1WHKA

Solution structure of the 3rd cap-gly domain in mouse 1700024k14rik hypothetical protein
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
91
structure length
91
Chain Sequence
b'GSSGSSGEGTVKLHEGSQVLLTSSNEMATVRYVGPTDFASGIWLGLELRSAKGKNDGAVGDKRYFTCKPNYGVLVRPSRVTYRGISGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIKEN cDNA 1700024K14
molecule tags Structural genomics, unknown function
source organism Mus musculus
publication title Solution structure of the 3rd CAP-Gly domain in mouse 1700024K14Rik hypothetical protein
rcsb
total genus 4
structure length 91
sequence length 91
ec nomenclature
pdb deposition date 2004-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01302 CAP_GLY CAP-Gly domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.190 Mainly Beta Roll SH3 type barrels. CAP Gly-rich-like domain 1whkA00
1WHLA 4B6MA 1LPLA 2COWA 2CP2A 2HKNA 3E2UA 2E3HA 2MPXC 2E3IA 1TOVA 2COZA 3TQ7P 2CP5A 2COYA 2HL3A 2M02A 1WHJA 1WHKA 3RDVA 1WHHA 2CP7A 2HQHA 2QK0A 2CP6A 2E4HA 1TXQA 2HKQB 2HL5C 2CP0A 2CP3A 1IXDA 2Z0WA 1WHMA 1WHGA
chains in the Genus database with same CATH superfamily
4E6RA 3HP9A 2FHDA 4E7SA 2K2VA 5LJ3f 1UGQB 5IHKA 2RPNA 1Y07A 1RLQC 4J83A 5IXFA 3OW2S 2Y4XA 2EQIA 5GMKh 4C8QE 5CQYA 6AT1B 4Y92A 4JZ4A 3G4ST 1YJ9T 1X6GA 1HJDA 3C12A 4F17A 3M0PA 4AT1B 1N9SA 3SWNB 1YCSB 3CPWA 4FYWB 4FM4B 2J6OA 3M9QA 1IO6A 3UWNA 2DFUA 2YWWA 2V8JA 4C92C 4RG2A 3H0IA 3TCJA 3CC2A 3QUIA 1Q81C 1EFNA 2DX1A 4A4KA 1SKUB 2RJDA 3M56A 3QZ5B 1CKAA 3LW5E 4EMKA 2H3JA 4M75E 4RMOA 3DKMA 2RNAA 1I1JA 3QJ6A 1O9SA 2L2PA 2A0FB 1PWTA 4M7DD 1FYNA 1NE8A 1M27C 5CCAA 2L0AA 1KFZA 1VQ6A 4D6WA 2KAFA 2HBPA 2OJ2A 1YITQ 1KQ2A 2CH4W 1G3SA 1X6OA 2KI7A 4M78G 3CCQQ 4BE0A 2CDTA 3LLRA 1MNEA 1YJNA 5I11A 2XDBA 4WCIA 1VQLT 1EIFA 4HA8A 2LQNA 2VB6A 1YP5A 3JB9D 5D6YA 3VYHB 3ZEHA 4J9FA 2DF6A 4X34A 1E6GA 4OB3B 5J26A 5FWCA 2QYZA 1VOMA 5KYYA 3P8BB 4XAXB 1V1CA 3OQ5A 3L2WA 4IUVA 1UE9A 2LTOA 2RMOA 2DIGA 1AHJB 1KQSS 2F5KA 2QQSA 4DOVA 5I2SA 2EYXA 2L3RA 3RNJA 5GMKi 4HCCA 1W4SA 2XK0A 2JM9A 3QYHB 2DRMA 3GIBA 3V7CA 2LZ6B 1X75C 4FW2A 4RKUE 1M90C 3FC3A 4JRPA 2HNIA 1RI9A 4O5VA 4PLLA 3VS4A 2COZA 4HT9A 1CSKA 1WHHA 2O9SA 4HKEA 4ZGDB 3HKSA 1SSHA 2YUNA 1OZ3A 2NWMA 3HFOA 1M90U 1VQNQ 2V8KA 1KD1C 2JMCA 3MEWA 1NBEB 3CC4A 1W6XA 3E1SA 1JRIA 2KY9A 2COWA 1KD1U 1YFNA 2ATCB 2M0YA 4M75B 4HVUA 1QW1A 5KE2A 2QA4A 5D7UA 3MEAA 2HMAA 4OMOA 2OX7A 2CP6A 4IUPA 3S6WA 2KBTA 2XDPA 4MMKA 2RD1A 2O4XB 2LT1A 2MWOA 1NPRA 2BTTA 2DERA 4XK8E 4MDWA 1UJYA 4LNPA 1SEMA 3BDUA 2RHUA 4E7JA 3V7RA 1G8XA 2KQWA 1MMDA 1KHIA 3MEUA 1YJWT 1OI1A 3LWIA 3CCUQ 4ANJA 2RM4A 1VQ4A 9ATCB 2NUTA 1K9MR 4ZNXA 3E19A 2QEXT 4FT4A 2DMOA 4MMLA 2F1LA 2GQVA 5IH2A 2I2LA 2HAXA 4PFPA 4NOYA 3CBMA 3VS0A 1D0YA 1F1BB 4ZGEB 2M9UA 1S72A 1QCNA 2VASA 4F14A 2EQKA 2X51A 3CCJT 1M3BA 4JS4A 2AZVA 4L5GA 5I22A 4OGCA 2ENMA 2PTKA 4C92B 5HCKA 2EFIA 3RKXA 2XD0A 1S72Q 4N4IA 3OYDA 4ZN1A 3G4SQ 1ABQA 3BW1A 3M54A 3CCEA 1IZ6A 1OULA 5KH6A 