1WHHA

Solution structure of the 2nd cap-gly domain in mouse clip170-related 59kda protein clipr-59
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
102
structure length
102
Chain Sequence
b'GSSGSSGKSPSSPSLGSLQQREGAKAEVGDQVLVAGQKQGIVRFYGKTDFAPGYWYGIELDQPTGKHDGSVFGVRYFTCAPRHGVFAPASRIQRIGSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CLIPR-59
publication title Solution structure of the 2nd CAP-Gly domain in mouse CLIP170-related 59kDa protein CLIPR-59
rcsb
source organism Mus musculus
molecule tags Structural protein
total genus 10
structure length 102
sequence length 102
ec nomenclature
pdb deposition date 2004-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01302 CAP_GLY CAP-Gly domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.190 Mainly Beta Roll SH3 type barrels. CAP Gly-rich-like domain 1whhA01
1WHJA 2HL5C 1WHHA 1WHGA 2CP0A 2M02A 2HL3A 1WHLA 1WHMA 2CP2A 2E4HA 1TXQA 2CP7A 1IXDA 1TOVA 2CP6A 2E3IA 1WHKA 2QK0A 2HKQB 3RDVA 2CP3A 2MPXC 2E3HA 4B6MA 2CP5A 2COZA 2COWA 2Z0WA 2COYA 1LPLA 3E2UA 3TQ7P 2HQHA 2HKNA
chains in the Genus database with same CATH superfamily
3CD6Q 2X4JA 4XTZA 4HVVA 4OB2B 4CRIA 2JM8A 3INZA 2KROA 4VUBA 5KYUA 3OW2A 5GAMj 5FRNA 3ZEHA 4C0FA 4L59A 3OYKA 1W2BS 1SSFA 3EGDB 3OYYA 4RTYA 4XU1A 3GIBA 5FW9A 1QVGA 4M7AE 2KVQG 4XTVA 1S1NA 3CCMT 5GAN7 1UFFA 2DZCA 2COYA 2NLUA 4C92B 3HKSA 2LQ8A 1JO8A 2O88A 3L42A 1RAAB 1SG5A 2ZAEA 4N4IA 2XIDA 1WHLA 3QHSA 1B34A 1KG1A 4QQDA 1KQ2A 3SWNC 1OPLA 4QQ6A 1SF9A 2DVJA 1MMNA 5GAN5 2O4XB 2PNIA 1M8VA 3CQTA 1UGSB 3GNGA 3EFOA 3CCMQ 2VYTA 1Q81C 4J9DA 2HAXA 2BTTA 1K73C 2V1QA 4M78B 4RG8A 3MEAA 2XI9A 2IPOB 1JXOA 5AYFA 4A4KA 1VYTA 4C8QF 4BE2A 4DQ2A 3CMAQ 2ROTA 3PGGA 5GAOp 1D0ZA 1E6GA 5CKDA 1VOMA 5GAOr 3SDZA 3EH1A 4XTXA 1TTHB 4FSXA 2DYBA 2KY9A 1YJNT 1M90R 3FDRA 1QKWA 2A0FB 2PZ1A 4M77C 4A4GA 2YUOA 4J6XA 4J7FA 2PVDB 2QK0A 1Q7YU 2ED0A 4Z02A 1PWTA 3EG9B 2E3HA 3X25B 4KT0E 4B6MA 1AWOA 4JRIA 1U3OA 3OSSC 1YNZA 1LVKA 3MEWA 1YIJA 4FT4A 1SSHA 4M75A 4BB7A 2ESWA 2KRNA 2O9VA 4JLGA 2DXBA 1YJNQ 1C1AA 3SEMA 2P4RA 5L8RE 1U8RA 1NLOC 2DVEA 2LQNA 4BUGA 2LT1A 1C0MA 1TU0B 1AZGB 4HCBA 2RMOA 1OU9A 2CT3A 2QTVA 3PMIA 2O9SA 5CK9A 2Y4XA 3CCEA 5GAN2 1UGPB 2BZ8A 4RTUA 2X9HA 3EH2A 3MP6A 3FC3A 3M5AA 2DXTA 5HY6A 3QJYA 1YIJT 2C0IA 2P0PA 1VQOA 2BZYA 4KGVB 2QQRA 1PD1A 2EKHA 4N4HA 4C92A 1AOJA 3OSVA 2CS7A 4HT8A 3CCQQ 1I1JA 1JB0E 4E7SA 2ZPEB 1NPPA 3SWNB 2QDLA 1QQJA 2RQUA 3JCMd 3DLLA 1W1FA 2H8HA 3CCET 1FXXA 2DL7A 3VUBA 5IN1A 2X3XD 1JJ2A 1YIJQ 1VQOT 4NL2A 4F7UE 4ATOA 2YDLA 5GAOn 2K3BA 4PJJA 4FIBA 2E64A 3SHWA 5GAMf 4M78A 1TH7A 4DA4A 3V8LA 1SHGA 4M7DA 2B8AA 4JJCA 1QW1A 4PFPA 3E19A 1X2QA 1ZX6A 4XTYA 1ACMB 2IIMA 5GANh 2LZ6B 1FWZA 1M9SA 2K4YA 2DAQA 3G6EQ 1D3BB 2XG8D 3PMTA 4M77B 4C0DC 3VS1A 2M1HA 2A3LA 4X1VA 7AT1B 5DY9A 3UT1A 2YRCA 5CKHA 2ZCFB 5IAYA 3G7ZA 1VQOQ 4M7DD 3PFSA 2WSEE 3PE0A 1RAHB 4JRQA 2L2PA 1OZ3A 2JN0A 2KRMA 4AG1C 3CCRA 2EYYA 1H92A 4ELYC 2AHJB 1WDXA 2ZPHB 3H0IA 1PD0A 1T3LA 4OB0B 5GAOl 1NPRA 1M1KR 2W10A 3Q1JA 3UDCA 4LDUA 2IG0A 4WCIA 3I56T 2CREA 4C5GA 1K0XA 3TSZA 3OS2A 3TEEA 1K76A 2DL5A 2EYZA 3O5ZA 2OTJT 1AZEA 3CCRT 3FB9A 1BBZA 2DEQA 1QVFA 3G1JA 3R6OA 2CP2A 3DB3A 3NMZC 2KSSA 4C5IA 1UGVA 5IH2A 4M7AG 1K9MC 2ZPBB 3MP1A 1D0XA 5LJ3d 1IZ6A 2COZA 1QVPA 4J9FA 3HPWA 3I56Q 2PVGB 2E41A 5LJ5h 3P8DA 3MEUA 3I9QA 2EYXA 2F69A 4MMKA 3QWYA 2E65A 2C0TA 2DD4A 2JXBA 2K5IA 1BCMA 4XK8E 4C8QC 1Q82R 2HBWA 2OTJQ 4J9EA 3NPFA 1I81A 3LGLA 2XD0A 3VYGA 4M75E 4E7ZA 1K4US 1ZA1B 1UE9A 5CR2A 3M9QA 2GTJA 3L2WA 2LT4A 4IUVA 2RHXA 2VWFA 4PKCC 2NWMA 5KYYA 3RNJA 3CCSA 5A2QE 3VUZA 3ZFJA 2XK0A 1GL5A 1D3BA 3CPWP 3H6ZA 1E6HA 4M77A 4JS4A 2MPXC 4PJLA 2K3YA 2VVKA 2M51A 3V7CA 1ZBJA 4FCYA 1MMDA 3A8LB 2L8DA 1WFWA 3ULRB 1M3BA 4IUUA 1U1TA 4C92E 1KQSA 4FYXB 4J9GA 4OMLA 1RAGB 2CZ7B 2E5QA 4OB1B 3IQLA 3A1PA 4E6RA 1VQLT 4C5EA 3CCST 4JZ4A 2BE9B 3PNWC 4LE9A 1YJ9Q 3ZBDA 5GMKh 2JOYA 4J9HA 1CKBA 3HTRA 3J81E 3QPHA 1M4ZA 2CDTA 5CVIA 2GCXA 1ZSZC 4M78E 1W6XA 2JTEA 4M7DE 3UPUA 1VA7A 1GBQA 1VQLQ 5KE2A 2QEXA 4LUEA 1W2BP 2CSIA 1N8RC 1Q7YR 1MMAA 1VYUA 3FRNA 4JUVA 4BI4A 5I22A 3JCMf 2KT1A 1G83A 2YHTA 3S3NA 1VQKT 1IREB 3RBBB 