1WHKA

Solution structure of the 3rd cap-gly domain in mouse 1700024k14rik hypothetical protein
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
91
structure length
91
Chain Sequence
GSSGSSGEGTVKLHEGSQVLLTSSNEMATVRYVGPTDFASGIWLGLELRSAKGKNDGAVGDKRYFTCKPNYGVLVRPSRVTYRGISGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIKEN cDNA 1700024K14
publication title Solution structure of the 3rd CAP-Gly domain in mouse 1700024K14Rik hypothetical protein
rcsb
source organism Mus musculus
molecule tags Structural genomics, unknown function
total genus 4
structure length 91
sequence length 91
ec nomenclature
pdb deposition date 2004-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01302 CAP_GLY CAP-Gly domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.190 Mainly Beta Roll SH3 type barrels. CAP Gly-rich-like domain 1whkA00
1WHGA 2CP7A 2CP2A 2E3HA 1TOVA 1IXDA 2CP3A 2E4HA 3TQ7P 2HKQB 1WHJA 4B6MA 2E3IA 2MPXC 2COZA 1WHMA 2Z0WA 2QK0A 2HQHA 2HKNA 1TXQA 2CP0A 1WHHA 1WHLA 2COYA 2M02A 2HL3A 1WHKA 2COWA 3E2UA 2HL5C 3RDVA 2CP6A 1LPLA 2CP5A
chains in the Genus database with same CATH superfamily
3M4GA 4MDWA 1IB8A 4Z02A 5J3BA 1RAAB 1CSKA 2C0IA 4O6JA 5GMKh 4M7DE 3QPHA 1VQ6T 1F1BB 1WI7A 1MGQA 2LJ0A 1N5ZA 1J3TA 3CCQT 1VQMT 3AT1B 1YJNA 2P4RA 3HKSA 2Y90A 4PJOG 1OPLA 3RKWA 2MWPA 5A0GA 5GAOm 1RABB 3TCJA 2K5IA 4M7DB 2DL7A 1QWEA 3CMAT 2L3SA 4ZNXA 5I11A 7AT1B 2EIFA 2K3BA 2DYIA 1YIJT 3LWHA 4GLMA 2O88A 2AZVA 5LJ3f 4C0DB 4HCZA 2K2VA 2ZPGB 3ZEHA 4LN2A 2HAXA 2MF2A 2DBMA 3I55Q 1YITQ 5FRNA 3OY9A 5GAN7 1MMDA 2IVWA 3AHUA 5LJ5j 2K4YA 2L5QA 4HCKA 2DIQA 4J9EA 2OTLT 2Y4YA 1VOMA 3MKDA 4AG2C 4FCYA 4OMPA 3JCMh 3JSCA 2VWFA 3M0RA 2ZAEA 1PD0A 3LX7A 3JCMd 2LRQA 5GAN8 2JJ9A 1SSFA 4AFQC 5GMKj 3OS5A 2FPDA 4QKUA 3A8GB 1KK7A 4MMLA 1QKXA 3M58A 4HVUA 3CCRQ 3L2ZA 1PRLC 4XAXB 1Y96A 1VQPA 3CC2T 4IUUA 4F14A 5I2SA 3MP6A 2BUDA 2AT1B 3R6NA 3M0QA 3C12A 1M8MA 1WX6A 1Q7YU 3SEMA 3PMTA 1TSFA 5CKHA 3X26B 2ATCB 3CD6T 1AEYA 1X6BA 5GAOr 2MOXA 1WPYA 4OB1B 3VS4A 2WSFE 1V29B 3QIIA 5EC7A 1VQ8T 1JBMA 4RTVA 3RR6A 4J9GA 3S3MA 3CCSA 5FWCA 3G1JA 1OPKA 3VUBA 1QMCA 3C4SA 4MZPA 4A54A 4RMOA 1VIFA 2DXBA 2R58A 3E2UA 4FT4A 4MZTA 2CZ0B 1W1FA 2PVOB 2ZPFB 4M7AE 1YJWA 4AMCA 5KYNA 2EGCA 1VQKQ 1QCFA 5CKBA 2I2LA 1BBZA 5GAMd 1WHMA 2CS7A 3HHTB 3OBYA 5D6YA 2QGGA 1D3BA 5KE3A 4M7AB 1BIBA 4GBQA 2J7IA 4DEXA 1KJWA 5J26A 1AOJA 1UB4A 3CXCS 2K6DA 3M59A 2D0NA 4M7AF 4C0GA 3IQLA 1QVFP 4PFPA 4M77A 2NUPB 5GMKi 1YJ9Q 1VYVA 5GANg 1K9MR 2RPNA 4FSXA 4IKFA 2EGAA 3PIOA 1I1JA 4DEYA 3I9QA 4E7KA 1R77A 1W4SA 3M55A 2YDLA 2JZ2A 4D6WA 3I56A 1UGQB 2DL4A 1KHIA 3MEVA 4RUGA 3FEOA 3CCJA 1ABQA 5KYUA 5AYFA 4B6MA 3I35A 4PFZA 3MO8A 1Y57A 2EQUA 1NYGA 4L6V5 3QSUA 2J6OA 4RKUE 2J06A 2MMPA 3H9NA 3HRSA 4C92D 2DTIA 1YHQQ 2QASA 4XU2A 5CAIA 4OP0A 3H6ZA 4RG2A 4LUEA 1QP2A 3JB9H 1M2VB 4M7DC 4C8QD 4PFOA 1UTIA 4JZ4A 3VJPA 3I55T 2QG9B 4XQ3A 1YITT 1OQKA 4FYVB 4RTXA 4LNPA 1T3LA 3HTRA 2V8JA 4JJBA 2G3RA 2PVGB 4C0DC 1QQJA 2IIMA 8AT1B 1RUWA 4B9WA 1T3SA 2YRCA 4M75E 2RD1A 1WHGA 3KUFA 2A28A 1BB9A 1U5SA 2DEUA 5GMKl 5CK9A 2YUPA 2CT3A 2JMCA 1IHWA 2HDAA 4AG1C 2C0OA 1JB0E 2DETA 1HJDA 2YRDA 3FJPA 4FIBA 2L3RA 4M75B 2DD4A 4ORZA 3CCRT 4KH0B 2QA4Q 3OYDA 1IHVA 3OW2S 3PMIA 2LNVA 3NGPA 1S1NA 3EG9A 4C8QF 2E4HA 2SRCA 3OYIA 4RTWA 4V2SA 5GAOq 1MMNA 1ZUKA 2X4YA 2FZKB 3L42A 5HCKA 1XNIA 4XK8E 3EFSA 5CKDA 3EFOB 3HL8A 2EYXA 3G71Q 1VQ4A 3BE3A 2OAUA 9ATCB 3GP8A 4HVWA 1YWOA 1KG1A 2D8JA 1YIJA 3O8VA 4KUDK 1KD1U 1MNEA 1I5OB 2BE9B 2LTOA 1LOJA 2D0QB 2NWMA 2DO3A 4J9CA 3LH5A 1Q7YR 1SRLA 4FW2A 1M5Q1 4CI0C 4CC2A 1VQKT 1ZUUA 2CDTA 3VS0A 1PSEA 1GCQC 4JS5A 3QYHB 1GBRA 3MP8A 3A8LB 3ZL7C 3RIRA 2YUOA 1DJ7B 4DQ2A 4M78B 2HD0A 2CZ6B 4JLIA 4PJLA 1JEGA 1EX4A 5DY9A 5IT9E 4Q5WA 4F7UA 2CUBA 2FEIA 3INZA 4X9CA 1D1CA 1K4US 4KBMB 1HYOA 1YJ9T 4M7AC 4K11A 2VUBA 4BE2A 2QDLA 2GGRA 4IIMA 2VASA 3J7AF 3P8HA 1I81A 5LJ5f 1T0HA 4OMOA 1ARKA 5GAN6 1YI2Q 1MNDA 5KE2A 1AZEA 2XDPA 1S72A 1BU1A 3CCLA 3RKXA 3MPUB 2CP5A 5GMKe 3GLXA 1SHFA 1WGSA 3OYJA 3EH2A 4J9IA 5ECAA 5L8RE 2O9VA 5GMKm 2OTJQ 2FZGB 1YHQT 4M78A 4J7FA 1MV3A 3CCMQ 2DVEA 4Z8AA 1B7TA 3EG1A 4LDUA 4RG8A 3CMEQ 2H3EB 1XOVA 1U1TA 4BI3A 1BYMA 2FRWA 2DL5A 1C6VX 3ASKA 1QVGP 5GANh 3HFOA 3EFRA 4DBQA 2WACA 1FMKA 2FPEA 3ER0A 4LD9K 5GANd 2LCCA 3M54A 4RCBA 3OYYA 3CPWA 2AIRB 4C92G 1NJIC 2O4XB 2MAMA 2CZ1B 1E6GA 2ROTA 4KGVB 3JB9D 3CXCP 5DM7R 4F7UG 2QA4T 3EGXB 4X9DA 1WNLA 2JM8A 2RK1A 3JCMf 3L1AA 3CBOA 2HNIA 2QQAA 1AWXA 1LPLA 1LVKA 4M75C 3OYNA 5I2MA 3T9NA 2JVVA 4AFSC 1RL2A 3TSZA 4NS5A 1WLPB 2RHUA 1BCMA 3UA7A 4A63B 4X34A 2EBPA 2KRMA 1C0MA 3G71T 2AKKA 3E9FA 3NMZC 1IO6A 3OSVA 1Y71A 2FHDA 1M1KC 1B34A 2COWA 3SWNB 3CQTA 2QQRA 2E6NA 3OS2A 3OMCA 3CCUA 5CIUA 2YRVA 1ZQ1A 3FRNA 3JB9F 1BK2A 1BCOA 2GBQA 2JTEA 5GANj 1X27A 2JS0A 3TREA 4PLIA 1YITA 4PJOA 2LQKA 4EMHA 4A4GA 3NPFA 1PSFA 4EMGA 4DOVA 2W0ZA 1QVGA 3CEYA 2W10A 5KCHA 4QQGA 1NLPC 1PKTA 2DL8A 5KYYB 4JS4A 2C06A 5HKCA 5GAMe 1TUCA 1SRMA 1UEBA 2CUDA 1KC8C 3RESA 1NPRA 2EVRA 2XHCA 3MJXA 1PG5B 3TSWA 2NLUA 2KXCA 4HA8A 3GOXA 4M78C 3CXCA 1VQ7Q 1D09B 3M0SA 2R57A 4O5VA 4E7LA 3DLMA 2F1LA 1BI3A 2F2VA 1IRXA 3OW2P 2K9GA 1YI2T 2KI7A 4M7DD 1MMGA 1N9RA 3JCMW 3BW1A 5IHNA 1M3CA 2KDSA 1G5VA 5FRMA 4QW2A 3QDRB 2EPDA 1PRMC 3FDRA 2EKHA 2OTJT 3JCMX 2G6FX 2B86A 4EMKA 1VQ5Q 1WZOA 3CCMT 3M9QA 1M27C 3META 4JDSA 4JRQA 3OS1A 1TOVA 4BACA 3A1PA 1RAIB 4N4HA 1AVZC 3OYGA 2F69A 2KR3A 4II1A 2RI5A 1YWPA 4CC4B 1HSQA 3PNWC 4PKCC 1PNJA 2HCKA 2ZPHB 4N4IA 1WJRA 4IUQA 3A8OB 1UGPB 5LJ3e 5GAOp 3GPLA 1KQSS 3CC7Q 4M7DF 1U8RA 1G3YA 3G4SA 2RF0A 2F5TX 2RQWA 4E47A 3FC3A 1Y96B 1U3OA 3HP9A 1D0ZA 1N27A 1OULA 2Z0WA 1N9SA 1ACMB 3BY7A 1JXOA 3OYBA 4CRIA 2M51A 1NYFA 3URGA 2ZCFB 3D7SB 1QW1A 1TG0A 2KQWA 2WSCE 2X9HA 2ZZDA 2QYZA 1WJSA 3LW5E 3EHRA 2ABLA 3OA6A 4QQ6A 2DERA 1VQNQ 2RQRA 3OB9A 4RTTA 2X3WD 1WFWA 2JM9A 3BFMA 2BZYA 4E7HA 1QLYA 2P0QA 2E70A 6AT1B 4FM4B 2XK0A 2RJCA 1H641 1ZA2B 4MDXA 1VQLA 2YWWA 2CYZB 4KGZB 3JCMc 1W2BS 2DF6A 4A53A 3RMSA 4Y91A 4A4FA 2COZA 3V7RA 4LDXA 4M77E 1I0CA 1D3BB 2EQMA 1G3SA 2DJQA 3VYGA 4FYYB 1IZ6A 3QZ5B 2EYQA 1UE9A 1XQHA 3SWNC 2ZPEB 4LXCA 2QEXA 4M7AD 2V8IA 4QVZA 2A7YA 2XICA 4GY5A 3OYEA 2RO0A 1M2OA 4BI4A 1WIEA 1G3WA 4RTUA 3M57A 1KC8U 4M77B 3CCEQ 3CCVQ 2ENMA 2CGHA 1WXBA 4J8OA 5FU6B 4M77F 2HL5C 5CKEA 4J6YA 2PVDB 1FX7A 2L0AA 4BE1A 3JAME 1H92A 5KYUB 2A08A 1GFCA 1RAFB 3HPWA 3F70A 2JXBA 3PE0A 1ZBJA 2RH2A 1LCKA 2KNBB 1VQ9A 4XTUA 1I4K1 2QI2A 3JCMJ 3JCMP 1U1SA 1YJNQ 3X28B 3G6ET 2NUZA 3THKA 2YUNA 2DZ9A 1KHCA 1VQ5T 4ELZC 1TUDA 2EQIA 2XIDA 4C5GA 3G71A 3QZ9B 2BZXA 1WXTA 4ESRA 2LQ8A 1JU5C 1RLPC 2O2OA 1IGUA 3EH1A 1UGVA 2M9UA 3QYGB 3R6OA 2GTJA 2PUKB 1FXXA 2YSQA 1YCSB 2DRKA 2DXTA 4ZGEB 2EQJA 2LQNA 3CC7T 1X01A 3LGLA 2E10A 5HY6A 1GCPA 1RI0A 2DPPB 4M75D 2DE0X 1K9AA 4N0AA 2DIGA 2KT8A 3A98A 3CBMA 3EG9B 5GANe 1X69A 2JOYA 1Y0MA 1XJWB 2BZ8A 1O75A 4EDUA 4ELYC 3HRTA 1VQOA 5GANf 4YTLA 3MEWA 3FJ5A 5D6WA 1JJ2P 4RCCA 1WHLA 3NTHA 1X2KA 1NJIR 2HQXA 1VQNT 4J5YA 3RUXA 1Q82C 1SKUB 1U06A 2CZ7B 3CC4A 4FU6A 1SPKA 2FPFA 1TH7A 1LJOA 5IAYA 2VXEA 4NL2A 4P5NA 4J9HA 3CCSQ 2QAZA 2RHZA 1QVFA 2COYA 2DILA 2LMJA 2CT4A 2EWNA 2K3YA 2VXFA 4F7UE 4M4ZA 4UC4A 2A37A 1FMWA 2JW4A 2X3XD 2RJDA 3MP1A 4M75F 5KYWA 3S6WA 3GBQA 2O9SA 3VS2A 1TUGB 2DA9A 2YLCA 1VQ6A 1YJWQ 2LJ3A 1IGQA 4VUBA 2OJ2A 4Y92A 2PZ1A 3E9GA 3P8DA 4Z89A 2RI2A 2XDBA 3ZBDA 5CKFA 2WSEE 3CCQA 3VS7A 4F7UB 1VQMA 2K57A 1M1KR 4XU0A 1RAEB 4XTXA 2E1HA 4R55A 2EJFA 3CCET 4FSSA 5I22A 3CCVT 2MIOA 2I0NA 2X35A 4OMMA 4PL6A 3REBB 3CMAA 5CVIA 1VIEA 1N8RC 3OS0A 4IUPA 5FWBA 2ZPIB 4AFZC 4OMNA 2HSPA 1O9SA 4XTVA 4M77C 3MHXA 4M78E 1TXQA 4OMFB 1OEBA 3QKJA 3G7ZA 2DLPA 1M90C 2FVUA 5FU6C 2XG8D 3RDVA 3V7CA 5C6SA 2CP7A 1GL5A 4E7SA 1KC8R 1JJ2A 4M7AG 4C5IA 2LCLA 3I56Q 4C92A 1YP5A 2LDMA 1W70A 4XU3A 3CCJQ 4E7IA 2OTLA 2QK0A 1YJNT 3JB9I 4C5HA 3WVEB 4M78F 4C8QA 1UGRB 3EG2A 4F16A 5GAN4 3EAEA 5GJWB 1WQWA 2XMFA 4JRKA 1ZSZA 1TU0B 5LJ5e 2EYZA 5LL6S 2RQTA 2GQVA 3HFNA 3E1SA 4EPCA 1NE8A 3CC2A 3UDCA 2L8DA 1RADB 4JRPA 1Q86C 2YT6A 2YUQA 4J83A 3CD6A 2J05A 3WVDB 2HQEA 1VQ8A 4PJNA 2V26A 1M1FA 1AWOA 4FYWB 1TWBA 4LUDA 3CBPA 1HD3A 2OAWA 2PQWA 4ATOA 4OGEA 3BDUA 3QUIA 1UFFA 2P0PA 1NBEB 2L3PA 1XTDA 1QP3A 3QHSA 3S3NA 4OB0B 4J9BA 1Q82U 2DYBA 1Q81C 3EG3A 1YCYA 3RNJA 4IURA 3RMQA 1WA7A 3A8HB 4PJOE 3L2VA 1QCNA 3VUZA 5IN1A 3QWXX 4DBHA 1B34B 2DZCA 2HSEB 1Z9QA 