4LUEA 3T9NA 2E1HA 4CRIA 5AT1B 3MP6A 1UECA 1LOJA 2X35A 2X4XA 3EG1A 3R6OA 2DXTA 1SRLA 3VS5A 1WZOA 4M7DG 3A8HB 1BK2A 3KFVA 2YUOA 3ZL7C 2P0QA 1YITT 2MAMA 5A0LA 4VUBA 2K57A 5FWBA 1K73U 4Y28E 1OX9A 1ZSZC 4C92D 2GF7A 2LT4A 2JZ2A 5FU6C 2BZYA 1WYXA 4Z8AA 4GBQA 1PRMC 4DBQA 1U3OA 5CIUA 1YWPA 2D6FA 4OMMA 4RTWA 1VQNA 2RF0A 2VUBA 1VYTA 1UHFA 1VQPA 2RJCA 3CPWP 4J9CA 4FT2A 2E10A 2FL7A 3C0CA 2KGTA 2DL4A 2DLPA 3LGLA 1SRMA 2O2OA 2RO0A 4N4GA 4BI3A 1YI2Q 2A3LA 1YHQT 2JS2A 2LVMA 1MMAA 4BACA 2EGAA 1KQSA 2RQTA 3G7ZA 3KBGA 2KXCA 2BE7D 1UG1A 1PC0A 4BI8B 4KH1B 2R57A 2CSIA 2LQKA 1GL5A 1I5LA 4OMNA 4M7DA 2EKHA 3E9FA 1K9MC 1N8RR 3U23A 2F5TX 3PIOA 1R0CB 2DL7A 2K5IA 5LJ5f 3JCMh 5IXBA 1VQ9T 4C5GA 1FMVA 5GAN7 2CGHA 2P0KA 4PNOA 2EGCA 3L2VA 2V26A 3PGGA 3HTRA 2YRDA 2SEMA 3NGPA 2JMAA 1ZX6A 1XQHA 2EJFA 5GAN6 4LD6A 4RCCA 4II1A 2JXBA 1H3ZA 4J9BA 2CYZB 2RHZA 4N4HA 1U1SA 3EH2A 3QSUA 2Y90A 4B9XA 4R56A 4LE9A 2BZ8A 4EPCA 4E7KA 1TXQA 2HKQB 2CP3A 3PIPA 3JB9F 4HVVA 3OS0A 1QVFA 2PVOB 3BE3A 1YBYA 2QQRA 1WHLA 4D8KA 1BIBA 2ZPHB 5KYXA 1M9SA 1RAEB 2V8IA 2X3WD 1QMCA 4FYYB 1R0BG 8AT1B 1QLYA 2JVVA 1K76A 1XJWB 3X28B 1VQ9Q 4EDUA 4MZPA 2C0OA 1IXDA 1D3BA 4E7HA 4F16A 3OYYA 3ME9A 3CCRT 2XU8A 3CBPA 1NEBA 4C92G 4A4EA 5J39A 2JTMA 2DL8A 1VYVA 2FPFA 1AOJA 4E7LA 5KYWA 3M4YA 4M4ZA 2KR3A 1E6HA 4RTUA 3TQ7P 3EGDA 2DYBA 5GANf 2MPXC 2E3IA 1NYGA 3MHXA 3KXTA 3JB9G 2XG8D 1YWOA 3DLMA 4AG2C 3CMAT 5GANj 3I55T 2D8HA 1WJQA 5GMKl 3CCSQ 2QTXA 2EIFA 4J5YA 3S3MA 2YDLA 5GAN3 1Q86R 1RUWA 2L3SA 1KQ1A 3JCMP 4PL6A 5GAN4 3JCMb 1YITA 2VVKA 2XHCA 4A53A 1MMNA 4XQ3A 1BU1A 3OMGA 3JCMV 1NPPA 5CKEA 3TSWA 2M02A 5LJ3j 4CC2A 3OS1A 2E70A 2RQRA 3META 3EG2A 3DB4A 2NLUA 1UGRB 2CT3A 3RKYA 1VQMA 4D8DA 2DAQA 4PKCC 4C8QC 2KVQG 4A4FA 1BI3A 1VQ6Q 2WSEE 4LXCA 4AG1C 1X6BA 4PJOB 3WVDB 4M7AD 1SG5A 3I55A 4M77B 4AFQC 2AKKA 2LNHB 2KRNA 3M55A 3C94A 4X1VA 4M7DB 5GAN5 2K5FA 3OYGA 4JRKA 1OQKA 3HSBA 4XU3A 1D1AA 2GFUA 1AWJA 1R77A 3FRNA 5IHIA 1Z9ZA 3CD6Q 2M16A 3PFSA 5KYUA 4PJLA 3JCMJ 1M1KR 1X69A 2K4YA 2K7AA 1NJIU 3CCLT 2RB6A 2NUPA 1AZEA 3EHQA 3CCSA 3CC2T 1JB0E 1HXDA 1M2VB 1TSFA 4OF1A 3JCMd 2R58A 3OYCA 1NG2A 2HKNA 3E2UA 1VQ7Q 3CBOA 2HD0A 1TH7A 3TU4K 1D1BA 5FU7B 2EW3A 1WA7A 3CC7Q 1VQPT 2PNIA 3CCMA 1HD3A 2AKLA 3THKA 1B7TA 3GF5A 2DD4A 2FZKB 3Q1JA 3CXCA 1M90R 3MJXA 4C8QD 1ZBXA 2P0PA 1D0ZA 3LH0A 2PZ1A 2DJZA 3HRUA 1PD0A 3EGXB 3R6NA 3CCJA 2HQXA 3H9NA 1IREB 1QVFS 1Q82R 1WI7A 4JLIA 5GJVB 4MDXA 1NLPC 3QZ9B 1KJWA 3L2ZA 1Y96B 3SB2A 1QWFA 2D9TA 2DXUA 4M75A 1M1GA 2DJQA 1WLPB 4OMPA 3EFOB 1CKBA 2JNGA 1W2BP 2E65A 5KYXB 3VUBA 2PVGB 2VGNA 1OPKA 1Y0MA 4M75D 1N27A 2E4HA 1QCOA 4JRQA 1X2QA 2FRWA 2FB7A 4DEYA 2J06A 4OGEA 2E6NA 3A5ZB 2RK1A 2KRMA 2RQUA 3MKDA 3I35A 3PT9A 1HSQA 4KRTA 4LD9K 3RERA 2PVDB 3JCMg 3GP8A 2DVEA 4FU6A 1GBQA 4RCBA 4TVRA 3OW2A 4CC3A 1UUEA 2CP0A 1BI1A 3FB9A 2J6KA 2ABLA 2NUZA 4KT0E 5GAOm 2AZSA 3HHTB 3WVEB 4J6WA 2XI9A 3H41A 4QVCA 2JN0A 1Q7YR 3HFNA 1Y71A 2EJGA 3TVTA 1WHKA 4QQDA 5CKBA 2W10A 3P8HA 1UGSB 1VQ8Q 1X27A 1YNZA 