;  2FLB L;  1IQF L;  3ZYJ B;  1PGE A;  1IQM L;  3ASI A;  3KCG L;  4O02 B;  1FFM A;  1LQD A;  2EI7 B;  2Y38 A;  3N8Y A;  3N8Z A;  1X7A L;  2FLG A;  1KKE A;  2Y80 B;  4E1G A;  2WFT A;  5JVY A;  3HO5 A;  2HOR A;  4NA9 L;  3TK5 B;  3F6U L;  2B7D L;  1HZ8 A;  1PRH A;  4X8U L;  1LPG A;  1WHF A;  1OB1 C;  1Z6E L;  1KIG L;  3KQD L;  5L30 L;  5KN5 C;  2J4I B;  2W26 B;  4X8T L;  5JW1 A;  4JZE L;  3PGH A;  1ATB A;  3LTF B;  3Q3K B;  5JVZ A;  1IQN L;  4Y7A B;  2UWL B;  1YUK B;  1MQ5 L;  3U7U G;  4PH9 A;  1G2L B;  1B9W A;  4YT6 L;  3GCW E;  4JZD L;  2Y5H L;  5EGM B;  2PUQ L;  1CVW L;  1COU A;  1FAX L;  1TPG A;  2J2U B;  2VJ3 A;  4XL1 A;  3LC3 B;  3TGF A;  2J38 B;  1CQE A;  3TH3 L;  1K36 A;  3POY A;  2I9B A;  2VH0 B;  2VVC K;  5IKV A;  2VH6 B;  4Y76 B;  1HX2 A;  3HS6 A;  2WPJ E;  1IQE L;  2I9A A;  2WZP P;  2BSF A;  3V64 C;  1JBU L;  2BOU A;  2XBY L;  1NFW B;  1M1X B;  1ZAQ A;  1JL9 A;  4G1M B;  2BZ6 L;  3R05 A;  1HJ7 A;  5FDQ A;  2P95 L;  1UZQ A;  2W86 A;  2FD6 A;  1FE2 A;  1G1Q A;  4COX A;  3N8W B;  2FZZ L;  4BXW A;  2BOH A;  1DX5 I;  1YUF A;  4Y7B B;  2MHP A;  3SOB B;  4OTY A;  5IKQ A;  2UWP B;  2P3U A;  3N8Y B;  4CUD A;  5CKQ A;  1APQ A;  2P3F L;  4LOR A;  1EMO A;  3TZI A;  4RRW A;  4C16 A;  2H9E C;  3QH0 A;  1APO A;  2VVV L;  3FBY A;  1TOZ A;  4RUT A;  4CUE A;  1V3X B;  1MOX C;  5COX A;  5JBA E;  4GU4 A;  4NG9 L;  1LMJ A;  1HRF A;  1YUG A;  1IVO C;  1P9J A;  1IOX A;  2W3K B;  1NT0 A;  2TGF A;  2MGR A;  1LK9 A;  2XBW L;  4Y6D B;  1WU1 B;  1L5G B;  1EPG A;  3QMO A;  4XBM A;  1CFH A;  2Q1J B;  1EGF A;  3HPT A;  1O5D L;  1IQG L;  4X8V L;  5JB8 E;  3TK6 B;  2J94 B;  2P93 L;  2CJI B;  1IQH L;  3Q7D A;  1DQB A;  4A7I A;  4RRY A;  2Y5G L;  3ELA L;  3M36 L;  4JYV L;  1HRE A;  1IQJ L;  4M11 A;  3ZYG A;  4TGF A;  4RRZ A;  2RHP A;  1FF7 A;  2FLR L;  4ZXX L;  1XKA L;  4YZU B;  2BQW A;  2W2N E;  2Y81 B;  3KQC L;  1I0U A;  1V1I A;  4JYU L;  2OYE P;  4GU3 A;  1PTH A;  3S6X A;  1G2M B;  3C9A C;  2XC4 L;  1XFE A;  2KL7 A;  2W3I B;  1DIY A;  1LPK A;  4ZXY L;  2P28 B;  5KIR A;  1G1R A;  1DDX A;  4MMX B;  3IJE B;  2AYL A;  4FM5 A;  2EI6 B;  4OTJ A;  1UZK A;  3QCW A;  1F0S B;  2JJL A;  3LIW B;  1G1T A;  3SOQ A;  1NFY B;  3LTG D;  5L2Z L;  2WPM E;  2K2S B;  3ZYI B;  2VRS A;  