3S3OA 2DXUA 4PFZA 1IO6A 4BDZA 4KGZB 2RHUA 2QGGA 1XNIA 4C8QB 1WHJA 1YHQQ 2CZ0B 4F16A 3X26B 2YLBA 4LUDA 2QEXT 2CH4W 2DFUA 5KH6A 3CC7A 3A98A 1H3HA 1WXTA 4QKUA 2CT4A 4FYWB 1Q81U 2GFAA 4DBQA 4BACA 2K3XA 2JTFA 2BIVA 4F7UG 2EYWA 3CCLQ 1S72T 1VQKQ 3OYNA 4FU6A 1BI1A 4BI3A 2JMAA 2FO0A 3CCVQ 2RM4A 2EQIA 1J3TA 2LNVA 1NJIC 1WGSA 2GFUA 2P84A 1X2KA 3I55T 1KHIA 1TXQA 2CP7A 3EG1A 2HQXA 4LD6A 2DXCA 3C4SA 2KR3A 3CC7T 2RJFA 1OX8A 4FYVB 4DOVA 3LLRA 1BIBA 1S72Q 3BDUA 4ESRA 4ELZC 1VQPA 4M7AF 4QVZA 3LH5A 4OMQA 1KD1U 1SRLA 1G3TA 2PQWA 4KUDK 3I55Q 1T3SA 5GAN4 1UECA 2VXEA 2JMCA 3M0TA 2DA9A 3NTHA 1VIFA 4QT7A 2M9UA 1OX9A 2PVOB 2GGRA 2HBPA 1WYXA 2VV5A 4IIMA 1X75C 1IB8A 1WHMA 2RD1A 2MCNA 5GANe 1VQ7Q 3EGUA 1NG2A 4L6V5 1PRMC 2QA4A 2EJGA 4KBMB 1QCOA 4DBFA 5FLXE 2QASA 2QTXA 2QQ9A 5LJ3f 4HCZA 3A8MB 1H3ZA 2JT4A 2HQEA 1UJYA 1KFZA 1OYXA 2J06A 4RTWA 1U5SA 1OI1A 1PKSA 3JB9J 5GMKi 4AT1B 1M90C 1UGQB 2DKGA 4R56A 4E7HA 1VQ9A 3JCMe 4HCCA 4OF1A 3WXMB 3CXCP 2RB6A 1YJWA 4C8QA 2OI3A 1PCXA 1RL2A 3JCMX 2QA4T 2LCCA 1Z9QA 4RCCA 1NEBA 2A36A 1ZSGA 1PHTA 1UHFA 4ME7A 4RTVA 3HFNA 2DETA 1G3YA 2DE0X 4II1A 1X6BA 2V26A 4EMKB 1VQ8A 2C0OA 1OV3A 3REAB 3BDLA 1TG0A 3M0UA 4XTUA 5GAMh 3OYCA 1VQ9T 2X4YA 2RQRA 5A0LA 1AD5A 4IIOA 1BK2A 2IVWA 2RJCA 2W0ZA 1YJWT 2XKOC 5GAOq 3OYDA 5CKBA 1TUGB 3I5RA 4ZN1A 4OMNA 4FYYB 2DZ9A 1MNDA 5EG2A 1MV3A 3CBMA 3WVDB 1I4K1 1Y96B 2G3RA 5GAN6 1ZUUA 2QQSA 3HRTA 2E12A 2K9GA 5GAN8 3JCMb 4NS5A 5LJ5e 4ZGJB 2GTOA 2LNHB 1WQ7A 1BB9A 1ZBXA 4ZTFA 3ER0A 3OYEA 5GANg 3CMEA 5I2SA 3C94A 1NM7A 2V8IA 2LJ1A 1NLPC 3UWNA 1YITA 2MI6A 3QO3A 4J6WA 2XDBA 2L5QA 1PSEA 2DK3A 1ZSZA 4HA8A 1TWBA 3RMSA 3BFMA 2FPEA 3PIOA 1I0CA 4OVAA 2J05A 4A63B 1N6AA 2ENMA 2LRQA 2RF0A 2AT1B 4F7UF 4M7DG 5FWCA 1GRIA 2MYSA 3CMET 2K7AA 1D1CA 1TUDA 3QBYA 1N5ZA 3M0QA 5LJ3e 4IURA 2HKNA 3HP9A 3VS0A 3DLMA 4CC3A 1P92A 2CZ6B 1IHWA 2DRMA 2AZSA 4XAXB 2CUDA 2GQIA 4V2SA 3OS0A 3JB9D 3CBPA 2DERA 1B7TA 5GMKe 3OYIA 3TQ7P 3CPWA 1VQ5A 4C0GA 1ARKA 4JDSA 2H3EB 1VQMA 2QGFB 4TVRA 4MZTA 1B3QA 3G71A 2YRDA 4AMCA 4M75D 1M1KC 2F5KA 1TOVA 3EGDA 2K79A 1PNJA 4F04B 1LNXA 4GY5A 2EIFA 3NHNA 2CP5A 1UHCA 3RERA 3QXEB 1ZQ1A 5GJVB 2E70A 4Y28E 4M7AC 2FG0A 4PLLA 1M3AA 1U1SA 2K5FA 2HMAA 1VQ6A 2KK4A 3CXCS 3OBWA 1Y96A 1VQ5T 1E7OA 5HK3A 1VQMT 1RLQC 1XJWB 4E7IA 2F2VA 3G71T 1RADB 2O4XA 1RI9A 2WSCE 1FMVA 4C92D 3KFVA 5CO7A 2JS0A 5LL6S 1JBMA 3RUXA 1SRMA 1Q81R 2DIQA 2PUKB 3H41A 1K73R 4DEXA 5I21A 3SFMA 4PJOC 1W2BA 2EVRA 4PJNA 1VQ6T 1FMKA 1Q82C 3JAME 1WIEA 1VQ5Q 4LDWA 1C6VX 1EFNA 3OMCA 2VKNA 3CEYA 3CCEQ 1X69A 1WJRA 4GLMA 2E6ZA 4OGCA 3OY9A 2MWPA 1OPKA 2HCKA 2KBTA 1M1FA 3JCMJ 4BDYA 2KI7A 4M78D 2AZVA 1ZLMA 3QG1A 1WQWA 3VS6A 1AVZC 3CCUA 1YFNA 4CC4B 3AHUA 3EG9A 3PVLA 2MOXA 2YWWA 1PRLC 1UB4A 2DD5A 3JCMh 3M53A 3VS5A 3OYMA 2OX7A 2K57A 3GP8A 1KD1R 3URGA 2HL5C 3QKJA 5DM7R 4OMOA 4LXCA 1WLPB 2DTOA 3X24B 3G4SA 1I5LA 4KH0B 2D9TA 2YRVA 3MP8A 5HCKA 1QVGP 2HSPA 2E4HA 2FPFA 2ROLA 1GCQC 4XQ3A 2LQKA 1NZ9A 4XU0A 3QDRB 4QVCA 4A4EA 4J9BA 5IXBA 1Q86U 3CCUT 2MWOA 2D8HA 3UATA 4IKFA 4HT9A 4F14A 5CQXA 1SPKA 2M02A 3EGXB 1LJOA 2J6KA 2X4WA 1K8AU 3GBQA 2RNAA 2DL8A 4E7KA 2DILA 1NJIU 4GLKA 4M7AB 1EIFA 1Y07A 1YWOA 3OS5A 2EPDA 1TUCA 5GAOm 3SWNA 3J7AF 1WHHA 3MKDA 1YI2A 4Z8AA 4M78F 4M7DF 5FU6B 3BE3A 2HEQA 3CCRQ 4AG2C 3OYJA 4EMGA 2VASA 1X6GA 5D7UA 1GCPA 4CC7A 1GXIE 3JCMW 4ZTJA 2EGAA 2AKKA 3PVQA 5FRMA 4PJOB 2A7YA 2O01E 3TSWA 5GAMe 1UDLA 1K1ZA 5HK0A 2H3JA 1YI2T 3S3MA 4KH1B 1Q95G 4Z88A 1Z9ZA 1PM3A 5CKFA 4A4HA 3VV0A 3H0FA 3FEOA 3P8BB 2HSEB 1IGQA 1ABOA 3O8VA 5LJ3h 4IUQA 5HKCA 3VRZA 4EMHA 5GAN3 3MO8A 3LWHA 4M77D 2NUPB 1ZHIA 4EDUA 1RI0A 3EFRA 3EHQA 1KC8C 1KQ1A 5EC7A 2EW3A 2BZXA 2E6NA 2HNIA 4F17A 1QWFA 2XDPA 2ZPFB 3VJPA 2EQJA 4FW2A 1TSFA 3EG3A 3CC2A 8AT1B 2EWNA 1D09B 4OP0A 2P0QA 4RTZA 1BU1A 4N4GA 1BI0A 3R6NA 5GMKj 4BI8B 4N0AC 4PLIA 3EGXA 1G5VA 4RTXA 3LGFA 3CCSQ 2RQVA 2V1RA 2C06A 3MCAB 2CP0A 3GF5A 4B9XA 2EJFA 2KGTA 4MZPA 1JJ2P 3RKWA 1XTDA 2EGCA 4QQGA 3JCMQ 2NUTB 3NFCA 2OTLA 3OW2S 1LOJA 1NBEB 1M2VB 2XICA 4J5YA 3J80E 2F1LA 4LN2A 2VGNA 1VQNA 1AEYA 3VS3A 3HHTB 1QVGS 3CC2T 2JNGA 1N9RA 2A37A 2RPNA 5ECAA 2I2LA 2HL3A 3GNFB 1B07A 1M1GA 1WJQA 2KXCA 2EGEA 2JJ9A 