3A8MB 3AHUA 4KULA 2KXDA 3G4SA 3JB9H 3PMTA 3I9QA 2YLCA 1N8RU 1KHCA 3CMEA 1TWBA 4PK4A 4PJOA 2ZPFB 2F69A 3JRZA 3M58A 2DK3A 3TSZA 1SPKA 4X9CA 1T3LA 1VQOA 2GQIA 2P4TA 3ER0A 2DTOA 2P84A 4JZ3A 3L1AA 2LQWA 5GAMd 4HXJA 2ZPIB 3PTAA 2EYZA 5A2QE 2VV5A 1JJ2S 3REBB 2GFAA 2RQVA 4OB0B 3H0FA 5KCHA 3OYHA 4KUDK 5GANe 3RMSA 3X24B 2HL5C 1BCMA 2LCSA 1S72T 2QI2A 4PJOE 1Y57A 1VQ6T 2FYKA 2K3BA 1VYUA 3C95A 2NUPB 2X3XD 4OB2B 3L2QA 2FPDA 4BI4A 4AMCA 3SHWA 4C8QF 1M1KU 4JJDA 4FSSA 1UEBA 2KK4A 4CC4B 1KC8C 1Q86U 4J7FA 1RADB 2AIRB 2DBKA 5LJ3d 2ZPBB 1ZA1B 2ZZDA 1IRXA 3LX7A 2W0ZA 5KYUB 1ZBJA 5GMKm 4B9WA 1ZSGA 1G3TA 1C0MA 3SWNA 1VQOT 2YT6A 2CZ7B 4OMLA 5GAMh 3FIFA 5FU7C 2Y4YA 3CCVQ 2YRCA 1H8KA 4RUGA 3GPLA 1M3AA 1ZUKA 3QKJA 2MF2A 2QG9B 2K3XA 1HYOA 1K0XA 1NZ9A 3O8VA 4WF2A 2E12A 4OVAA 1GFDA 3HPWA 1H92A 4BD3A 3QBYA 1N8RC 5CKHA 2DE0X 2EVRA 1LJOA 1WQ7A 2AK5A 1JXMA 3RUXA 5DLOA 1Q7YC 3EG9A 1BI2A 2VKNA 1AZGB 1K1ZA 1ZHIA 2JM8A 2C0IA 2P4RA 2LJ3A 3RMQA 3VYGA 2JJ9A 1G3WA 3QPHA 2DZ9A 1H3HA 5J3BA 2A7YA 4C0GA 2J05A 3RIRA 4IKFA 3CCST 3A8LB 3HL8A 4KGVB 1PSFA 1JJ2P 1U1TA 3VS3A 1RAFB 3ZFJA 3EAEA 3OYIA 2QASA 4A54A 1LCKA 2E41A 4LDYA 4M77E 2FRYA 2DILA 1ZLMA 3RESA 2ZAEA 5FU6B 3VS6A 3C4SA 3CCEQ 4BY6B 2L3QA 1VQKQ 4M7DF 3CCJQ 3JSCA 1YCYA 3QHSA 5CVIA 1BI0A 1TOVA 1GBRA 4NS5A 1OEBA 3CCVA 2OAWA 2BIVA 5LJ3e 1T0HA 3REAB 3G6EA 1XTDA 1PKTA 2ROTA 4AFSC 4QVDA 3EHRA 2LNVA 4AFUC 3RKWA 2QA4T 2LP5A 2PU9B 2D0QB 1JO8A 1Q82U 2G6FX 3WXMB 2J7IA 1EX4A 2A28A 1K8AR 2ZPGB 3JV3A 1JXOA 4C0DB 1VQ5A 2QQ9A 4J9GA 1G3YA 5FW9A 2LMJA 3L42A 3X20B 1D3BB 1MNDA 4BUGA 2BE9B 2BKDN 1MV0B 2KEAA 2QAZA 4QQ6A 1MUZA 3NPFA 3CCQA 1QVGS 3NTKA 1QCFA 1QKXA 3P8DA 3NTIA 4O6JA 2E5KA 3I56T 1XNIA 3OBYA 3I5RA 3GNGA 1ACMB 4DQ2A 3OS2A 4NL3A 1UDLA 4LDVA 4M7AE 4BE1A 4HCKA 3OYAA 2YSQA 1E7OA 1JBMA 1TG0A 1JJ2A 3EG3A 1M1FA 3RDVA 2GNCA 3KUFA 2PUOB 3V7SA 1BBZA 4JJBA 1PD1A 1WJSA 3GLXA 2B8AA 3CMEQ 2MI6A 4N0AC 3L2RA 4MZMA 3CCRA 2L5QA 1X2KA 1PRLC 2VC8A 3LYIA 2HSEB 4BY6C 2X4WA 3CXCS 1G83A 2XDDA 5LJ3h 4M77A 3TEEA 4C5EA 4RTXA 1WGSA 1YJWA 1J3TA 1QQJA 2CSQA 5CKDA 2DETA 1PCXA 3LWHA 2K9GA 2ED0A 1VIFA 5HY6A 3VU3C 5CO7A 3URGA 5GANg 2QEXA 5LJ5e 1LNXA 1JEGA 3ASKA 5CR2A 4EMKC 2OTJA 1YHQA 2DTIA 1IHWA 1VQOQ 2JUFA 5LJ5j 5IAYA 2R5MA 3MEVA 4E7IA 2E5QA 1QVGP 2AT1B 1OYXA 4XU2A 2EBPA 4Z02A 5GAMf 3FJ5A 2OTJQ 5AYFA 4IIOA 2KRSA 3UF4A 4M7AG 2ZPEB 1VQLA 2RJEA 1GFCA 3SEMA 3A1PA 1OZ2A 1GRIA 4E7ZA 5I21A 2IIMA 1AWOA 3JCMW 2HQHA 4C8QG 4PFZA 1K4US 1NEGA 2DXBA 3IQLA 3VV0A 3GOXA 2FVUA 5GAOp 2VWFA 2DL5A 2SRCA 4EMKB 3N5BB 1A0NB 2XKOC 2M51A 2RI2A 1LVKA 1B34B 4E47A 1M30A 5KYYB 1RAGB 2RN8A 2CP5A 1PNJA 2DXCA 3M0RA 5DM7R 1MV3A 1YJ9A 2EWNA 5FRMA 4FCYA 5HKCA 1FMKA 2OI3A 2RI5A 1P92A 1MGQA 4PJJA 3MP8A 2PUKB 1ABOA 3J7AF 2EQJA 1WHGA 5GAN8 3OY9A 1RAAB 1VQ5Q 2HZYA 1YJ9Q 4QW2A 2F2WA 2FPEA 4C0ZA 5M9OA 1AVZC 4QT7A 2ZGWA 1WJRA 4V2SA 4EMGA 3A8GB 2IG0A 1Q7YU 1PM3A 3OS5A 1X01A 3EFRA 4QKUA 3CC7A 1U5SA 2YRVA 3I55Q 1VUBA 4RTZA 2KDSA 3CPWS 1K8AU 1KG1A 5GAOl 2CUDA 5ECAA 