3NTG A;  1UZP A;  2WYG B;  2NPR A;  2W2O E;  1CVU A;  2Y82 B;  3LN1 A;  2WG4 B;  2W2P E;  2BOX A;  2UWO B;  4CSY A;  4Y71 B;  2VWM K;  3H5C B;  1PXX A;  4RRX A;  2MGP A;  3SW2 A;  2KV4 A;  3P5B L;  3HO3 A;  4Z0K B;  2EI8 B;  4D0E A;  4A94 C;  3CA7 A;  1W8B L;  3CS7 L;  3F1S B;  3BT2 A;  2K2T A;  3EGF A;  2W2M E;  1WHE A;  1EPI A;  3GCX E;  1ADX A;  5I46 L;  4ISH L;  2WPI E;  1F7E A;  1F7M A;  2VVU L;  3KQB L;  1YGC L;  5IKR A;  1K37 A;  2BT7 A;  4ZH8 B;  3HO4 A;  2WPK E;  1IJQ A;  1SZB A;  5IKT A;  1EMN A;  3FFG L;  2GD4 A;  2F9B L;  3SOV A;  2BT8 A;  1IP0 A;  3N8W A;  3GIS X;  1IQI L;  1N7D A;  5CKM A;  2HOX A;  2YGQ A;  2W2Q E;  2BQ7 A;  4D90 A;  1KLO A;  1XDT R;  2JKH L;  3U73 A;  1HAF A;  4BXS A;  2VWO L;  1QIU A;  5K0H B;  2WPH E;  1HT8 A;  1EPJ A;  1BF9 A;  1EQH A;  2G00 L;  3LC5 B;  1CCV A;  5JBC E;  4JZF L;  1U8C B;  1YO8 A;  2ADX A;  3CEN L;  4BTT A;  4MMY B;  4RS0 A;  3LAQ A;  4Z0L A;  2PR3 B;  4NGA L;  2RNL A;  1ATD A;  2YGP A;  2P94 L;  1P0S L;  1EZQ B;  2WFX B;  1URK A;  2P16 L;  1HCG B;  1HAE A;  4Z6A L;  3N8V A;  4X8S L;  1NFU B;  1A3P A;  3BT1 A;  1RFN B;  3K9X A;  1IGZ A;  1V1H A;  1IQL L;  1KSN B;  4ZAE B;  2P3T A;  1KLI L;  3HS5 A;  5JB9 E;  1LMM A;  2P26 A;  3LN0 A;  1IGX A;  2VWL L;  3BPS E;  2BO2 A;  2BMG A;  1KLJ L;  3NTB A;  4BDX A;  5F1A A;  2P3F N;  1J9C L;  2PHB B;  3KRK A;  4MMZ B;  1CCF A;  1DVA L;  3MDL A;  2D1J B;  4D0F A;  3RR3 A;  1L3Y A;  2J95 B;  1U67 A;  4BTU A;  2WYJ B;  2OYU P;  5CIS A;  1EQG A;  1HT5 A;  2XC5 L;  1EBV A;  1PFX L;  2Y7X B;  3V65 B;  1EAI C;  2VWN L;  1G1S A;  1CEJ A;  1IQK L;  3KQE L;  2XBX L;  3OLU A;  1FSB A;  3OLT A;  1QFK L;  1GK5 A;  5F19 A;  2J34 B;  2M74 A;  3HS7 A;  4ISI L;  1EPH A;  3IIT B;  2Y5F L;  1JV2 B;  4BTI A;  5CKN A;  2KNI A;  1C5M F;  4AQT A;  1ATA A;  5JBB E;  2Y7Z B;  3MQE A;  1UZJ A;  4Y79 B;  3NJP C;  4O1Z A;  5L2Y L;  1LPZ A;  1N1I A;  4LMF A;  1F0R B;  2XBV L;  3N8X A;  1ATE A;  1TLE A;  3M37 L;  6COX A;  4XLW A;  2BQ6 A;  4BDW A;  1NQL B;  1CX2 A;  3ENS A;  2KB9 A;  1NZI A;  3KK6 A;  1Z6C A;  2WPL E;  4ZHA B;  3DEM A;  3KL6 B;  4YT7 L;  2H9E L;  1Q4G A;  1NPE B;  1IOE L;  3TBD A;  1MQ6 L;  4M10 A; 
#chains in the Genus database with same CATH homology