5M9OA 3CC4A 1H641 2GBQA 3LWIA 2KMTA 3A8GB 3M59A 4MDXA 2FB7A 3UA6A 3EAEA 3ME9A 1RAFB 4PJOA 4F7UB 1K73U 2EQMA 3QUIA 3UA7A 2YLCA 4HCKA 4EMKC 5D6WA 3M56A 2RI3A 2E1HA 1GFDA 3HSBA 3QJ6A 5IHIA 1YN8A 1ZA2B 2DO3A 2VB6A 2JTMA 2YXYA 3FJPA 1YCYA 2JW4A 2EFIA 3VU3C 2AKLA 4EIKA 2QEXQ 3CC4T 1W70A 2D8JA 3A8OB 4HVUA 2QG9B 2HQHA 2KQWA 2D1XA 3QZ9B 2LDMA 4GBQA 1QLYA 1HJDA 4R55A 2FYKA 5A0DA 3M58A 2EKOA 2OJ2A 4BE1A 1V29B 3GOXA 3L2VA 1MHNA 1WXBA 3BW1A 1Y71A 1B34B 4KULA 2X35A 3L2QA 1M27C 4BD3A 3LX7A 5I11A 2KXDA 1GCQA 2ECZA 3JB9H 3E9FA 3DB4A 4WTOB 3CC4Q 3CC7Q 1VQ4A 1R0CB 3CD6A 2MMPA 5IHNA 2M16A 4IUPA 1K0SA 2PTKA 3OYGA 1WNLA 3L2RA 3RDVA 1G3SA 1V76A 1VQPT 3WVEB 3M54A 1D1AA 1MUZA 2QQAA 4M7DC 1QWEA 5KCOA 2EJ9A 2FRYA 2EYQA 4M77E 3V8KA 2F2XA 2NUTA 4WF2A 1M30A 1M2VA 4E7LA 1GBRA 3V7RA 1VQ4T 4EPCA 1OZ2A 2R5MA 4AFQC 2B86A 2CP3A 5KCHA 2RO0A 1WPYA 2FRWA 2G6FX 4DBHA 3JB9G 1HSQA 5KYXB 3C0CA 4FM4B 2LP5A 1VQPQ 2ATCB 2FEIA 3GLXA 4C0ZA 1T0JA 9ATCB 1Q86R 2D0NA 1GFCA 2O31A 3JCMc 3CCMA 2LCSA 4M75G 3OA6A 3VS7A 4F7UA 4AFSC 3QDFA 2R5AA 3LYIA 4E47A 1IHVA 4C8QD 1BCOA 2E10A 2X4XA 2ZZDA 4D8DA 1JJ2S 1K8AR 2FHDA 3RKYA 3OMGA 2CZ1B 2P0KA 1NJIR 3CMAA 4OMFB 5IXFA 2QA4Q 3ASKA 1AWJA 2CP6A 1K9AA 1KSWA 2WSFE 4FL6A 1YP5A 3L2ZA 4L5GA 4MZMA 1F1BB 4OB3B 1OQKA 1RAEB 1VQ8T 2VC8A 2Z0WA 5A0GA 5FROA 4C92G 4NOYA 1VQ9Q 3EG0A 2NYSA 1RACB 2FL7A 4Y91A 3NGPA 4A53A 1YJWQ 3SB2A 2YUNA 2MAMA 3CMAT 2DEUA 2RHZA 1SKUB 4DBRA 2RHIA 1YJNA 1MNEA 3L1AA 1A0NB 2J6OA 3LW5E 2L0AA 1RABB 3LH0A 4PJOE 2QDYB 3M57A 1VQ8Q 1WI7A 4FSSA 5J26A 1WA7A 4N0AA 1FMWA 1BYMA 1V1CA 3M4YA 1ABQA 2KYMA 1IXDA 3JCMg 2DPPB 5C0MA 2CSQA 4M78G 1OOTA 2CGHA 4OGEA 4M7DB 1QKXA 4CC2A 3MEVA 2QI2A 4XU2A 3QSUA 1RUWA 2DMOA 2SEMA 4X9CA 2FZKB 4KGXB 2RHYA 3E2UA 3PT9A 1UUEA 1X01A 1YITT 1K9MU 1JQQA 4UC4A 2GNCA 3V7SA 2ABLA 3M55A 3CCQA 4X9DA 2LC4A 1QVFS 5IHKA 1M8MA 1WHKA 2DRKA 3A8HB 4HXJA 3RMQA 2KDSA 3VKIA 2DX1A 5KYXA 2R58A 1JXMA 1RAIB 2QAZA 3A5ZB 2KRSA 2V8KA 1U06A 4J9CA 1OULA 3ZL7C 2BE7D 5CKEA 3CMEQ 1ZUYA 4Z89A 1WHGA 2F2WA 1KD1C 3EFSA 3OYFA 2AK5A 4EMKA 1YITQ 2BUDA 3RIRA 3FIFA 4C5HA 3CCQT 1VUBA 4JS5A 2PU9B 2VUBA 5KE3A 1R0BG 5LJ5g 4ANJA 1YWPA 3THKA 1EZZB 2DNUA 2F5TX 1XOVA 2I0NA 3G6EA 4ZGEB 3VYHB 3EG2A 5GANd 2QXFA 5CCAA 4PJMA 2RK2A 2VXFA 2ZPGB 2YUQA 4M4ZA 3VRYA 1X27A 3E1SA 2JUFA 3H8ZA 4FW1A 1I5OB 2EBPA 3PIPA 5FU6C 5KYWB 2A28A 2DJQA 2O2OA 1HD3A 5FU7C 3P8HA 5DLOA 3OYLA 2YT6A 4C8QE 3H9NA 2EQUA 2Y90A 1KC8U 1KQSS 5AT1B 4RTTA 3G6ET 2K2VA 2FZGB 4DEYA 4JJBA 3HRSA 3JB9F 3T9NA 1VQMQ 2DBKA 5LJ3g 1EX4A 2LTOA 5IT9E 4JPBW 3G71Q 1NYFA 1Y7XA 5J39A 2DLPA 2KE9A 3TVTA 4M75F 4LDVA 1H8KA 4RUGA 4NL3A 4J8OA 5KYYB 5GANj 1G3WA 1N8RU 2LMJA 4PL6A 1M5Q1 3JCMV 3CCJA 1UJ0A 4KUIA 1VQ6Q 4M77G 3QYGB 3QZ5B 3OW2P 1QMCA 1N27A 1OU8A 2L3RA 1QP3A 2DTHA 2QQBA 2DL3A 1YCSB 4RCBA 3I56A 4BE0A 2ZPIB 1WJSA 2FZCB 2X51A 5J3BA 1PSFA 2MK5A 2JZ2A 2DYIA 2OTJA 5LJ5d 4B9WA 4E2FB 4C92F 3EHRA 2SRCA 2RI5A 1NE8A 4FT2A 1OEBA 4RMOA 4P5NA 1R8OB 5GJWB 3GPLA 3CCJT 6AT1B 2LX9A 1VYVA 2PUOB 2KNBB 4ORZA 3G4ST 1QCNA 1HYOA 4AFZC 1FYNA 3H0HA 4PK4A 4D8KA 5CQYA 2LJ3A 2ED1A 1KHCA 4J6YA 2JM9A 3CCUQ 4RKUE 5CAIA 1Q7YC 2LJ0A 4AFUC 3CCJQ 4BY6C 3MPUB 1KK7A 5GMKl 3BY7A 2KYBA 1O75A 3N5BB 2XU8A 5FU7B 3I5SA 5KYWA 4PNOA 2AIRB 4Q5WA 2MF2A 2EAYA 5LJ5j 1WX6A 4LNPA 1M3CA 2DIGA 3E9GA 3G4SQ 4MMLA 4X34A 4CI0C 3C12A 3META 3F70A 3DKMA 1AT1B 1YJ9A 2RA2A 1HXDA 3RESA 5CIUA 2E5KA 1M2OA 2RI2A 1AWWA 1R77A 4PJOG 2Y4YA 1KIKA 3CXCA 4K11A 1QCFA 4DOWA 1VQLA 5GMKm 2M0YA 2RJDA 1N9SA 2OAUA 3JB9I 2DBMA 4C0DB 2V8JA 3UF4A 2KAFA 1YBYA 1PKTA 1JRIA 1YJ9T 1M90U 4PFOA 1FX7A 1SEMA 1TS9A 2YUPA 3PTAA 3KXTA 5LJ3j 1X43A 4R0KA 1YI2Q 1X6OA 2K5LA 1XQHA 3C95A 4MDWA 4JLIA 2R57A 2ZGWA 1HK9A 1YHQA 2L89A 5I2MA 2FPDA 1I8FA 5DLQE 4JJNK 3HFOA 2HKQB 4J83A 2MIOA 4ZN3A 4O6JA 2WACA 3JRZA 2JVVA 4J9IA 1BIAA 2K6DA 3I35A 4ZNXA 1G8XA 1CSKA 4LD9K 1UTIA 2EQKA 2GQVA 2RQTA 2RK1A 1BKBA 3CCLA 1VQKA 2HD0A 3FJ5A 2L3QA 5GANf 2HDAA 4JZ3A 3CCVA 5D6YA 4M7AA 1AHJB 2DF6A 3D7SB 1K9MR 1AWXA 2DTIA 1YHQT 3TCJA 1D0YA 2COWA 3X28B 4JRPA 4BY6B 4O5VA 2OAWA 4J7IA 2VGMA 1LCKA 4E7JA 1BI2A 5GAMg 4QW2A 4M7AD 3M0PA 1S72A 3CCLT 1UEBA 2A08A 4HKEA 1QP2A 4M77F 3CCVT 3SD4A 