3V8LA 1H3HA 1M4ZA 4J9FA 4CC7A 2ROLA 5FLXE 2RM4A 3CCST 2E6ZA 1VYUA 1JXMA 2ZGWA 3G6EA 1VQ4Q 4C8QG 4ANJA 1M9SA 3JCMe 3NHNA 1QVPA 4PJOB 2K2MA 3O5ZA 4OMLA 1VQ5A 2X4XA 5I21A 4E7ZA 1T0JA 4KGXB 2P4TA 1YN8A 4PJOF 1SF9A 2PU9B 2L89A 2KY9A 1UUEA 3MCAB 4XTYA 1RI9A 3UPUA 1YJWT 4ZTJA 1C1AA 4E7JA 1OV3A 2CP3A 3TU4K 3JB9J 2JS2A 4JPBW 4XTWA 2JT4A 2DRMA 3UATA 2LX7A 5KYXA 2F5KA 3A5ZB 4A4EA 2C0TA 1AZGB 3OQ5A 2JTFA 4Y28E 1NM7A 4QQDA 1M90U 4B9XA 3UF4A 3ULRB 1R0BG 1SG5A 5GAMg 4KULA 3I55A 2FL7A 4IIOA 3JCMV 2R5AA 4EMKB 2VVKA 3V7SA 2XDDA 3I56T 2EFIA 2PNIA 4R0KA 1S72Q 3CCJT 2DXUA 3CCLQ 4IUTA 2LZ6B 1X6GA 2X51A 3EG0A 3Q1JA 1TTHB 3H0HA 2YHTA 4HT8A 3OMGA 2CREA 2HMAA 3CCRA 1PM3A 1Q86U 3REAB 3LH0A 2BKDN 2QGFB 1EZZB 4BUGA 2HBPA 1NPPA 1OU8A 1MUZA 2CSQA 3DB3A 2DXCA 3ME9A 2AHJB 1K8AC 2DX1A 1VYTA 2EJ9A 1FMVA 3OSSC 2K5LA 5LJ3g 4OF1A 3CMET 1WQ7A 1OU9A 2MCNA 2P84A 2EW3A 3I5SA 3HSBA 2E5KA 4HT9A 1Q81U 1WXUA 5A0DA 4EIKA 1KFZA 2KRNA 2CH4W 5CQXA 3VKIA 5DLOA 4ZN1A 2XKOC 2MI6A 1M3BA 4WTOB 1VQKA 3DLLA 5IHKA 2KYMA 2IG0A 4ZGDB 1IXDA 3L2UA 1NJIU 2QQSA 2HKQB 2OI3A 1NZ9A 4MMKA 3VS3A 1VA7A 4N4GA 4J9DA 1X75C 2RB6A 2GTOA 1PHTA 4CC3A 4JLGA 2DNUA 1VQ4T 3X25B 2GNCA 2A36A 1YFNA 5IH2A 1Q82R 1I07A 3VU3C 2KROA 2RI3A 1OYXA 1YJ9A 2HBWA 4A4KA 1M8VA 3CCUQ 2XU8A 4KT0E 5CCAA 3VV0A 2EAYA 2LP5A 1PKSA 3OW2A 2HEQA 1EFNA 2MWOA 4PJOC 3C95A 3SD4A 3QWYA 4M77D 1ZX6A 2HL3A 1R0CB 2YXYA 2KK4A 2FO0A 1M1KU 2RJEA 2O31A 3JV3A 4F04B 1QWFA 2D1XA 3PT9A 3CPWS 3JB9G 4JUVA 1OX9A 1IREB 5CQYA 2LC4A 4JZ3A 1OOTA 1YHQA 3M0PA 4C0ZA 2ED0A 3HRUA 3VRZA 5J39A 3X20B 2KVQG 1WHHA 3QDFA 3OYKA 2R5MA 4QVDA 1HXDA 4M7DA 1ZLMA 2QTVA 4DBFA 2LNHB 2PTKA 2KXDA 1B3QA 5A2QE 3RKYA 2QDYB 2M0OA 1SHGA 3OYHA 1N8RR 2KYBA 2DBKA 5HK3A 2MK5A 1TS9A 2K7AA 5GAN5 3KBGA 1S72T 2HQHA 3CCLT 1WDXA 2FB7A 2KBTA 4JRIA 4HVVA 1M90R 4WCIA 4D8KA 2YLBA 3DKMA 5FU7B 4EMKC 4QT7A 3RBBB 1K1ZA 1PWTA 2CSIA 2EYYA 4OVAA 1VQ7T 2NUTB 1KQ1A 4HCCA 1WYXA 2AKLA 2QA4A 2PUOB 2RJFA 3LYIA 2VGNA 2VB6A 2GCXA 2CP6A 3H41A 2LX9A 2V8KA 3N5BB 2F2WA 3UA6A 2HZYA 1K8AU 1R8OB 1KD1C 4HCBA 1QVGS 5GAMh 2GFAA 2ECZA 3OBWA 4QVCA 2DMOA 1MMAA 1LNXA 1RAGB 2DM1A 1UDLA 4OMQA 3G4SQ 3FIFA 4MZMA 3GF5A 2VKNA 3LLRA 1BI1A 2EKOA 1Q86R 1SSHA 4BB7A 1K73C 4AFUC 2BIVA 2VYTA 1YBYA 1Y7XA 2XI9A 1CKBA 3TVTA 1PCXA 2NUTA 4M7DG 3V8KA 2RHIA 4ZTFA 1P92A 4NOYA 1QCOA 2DJZA 1GCQA 2EQKA 2LT4A 1KIKA 3C94A 5L23A 3DB4A 4XU1A 5IHIA 4ME7A 3BDLA 5KYWB 2RQUA 5FROA 1HK9A 3CPFA 1WHJA 1E7OA 1Q81R 1VQLQ 1AWJA 1UECA 3RERA 2D9TA 4L59A 2D6FA 1K76A 4XTZA 3NTIA 1VQPQ 4M7AA 1EIFA 5FW9A 1B07A 2DEQA 3CCUT 4Z88A 4ZGJB 2B8AA 2KAFA 5GAMj 4OB3B 2CP2A 3QXEB 4LE9A 4E2FB 4E6RA 2RHXA 5LJ3h 3VS1A 2QXFA 1YI2A 3PIPA 5IXBA 2M0YA 5LJ3d 2NUPA 2QEXQ 1YNZA 3WXMB 2NYSA 4OGCA 3TEEA 3I5RA 4R56A 3OYLA 1A0NB 4C92E 4HXJA 1D0XA 3UWNA 1UJYA 1Z9ZA 2JUFA 3PVQA 1ZA1B 3QG1A 2P0KA 4KRTA 2OTJA 4ZN3A 4FT2A 2DL3A 2SEMA 3U23A 4C8QE 2H3JA 3VS6A 3CCMA 3M4YA 4JJCA 1RACB 3QJYA 1MV0B 2ESWA 2LQWA 2IPOB 3CMEA 4IUVA 1NEBA 4C92B 1ZUYA 1I5LA 2ZPBB 3GNGA 3M5AA 4GLKA 1AT1B 1AWWA 1PD1A 1K0SA 2RQVA 4M78D 4C92F 2KGTA 2DKGA 1FYNA 5CO7A 4C8QB 4M77G 2CH4A 2RN8A 4BI8B 1UHCA 1M2VA 1VQ9Q 1ZSZB 2EGEA 2QQBA 4F7UF 2LVMA 5GAN2 1KQSP 3J81E 4NL3A 1ABOA 4KUIA 2KEAA 4L5GA 2A0FB 4F17A 3SDZA 4D8DA 3SHWA 2RHYA 1GBQA 1BI2A 2VC8A 1D0YA 3E19A 2X4JA 1V1CA 5LJ3j 1JO8A 2E64A 2KRSA 1RLQC 2EYWA 1CKAA 3TQ7P 5FU7C 2QQ9A 5LJ5g 2GFUA 1AD5A 4BD3A 2LCSA 4M75A 2AK5A 4DA4A 1UG1A 1W6XA 3PGGA 3LGFA 1M30A 1K73U 2KMTA 3G4ST 5GJVB 1MHNA 1BKBA 4N0AC 2FRYA 3CPWP 2H8HA 3EGDB 4RTZA 1W2BP 3KFVA 4BY6B 3SB2A 3M53A 1KSWA 2KSSA 1X6OA 3OYAA 3LWIA 3JRZA 1I8FA 3EHQA 2DTHA 1VQOQ 2M02A 3EFOA 1K8AR 3NFCA 3M0TA 3QO3A 4LDWA 4PJMA 2RK2A 1D1BA 3X24B 2MYSA 2X4WA 1UHFA 3EGUA 4LDYA 3CC4Q 4PK4A 1K9MC 2JTMA 2ED1A 2DFUA 1G3TA 2E65A 4PJOD 3JCMQ 1KQSA 5D6XA 4DBRA 1VQLT 4C5EA 1PC0A 5GAN3 2GQIA 2M16A 3QBYA 3P8BB 4BDYA 2L2PA 2RA2A 2M1HA 1JQQA 3OYMA 1VQ7A 1VQPT 1AHJB 1NEGA 3EGDA 5A0LA 4FL6A 3M56A 5KYXB 2VGMA 3JCMg 3VRYA 2HKNA 1VQ6Q 1ZHIA 2GF7A 3FLGA 1WHKA 2AZSA 2OX7A 4HKEA 4FYXB 2Y4XA 3H0FA 2QEXT 3CCQQ 1VQMQ 1WJQA 2CKKA 2K79A 4M75G 2J6FA 1K0XA 2E12A 2VV5A 8ATCB 3CMAQ 2MPXC 2L3QA 1YIJQ 1GFDA 2J6KA 2RMOA 