3V8JA 4JRIA 3EFOA 3O5ZA 2C06A 3G71A 3M0QA 5CQXA 5IN1A 2MOXA 3M53A 2QA4Q 3J81E 3QDFA 2MCNA 1WFWA 3CD6A 5D6XA 3UATA 5GAOr 1W1FA 2OTLQ 4FYXB 3EH1A 1WQWA 2CH4A 4RTVA 1YJWQ 1BYMA 4OMQA 4ATOA 2ESWA 1WHJA 3OYLA 1KC8U 2K3YA 2VXEA 2RHYA 3EGXA 4ELYC 3DB3A 1VIEA 4PFOA 5GJWB 5GAN2 4AFZC 2OTLA 2QGFB 2YHTA 4M75C 3NHNA 4WTOB 4NL2A 2DPPB 2QTVA 1YIJA 2HCKA 1FWZA 3M59A 4XTWA 1WNLA 4B6MA 3OSSC 4M75G 4QQGA 2HDAA 1W2BA 3VS2A 1TUGB 5LJ5g 4J9DA 2KE9A 1FMWA 1Y7XA 1BKBA 1UGPB 1TU0B 3BDLA 3D7SB 5KYWB 4BE2A 2JOYA 1SHGA 2FG0A 1OX8A 2DBMA 5LL6S 5IT9E 1TS9A 1Z9QA 1UFFA 2E3HA 2RA2A 4M78E 1OU8A 2AHJB 5A0DA 4LUDA 4HT8A 3QJYA 2DTHA 2OTLT 4RG8A 1VQ7T 2XIDA 1QVGA 2EYWA 4M78B 2RH2A 1FX7A 4E2FB 2F2VA 1G2BA 2IPOB 4UC4A 2RI3A 3HRTA 5FLXE 3GBQA 4IUTA 2V1RA 3CCUA 2A08A 3JB9I 1NJIR 2CT4A 1K9AA 4FL6A 4OP0A 2LCLA 4CC7A 5GANd 3OYFA 2KT1A 3M4GA 3CCRQ 4C92A 2R5AA 1Q81R 2K6DA 4M77D 1K73C 2CZ0B 2EYQA 1QKWA 3LH5A 1PKSA 3PMIA 5A0GA 1U8RA 1VQNT 1VA7A 5KE3A 2EYYA 1KK7A 3CMAA 2CZ1B 4F7UG 2RQWA 4Z88A 1JQQA 2HSPA 5CK9A 3E9GA 3OYBA 4C0FA 2NYSA 4JDSA 3VKIA 1PSEA 3FDRA 2JTFA 2MK5A 4FSXA 4HVWA 3EG9B 4PJOF 1ZSZB 4M77F 1VQ8A 3I5SA 1X43A 3MO8A 1YI2A 4C0DC 3AT1B 1V29B 2DM1A 5GANh 4C8QA 1VQMQ 3JCMX 1Q86C 2WACA 2QEXQ 1VQ5T 1RI0A 2QGGA 4ESRA 3M57A 4YTLA 3VS1A 5EG2A 1TTHB 2JT4A 4RTTA 1PG5B 2GTOA 5CKFA 3I56Q 4HCZA 1SHFA 1AWXA 4EIKA 2LX9A 4KGZB 2LCCA 5LJ3g 3VS7A 1KIKA 3MCAB 1AT1B 2H3EB 3HRSA 1O75A 2EPDA 4XTUA 3V8KA 2RJFA 1C6VX 4J8OA 3QO3A 2D8JA 2O31A 2MYSA 1VQLQ 2LQ8A 3CEYA 4JUVA 4F7UE 3M0SA 5LJ5d 1ZSZA 5KYNA 1VQKA 2VYTA 3PVQA 3QIIA 1VQ4T 3TREA 1WPYA 4JJNK 2X4YA 2DNUA 1WIEA 4F7UB 2C0TA 1I81A 3JCMf 3G71T 1KSWA 3CMET 1RLPC 1QP2A 2HQEA 2EKOA 2LC4A 3CCLA 2EAYA 3UA6A 5GAOq 2I0NA 4K11A 3CD6T 1NM7A 2MWPA 3DLLA 2M0OA 1WHMA 5HK3A 2WSCE 1PHTA 3OBWA 4L59A 3VRYA 1R8OB 3M0TA 1NJIC 1UTIA 2D1XA 1QWEA 1UJ0A 3H8ZA 2CREA 4A4HA 4A63B 3EFSA 3PNWC 3CC2Q 1M1KC 2FZGB 2KT8A 2QQBA 1WXTA 3CCET 4M7AF 1S1NA 1M8MA 3G1JA 5LJ5h 1M5Q1 4DBFA 1T3SA 2V1QA 3RBBB 1YIJT 4DEXA 2JS0A 1B3QA 2K79A 2DD5A 3CC7T 5FROA 4IUUA 1G5VA 1MMGA 5GAMe 3J80E 2FO0A 1ZUUA 1I0CA 3MPUB 2KNBB 2F2XA 3VRZA 2KMTA 2QQAA 3OYMA 2E64A 3RR6A 1YI2T 4HCBA 2HEQA 2LJ0A 4BDZA 3L2UA 3X25B 1IGUA 4LDUA 3H0HA 2BZXA 4F04B 1YJNQ 4QVZA 1I5OB 2DZCA 3QWYA 3G71Q 4J9EA 3CMAQ 4P5NA 2NUTB 3QXEB 4XTYA 5C6SA 2HBWA 3JAME 3OA6A 2MMPA 1NLOC 2GGRA 3ZBDA 4XTZA 3FJPA 2EQMA 1ZQ1A 1UHCA 2LX7A 2DL3A 1HK9A 2ROLA 2K2MA 2PQWA 4R55A 1C1AA 2VXFA 1BIAA 3OYEA 1VQ7A 1YHQQ 3VJPA 3OSVA 4A4GA 2GBQA 1RABB 1I07A 2J6FA 2Z0WA 4L6V5 3SD4A 3CC4T 5FRNA 1K73R 3CPFA 1FXXA 4ORZA 1LPLA 4M7DC 2GTJA 4EMHA 4Y91A 4N0AA 3CCUT 1RACB 2MIOA 2O01E 1Q81U 1AD5A 1OU9A 1I8FA 4IIMA 4M7AC 3EGDB 3UPUA 2XMFA 5IHNA 4KH0B 3FLGA 3OYKA 1SF9A 4PJOG 7AT1B 1QVPA 3NTHA 5CAIA 2CP2A 2EGEA 2IVWA 5GMKj 2O9VA 1K0SA 4KBMB 5D6WA 1KQSP 2EJ9A 4J9HA 1W70A 4M78D 4GLMA 5HK0A 2H8HA 2JTEA 1RAIB 2X4JA 1MHNA 3SFMA 5L8RE 2QK0A 2DYIA 3JCMe 2E6ZA 4M78A 4JPBW 4DOWA 2EQUA 1VQ8T 3JCMQ 3UT1A 5I2MA 2CUBA 4FIBA 5KCOA 