3U23A 2FVUA 4LDYA 4Y92A 4OMPA 5KYNA 3REBB 2OTLT 4JJDA 5L23A 4M75C 3VS2A 4C8QG 3I55A 2LVMA 3JSCA 1D1BA 4LDXA 1VQNT 2K2MA 2DM1A 1PC0A 4ZGDB 2GF7A 1Q86C 3CC2Q 1PG5B 2RN8A 2LX7A 2KEAA 3JV3A 2XDDA 5D6XA 3MHXA 5KYUB 1VQ7A 1T0HA 4PJOD 3QIIA 1IGUA 3NTIA 2CKKA 4QVDA 1K8AC 1IRXA 1W4SA 3V8JA 1BI3A 2OTLQ 2YSQA 1WXUA 3MJXA 5C6SA 3OS1A 2CH4A 3KBGA 4C92C 1VQNQ 2E3IA 2NUPA 3RR6A 3OYBA 1WZOA 2CUBA 4XU3A 5LJ5f 3OYAA 1KC8R 3QYHB 4KRTA 1QVFP 3X20B 3HRUA 3CBOA 1VQ7T 2DL4A 2DJZA 3M4GA 2RH2A 3OYHA 1NYGA 4A54A 1UG1A 2L3SA 2LQWA 2XMFA 3EFOB 3M0RA 2BKDN 1JEGA 3FLGA 3CPFA 3AT1B 8ATCB 2D6FA 1M1KU 1O9SA 3L2UA 4M78C 1ZUKA 4RG2A 1N8RR 1SHFA 2JS2A 3OQ5A 3TU4K 2J7IA 2L3PA 2LCLA 3CPWS 1Y0MA 2HZYA 2KT8A 3OBYA 1ZSZB 2D0QB 2X3WD 1MGQA 5GAMd 3RKXA 1KJWA 4D6WA 1UGRB 1MV0B 3OB9A 2NUZA 2RJEA 4A4FA 1CKAA 3VS4A 4HVWA 1VIEA 3NTKA 3CD6T 3S6WA 4PJOF 2P4TA 1NEGA 2RQWA 3KUFA 1MMGA 3TREA 2XHCA 2M0OA 3HL8A 2J6FA 4YTLA 3QWXX 1RLPC 1Y57A 3M0SA 3JCMP 2CYZB 2QYZA 1G2BA 4JRKA 4M75B 1I07A 5FWBA 1KQSP 1JU5C 1VQ4Q 1Q82U 1LPLA 4OMMA 4IUTA 4XTWA 1DJ7B
chains in the Genus database with same CATH topology
1WHJA 2HL5C 1WHHA 1WHGA 2CP0A 2M02A 2HL3A 1WHLA 1WHMA 2CP2A 2E4HA 1TXQA 2CP7A 1IXDA 1TOVA 2CP6A 2E3IA 1WHKA 2QK0A 2HKQB 3RDVA 2CP3A 2MPXC 2E3HA 4B6MA 2CP5A 2COZA 2COWA 2Z0WA 2COYA 1LPLA 3E2UA 3TQ7P 2HQHA 2HKNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WHJ A;  2HL5 C;  1WHH A;  1WHG A;  2CP0 A;  2M02 A;  2HL3 A;  1WHL A;  1WHM A;  2CP2 A;  2E4H A;  1TXQ A;  2CP7 A;  1IXD A;  1TOV A;  2CP6 A;  2E3I A;  1WHK A;  2QK0 A;  2HKQ B;  3RDV A;  2CP3 A;  2MPX C;  2E3H A;  4B6M A;  2CP5 A;  2COZ A;  2COW A;  2Z0W A;  2COY A;  1LPL A;  3E2U A;  3TQ7 P;  2HQH A;  2HKN A; 
#chains in the Genus database with same CATH topology
 3CD6 Q;  2X4J A;  4XTZ A;  4HVV A;  4OB2 B;  4CRI A;  2JM8 A;  3INZ A;  2KRO A;  4VUB A;  5KYU A;  3OW2 A;  5GAM j;  5FRN A;  3ZEH A;  4C0F A;  4L59 A;  3OYK A;  1W2B S;  1SSF A;  3EGD B;  3OYY A;  4RTY A;  4XU1 A;  3GIB A;  5FW9 A;  1QVG A;  4M7A E;  2KVQ G;  4XTV A;  1S1N A;  3CCM T;  5GAN 7;  1UFF A;  2DZC A;  2COY A;  2NLU A;  4C92 B;  3HKS A;  2LQ8 A;  1JO8 A;  2O88 A;  3L42 A;  1RAA B;  1SG5 A;  2ZAE A;  4N4I A;  2XID A;  1WHL A;  3QHS A;  1B34 A;  1KG1 A;  4QQD A;  1KQ2 A;  3SWN C;  1OPL A;  4QQ6 A;  1SF9 A;  2DVJ A;  1MMN A;  5GAN 5;  2O4X B;  2PNI A;  1M8V A;  3CQT A;  1UGS B;  3GNG A;  3EFO A;  3CCM Q;  2VYT A;  1Q81 C;  4J9D A;  2HAX A;  2BTT A;  1K73 C;  2V1Q A;  4M78 B;  4RG8 A;  3MEA A;  2XI9 A;  2IPO B;  1JXO A;  5AYF A;  4A4K A;  1VYT A;  4C8Q F;  4BE2 A;  4DQ2 A;  3CMA Q;  2ROT A;  3PGG A;  5GAO p;  1D0Z A;  1E6G A;  5CKD A;  1VOM A;  5GAO r;  3SDZ A;  3EH1 A;  4XTX A;  1TTH B;  4FSX A;  2DYB A;  2KY9 A;  1YJN T;  1M90 R;  3FDR A;  1QKW A;  2A0F B;  2PZ1 A;  4M77 C;  4A4G A;  2YUO A;  4J6X A;  4J7F A;  2PVD B;  2QK0 A;  1Q7Y U;  2ED0 A;  4Z02 A;  1PWT A;  3EG9 B;  2E3H A;  3X25 B;  4KT0 E;  4B6M A;  1AWO A;  4JRI A;  1U3O A;  3OSS C;  1YNZ A;  1LVK A;  3MEW A;  1YIJ A;  4FT4 A;  1SSH A;  4M75 A;  4BB7 A;  2ESW A;  2KRN A;  2O9V A;  4JLG A;  2DXB A;  1YJN Q;  1C1A A;  3SEM A;  2P4R A;  5L8R E;  1U8R A;  1NLO C;  2DVE A;  2LQN A;  4BUG A;  2LT1 A;  1C0M A;  1TU0 B;  1AZG B;  4HCB A;  2RMO A;  1OU9 A;  2CT3 A;  2QTV A;  3PMI A;  2O9S A;  5CK9 A;  2Y4X A;  3CCE A;  5GAN 2;  1UGP B;  2BZ8 A;  4RTU A;  2X9H A;  3EH2 A;  3MP6 A;  3FC3 A;  3M5A A;  2DXT A;  5HY6 A;  3QJY A;  1YIJ T;  2C0I A;  2P0P A;  1VQO A;  2BZY A;  4KGV B;  2QQR A;  1PD1 A;  2EKH A;  4N4H A;  4C92 A;  1AOJ A;  3OSV A;  2CS7 A;  4HT8 A;  3CCQ Q;  1I1J A;  1JB0 E;  4E7S A;  2ZPE B;  1NPP A;  3SWN B;  2QDL A;  1QQJ A;  2RQU A;  3JCM d;  3DLL A;  1W1F A;  2H8H A;  3CCE T;  1FXX A;  2DL7 A;  3VUB A;  5IN1 A;  2X3X D;  1JJ2 A;  1YIJ Q;  1VQO T;  4NL2 A;  4F7U E;  4ATO A;  2YDL A;  5GAO n;  2K3B A;  4PJJ A;  4FIB A;  2E64 A;  3SHW A;  5GAM f;  4M78 A;  1TH7 A;  4DA4 A;  3V8L A;  1SHG A;  4M7D A;  2B8A A;  4JJC A;  1QW1 A;  4PFP A;  3E19 A;  1X2Q A;  1ZX6 A;  4XTY A;  1ACM B;  2IIM A;  5GAN h;  2LZ6 B;  1FWZ A;  1M9S A;  2K4Y A;  2DAQ A;  3G6E Q;  1D3B B;  2XG8 D;  3PMT A;  4M77 B;  4C0D C;  3VS1 A;  2M1H A;  2A3L A;  4X1V A;  7AT1 B;  5DY9 A;  3UT1 A;  2YRC A;  5CKH A;  2ZCF B;  5IAY A;  3G7Z A;  1VQO Q;  4M7D D;  3PFS A;  2WSE E;  3PE0 A;  1RAH B;  4JRQ A;  2L2P A;  1OZ3 A;  2JN0 A;  2KRM A;  4AG1 C;  3CCR A;  2EYY A;  1H92 A;  4ELY C;  2AHJ B;  1WDX A;  2ZPH B;  3H0I A;  1PD0 A;  1T3L A;  4OB0 B;  5GAO l;  1NPR A;  1M1K R;  2W10 A;  3Q1J A;  3UDC A;  4LDU A;  2IG0 A;  4WCI A;  3I56 T;  2CRE A;  4C5G A;  1K0X A;  3TSZ A;  3OS2 A;  3TEE A;  1K76 A;  2DL5 A;  2EYZ A;  3O5Z A;  2OTJ T;  1AZE A;  3CCR T;  3FB9 A;  1BBZ A;  2DEQ A;  1QVF A;  3G1J A;  3R6O A;  2CP2 A;  3DB3 A;  3NMZ C;  2KSS A;  4C5I A;  1UGV A;  5IH2 A;  4M7A G;  1K9M C;  2ZPB B;  3MP1 A;  1D0X A;  5LJ3 d;  1IZ6 A;  2COZ A;  1QVP A;  4J9F A;  3HPW A;  3I56 Q;  2PVG B;  2E41 A;  5LJ5 h;  3P8D A;  3MEU A;  3I9Q A;  2EYX A;  2F69 A;  4MMK A;  3QWY A;  2E65 A;  2C0T A;  2DD4 A;  2JXB A;  2K5I A;  1BCM A;  4XK8 E;  4C8Q C;  1Q82 R;  2HBW A;  2OTJ Q;  4J9E A;  3NPF A;  1I81 A;  3LGL A;  2XD0 A;  3VYG A;  4M75 E;  4E7Z A;  1K4U S;  1ZA1 B;  1UE9 A;  5CR2 A;  3M9Q A;  2GTJ A;  3L2W A;  2LT4 A;  4IUV A;  2RHX A;  2VWF A;  4PKC C;  2NWM A;  5KYY A;  3RNJ A;  3CCS A;  5A2Q E;  3VUZ A;  3ZFJ A;  2XK0 A;  1GL5 A;  1D3B A;  3CPW P;  3H6Z A;  1E6H A;  4M77 A;  4JS4 A;  2MPX C;  4PJL A;  2K3Y A;  2VVK A;  2M51 A;  3V7C A;  1ZBJ A;  4FCY A;  1MMD A;  3A8L B;  2L8D A;  1WFW A;  3ULR B;  1M3B A;  4IUU A;  1U1T A;  4C92 E;  1KQS A;  4FYX B;  4J9G A;  4OML A;  1RAG B;  2CZ7 B;  2E5Q A;  4OB1 B;  3IQL A;  3A1P A;  4E6R A;  1VQL T;  4C5E A;  3CCS T;  4JZ4 A;  2BE9 B;  3PNW C;  4LE9 A;  1YJ9 Q;  3ZBD A;  5GMK h;  2JOY A;  4J9H A;  1CKB A;  3HTR A;  3J81 E;  3QPH A;  1M4Z A;  2CDT A;  5CVI A;  2GCX A;  1ZSZ C;  4M78 E;  1W6X A;  2JTE A;  4M7D E;  3UPU A;  1VA7 A;  1GBQ A;  1VQL Q;  5KE2 A;  2QEX A;  4LUE A;  1W2B P;  2CSI A;  1N8R C;  1Q7Y R;  1MMA A;  1VYU A;  3FRN A;  4JUV A;  4BI4 A;  5I22 A;  3JCM f;  2KT1 A;  1G83 A;  2YHT A;  3S3N A;  1VQK T;  1IRE B;  3RBB B;  3S3O A;  2DXU A;  4PFZ A;  1IO6 A;  4BDZ A;  4KGZ B;  2RHU A;  2QGG A;  1XNI A;  4C8Q B;  1WHJ A;  1YHQ Q;  2CZ0 B;  4F16 A;  3X26 B;  2YLB A;  4LUD A;  2QEX T;  2CH4 W;  2DFU A;  5KH6 A;  3CC7 A;  3A98 A;  1H3H A;  1WXT A;  4QKU A;  2CT4 A;  4FYW B;  1Q81 U;  2GFA A;  4DBQ A;  4BAC A;  2K3X A;  2JTF A;  2BIV A;  4F7U G;  2EYW A;  3CCL Q;  1S72 T;  1VQK Q;  3OYN A;  4FU6 A;  1BI1 A;  4BI3 A;  2JMA A;  2FO0 A;  3CCV Q;  2RM4 A;  2EQI A;  1J3T A;  2LNV A;  1NJI C;  1WGS A;  2GFU A;  2P84 A;  1X2K A;  3I55 T;  1KHI A;  1TXQ A;  2CP7 A;  3EG1 A;  2HQX A;  4LD6 A;  2DXC A;  3C4S A;  2KR3 A;  3CC7 T;  2RJF A;  1OX8 A;  4FYV B;  4DOV A;  3LLR A;  1BIB A;  1S72 Q;  3BDU A;  4ESR A;  4ELZ C;  1VQP A;  4M7A F;  4QVZ A;  3LH5 A;  4OMQ A;  1KD1 U;  1SRL A;  1G3T A;  2PQW A;  4KUD K;  3I55 Q;  1T3S A;  5GAN 4;  1UEC A;  2VXE A;  2JMC A;  3M0T A;  2DA9 A;  3NTH A;  1VIF A;  4QT7 A;  2M9U A;  1OX9 A;  2PVO B;  2GGR A;  2HBP A;  1WYX A;  2VV5 A;  4IIM A;  1X75 C;  1IB8 A;  1WHM A;  2RD1 A;  2MCN A;  5GAN e;  1VQ7 Q;  3EGU A;  1NG2 A;  4L6V 5;  1PRM C;  2QA4 A;  2EJG A;  4KBM B;  1QCO A;  4DBF A;  5FLX E;  2QAS A;  2QTX A;  2QQ9 A;  5LJ3 f;  4HCZ A;  3A8M B;  1H3Z A;  2JT4 A;  2HQE A;  1UJY A;  1KFZ A;  1OYX A;  2J06 A;  4RTW A;  1U5S A;  1OI1 A;  1PKS A;  3JB9 J;  5GMK i;  4AT1 B;  1M90 C;  1UGQ B;  2DKG A;  4R56 A;  4E7H A;  1VQ9 A;  3JCM e;  4HCC A;  4OF1 A;  3WXM B;  3CXC P;  2RB6 A;  1YJW A;  4C8Q A;  2OI3 A;  1PCX A;  1RL2 A;  3JCM X;  2QA4 T;  2LCC A;  1Z9Q A;  4RCC A;  1NEB A;  2A36 A;  1ZSG A;  1PHT A;  1UHF A;  4ME7 A;  4RTV A;  3HFN A;  2DET A;  1G3Y A;  2DE0 X;  4II1 A;  1X6B A;  2V26 A;  4EMK B;  1VQ8 A;  2C0O A;  1OV3 A;  3REA B;  3BDL A;  1TG0 A;  3M0U A;  4XTU A;  5GAM h;  3OYC A;  1VQ9 T;  2X4Y A;  2RQR A;  5A0L A;  1AD5 A;  4IIO A;  1BK2 A;  2IVW A;  2RJC A;  2W0Z A;  1YJW T;  2XKO C;  5GAO q;  3OYD A;  5CKB A;  1TUG B;  3I5R A;  4ZN1 A;  4OMN A;  4FYY B;  2DZ9 A;  1MND A;  5EG2 A;  1MV3 A;  