1W2BA 3JCMb 2KT1A 5M9OA 5HK0A 1D1AA 5EG2A 3GNFB 2JNGA 4LDVA 1V76A 2DK3A 3OYCA 2E5QA 3H0IA 5C0MA 2DD5A 4TVRA 1OI1A 2DTOA 4X1VA 1GXIE 1N8RU 3FB9A 5AT1B 4JJNK 1VQ9T 4C92C 3M0UA 3NTKA 3UT1A 2OTLQ 2QTXA 3PTAA 2XD0A 1GRIA 5GAOl 1E6HA 1G83A 4LD6A 4RTYA 4DOWA 3CC7A 2E41A 1G8XA 4C8QC 4J6XA 2BTTA 5DLQE 5KCOA 1QVFS 3GIBA 1NG2A 2DAQA 5IXFA 1RAHB 1ZSZC 1KQ2A 5GAOn 1UGSB 4PNOA 3MEAA 4J7IA 1ZBXA 1X43A 3QJ6A 1NLOC 2RNAA 2FYKA 3ZFJA 4M78G 1UJ0A 4WF2A 3CC2Q 4FW1A 2O4XA 2D8HA 2F2XA 1G2BA 1Q95G 1VQNA 1H8KA 3MEUA 3VS5A 3V8JA 2DVJA 3CD6Q 5KH6A 1H3ZA 2K3XA 3EGXA 4PLLA 1VQ8Q 4AT1B 1Q7YC 3A8MB 1Y07A 2JN0A 2CP0A 2FZCB 3SFMA 1SEMA 5D7UA 5CR2A 2V1RA 3S3OA 4JJDA 3L2QA 2E3HA 1X2QA 2K5FA 1KD1R 1M3AA 1BIAA 2BE7D 3VYHB 4C0FA 4KH1B 3H8ZA 3L2WA 2LT1A 4PJJA 5GAMf 1VQOT 3PFSA 3L2RA 1BI0A 2E3IA 1ZSGA 1JJ2S 4BY6C 4BDZA 2FG0A 3PVLA 3OYFA 1FWZA 1K9MU 2V1QA 1JRIA 2A3LA 3SWNA 3J80E 1QKWA 1K73R 1OX8A 1M1GA 2LJ1A 4A4HA 3CC4T 4OB2B 3CCEA 5LJ5h 1VUBA 4J6WA 3CCVA 2JMAA 1N6AA 5LJ5d 1OZ3A 3G6EQ 1OZ2A 2O01E 2EJGA 2KE9A 5KYYA 3KXTA 3C0CA 4BE0A
chains in the Genus database with same CATH topology
1WHGA 2CP7A 2CP2A 2E3HA 1TOVA 1IXDA 2CP3A 2E4HA 3TQ7P 2HKQB 1WHJA 4B6MA 2E3IA 2MPXC 2COZA 1WHMA 2Z0WA 2QK0A 2HQHA 2HKNA 1TXQA 2CP0A 1WHHA 1WHLA 2COYA 2M02A 2HL3A 1WHKA 2COWA 3E2UA 2HL5C 3RDVA 2CP6A 1LPLA 2CP5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WHG A;  2CP7 A;  2CP2 A;  2E3H A;  1TOV A;  1IXD A;  2CP3 A;  2E4H A;  3TQ7 P;  2HKQ B;  1WHJ A;  4B6M A;  2E3I A;  2MPX C;  2COZ A;  1WHM A;  2Z0W A;  2QK0 A;  2HQH A;  2HKN A;  1TXQ A;  2CP0 A;  1WHH A;  1WHL A;  2COY A;  2M02 A;  2HL3 A;  1WHK A;  2COW A;  3E2U A;  2HL5 C;  3RDV A;  2CP6 A;  1LPL A;  2CP5 A; 
#chains in the Genus database with same CATH topology
 3M4G A;  4MDW A;  1IB8 A;  4Z02 A;  5J3B A;  1RAA B;  1CSK A;  2C0I A;  4O6J A;  5GMK h;  4M7D E;  3QPH A;  1VQ6 T;  1F1B B;  1WI7 A;  1MGQ A;  2LJ0 A;  1N5Z A;  1J3T A;  3CCQ T;  1VQM T;  3AT1 B;  1YJN A;  2P4R A;  3HKS A;  2Y90 A;  4PJO G;  1OPL A;  3RKW A;  2MWP A;  5A0G A;  5GAO m;  1RAB B;  3TCJ A;  2K5I A;  4M7D B;  2DL7 A;  1QWE A;  3CMA T;  2L3S A;  4ZNX A;  5I11 A;  7AT1 B;  2EIF A;  2K3B A;  2DYI A;  1YIJ T;  3LWH A;  4GLM A;  2O88 A;  2AZV A;  5LJ3 f;  4C0D B;  4HCZ A;  2K2V A;  2ZPG B;  3ZEH A;  4LN2 A;  2HAX A;  2MF2 A;  2DBM A;  3I55 Q;  1YIT Q;  5FRN A;  3OY9 A;  5GAN 7;  1MMD A;  2IVW A;  3AHU A;  5LJ5 j;  2K4Y A;  2L5Q A;  4HCK A;  2DIQ A;  4J9E A;  2OTL T;  2Y4Y A;  1VOM A;  3MKD A;  4AG2 C;  4FCY A;  4OMP A;  3JCM h;  3JSC A;  2VWF A;  3M0R A;  2ZAE A;  1PD0 A;  3LX7 A;  3JCM d;  2LRQ A;  5GAN 8;  2JJ9 A;  1SSF A;  4AFQ C;  5GMK j;  3OS5 A;  2FPD A;  4QKU A;  3A8G B;  1KK7 A;  4MML A;  1QKX A;  3M58 A;  4HVU A;  3CCR Q;  3L2Z A;  1PRL C;  4XAX B;  1Y96 A;  1VQP A;  3CC2 T;  4IUU A;  4F14 A;  5I2S A;  3MP6 A;  2BUD A;  2AT1 B;  3R6N A;  3M0Q A;  3C12 A;  1M8M A;  1WX6 A;  1Q7Y U;  3SEM A;  3PMT A;  1TSF A;  5CKH A;  3X26 B;  2ATC B;  3CD6 T;  1AEY A;  1X6B A;  5GAO r;  2MOX A;  1WPY A;  4OB1 B;  3VS4 A;  2WSF E;  1V29 B;  3QII A;  5EC7 A;  1VQ8 T;  1JBM A;  4RTV A;  3RR6 A;  4J9G A;  3S3M A;  3CCS A;  5FWC A;  3G1J A;  1OPK A;  3VUB A;  1QMC A;  3C4S A;  4MZP A;  4A54 A;  4RMO A;  1VIF A;  2DXB A;  2R58 A;  3E2U A;  4FT4 A;  4MZT A;  2CZ0 B;  1W1F A;  2PVO B;  2ZPF B;  4M7A E;  1YJW A;  4AMC A;  5KYN A;  2EGC A;  1VQK Q;  1QCF A;  5CKB A;  2I2L A;  1BBZ A;  5GAM d;  1WHM A;  2CS7 A;  3HHT B;  3OBY A;  5D6Y A;  2QGG A;  1D3B A;  5KE3 A;  4M7A B;  1BIB A;  4GBQ A;  2J7I A;  4DEX A;  1KJW A;  5J26 A;  1AOJ A;  1UB4 A;  3CXC S;  2K6D A;  3M59 A;  2D0N A;  4M7A F;  4C0G A;  3IQL A;  1QVF P;  4PFP A;  4M77 A;  2NUP B;  5GMK i;  1YJ9 Q;  1VYV A;  5GAN g;  1K9M R;  2RPN A;  4FSX A;  4IKF A;  2EGA A;  3PIO A;  1I1J A;  4DEY A;  3I9Q A;  4E7K A;  1R77 A;  1W4S A;  3M55 A;  2YDL A;  2JZ2 A;  4D6W A;  3I56 A;  1UGQ B;  2DL4 A;  1KHI A;  3MEV A;  4RUG A;  3FEO A;  3CCJ A;  1ABQ A;  5KYU A;  5AYF A;  4B6M A;  3I35 A;  4PFZ A;  3MO8 A;  1Y57 A;  2EQU A;  1NYG A;  4L6V 5;  3QSU A;  2J6O A;  4RKU E;  2J06 