4ZTFA 4KUIA 4C5IA 2ED1A 2ECZA 1WXBA 2X9HA 1ARKA 4OMFB 3SDZA 3OMCA 4C8QB 1SSFA 3FEOA 1N6AA 3PVLA 2CKKA 1VQMT 2ZCFB 1VQPQ 3M5AA 4PJOC 4JLGA 2KYMA 3S3NA 3A8OB 2K5LA 4XTVA 1M2VA 4C92F 2HL3A 3BY7A 2DRKA 1M2OA 1GCQC 2YUQA 3UA7A 3JB9J 1VQKT 4KGXB 4RTYA 8ATCB 3NMZC 2L89A 1JU5C 1XOVA 1T0JA 2BUDA 1IGQA 1I4K1 3NFCA 1Q82C 4LN2A 3M0UA 4M78F 1ZA2B 1V76A 1VQ9A 4J9IA 1B34A 3OB9A 3I56A 3SWNC 4M7DE 3EG0A 2G3RA 2CS7A 4C5HA 4FYVB 4M7AB 4M75F 4Q5WA 2A37A 3OW2P 3V8LA 4ME7A 5EC7A 4DBHA 1KC8R 4ELZC 4M7AA 4LDXA 1YIJQ 1TUDA 3GNFB 3JCMc 3MP1A 2VGMA 2COYA 2OAUA 1BCOA 1N5ZA 4XU1A 4MZTA 2RHXA 4IURA 2D0NA 1D09B 1UB4A 1U06A 2DA9A 2KYBA 2QDLA 4J7IA 1GXIE 4X9DA 2L8DA 1NYFA 1GCPA 1WX6A 3G6EQ 4JJCA 2LRQA 4C92E 1YJNT 1H641 3X26B 1IHVA 4J6YA 1EZZB 5DLQE 4F7UA 4Z89A 3CCQT 5GAOn 1RL2A 2DEUA 2QDYB 4J6XA 5DY9A 2JW4A 3UDCA 1Q95G 2DIQA 2LDMA 1ZUYA 2DKGA 3CCMQ 4M78C 3CCLQ 4DA4A 1Y96A 4R0KA 2QXFA 4BDYA 4ZTJA 2DVJA 3PE0A 3CXCP 4PJMA 3CC4Q 2B86A 2KROA 3INZA 4CI0C 5GAMj 1AEYA 2O88A 1UGVA 4JS5A 5GMKe 2M1HA 3H6ZA 1WXUA 2YUPA 3OYNA 1W2BS 2YXYA 4PLIA 3QDRB 2FZCB 2GCXA 5C0MA 2CP7A 4OB1B 1K9MU 4F7UF 1QVFP 4PJOD 1IB8A 3G6ET 4PJNA 1QP3A 1TUCA 2DEQA 3QWXX 1BB9A 1WDXA 1OOTA 1OPLA 2O4XA 1AWWA 2LJ1A 4GLKA 4M77C 3QYGB 4BB7A 3OYJA 1VQ4Q 4ZGJB 2WSFE 3QG1A 1D1CA 5L23A 3S3OA 2OTJT 1KD1R 1M4ZA 4IUQA 3CCMT 3CQTA 1DJ7B 2CZ6B 1M3CA 2XICA 3LGFA 1M8VA 1YN8A 5GAMg 4XTXA 4DBRA 1OV3A 4FW1A 3BFMA 2RK2A 3EGUA 2A36A 1K8AC 4LDWA 4ZN3A 3F70A 1B07A 3A98A 2FEIA 2RHIA 4GY5A 4XU0A 2KSSA 1N9RA 2DO3A 2YLBA 2L3PA 1RAHB 3ULRB 1D0XA 3CCVT 4M77G 1GCQA 3VUZA
chains in the Genus database with same CATH topology
1WHLA 4B6MA 1LPLA 2COWA 2CP2A 2HKNA 3E2UA 2E3HA 2MPXC 2E3IA 1TOVA 2COZA 3TQ7P 2CP5A 2COYA 2HL3A 2M02A 1WHJA 1WHKA 3RDVA 1WHHA 2CP7A 2HQHA 2QK0A 2CP6A 2E4HA 1TXQA 2HKQB 2HL5C 2CP0A 2CP3A 1IXDA 2Z0WA 1WHMA 1WHGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WHL A;  4B6M A;  1LPL A;  2COW A;  2CP2 A;  2HKN A;  3E2U A;  2E3H A;  2MPX C;  2E3I A;  1TOV A;  2COZ A;  3TQ7 P;  2CP5 A;  2COY A;  2HL3 A;  2M02 A;  1WHJ A;  1WHK A;  3RDV A;  1WHH A;  2CP7 A;  2HQH A;  2QK0 A;  2CP6 A;  2E4H A;  1TXQ A;  2HKQ B;  2HL5 C;  2CP0 A;  2CP3 A;  1IXD A;  2Z0W A;  1WHM A;  1WHG A; 
#chains in the Genus database with same CATH topology
 4E6R A;  3HP9 A;  2FHD A;  4E7S A;  2K2V A;  5LJ3 f;  1UGQ B;  5IHK A;  2RPN A;  1Y07 A;  1RLQ C;  4J83 A;  5IXF A;  3OW2 S;  2Y4X A;  2EQI A;  5GMK h;  4C8Q E;  5CQY A;  6AT1 B;  4Y92 A;  4JZ4 A;  3G4S T;  1YJ9 T;  1X6G A;  1HJD A;  3C12 A;  4F17 A;  3M0P A;  4AT1 B;  1N9S A;  3SWN B;  1YCS B;  3CPW A;  4FYW B;  4FM4 B;  2J6O A;  3M9Q A;  1IO6 A;  3UWN A;  2DFU A;  2YWW A;  2V8J A;  4C92 C;  4RG2 A;  3H0I A;  3TCJ A;  3CC2 A;  3QUI A;  1Q81 C;  1EFN A;  2DX1 A;  4A4K A;  1SKU B;  2RJD A;  3M56 A;  3QZ5 B;  1CKA A;  3LW5 E;  4EMK A;  2H3J A;  4M75 E;  4RMO A;  3DKM A;  2RNA A;  1I1J A;  3QJ6 A;  1O9S A;  2L2P A;  2A0F B;  1PWT A;  4M7D D;  1FYN