3CBM A;  3WVD B;  1I4K 1;  1Y96 B;  2G3R A;  5GAN 6;  1ZUU A;  2QQS A;  3HRT A;  2E12 A;  2K9G A;  5GAN 8;  3JCM b;  4NS5 A;  5LJ5 e;  4ZGJ B;  2GTO A;  2LNH B;  1WQ7 A;  1BB9 A;  1ZBX A;  4ZTF A;  3ER0 A;  3OYE A;  5GAN g;  3CME A;  5I2S A;  3C94 A;  1NM7 A;  2V8I A;  2LJ1 A;  1NLP C;  3UWN A;  1YIT A;  2MI6 A;  3QO3 A;  4J6W A;  2XDB A;  2L5Q A;  1PSE A;  2DK3 A;  1ZSZ A;  4HA8 A;  1TWB A;  3RMS A;  3BFM A;  2FPE A;  3PIO A;  1I0C A;  4OVA A;  2J05 A;  4A63 B;  1N6A A;  2ENM A;  2LRQ A;  2RF0 A;  2AT1 B;  4F7U F;  4M7D G;  5FWC A;  1GRI A;  2MYS A;  3CME T;  2K7A A;  1D1C A;  1TUD A;  3QBY A;  1N5Z A;  3M0Q A;  5LJ3 e;  4IUR A;  2HKN A;  3HP9 A;  3VS0 A;  3DLM A;  4CC3 A;  1P92 A;  2CZ6 B;  1IHW A;  2DRM A;  2AZS A;  4XAX B;  2CUD A;  2GQI A;  4V2S A;  3OS0 A;  3JB9 D;  3CBP A;  2DER A;  1B7T A;  5GMK e;  3OYI A;  3TQ7 P;  3CPW A;  1VQ5 A;  4C0G A;  1ARK A;  4JDS A;  2H3E B;  1VQM A;  2QGF B;  4TVR A;  4MZT A;  1B3Q A;  3G71 A;  2YRD A;  4AMC A;  4M75 D;  1M1K C;  2F5K A;  1TOV A;  3EGD A;  2K79 A;  1PNJ A;  4F04 B;  1LNX A;  4GY5 A;  2EIF A;  3NHN A;  2CP5 A;  1UHC A;  3RER A;  3QXE B;  1ZQ1 A;  5GJV B;  2E70 A;  4Y28 E;  4M7A C;  2FG0 A;  4PLL A;  1M3A A;  1U1S A;  2K5F A;  2HMA A;  1VQ6 A;  2KK4 A;  3CXC S;  3OBW A;  1Y96 A;  1VQ5 T;  1E7O A;  5HK3 A;  1VQM T;  1RLQ C;  1XJW B;  4E7I A;  2F2V A;  3G71 T;  1RAD B;  2O4X A;  1RI9 A;  2WSC E;  1FMV A;  4C92 D;  3KFV A;  5CO7 A;  2JS0 A;  5LL6 S;  1JBM A;  3RUX A;  1SRM A;  1Q81 R;  2DIQ A;  2PUK B;  3H41 A;  1K73 R;  4DEX A;  5I21 A;  3SFM A;  4PJO C;  1W2B A;  2EVR A;  4PJN A;  1VQ6 T;  1FMK A;  1Q82 C;  3JAM E;  1WIE A;  1VQ5 Q;  4LDW A;  1C6V X;  1EFN A;  3OMC A;  2VKN A;  3CEY A;  3CCE Q;  1X69 A;  1WJR A;  4GLM A;  2E6Z A;  4OGC A;  3OY9 A;  2MWP A;  1OPK A;  2HCK A;  2KBT A;  1M1F A;  3JCM J;  4BDY A;  2KI7 A;  4M78 D;  2AZV A;  1ZLM A;  3QG1 A;  1WQW A;  3VS6 A;  1AVZ C;  3CCU A;  1YFN A;  4CC4 B;  3AHU A;  3EG9 A;  3PVL A;  2MOX A;  2YWW A;  1PRL C;  1UB4 A;  2DD5 A;  3JCM h;  3M53 A;  3VS5 A;  3OYM A;  2OX7 A;  2K57 A;  3GP8 A;  1KD1 R;  3URG A;  2HL5 C;  3QKJ A;  5DM7 R;  4OMO A;  4LXC A;  1WLP B;  2DTO A;  3X24 B;  3G4S A;  1I5L A;  4KH0 B;  2D9T A;  2YRV A;  3MP8 A;  5HCK A;  1QVG P;  2HSP A;  2E4H A;  2FPF A;  2ROL A;  1GCQ C;  4XQ3 A;  2LQK A;  1NZ9 A;  4XU0 A;  3QDR B;  4QVC A;  4A4E A;  4J9B A;  5IXB A;  1Q86 U;  3CCU T;  2MWO A;  2D8H A;  3UAT A;  4IKF A;  4HT9 A;  4F14 A;  5CQX A;  1SPK A;  2M02 A;  3EGX B;  1LJO A;  2J6K A;  2X4W A;  1K8A U;  3GBQ A;  2RNA A;  2DL8 A;  4E7K A;  2DIL A;  1NJI U;  4GLK A;  4M7A B;  1EIF A;  1Y07 A;  1YWO A;  3OS5 A;  2EPD A;  1TUC A;  5GAO m;  3SWN A;  3J7A F;  1WHH A;  3MKD A;  1YI2 A;  4Z8A A;  4M78 F;  4M7D F;  5FU6 B;  3BE3 A;  2HEQ A;  3CCR Q;  4AG2 C;  3OYJ A;  4EMG A;  2VAS A;  1X6G A;  5D7U A;  1GCP A;  4CC7 A;  1GXI E;  3JCM W;  4ZTJ A;  2EGA A;  2AKK A;  3PVQ A;  5FRM A;  4PJO B;  2A7Y A;  2O01 E;  3TSW A;  5GAM e;  1UDL A;  1K1Z A;  5HK0 A;  2H3J A;  1YI2 T;  3S3M A;  4KH1 B;  1Q95 G;  4Z88 A;  1Z9Z A;  1PM3 A;  5CKF A;  4A4H A;  3VV0 A;  3H0F A;  3FEO A;  3P8B B;  2HSE B;  1IGQ A;  1ABO A;  3O8V A;  5LJ3 h;  4IUQ A;  5HKC A;  3VRZ A;  4EMH A;  5GAN 3;  3MO8 A;  3LWH A;  4M77 D;  2NUP B;  1ZHI A;  4EDU A;  1RI0 A;  3EFR A;  3EHQ A;  1KC8 C;  1KQ1 A;  5EC7 A;  2EW3 A;  2BZX A;  2E6N A;  2HNI A;  4F17 A;  1QWF A;  2XDP A;  2ZPF B;  3VJP A;  2EQJ A;  4FW2 A;  1TSF A;  3EG3 A;  3CC2 A;  8AT1 B;  2EWN A;  1D09 B;  4OP0 A;  2P0Q A;  4RTZ A;  1BU1 A;  4N4G A;  1BI0 A;  3R6N A;  5GMK j;  4BI8 B;  4N0A C;  4PLI A;  3EGX A;  1G5V A;  4RTX A;  3LGF A;  3CCS Q;  2RQV A;  2V1R A;  2C06 A;  3MCA B;  2CP0 A;  3GF5 A;  4B9X A;  2EJF A;  2KGT A;  4MZP A;  1JJ2 P;  3RKW A;  1XTD A;  2EGC A;  4QQG A;  3JCM Q;  2NUT B;  3NFC A;  2OTL A;  3OW2 S;  1LOJ A;  1NBE B;  1M2V B;  2XIC A;  4J5Y A;  3J80 E;  2F1L A;  4LN2 A;  2VGN A;  1VQN A;  1AEY A;  3VS3 A;  3HHT B;  1QVG S;  3CC2 T;  2JNG A;  1N9R A;  2A37 A;  2RPN A;  5ECA A;  2I2L A;  2HL3 A;  3GNF B;  1B07 A;  1M1G A;  