A;  2MMP A;  3H9N A;  3HRS A;  4C92 D;  2DTI A;  1YHQ Q;  2QAS A;  4XU2 A;  5CAI A;  4OP0 A;  3H6Z A;  4RG2 A;  4LUE A;  1QP2 A;  3JB9 H;  1M2V B;  4M7D C;  4C8Q D;  4PFO A;  1UTI A;  4JZ4 A;  3VJP A;  3I55 T;  2QG9 B;  4XQ3 A;  1YIT T;  1OQK A;  4FYV B;  4RTX A;  4LNP A;  1T3L A;  3HTR A;  2V8J A;  4JJB A;  2G3R A;  2PVG B;  4C0D C;  1QQJ A;  2IIM A;  8AT1 B;  1RUW A;  4B9W A;  1T3S A;  2YRC A;  4M75 E;  2RD1 A;  1WHG A;  3KUF A;  2A28 A;  1BB9 A;  1U5S A;  2DEU A;  5GMK l;  5CK9 A;  2YUP A;  2CT3 A;  2JMC A;  1IHW A;  2HDA A;  4AG1 C;  2C0O A;  1JB0 E;  2DET A;  1HJD A;  2YRD A;  3FJP A;  4FIB A;  2L3R A;  4M75 B;  2DD4 A;  4ORZ A;  3CCR T;  4KH0 B;  2QA4 Q;  3OYD A;  1IHV A;  3OW2 S;  3PMI A;  2LNV A;  3NGP A;  1S1N A;  3EG9 A;  4C8Q F;  2E4H A;  2SRC A;  3OYI A;  4RTW A;  4V2S A;  5GAO q;  1MMN A;  1ZUK A;  2X4Y A;  2FZK B;  3L42 A;  5HCK A;  1XNI A;  4XK8 E;  3EFS A;  5CKD A;  3EFO B;  3HL8 A;  2EYX A;  3G71 Q;  1VQ4 A;  3BE3 A;  2OAU A;  9ATC B;  3GP8 A;  4HVW A;  1YWO A;  1KG1 A;  2D8J A;  1YIJ A;  3O8V A;  4KUD K;  1KD1 U;  1MNE A;  1I5O B;  2BE9 B;  2LTO A;  1LOJ A;  2D0Q B;  2NWM A;  2DO3 A;  4J9C A;  3LH5 A;  1Q7Y R;  1SRL A;  4FW2 A;  1M5Q 1;  4CI0 C;  4CC2 A;  1VQK T;  1ZUU A;  2CDT A;  3VS0 A;  1PSE A;  1GCQ C;  4JS5 A;  3QYH B;  1GBR A;  3MP8 A;  3A8L B;  3ZL7 C;  3RIR A;  2YUO A;  1DJ7 B;  4DQ2 A;  4M78 B;  2HD0 A;  2CZ6 B;  4JLI A;  4PJL A;  1JEG A;  1EX4 A;  5DY9 A;  5IT9 E;  4Q5W A;  4F7U A;  2CUB A;  2FEI A;  3INZ A;  4X9C A;  1D1C A;  1K4U S;  4KBM B;  1HYO A;  1YJ9 T;  4M7A C;  4K11 A;  2VUB A;  4BE2 A;  2QDL A;  2GGR A;  4IIM A;  2VAS A;  3J7A F;  3P8H A;  1I81 A;  5LJ5 f;  1T0H A;  4OMO A;  1ARK A;  5GAN 6;  1YI2 Q;  1MND A;  5KE2 A;  1AZE A;  2XDP A;  1S72 A;  1BU1 A;  3CCL A;  3RKX A;  3MPU B;  2CP5 A;  5GMK e;  3GLX A;  1SHF A;  1WGS A;  3OYJ A;  3EH2 A;  4J9I A;  5ECA A;  5L8R E;  2O9V A;  5GMK m;  2OTJ Q;  2FZG B;  1YHQ T;  4M78 A;  4J7F A;  1MV3 A;  3CCM Q;  2DVE A;  4Z8A A;  1B7T A;  3EG1 A;  4LDU A;  4RG8 A;  3CME Q;  2H3E B;  1XOV A;  1U1T A;  4BI3 A;  1BYM A;  2FRW A;  2DL5 A;  1C6V X;  3ASK A;  1QVG P;  5GAN h;  3HFO A;  3EFR A;  4DBQ A;  2WAC A;  1FMK A;  2FPE A;  3ER0 A;  4LD9 K;  5GAN d;  2LCC A;  3M54 A;  4RCB A;  3OYY A;  3CPW A;  2AIR B;  4C92 G;  1NJI C;  2O4X B;  2MAM A;  2CZ1 B;  1E6G A;  2ROT A;  4KGV B;  3JB9 D;  3CXC P;  5DM7 R;  4F7U G;  2QA4 T;  3EGX B;  4X9D A;  1WNL A;  2JM8 A;  2RK1 A;  3JCM f;  3L1A A;  3CBO A;  2HNI A;  2QQA A;  1AWX A;  1LPL A;  1LVK A;  4M75 C;  3OYN A;  5I2M A;  3T9N A;  2JVV A;  4AFS C;  1RL2 A;  3TSZ A;  4NS5 A;  1WLP B;  2RHU A;  1BCM A;  3UA7 A;  4A63 B;  4X34 A;  2EBP A;  2KRM A;  1C0M A;  3G71 T;  2AKK A;  3E9F A;  3NMZ C;  1IO6 A;  3OSV A;  1Y71 A;  2FHD A;  1M1K C;  1B34 A;  2COW A;  3SWN B;  3CQT A;  2QQR A;  2E6N A;  3OS2 A;  3OMC A;  3CCU A;  5CIU A;  2YRV A;  1ZQ1 A;  3FRN A;  3JB9 F;  1BK2 A;  1BCO A;  2GBQ A;  2JTE A;  5GAN j;  1X27 A;  2JS0 A;  3TRE A;  4PLI A;  1YIT A;  4PJO A;  2LQK A;  4EMH A;  4A4G A;  3NPF A;  1PSF A;  4EMG A;  4DOV A;  2W0Z A;  1QVG A;  3CEY A;  2W10 A;  5KCH A;  4QQG A;  1NLP C;  1PKT A;  2DL8 A;  5KYY B;  4JS4 A;  2C06 A;  5HKC A;  5GAM e;  1TUC A;  1SRM A;  1UEB A;  2CUD A;  1KC8 C;  3RES A;  1NPR A;  2EVR A;  2XHC A;  3MJX A;  1PG5 B;  3TSW A;  2NLU A;  2KXC A;  4HA8 A;  3GOX A;  4M78 C;  3CXC A;  1VQ7 Q;  1D09 B;  3M0S A;  2R57 A;  4O5V A;  4E7L A;  3DLM A;  2F1L A;  1BI3 A;  2F2V A;  1IRX A;  3OW2 P;  2K9G A;  1YI2 T;  2KI7 A;  4M7D D;  1MMG A;  1N9R A;  3JCM W;  3BW1 A;  5IHN A;  1M3C A;  2KDS A;  1G5V A;  5FRM A;  4QW2 A;  3QDR B;  2EPD A;  1PRM C;  3FDR A;  2EKH A;  2OTJ T;  3JCM X;  2G6F X;  2B86 A;  4EMK A;  1VQ5 Q;  1WZO A;  3CCM T;  3M9Q A;  1M27 C;  3MET A;  4JDS A;  4JRQ A;  3OS1 A;  1TOV A;  4BAC A;  3A1P A;  1RAI B;  4N4H A;  1AVZ C;  3OYG A;  2F69 A;  2KR3 A;  4II1 A;  2RI5 A;  1YWP A;  4CC4 B;  1HSQ A;  3PNW C;  4PKC C;  1PNJ A;  2HCK A;  2ZPH B;  4N4I A;  1WJR A;  4IUQ A;  3A8O B;  1UGP B;  5LJ3 e;  5GAO p;  3GPL A;  1KQS S;  3CC7 Q;  4M7D F;  1U8R A;  1G3Y A;  3G4S A;  2RF0 A;  2F5T X;  2RQW A;  4E47 A;  3FC3 A;  1Y96 B;  1U3O A;  3HP9 A;  1D0Z A;  1N27 A;  1OUL A;  2Z0W A;  1N9S A;  1ACM B;  3BY7 A;  1JXO A;  3OYB A;  4CRI A;  2M51 A;  1NYF A;  3URG A;  2ZCF B;  3D7S B;  1QW1 A;  1TG0 A;  2KQW A;  2WSC E;  2X9H A;  2ZZD A;  2QYZ A;  1WJS A;  3LW5 E;  3EHR A;  2ABL A;  3OA6 A;  4QQ6 A;  2DER A;  1VQN Q;  2RQR A;  3OB9 A;  4RTT A;  2X3W D;  1WFW A;  2JM9 A;  3BFM A;  2BZY A;  4E7H A;  1QLY A;  2P0Q A;  2E70 A;  6AT1 B;  4FM4 B;  2XK0 A;  2RJC A;  1H64 1;  1ZA2 B;  4MDX A;  1VQL A;  2YWW A;  2CYZ B;  4KGZ B;  3JCM c;  1W2B S;  2DF6 A;  4A53 A;  3RMS A;  4Y91 A;  4A4F A;  2COZ A;  3V7R A;  4LDX A;  4M77 E;  1I0C A;  1D3B B;  2EQM A;  1G3S A;  2DJQ A;  3VYG A;  4FYY B;  1IZ6 A;  3QZ5 B;  2EYQ A;  1UE9 A;  1XQH A;  3SWN C;  2ZPE B;  4LXC A;  2QEX A;  4M7A D;  2V8I A;  4QVZ A;  2A7Y A;  2XIC A;  4GY5 A;  3OYE A;  2RO0 A;  1M2O A;  4BI4 A;  1WIE A;  1G3W A;  4RTU A;  3M57 A;  1KC8 U;  4M77 B;  3CCE Q;  3CCV Q;  2ENM A;  2CGH A;  1WXB A;  4J8O A;  5FU6 B;  4M77 F;  2HL5 C;  5CKE A;  4J6Y A;  2PVD B;  1FX7 A;  2L0A A;  4BE1 A;  3JAM E;  1H92 A;  5KYU B;  2A08 A;  1GFC A;  1RAF B;  3HPW A;  3F70 A;  2JXB A;  3PE0 A;  1ZBJ A;  2RH2 A;  1LCK A;  2KNB B;  1VQ9 A;  4XTU A;  1I4K 1;  2QI2 A;  3JCM J;  3JCM P;  1U1S A;  1YJN Q;  3X28 B;  3G6E T;  2NUZ A;  3THK A;  2YUN A;  2DZ9 A;  1KHC A;  1VQ5 T;  4ELZ C;  1TUD A;  2EQI A;  2XID A;  4C5G A;  3G71 A;  3QZ9 B;  2BZX A;  1WXT A;  4ESR A;  2LQ8 A;  1JU5 C;  1RLP C;  2O2O A;  1IGU A;  3EH1 A;  1UGV A;  2M9U A;  3QYG B;  3R6O A;  2GTJ A;  2PUK B;  1FXX A;  2YSQ A;  1YCS B;  2DRK A;  2DXT A;  4ZGE B;  2EQJ A;  2LQN A;  3CC7 T;  1X01 A;  3LGL A;  2E10 A;  5HY6 A;  1GCP A;  1RI0 A;  2DPP B;  4M75 D;  2DE0 X;  1K9A A;  4N0A A;  2DIG A;  2KT8 A;  3A98 A;  3CBM A;  3EG9 B;  5GAN e;  1X69 A;  2JOY A;  1Y0M A;  1XJW B;  2BZ8 A;  1O75 A;  4EDU A;  4ELY C;  3HRT A;  1VQO A;  5GAN f;  4YTL A;  3MEW A;  3FJ5 A;  5D6W A;  1JJ2 P;  4RCC A;  1WHL A;  3NTH A;  1X2K A;  1NJI R;  2HQX A;  1VQN T;  4J5Y A;  3RUX A;  1Q82 C;  1SKU B;  1U06 A;  2CZ7 B;  3CC4 A;  4FU6 A;  1SPK A;  2FPF A;  1TH7 A;  1LJO A;  5IAY A;  2VXE A;  4NL2 A;  4P5N A;  4J9H A;  3CCS Q;  2QAZ A;  2RHZ A;  1QVF A;  2COY A;  2DIL A;  2LMJ A;  2CT4 A;  2EWN A;  2K3Y A;  2VXF A;  4F7U E;  4M4Z A;  4UC4 A;  2A37 A;  1FMW A;  2JW4 A;  2X3X D;  2RJD A;  3MP1 A;  4M75 F;  5KYW A;  3S6W A;  3GBQ A;  2O9S A;  3VS2 A;  1TUG B;  2DA9 A;  2YLC A;  1VQ6 A;  1YJW Q;  2LJ3 A;  1IGQ A;  4VUB A;  2OJ2 A;  4Y92 A;  2PZ1 A;  3E9G A;  3P8D A;  4Z89 A;  2RI2 A;  2XDB A;  3ZBD A;  5CKF A;  2WSE E;  3CCQ A;  3VS7 A;  4F7U B;  1VQM A;  2K57 A;  1M1K R;  4XU0 A;  1RAE B;  4XTX A;  2E1H A;  4R55 A;  2EJF A;  3CCE T;  4FSS A;  5I22 A;  3CCV T;  2MIO A;  2I0N A;  2X35 A;  4OMM A;  4PL6 A;  3REB B;  3CMA A;  5CVI A;  1VIE A;  1N8R C;  3OS0 A;  4IUP A;  5FWB A;  2ZPI B;  4AFZ C;  4OMN A;  2HSP A;  1O9S A;  4XTV A;  4M77 C;  3MHX A;  4M78 E;  1TXQ A;  4OMF B;  1OEB A;  3QKJ A;  3G7Z A;  2DLP A;  1M90 C;  2FVU A;  5FU6 C;  2XG8 D;  3RDV A;  3V7C A;  5C6S A;  2CP7 A;  1GL5 A;  4E7S A;  1KC8 R;  1JJ2 A;  4M7A G;  4C5I A;  2LCL A;  3I56 Q;  4C92 A;  1YP5 A;  2LDM A;  1W70 A;  4XU3 A;  3CCJ Q;  4E7I A;  2OTL A;  2QK0 A;  1YJN T;  3JB9 I;  4C5H A;  3WVE B;  4M78 F;  4C8Q A;  1UGR B;  3EG2 A;  4F16 A;  5GAN 4;  3EAE A;  5GJW B;  1WQW A;  2XMF A;  4JRK A;  1ZSZ A;  1TU0 B;  5LJ5 e;  2EYZ A;  5LL6 S;  2RQT A;  2GQV A;  3HFN A;  3E1S A;  4EPC A;  1NE8 A;  3CC2 A;  3UDC A;  2L8D A;  1RAD B;  4JRP A;  1Q86 C;  2YT6 A;  2YUQ A;  4J83 A;  3CD6 A;  2J05 A;  3WVD B;  2HQE A;  1VQ8 A;  4PJN A;  2V26 A;  1M1F A;  1AWO A;  4FYW B;  1TWB A;  4LUD A;  3CBP A;  1HD3 A;  2OAW A;  2PQW A;  4ATO A;  4OGE A;  3BDU A;  3QUI A;  1UFF A;  2P0P A;  1NBE B;  2L3P A;  1XTD A;  1QP3 A;  3QHS A;  3S3N A;  4OB0 B;  4J9B A;  1Q82 U;  2DYB A;  1Q81 C;  3EG3 A;  1YCY A;  3RNJ A;  4IUR A;  3RMQ A;  1WA7 A;  3A8H B;  4PJO E;  3L2V A;  1QCN A;  3VUZ A;  5IN1 A;  3QWX X;  4DBH A;  