A;  1NE8 A;  1M27 C;  5CCA A;  2L0A A;  1KFZ A;  1VQ6 A;  4D6W A;  2KAF A;  2HBP A;  2OJ2 A;  1YIT Q;  1KQ2 A;  2CH4 W;  1G3S A;  1X6O A;  2KI7 A;  4M78 G;  3CCQ Q;  4BE0 A;  2CDT A;  3LLR A;  1MNE A;  1YJN A;  5I11 A;  2XDB A;  4WCI A;  1VQL T;  1EIF A;  4HA8 A;  2LQN A;  2VB6 A;  1YP5 A;  3JB9 D;  5D6Y A;  3VYH B;  3ZEH A;  4J9F A;  2DF6 A;  4X34 A;  1E6G A;  4OB3 B;  5J26 A;  5FWC A;  2QYZ A;  1VOM A;  5KYY A;  3P8B B;  4XAX B;  1V1C A;  3OQ5 A;  3L2W A;  4IUV A;  1UE9 A;  2LTO A;  2RMO A;  2DIG A;  1AHJ B;  1KQS S;  2F5K A;  2QQS A;  4DOV A;  5I2S A;  2EYX A;  2L3R A;  3RNJ A;  5GMK i;  4HCC A;  1W4S A;  2XK0 A;  2JM9 A;  3QYH B;  2DRM A;  3GIB A;  3V7C A;  2LZ6 B;  1X75 C;  4FW2 A;  4RKU E;  1M90 C;  3FC3 A;  4JRP A;  2HNI A;  1RI9 A;  4O5V A;  4PLL A;  3VS4 A;  2COZ A;  4HT9 A;  1CSK A;  1WHH A;  2O9S A;  4HKE A;  4ZGD B;  3HKS A;  1SSH A;  2YUN A;  1OZ3 A;  2NWM A;  3HFO A;  1M90 U;  1VQN Q;  2V8K A;  1KD1 C;  2JMC A;  3MEW A;  1NBE B;  3CC4 A;  1W6X A;  3E1S A;  1JRI A;  2KY9 A;  2COW A;  1KD1 U;  1YFN A;  2ATC B;  2M0Y A;  4M75 B;  4HVU A;  1QW1 A;  5KE2 A;  2QA4 A;  5D7U A;  3MEA A;  2HMA A;  4OMO A;  2OX7 A;  2CP6 A;  4IUP A;  3S6W A;  2KBT A;  2XDP A;  4MMK A;  2RD1 A;  2O4X B;  2LT1 A;  2MWO A;  1NPR A;  2BTT A;  2DER A;  4XK8 E;  4MDW A;  1UJY A;  4LNP A;  1SEM A;  3BDU A;  2RHU A;  4E7J A;  3V7R A;  1G8X A;  2KQW A;  1MMD A;  1KHI A;  3MEU A;  1YJW T;  1OI1 A;  3LWI A;  3CCU Q;  4ANJ A;  2RM4 A;  1VQ4 A;  9ATC B;  2NUT A;  1K9M R;  4ZNX A;  3E19 A;  2QEX T;  4FT4 A;  2DMO A;  4MML A;  2F1L A;  2GQV A;  5IH2 A;  2I2L A;  2HAX A;  4PFP A;  4NOY A;  3CBM A;  3VS0 A;  1D0Y A;  1F1B B;  4ZGE B;  2M9U A;  1S72 A;  1QCN A;  2VAS A;  4F14 A;  2EQK A;  2X51 A;  3CCJ T;  1M3B A;  4JS4 A;  2AZV A;  4L5G A;  5I22 A;  4OGC A;  2ENM A;  2PTK A;  4C92 B;  5HCK A;  2EFI A;  3RKX A;  2XD0 A;  1S72 Q;  4N4I A;  3OYD A;  4ZN1 A;  3G4S Q;  1ABQ A;  3BW1 A;  3M54 A;  3CCE A;  1IZ6 A;  1OUL A;  5KH6 A;  4LUE A;  3T9N A;  2E1H A;  4CRI A;  5AT1 B;  3MP6 A;  1UEC A;  1LOJ A;  2X35 A;  2X4X A;  3EG1 A;  3R6O A;  2DXT A;  1SRL A;  3VS5 A;  1WZO A;  4M7D G;  3A8H B;  1BK2 A;  3KFV A;  2YUO A;  3ZL7 C;  2P0Q A;  1YIT T;  2MAM A;  5A0L A;  4VUB A;  2K57 A;  5FWB A;  1K73 U;  4Y28 E;  1OX9 A;  1ZSZ C;  4C92 D;  2GF7 A;  2LT4 A;  2JZ2 A;  5FU6 C;  2BZY A;  1WYX A;  4Z8A A;  4GBQ A;  1PRM C;  4DBQ A;  1U3O A;  5CIU A;  1YWP A;  2D6F A;  4OMM A;  4RTW A;  1VQN A;  2RF0 A;  2VUB A;  1VYT A;  1UHF A;  1VQP A;  2RJC A;  3CPW P;  4J9C A;  4FT2 A;  2E10 A;  2FL7 A;  3C0C A;  2KGT A;  2DL4 A;  2DLP A;  3LGL A;  1SRM A;  2O2O A;  2RO0 A;  4N4G A;  4BI3 A;  1YI2 Q;  2A3L A;  1YHQ T;  2JS2 A;  2LVM A;  1MMA A;  4BAC A;  2EGA A;  1KQS A;  2RQT A;  3G7Z A;  3KBG A;  2KXC A;  2BE7 D;  1UG1 A;  1PC0 A;  4BI8 B;  4KH1 B;  2R57 A;  2CSI A;  2LQK A;  1GL5 A;  1I5L A;  4OMN A;  4M7D A;  2EKH A;  3E9F A;  1K9M C;  