1WJQ A;  2KXC A;  2EGE A;  2JJ9 A;  5M9O A;  3CC4 A;  1H64 1;  2GBQ A;  3LWI A;  2KMT A;  3A8G B;  3M59 A;  4MDX A;  2FB7 A;  3UA6 A;  3EAE A;  3ME9 A;  1RAF B;  4PJO A;  4F7U B;  1K73 U;  2EQM A;  3QUI A;  3UA7 A;  2YLC A;  4HCK A;  4EMK C;  5D6W A;  3M56 A;  2RI3 A;  2E1H A;  1GFD A;  3HSB A;  3QJ6 A;  5IHI A;  1YN8 A;  1ZA2 B;  2DO3 A;  2VB6 A;  2JTM A;  2YXY A;  3FJP A;  1YCY A;  2JW4 A;  2EFI A;  3VU3 C;  2AKL A;  4EIK A;  2QEX Q;  3CC4 T;  1W70 A;  2D8J A;  3A8O B;  4HVU A;  2QG9 B;  2HQH A;  2KQW A;  2D1X A;  3QZ9 B;  2LDM A;  4GBQ A;  1QLY A;  1HJD A;  4R55 A;  2FYK A;  5A0D A;  3M58 A;  2EKO A;  2OJ2 A;  4BE1 A;  1V29 B;  3GOX A;  3L2V A;  1MHN A;  1WXB A;  3BW1 A;  1Y71 A;  1B34 B;  4KUL A;  2X35 A;  3L2Q A;  1M27 C;  4BD3 A;  3LX7 A;  5I11 A;  2KXD A;  1GCQ A;  2ECZ A;  3JB9 H;  3E9F A;  3DB4 A;  4WTO B;  3CC4 Q;  3CC7 Q;  1VQ4 A;  1R0C B;  3CD6 A;  2MMP A;  5IHN A;  2M16 A;  4IUP A;  1K0S A;  2PTK A;  3OYG A;  1WNL A;  3L2R A;  3RDV A;  1G3S A;  1V76 A;  1VQP T;  3WVE B;  3M54 A;  1D1A A;  1MUZ A;  2QQA A;  4M7D C;  1QWE A;  5KCO A;  2EJ9 A;  2FRY A;  2EYQ A;  4M77 E;  3V8K A;  2F2X A;  2NUT A;  4WF2 A;  1M30 A;  1M2V A;  4E7L A;  1GBR A;  3V7R A;  1VQ4 T;  4EPC A;  1OZ2 A;  2R5M A;  4AFQ C;  2B86 A;  2CP3 A;  5KCH A;  2RO0 A;  1WPY A;  2FRW A;  2G6F X;  4DBH A;  3JB9 G;  1HSQ A;  5KYX B;  3C0C A;  4FM4 B;  2LP5 A;  1VQP Q;  2ATC B;  2FEI A;  3GLX A;  4C0Z A;  1T0J A;  9ATC B;  1Q86 R;  2D0N A;  1GFC A;  2O31 A;  3JCM c;  3CCM A;  2LCS A;  4M75 G;  3OA6 A;  3VS7 A;  4F7U A;  4AFS C;  3QDF A;  2R5A A;  3LYI A;  4E47 A;  1IHV A;  4C8Q D;  1BCO A;  2E10 A;  2X4X A;  2ZZD A;  4D8D A;  1JJ2 S;  1K8A R;  2FHD A;  3RKY A;  3OMG A;  2CZ1 B;  2P0K A;  1NJI R;  3CMA A;  4OMF B;  5IXF A;  2QA4 Q;  3ASK A;  1AWJ A;  2CP6 A;  1K9A A;  1KSW A;  2WSF E;  4FL6 A;  1YP5 A;  3L2Z A;  4L5G A;  4MZM A;  1F1B B;  4OB3 B;  1OQK A;  1RAE B;  1VQ8 T;  2VC8 A;  2Z0W A;  5A0G A;  5FRO A;  4C92 G;  4NOY A;  1VQ9 Q;  3EG0 A;  2NYS A;  1RAC B;  2FL7 A;  4Y91 A;  3NGP A;  4A53 A;  1YJW Q;  3SB2 A;  2YUN A;  2MAM A;  3CMA T;  2DEU A;  2RHZ A;  1SKU B;  4DBR A;  2RHI A;  1YJN A;  1MNE A;  3L1A A;  1A0N B;  2J6O A;  3LW5 E;  2L0A A;  1RAB B;  3LH0 A;  4PJO E;  2QDY B;  3M57 A;  1VQ8 Q;  1WI7 A;  4FSS A;  5J26 A;  1WA7 A;  4N0A A;  1FMW A;  1BYM A;  1V1C A;  3M4Y A;  1ABQ A;  2KYM A;  1IXD A;  3JCM g;  2DPP B;  5C0M A;  2CSQ A;  4M78 G;  1OOT A;  2CGH A;  4OGE A;  4M7D B;  1QKX A;  4CC2 A;  3MEV A;  2QI2 A;  4XU2 A;  3QSU A;  1RUW A;  2DMO A;  2SEM A;  4X9C A;  2FZK B;  4KGX B;  2RHY A;  3E2U A;  3PT9 A;  1UUE A;  1X01 A;  1YIT T;  1K9M U;  1JQQ A;  4UC4 A;  2GNC A;  3V7S A;  2ABL A;  3M55 A;  3CCQ A;  4X9D A;  2LC4 A;  1QVF S;  5IHK A;  1M8M A;  1WHK A;  2DRK A;  3A8H B;  4HXJ A;  3RMQ A;  2KDS A;  3VKI A;  2DX1 A;  5KYX A;  2R58 A;  1JXM A;  1RAI B;  2QAZ A;  3A5Z B;  2KRS A;  2V8K A;  1U06 A;  4J9C A;  1OUL A;  3ZL7 C;  2BE7 D;  5CKE A;  3CME Q;  1ZUY A;  4Z89 A;  1WHG A;  2F2W A;  1KD1 C;  3EFS A;  3OYF A;  2AK5 A;  4EMK A;  1YIT Q;  2BUD A;  3RIR A;  3FIF A;  4C5H A;  3CCQ T;  1VUB A;  4JS5 A;  2PU9 B;  2VUB A;  5KE3 A;  1R0B G;  5LJ5 g;  4ANJ A;  1YWP A;  3THK A;  1EZZ B;  2DNU A;  2F5T X;  1XOV A;  2I0N A;  3G6E A;  4ZGE B;  3VYH B;  3EG2 A;  5GAN d;  2QXF A;  5CCA A;  4PJM A;  2RK2 A;  2VXF A;  2ZPG B;  2YUQ A;  4M4Z A;  3VRY A;  1X27 A;  3E1S A;  2JUF A;  3H8Z A;  4FW1 A;  1I5O B;  2EBP A;  3PIP A;  5FU6 C;  5KYW B;  2A28 A;  2DJQ A;  2O2O A;  1HD3 A;  5FU7 C;  3P8H A;  5DLO A;  3OYL A;  2YT6 A;  4C8Q E;  3H9N A;  2EQU A;  2Y90 A;  1KC8 U;  1KQS S;  5AT1 B;  4RTT A;  3G6E T;  2K2V A;  2FZG B;  4DEY A;  4JJB A;  3HRS A;  3JB9 F;  3T9N A;  1VQM Q;  2DBK A;  5LJ3 g;  1EX4 A;  2LTO A;  5IT9 E;  4JPB W;  3G71 Q;  1NYF A;  1Y7X A;  5J39 A;  2DLP A;  2KE9 A;  3TVT A;  4M75 F;  4LDV A;  1H8K A;  4RUG A;  4NL3 A;  4J8O A;  5KYY B;  5GAN j;  1G3W A;  1N8R U;  2LMJ A;  4PL6 A;  1M5Q 1;  3JCM V;  3CCJ A;  1UJ0 A;  4KUI A;  1VQ6 Q;  4M77 G;  3QYG B;  3QZ5 B;  3OW2 P;  1QMC A;  1N27 A;  1OU8 