1B34 B;  2DZC A;  2HSE B;  1Z9Q A;  3V8L A;  1H3H A;  1M4Z A;  4J9F A;  4CC7 A;  2ROL A;  5FLX E;  2RM4 A;  3CCS T;  2E6Z A;  1VYU A;  1JXM A;  2ZGW A;  3G6E A;  1VQ4 Q;  4C8Q G;  4ANJ A;  1M9S A;  3JCM e;  3NHN A;  1QVP A;  4PJO B;  2K2M A;  3O5Z A;  4OML A;  1VQ5 A;  2X4X A;  5I21 A;  4E7Z A;  1T0J A;  4KGX B;  2P4T A;  1YN8 A;  4PJO F;  1SF9 A;  2PU9 B;  2L89 A;  2KY9 A;  1UUE A;  3MCA B;  4XTY A;  1RI9 A;  3UPU A;  1YJW T;  4ZTJ A;  1C1A A;  4E7J A;  1OV3 A;  2CP3 A;  3TU4 K;  3JB9 J;  2JS2 A;  4JPB W;  4XTW A;  2JT4 A;  2DRM A;  3UAT A;  2LX7 A;  5KYX A;  2F5K A;  3A5Z B;  4A4E A;  2C0T A;  1AZG B;  3OQ5 A;  2JTF A;  4Y28 E;  1NM7 A;  4QQD A;  1M90 U;  4B9X A;  3UF4 A;  3ULR B;  1R0B G;  1SG5 A;  5GAM g;  4KUL A;  3I55 A;  2FL7 A;  4IIO A;  3JCM V;  2R5A A;  4EMK B;  2VVK A;  3V7S A;  2XDD A;  3I56 T;  2EFI A;  2PNI A;  4R0K A;  1S72 Q;  3CCJ T;  2DXU A;  3CCL Q;  4IUT A;  2LZ6 B;  1X6G A;  2X51 A;  3EG0 A;  3Q1J A;  1TTH B;  3H0H A;  2YHT A;  4HT8 A;  3OMG A;  2CRE A;  2HMA A;  3CCR A;  1PM3 A;  1Q86 U;  3REA B;  3LH0 A;  2BKD N;  2QGF B;  1EZZ B;  4BUG A;  2HBP A;  1NPP A;  1OU8 A;  1MUZ A;  2CSQ A;  3DB3 A;  2DXC A;  3ME9 A;  2AHJ B;  1K8A C;  2DX1 A;  1VYT A;  2EJ9 A;  1FMV A;  3OSS C;  2K5L A;  5LJ3 g;  4OF1 A;  3CME T;  1WQ7 A;  1OU9 A;  2MCN A;  2P84 A;  2EW3 A;  3I5S A;  3HSB A;  2E5K A;  4HT9 A;  1Q81 U;  1WXU A;  5A0D A;  4EIK A;  1KFZ A;  2KRN A;  2CH4 W;  5CQX A;  3VKI A;  5DLO A;  4ZN1 A;  2XKO C;  2MI6 A;  1M3B A;  4WTO B;  1VQK A;  3DLL A;  5IHK A;  2KYM A;  2IG0 A;  4ZGD B;  1IXD A;  3L2U A;  1NJI U;  2QQS A;  2HKQ B;  2OI3 A;  1NZ9 A;  4MMK A;  3VS3 A;  1VA7 A;  4N4G A;  4J9D A;  1X75 C;  2RB6 A;  2GTO A;  1PHT A;  4CC3 A;  4JLG A;  2DNU A;  1VQ4 T;  3X25 B;  2GNC A;  2A36 A;  1YFN A;  5IH2 A;  1Q82 R;  1I07 A;  3VU3 C;  2KRO A;  2RI3 A;  1OYX A;  1YJ9 A;  2HBW A;  4A4K A;  1M8V A;  3CCU Q;  2XU8 A;  4KT0 E;  5CCA A;  3VV0 A;  2EAY A;  2LP5 A;  1PKS A;  3OW2 A;  2HEQ A;  1EFN A;  2MWO A;  4PJO C;  3C95 A;  3SD4 A;  3QWY A;  4M77 D;  1ZX6 A;  2HL3 A;  1R0C B;  2YXY A;  2KK4 A;  2FO0 A;  1M1K U;  2RJE A;  2O31 A;  3JV3 A;  4F04 B;  1QWF A;  2D1X A;  3PT9 A;  3CPW S;  3JB9 G;  4JUV A;  1OX9 A;  1IRE B;  5CQY A;  2LC4 A;  4JZ3 A;  1OOT A;  1YHQ A;  3M0P A;  4C0Z A;  2ED0 A;  3HRU A;  3VRZ A;  5J39 A;  3X20 B;  2KVQ G;  1WHH A;  3QDF A;  3OYK A;  2R5M A;  4QVD A;  1HXD A;  4M7D A;  1ZLM A;  2QTV A;  4DBF A;  2LNH B;  2PTK A;  2KXD A;  1B3Q A;  5A2Q E;  3RKY A;  2QDY B;  2M0O A;  1SHG A;  3OYH A;  1N8R R;  2KYB A;  2DBK A;  5HK3 A;  2MK5 A;  1TS9 A;  2K7A A;  5GAN 5;  3KBG A;  1S72 T;  2HQH A;  3CCL T;  1WDX A;  2FB7 A;  2KBT A;  4JRI A;  4HVV A;  1M90 R;  4WCI A;  4D8K A;  2YLB A;  3DKM A;  5FU7 B;  4EMK C;  4QT7 A;  3RBB B;  1K1Z A;  1PWT A;  2CSI A;  2EYY A;  4OVA A;  1VQ7 T;  2NUT B;  1KQ1 A;  4HCC A;  1WYX A;  2AKL A;  2QA4 A;  2PUO B;  2RJF A;  3LYI A;  2VGN A;  2VB6 A;  2GCX A;  2CP6 A;  3H41 A;  2LX9 A;  2V8K A;  3N5B B;  2F2W A;  3UA6 A;  2HZY A;  1K8A U;  1R8O B;  1KD1 C;  4HCB A;  1QVG S;  5GAM h;  2GFA A;  2ECZ A;  3OBW A;  4QVC A;  2DMO A;  1MMA A;  1LNX A;  1RAG B;  2DM1 A;  1UDL A;  4OMQ A;  3G4S Q;  3FIF A;  4MZM A;  3GF5 A;  2VKN A;  3LLR A;  1BI1 A;  2EKO A;  1Q86 R;  1SSH A;  4BB7 A;  1K73 C;  4AFU C;  2BIV A;  2VYT A;  1YBY A;  1Y7X A;  2XI9 A;  1CKB A;  3TVT A;  1PCX A;  2NUT A;  4M7D G;  3V8K A;  2RHI A;  4ZTF A;  1P92 A;  4NOY A;  1QCO A;  2DJZ A;  1GCQ A;  2EQK A;  2LT4 A;  1KIK A;  3C94 A;  5L23 A;  3DB4 A;  4XU1 A;  5IHI A;  4ME7 A;  3BDL A;  5KYW B;  2RQU A;  5FRO A;  1HK9 A;  3CPF A;  1WHJ A;  1E7O A;  1Q81 R;  1VQL Q;  1AWJ A;  1UEC A;  3RER A;  2D9T A;  4L59 A;  2D6F A;  1K76 A;  4XTZ A;  3NTI A;  1VQP Q;  4M7A A;  1EIF A;  5FW9 A;  1B07 A;  2DEQ A;  3CCU T;  4Z88 A;  4ZGJ B;  2B8A A;  2KAF A;  5GAM j;  4OB3 B;  2CP2 A;  3QXE B;  4LE9 A;  4E2F B;  4E6R A;  2RHX A;  5LJ3 h;  3VS1 A;  2QXF A;  1YI2 A;  3PIP A;  5IXB A;  2M0Y A;  5LJ3 d;  2NUP A;  2QEX Q;  1YNZ A;  3WXM B;  2NYS A;  4OGC A;  3TEE A;  3I5R A;  4R56 A;  3OYL