1N8R R;  3U23 A;  2F5T X;  3PIO A;  1R0C B;  2DL7 A;  2K5I A;  5LJ5 f;  3JCM h;  5IXB A;  1VQ9 T;  4C5G A;  1FMV A;  5GAN 7;  2CGH A;  2P0K A;  4PNO A;  2EGC A;  3L2V A;  2V26 A;  3PGG A;  3HTR A;  2YRD A;  2SEM A;  3NGP A;  2JMA A;  1ZX6 A;  1XQH A;  2EJF A;  5GAN 6;  4LD6 A;  4RCC A;  4II1 A;  2JXB A;  1H3Z A;  4J9B A;  2CYZ B;  2RHZ A;  4N4H A;  1U1S A;  3EH2 A;  3QSU A;  2Y90 A;  4B9X A;  4R56 A;  4LE9 A;  2BZ8 A;  4EPC A;  4E7K A;  1TXQ A;  2HKQ B;  2CP3 A;  3PIP A;  3JB9 F;  4HVV A;  3OS0 A;  1QVF A;  2PVO B;  3BE3 A;  1YBY A;  2QQR A;  1WHL A;  4D8K A;  1BIB A;  2ZPH B;  5KYX A;  1M9S A;  1RAE B;  2V8I A;  2X3W D;  1QMC A;  4FYY B;  1R0B G;  8AT1 B;  1QLY A;  2JVV A;  1K76 A;  1XJW B;  3X28 B;  1VQ9 Q;  4EDU A;  4MZP A;  2C0O A;  1IXD A;  1D3B A;  4E7H A;  4F16 A;  3OYY A;  3ME9 A;  3CCR T;  2XU8 A;  3CBP A;  1NEB A;  4C92 G;  4A4E A;  5J39 A;  2JTM A;  2DL8 A;  1VYV A;  2FPF A;  1AOJ A;  4E7L A;  5KYW A;  3M4Y A;  4M4Z A;  2KR3 A;  1E6H A;  4RTU A;  3TQ7 P;  3EGD A;  2DYB A;  5GAN f;  2MPX C;  2E3I A;  1NYG A;  3MHX A;  3KXT A;  3JB9 G;  2XG8 D;  1YWO A;  3DLM A;  4AG2 C;  3CMA T;  5GAN j;  3I55 T;  2D8H A;  1WJQ A;  5GMK l;  3CCS Q;  2QTX A;  2EIF A;  4J5Y A;  3S3M A;  2YDL A;  5GAN 3;  1Q86 R;  1RUW A;  2L3S A;  1KQ1 A;  3JCM P;  4PL6 A;  5GAN 4;  3JCM b;  1YIT A;  2VVK A;  2XHC A;  4A53 A;  1MMN A;  4XQ3 A;  1BU1 A;  3OMG A;  3JCM V;  1NPP A;  5CKE A;  3TSW A;  2M02 A;  5LJ3 j;  4CC2 A;  3OS1 A;  2E70 A;  2RQR A;  3MET A;  3EG2 A;  3DB4 A;  2NLU A;  1UGR B;  2CT3 A;  3RKY A;  1VQM A;  4D8D A;  2DAQ A;  4PKC C;  4C8Q C;  2KVQ G;  4A4F A;  1BI3 A;  1VQ6 Q;  2WSE E;  4LXC A;  4AG1 C;  1X6B A;  4PJO B;  3WVD B;  4M7A D;  1SG5 A;  3I55 A;  4M77 B;  4AFQ C;  2AKK A;  2LNH B;  2KRN A;  3M55 A;  3C94 A;  4X1V A;  4M7D B;  5GAN 5;  2K5F A;  3OYG A;  4JRK A;  1OQK A;  3HSB A;  4XU3 A;  1D1A A;  2GFU A;  1AWJ A;  1R77 A;  3FRN A;  5IHI A;  1Z9Z A;  3CD6 Q;  2M16 A;  3PFS A;  5KYU A;  4PJL A;  3JCM J;  1M1K R;  1X69 A;  2K4Y A;  2K7A A;  1NJI U;  3CCL T;  2RB6 A;  2NUP A;  1AZE A;  3EHQ A;  3CCS A;  3CC2 T;  1JB0 E;  1HXD A;  1M2V B;  1TSF A;  4OF1 A;  3JCM d;  2R58 A;  3OYC A;  1NG2 A;  2HKN A;  3E2U A;  1VQ7 Q;  3CBO A;  2HD0 A;  1TH7 A;  3TU4 K;  1D1B A;  5FU7 B;  2EW3 A;  1WA7 A;  3CC7 Q;  1VQP T;  2PNI A;  3CCM A;  1HD3 A;  2AKL A;  3THK A;  1B7T A;  3GF5 A;  2DD4 A;  2FZK B;  3Q1J A;  3CXC A;  1M90 R;  3MJX A;  4C8Q D;  1ZBX A;  2P0P A;  1D0Z A;  3LH0 A;  2PZ1 A;  2DJZ A;  3HRU A;  1PD0 A;  3EGX B;  3R6N A;  3CCJ A;  2HQX A;  3H9N A;  1IRE B;  1QVF S;  1Q82 R;  1WI7 A;  4JLI A;  5GJV B;  4MDX A;  1NLP C;  3QZ9 B;  1KJW A;  3L2Z A;  1Y96 B;  3SB2 A;  1QWF A;  2D9T A;  2DXU A;  4M75 A;  1M1G A;  2DJQ A;  1WLP B;  4OMP A;  3EFO B;  1CKB A;  2JNG A;  1W2B P;  2E65 A;  5KYX B;  3VUB A;  2PVG B;  2VGN A;  1OPK A;  1Y0M A;  4M75 D;  1N27 A;  2E4H A;  1QCO A;  4JRQ A;  1X2Q A;  2FRW