A;  2L3R A;  1QP3 A;  2DTH A;  2QQB A;  2DL3 A;  1YCS B;  4RCB A;  3I56 A;  4BE0 A;  2ZPI B;  1WJS A;  2FZC B;  2X51 A;  5J3B A;  1PSF A;  2MK5 A;  2JZ2 A;  2DYI A;  2OTJ A;  5LJ5 d;  4B9W A;  4E2F B;  4C92 F;  3EHR A;  2SRC A;  2RI5 A;  1NE8 A;  4FT2 A;  1OEB A;  4RMO A;  4P5N A;  1R8O B;  5GJW B;  3GPL A;  3CCJ T;  6AT1 B;  2LX9 A;  1VYV A;  2PUO B;  2KNB B;  4ORZ A;  3G4S T;  1QCN A;  1HYO A;  4AFZ C;  1FYN A;  3H0H A;  4PK4 A;  4D8K A;  5CQY A;  2LJ3 A;  2ED1 A;  1KHC A;  4J6Y A;  2JM9 A;  3CCU Q;  4RKU E;  5CAI A;  1Q7Y C;  2LJ0 A;  4AFU C;  3CCJ Q;  4BY6 C;  3MPU B;  1KK7 A;  5GMK l;  3BY7 A;  2KYB A;  1O75 A;  3N5B B;  2XU8 A;  5FU7 B;  3I5S A;  5KYW A;  4PNO A;  2AIR B;  4Q5W A;  2MF2 A;  2EAY A;  5LJ5 j;  1WX6 A;  4LNP A;  1M3C A;  2DIG A;  3E9G A;  3G4S Q;  4MML A;  4X34 A;  4CI0 C;  3C12 A;  3MET A;  3F70 A;  3DKM A;  1AT1 B;  1YJ9 A;  2RA2 A;  1HXD A;  3RES A;  5CIU A;  2E5K A;  1M2O A;  2RI2 A;  1AWW A;  1R77 A;  4PJO G;  2Y4Y A;  1KIK A;  3CXC A;  4K11 A;  1QCF A;  4DOW A;  1VQL A;  5GMK m;  2M0Y A;  2RJD A;  1N9S A;  2OAU A;  3JB9 I;  2DBM A;  4C0D B;  2V8J A;  3UF4 A;  2KAF A;  1YBY A;  1PKT A;  1JRI A;  1YJ9 T;  1M90 U;  4PFO A;  1FX7 A;  1SEM A;  1TS9 A;  2YUP A;  3PTA A;  3KXT A;  5LJ3 j;  1X43 A;  4R0K A;  1YI2 Q;  1X6O A;  2K5L A;  1XQH A;  3C95 A;  4MDW A;  4JLI A;  2R57 A;  2ZGW A;  1HK9 A;  1YHQ A;  2L89 A;  5I2M A;  2FPD A;  1I8F A;  5DLQ E;  4JJN K;  3HFO A;  2HKQ B;  4J83 A;  2MIO A;  4ZN3 A;  4O6J A;  2WAC A;  3JRZ A;  2JVV A;  4J9I A;  1BIA A;  2K6D A;  3I35 A;  4ZNX A;  1G8X A;  1CSK A;  4LD9 K;  1UTI A;  2EQK A;  2GQV A;  2RQT A;  2RK1 A;  1BKB A;  3CCL A;  1VQK A;  2HD0 A;  3FJ5 A;  2L3Q A;  5GAN f;  2HDA A;  4JZ3 A;  3CCV A;  5D6Y A;  4M7A A;  1AHJ B;  2DF6 A;  3D7S B;  1K9M R;  1AWX A;  2DTI A;  1YHQ T;  3TCJ A;  1D0Y A;  2COW A;  3X28 B;  4JRP A;  4BY6 B;  4O5V A;  2OAW A;  4J7I A;  2VGM A;  1LCK A;  4E7J A;  1BI2 A;  5GAM g;  4QW2 A;  4M7A D;  3M0P A;  1S72 A;  3CCL T;  1UEB A;  2A08 A;  4HKE A;  1QP2 A;  4M77 F;  3CCV T;  3SD4 A;  3U23 A;  2FVU A;  4LDY A;  4Y92 A;  4OMP A;  5KYN A;  3REB B;  2OTL T;  4JJD A;  5L23 A;  4M75 C;  3VS2 A;  4C8Q G;  3I55 A;  2LVM A;  3JSC A;  1D1B A;  4LDX A;  1VQN T;  2K2M A;  2DM1 A;  1PC0 A;  4ZGD B;  2GF7 A;  1Q86 C;  3CC2 Q;  1PG5 B;  2RN8 A;  2LX7 A;  2KEA A;  3JV3 A;  2XDD A;  5D6X A;  3MHX A;  5KYU B;  1VQ7 A;  1T0H A;  4PJO D;  3QII A;  1IGU A;  3NTI A;  2CKK A;  4QVD A;  1K8A C;  1IRX A;  1W4S A;  3V8J A;  1BI3 A;  2OTL Q;  2YSQ A;  1WXU A;  3MJX A;  5C6S A;  3OS1 A;  2CH4 A;  3KBG A;  4C92 C;  1VQN Q;  2E3I A;  2NUP A;  3RR6 A;  3OYB A;  1WZO A;  2CUB A;  4XU3 A;  5LJ5 f;  3OYA A;  1KC8 R;  3QYH B;  4KRT A;  1QVF P;  3X20 B;  3HRU A;  3CBO A;  1VQ7 T;  2DL4 A;  2DJZ A;  3M4G A;  2RH2 A;  3OYH A;  1NYG A;  4A54 A;  1UG1 A;  2L3S A;  2LQW A;  2XMF A;  3EFO B;  3M0R A;  2BKD N;  1JEG A;  3FLG A;  3CPF A;  3AT1 B;  8ATC B;  2D6F A;  1M1K U;  1O9S A;  3L2U A;  4M78 C;  1ZUK A;  4RG2 A;  1N8R R;  1SHF A;  2JS2 A;  3OQ5 A;  3TU4 K;  2J7I A;  2L3P A;  2LCL A;  3CPW S;  1Y0M A;  2HZY A;  2KT8 A;  3OBY A;  1ZSZ B;  2D0Q B;  2X3W D;  1MGQ A;  5GAM d;  3RKX A;  1KJW A;  4D6W A;  1UGR B;  1MV0 B;  3OB9 A;  2NUZ A;  2RJE A;  4A4F A;  1CKA A;  3VS4 A;  4HVW A;  1VIE A;  3NTK A;  3CD6 T;  3S6W A;  4PJO F;  2P4T A;  1NEG A;  2RQW A;  3KUF A;  1MMG A;  3TRE A;  2XHC A;  2M0O A;  3HL8 A;  2J6F A;  4YTL A;  3QWX X;  1RLP C;  1Y57 A;  3M0S A;  3JCM P;  2CYZ B;  2QYZ A;  1G2B A;  4JRK A;  4M75 B;  1I07 A;  5FWB A;  1KQS P;  1JU5 C;  1VQ4 Q;  1Q82 U;  1LPL A;  4OMM A;  4IUT A;  4XTW A;  1DJ7 B; 
#chains in the Genus database with same CATH homology
 1WHJ A;  2HL5 C;  1WHH A;  1WHG A;  2CP0 A;  2M02 A;  2HL3 A;  1WHL A;  1WHM A;  2CP2 A;  2E4H A;  1TXQ A;  2CP7 A;  1IXD A;  1TOV A;  2CP6 A;  2E3I A;  1WHK A;  2QK0 A;  2HKQ B;  3RDV A;  2CP3 A;  2MPX C;  2E3H A;  4B6M A;  2CP5 A;  2COZ A;  2COW A;  2Z0W A;  2COY A;  1LPL A;  3E2U A;  3TQ7 P;  2HQH A;  2HKN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...