 2RA0 L;  1FAK L;  2BOK L;  4CUF A;  2XC0 L;  1AUT L;  2DDU A;  2YGO A;  3CFW A;  3NT1 A;  5E8D A;  1XKB A;  3FCS B;  1NFX B;  1FJS L;  1W7X L;  2WG3 C;  2FLB L;  1IQF L;  3ZYJ B;  1PGE A;  1IQM L;  3ASI A;  3KCG L;  4O02 B;  1FFM A;  1LQD A;  2EI7 B;  2Y38 A;  3N8Y A;  3N8Z A;  1X7A L;  2FLG A;  2Y80 B;  4E1G A;  2WFT A;  5JVY A;  3HO5 A;  4NA9 L;  3TK5 B;  3F6U L;  2B7D L;  1HZ8 A;  1PRH A;  4X8U L;  1LPG A;  1WHF A;  1OB1 C;  1Z6E L;  1KIG L;  3KQD L;  5L30 L;  5KN5 C;  2J4I B;  2W26 B;  4X8T L;  5JW1 A;  4JZE L;  3PGH A;  1ATB A;  3LTF B;  3Q3K B;  5JVZ A;  1IQN L;  4Y7A B;  2UWL B;  1YUK B;  1MQ5 L;  3U7U G;  4PH9 A;  1G2L B;  1B9W A;  4YT6 L;  3GCW E;  4JZD L;  2Y5H L;  5EGM B;  2PUQ L;  1CVW L;  1COU A;  1FAX L;  1TPG A;  2J2U B;  2VJ3 A;  4XL1 A;  3LC3 B;  3TGF A;  2J38 B;  1CQE A;  3TH3 L;  1K36 A;  3POY A;  2I9B A;  2VH0 B;  2VVC K;  5IKV A;  2VH6 B;  4Y76 B;  1HX2 A;  3HS6 A;  2WPJ E;  1IQE L;  2I9A A;  2WZP P;  3V64 C;  1JBU L;  2BOU A;  2XBY L;  1NFW B;  1M1X B;  1ZAQ A;  1JL9 A;  4G1M B;  2BZ6 L;  3R05 A;  1HJ7 A;  5FDQ A;  2P95 L;  1UZQ A;  2W86 A;  2FD6 A;  1FE2 A;  1G1Q A;  4COX A;  3N8W B;  2FZZ L;  4BXW A;  2BOH A;  1DX5 I;  1YUF A;  4Y7B B;  2MHP A;  3SOB B;  4OTY A;  5IKQ A;  2UWP B;  2P3U A;  3N8Y B;  4CUD A;  5CKQ A;  1APQ A;  2P3F L;  4LOR A;  1EMO A;  3TZI A;  4RRW A;  4C16 A;  2H9E C;  3QH0 A;  1APO A;  2VVV L;  3FBY A;  1TOZ A;  4RUT A;  4CUE A;  1V3X B;  1MOX C;  5COX A;  5JBA E;  4NG9 L;  1LMJ A;  1HRF A;  1YUG A;  1IVO C;  1P9J A;  1IOX A;  2W3K B;  1NT0 A;  2TGF A;  2MGR A;  2XBW L;  4Y6D B;  1WU1 B;  1L5G B;  1EPG A;  3QMO A;  4XBM A;  1CFH A;  2Q1J B;  1EGF A;  3HPT A;  1O5D L;  1IQG L;  4X8V L;  5JB8 E;  3TK6 B;  2J94 B;  2P93 L;  2CJI B;  1IQH L;  3Q7D A;  1DQB A;  4A7I A;  4RRY A;  2Y5G L;  4JYV L;  3ELA L;  3M36 L;  1HRE A;  1IQJ L;  4M11 A;  3ZYG A;  4TGF A;  4RRZ A;  2RHP A;  1FF7 A;  2FLR L;  4ZXX L;  1XKA L;  4YZU B;  2BQW A;  2W2N E;  2Y81 B;  3KQC L;  1I0U A;  4JYU L;  2OYE P;  1PTH A;  3S6X A;  1G2M B;  3C9A C;  2XC4 L;  1XFE A;  2KL7 A;  2W3I B;  1DIY A;  1LPK A;  4ZXY L;  2P28 B;  5KIR A;  1G1R A;  1DDX A;  4MMX B;  3IJE B;  2AYL A;  4FM5 A;  2EI6 B;  4OTJ A;  1UZK A;  3QCW A;  1F0S B;  3LIW B;  1G1T A;  3SOQ A;  1NFY B;  3LTG D;  5L2Z L;  2WPM E;  2K2S B;  3ZYI B;  3NTG A;  1UZP A;  2WYG B;  2NPR A;  2W2O E;  1CVU A;  2Y82 B;  3LN1 A;  2WG4 B;  2W2P E;  2BOX A;  2UWO B;  4CSY A;  4Y71 B;  2VWM K;  3H5C B;  1PXX A;  4RRX A;  2MGP A;  3SW2 A;  2KV4 A;  3P5B L;  3HO3 A;  4Z0K B;  2EI8 B;  4D0E A;  4A94 C;  3CA7 A;  1W8B L;  3CS7 L;  3F1S B;  3BT2 A;  2K2T A;  3EGF A;  2W2M E;  1WHE A;  1EPI A;  3GCX E;  1ADX A;  5I46 L;  4ISH L;  2WPI E;  1F7E A;  1F7M A;  2VVU L;  3KQB L;  1YGC L;  5IKR A;  1K37 A;  4ZH8 B;  3HO4 A;  2WPK E;  1IJQ A;  1SZB A;  5IKT A;  1EMN A;  3FFG L;  2GD4 A;  2F9B L;  3SOV A;  1IP0 A;  3N8W A;  3GIS X;  1IQI L;  1N7D A;  5CKM A;  2YGQ A;  2W2Q E;  2BQ7 A;  4D90 A;  1KLO A;  1XDT R;  2JKH L;  3U73 A;  1HAF A;  4BXS A;  2VWO L;  5K0H B;  2WPH E;  1HT8 A;  1EPJ A;  1BF9 A;  1EQH A;  2G00 L;  3LC5 B;  1CCV A;  5JBC E;  4JZF L;  1U8C B;  1YO8 A;  2ADX A;  3CEN L;  4BTT A;  4MMY B;  4RS0 A;  3LAQ A;  4Z0L A;  2PR3 B;  4NGA L;  2RNL A;  1ATD A;  2YGP A;  2P94 L;  1P0S L;  1EZQ B;  2WFX B;  1URK A;  2P16 L;  1HCG B;  1HAE A;  4Z6A L;  3N8V A;  4X8S L;  1NFU B;  1A3P A;  3BT1 A;  1RFN B;  3K9X A;  1IGZ A;  1IQL L;  1KSN B;  4ZAE B;  2P3T A;  1KLI L;  3HS5 A;  5JB9 E;  1LMM A;  2P26 A;  3LN0 A;  1IGX A;  2VWL L;  3BPS E;  2BO2 A;  2BMG A;  1KLJ L;  3NTB A;  4BDX A;  5F1A A;  2P3F N;  1J9C L;  2PHB B;  3KRK A;  4MMZ B;  1CCF A;  1DVA L;  3MDL A;  2D1J B;  4D0F A;  3RR3 A;  1L3Y A;  2J95 B;  1U67 A;  4BTU A;  2WYJ B;  2OYU P;  5CIS A;  1EQG A;  1HT5 A;  2XC5 L;  1EBV A;  1PFX L;  2Y7X B;  3V65 B;  1EAI C;  2VWN L;  1G1S A;  1CEJ A;  1IQK L;  3KQE L;  2XBX L;  3OLU A;  1FSB A;  3OLT A;  1QFK L;  1GK5 A;  5F19 A;  2J34 B;  2M74 A;  3HS7 A;  4ISI L;  1EPH A;  3IIT B;  2Y5F L;  1JV2 B;  4BTI A;  5CKN A;  2KNI A;  1C5M F;  4AQT A;  1ATA A;  5JBB E;  2Y7Z B;  3MQE A;  1UZJ A;  4Y79 B;  3NJP C;  4O1Z A;  5L2Y L;  1LPZ A;  1N1I A;  4LMF A;  1F0R B;  2XBV L;  3N8X A;  1ATE A;  1TLE A;  3M37 L;  6COX A;  4XLW A;  2BQ6 A;  4BDW A;  1NQL B;  1CX2 A;  3ENS A;  2KB9 A;  1NZI A;  3KK6 A;  1Z6C A;  2WPL E;  4ZHA B;  3DEM A;  3KL6 B;  4YT7 L;  2H9E L;  1Q4G A;  1NPE B;  1IOE L;  3TBD A;  1MQ6 L;  4M10 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...