A;  1A0N B;  4C92 E;  4HXJ A;  1D0X A;  3UWN A;  1UJY A;  1Z9Z A;  2JUF A;  3PVQ A;  1ZA1 B;  3QG1 A;  2P0K A;  4KRT A;  2OTJ A;  4ZN3 A;  4FT2 A;  2DL3 A;  2SEM A;  3U23 A;  4C8Q E;  2H3J A;  3VS6 A;  3CCM A;  3M4Y A;  4JJC A;  1RAC B;  3QJY A;  1MV0 B;  2ESW A;  2LQW A;  2IPO B;  3CME A;  4IUV A;  1NEB A;  4C92 B;  1ZUY A;  1I5L A;  2ZPB B;  3GNG A;  3M5A A;  4GLK A;  1AT1 B;  1AWW A;  1PD1 A;  1K0S A;  2RQV A;  4M78 D;  4C92 F;  2KGT A;  2DKG A;  1FYN A;  5CO7 A;  4C8Q B;  4M77 G;  2CH4 A;  2RN8 A;  4BI8 B;  1UHC A;  1M2V A;  1VQ9 Q;  1ZSZ B;  2EGE A;  2QQB A;  4F7U F;  2LVM A;  5GAN 2;  1KQS P;  3J81 E;  4NL3 A;  1ABO A;  4KUI A;  2KEA A;  4L5G A;  2A0F B;  4F17 A;  3SDZ A;  4D8D A;  3SHW A;  2RHY A;  1GBQ A;  1BI2 A;  2VC8 A;  1D0Y A;  3E19 A;  2X4J A;  1V1C A;  5LJ3 j;  1JO8 A;  2E64 A;  2KRS A;  1RLQ C;  2EYW A;  1CKA A;  3TQ7 P;  5FU7 C;  2QQ9 A;  5LJ5 g;  2GFU A;  1AD5 A;  4BD3 A;  2LCS A;  4M75 A;  2AK5 A;  4DA4 A;  1UG1 A;  1W6X A;  3PGG A;  3LGF A;  1M30 A;  1K73 U;  2KMT A;  3G4S T;  5GJV B;  1MHN A;  1BKB A;  4N0A C;  2FRY A;  3CPW P;  2H8H A;  3EGD B;  4RTZ A;  1W2B P;  3KFV A;  4BY6 B;  3SB2 A;  3M53 A;  1KSW A;  2KSS A;  1X6O A;  3OYA A;  3LWI A;  3JRZ A;  1I8F A;  3EHQ A;  2DTH A;  1VQO Q;  2M02 A;  3EFO A;  1K8A R;  3NFC A;  3M0T A;  3QO3 A;  4LDW A;  4PJM A;  2RK2 A;  1D1B A;  3X24 B;  2MYS A;  2X4W A;  1UHF A;  3EGU A;  4LDY A;  3CC4 Q;  4PK4 A;  1K9M C;  2JTM A;  2ED1 A;  2DFU A;  1G3T A;  2E65 A;  4PJO D;  3JCM Q;  1KQS A;  5D6X A;  4DBR A;  1VQL T;  4C5E A;  1PC0 A;  5GAN 3;  2GQI A;  2M16 A;  3QBY A;  3P8B B;  4BDY A;  2L2P A;  2RA2 A;  2M1H A;  1JQQ A;  3OYM A;  1VQ7 A;  1VQP T;  1AHJ B;  1NEG A;  3EGD A;  5A0L A;  4FL6 A;  3M56 A;  5KYX B;  2VGM A;  3JCM g;  3VRY A;  2HKN A;  1VQ6 Q;  1ZHI A;  2GF7 A;  3FLG A;  1WHK A;  2AZS A;  2OX7 A;  4HKE A;  4FYX B;  2Y4X A;  3H0F A;  2QEX T;  3CCQ Q;  1VQM Q;  1WJQ A;  2CKK A;  2K79 A;  4M75 G;  2J6F A;  1K0X A;  2E12 A;  2VV5 A;  8ATC B;  3CMA Q;  2MPX C;  2L3Q A;  1YIJ Q;  1GFD A;  2J6K A;  2RMO A;  1W2B A;  3JCM b;  2KT1 A;  5M9O A;  5HK0 A;  1D1A A;  5EG2 A;  3GNF B;  2JNG A;  4LDV A;  1V76 A;  2DK3 A;  3OYC A;  2E5Q A;  3H0I A;  5C0M A;  2DD5 A;  4TVR A;  1OI1 A;  2DTO A;  4X1V A;  1GXI E;  1N8R U;  3FB9 A;  5AT1 B;  4JJN K;  1VQ9 T;  4C92 C;  3M0U A;  3NTK A;  3UT1 A;  2OTL Q;  2QTX A;  3PTA A;  2XD0 A;  1GRI A;  5GAO l;  1E6H A;  1G83 A;  4LD6 A;  4RTY A;  4DOW A;  3CC7 A;  2E41 A;  1G8X A;  4C8Q C;  4J6X A;  2BTT A;  5DLQ E;  5KCO A;  1QVF S;  3GIB A;  1NG2 A;  2DAQ A;  5IXF A;  1RAH B;  1ZSZ C;  1KQ2 A;  5GAO n;  1UGS B;  4PNO A;  3MEA A;  4J7I A;  1ZBX A;  1X43 A;  3QJ6 A;  1NLO C;  2RNA A;  2FYK A;  3ZFJ A;  4M78 G;  1UJ0 A;  4WF2 A;  3CC2 Q;  4FW1 A;  2O4X A;  2D8H A;  2F2X A;  1G2B A;  1Q95 G;  1VQN A;  1H8K A;  3MEU A;  3VS5 A;  3V8J A;  2DVJ A;  3CD6 Q;  5KH6 A;  1H3Z A;  2K3X A;  3EGX A;  4PLL A;  1VQ8 Q;  4AT1 B;  1Q7Y C;  3A8M B;  1Y07 A;  2JN0 A;  2CP0 A;  2FZC B;  3SFM A;  1SEM A;  5D7U A;  5CR2 A;  2V1R A;  3S3O A;  4JJD A;  3L2Q A;  2E3H A;  1X2Q A;  2K5F A;  1KD1 R;  1M3A A;  1BIA A;  2BE7 D;  3VYH B;  4C0F A;  4KH1 B;  3H8Z A;  3L2W A;  2LT1 A;  4PJJ A;  5GAM f;  1VQO T;  3PFS A;  3L2R A;  1BI0 A;  2E3I A;  1ZSG A;  1JJ2 S;  4BY6 C;  4BDZ A;  2FG0 A;  3PVL A;  3OYF A;  1FWZ A;  1K9M U;  2V1Q A;  1JRI A;  2A3L A;  3SWN A;  3J80 E;  1QKW A;  1K73 R;  1OX8 A;  1M1G A;  2LJ1 A;  4A4H A;  3CC4 T;  4OB2 B;  3CCE A;  5LJ5 h;  1VUB A;  4J6W A;  3CCV A;  2JMA A;  1N6A A;  5LJ5 d;  1OZ3 A;  3G6E Q;  1OZ2 A;  2O01 E;  2EJG A;  2KE9 A;  5KYY A;  3KXT A;  3C0C A;  4BE0 A; 
#chains in the Genus database with same CATH homology
 1WHG A;  2CP7 A;  2CP2 A;  2E3H A;  1TOV A;  1IXD A;  2CP3 A;  2E4H A;  3TQ7 P;  2HKQ B;  1WHJ A;  4B6M A;  2E3I A;  2MPX C;  2COZ A;  1WHM A;  2Z0W A;  2QK0 A;  2HQH A;  2HKN A;  1TXQ A;  2CP0 A;  1WHH A;  1WHL A;  2COY A;  2M02 A;  2HL3 A;  1WHK A;  2COW A;  3E2U A;  2HL5 C;  3RDV A;  2CP6 A;  1LPL A;  2CP5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...