A;  2FB7 A;  4DEY A;  2J06 A;  4OGE A;  2E6N A;  3A5Z B;  2RK1 A;  2KRM A;  2RQU A;  3MKD A;  3I35 A;  3PT9 A;  1HSQ A;  4KRT A;  4LD9 K;  3RER A;  2PVD B;  3JCM g;  3GP8 A;  2DVE A;  4FU6 A;  1GBQ A;  4RCB A;  4TVR A;  3OW2 A;  4CC3 A;  1UUE A;  2CP0 A;  1BI1 A;  3FB9 A;  2J6K A;  2ABL A;  2NUZ A;  4KT0 E;  5GAO m;  2AZS A;  3HHT B;  3WVE B;  4J6W A;  2XI9 A;  3H41 A;  4QVC A;  2JN0 A;  1Q7Y R;  3HFN A;  1Y71 A;  2EJG A;  3TVT A;  1WHK A;  4QQD A;  5CKB A;  2W10 A;  3P8H A;  1UGS B;  1VQ8 Q;  1X27 A;  1YNZ A;  3A8M B;  3AHU A;  4KUL A;  2KXD A;  3G4S A;  3JB9 H;  3PMT A;  3I9Q A;  2YLC A;  1N8R U;  1KHC A;  3CME A;  1TWB A;  4PK4 A;  4PJO A;  2ZPF B;  2F69 A;  3JRZ A;  3M58 A;  2DK3 A;  3TSZ A;  1SPK A;  4X9C A;  1T3L A;  1VQO A;  2GQI A;  2P4T A;  3ER0 A;  2DTO A;  2P84 A;  4JZ3 A;  3L1A A;  2LQW A;  5GAM d;  4HXJ A;  2ZPI B;  3PTA A;  2EYZ A;  5A2Q E;  2VV5 A;  1JJ2 S;  3REB B;  2GFA A;  2RQV A;  4OB0 B;  3H0F A;  5KCH A;  3OYH A;  4KUD K;  5GAN e;  3RMS A;  3X24 B;  2HL5 C;  1BCM A;  2LCS A;  1S72 T;  2QI2 A;  4PJO E;  1Y57 A;  1VQ6 T;  2FYK A;  2K3B A;  1VYU A;  3C95 A;  2NUP B;  2X3X D;  4OB2 B;  3L2Q A;  2FPD A;  4BI4 A;  4AMC A;  3SHW A;  4C8Q F;  1M1K U;  4JJD A;  4FSS A;  1UEB A;  2KK4 A;  4CC4 B;  1KC8 C;  1Q86 U;  4J7F A;  1RAD B;  2AIR B;  2DBK A;  5LJ3 d;  2ZPB B;  1ZA1 B;  2ZZD A;  1IRX A;  3LX7 A;  2W0Z A;  5KYU B;  1ZBJ A;  5GMK m;  4B9W A;  1ZSG A;  1G3T A;  1C0M A;  3SWN A;  1VQO T;  2YT6 A;  2CZ7 B;  4OML A;  5GAM h;  3FIF A;  5FU7 C;  2Y4Y A;  3CCV Q;  2YRC A;  1H8K A;  4RUG A;  3GPL A;  1M3A A;  1ZUK A;  3QKJ A;  2MF2 A;  2QG9 B;  2K3X A;  1HYO A;  1K0X A;  1NZ9 A;  3O8V A;  4WF2 A;  2E12 A;  4OVA A;  1GFD A;  3HPW A;  1H92 A;  4BD3 A;  3QBY A;  1N8R C;  5CKH A;  2DE0 X;  2EVR A;  1LJO A;  1WQ7 A;  2AK5 A;  1JXM A;  3RUX A;  5DLO A;  1Q7Y C;  3EG9 A;  1BI2 A;  2VKN A;  1AZG B;  1K1Z A;  1ZHI A;  2JM8 A;  2C0I A;  2P4R A;  2LJ3 A;  3RMQ A;  3VYG A;  2JJ9 A;  1G3W A;  3QPH A;  2DZ9 A;  1H3H A;  5J3B A;  2A7Y A;  4C0G A;  2J05 A;  3RIR A;  4IKF A;  3CCS T;  3A8L B;  3HL8 A;  4KGV B;  1PSF A;  1JJ2 P;  1U1T A;  3VS3 A;  1RAF B;  3ZFJ A;  3EAE A;  3OYI A;  2QAS A;  4A54 A;  1LCK A;  2E41 A;  4LDY A;  4M77 E;  2FRY A;  2DIL A;  1ZLM A;  3RES A;  2ZAE A;  5FU6 B;  3VS6 A;  3C4S A;  3CCE Q;  4BY6 B;  2L3Q A;  1VQK Q;  4M7D F;  3CCJ Q;  3JSC A;  1YCY A;  3QHS A;  5CVI A;  1BI0 A;  1TOV A;  1GBR A;  4NS5 A;  1OEB A;  3CCV A;  2OAW A;  2BIV A;  5LJ3 e;  1T0H A;  3REA B;  3G6E A;  1XTD A;  1PKT A;  2ROT A;  4AFS C;  4QVD A;  3EHR A;  2LNV A;  4AFU C;  3RKW A;  2QA4 T;  2LP5 A;  2PU9 B;  2D0Q B;  1JO8 A;  1Q82 U;  2G6F X;  3WXM B;  2J7I A;  1EX4 A;  2A28 A;  1K8A R;  2ZPG B;  3JV3 A;  1JXO A;  4C0D B;  1VQ5 A;  2QQ9 A;  4J9G A;  1G3Y A;  5FW9 A;  2LMJ A;  3L42 A;  3X20 B;  1D3B B;  1MND A;  4BUG A;  2BE9 B;  2BKD N;  1MV0 B;  2KEA A;  2QAZ A;  4QQ6 A;  1MUZ A;  3NPF A;  3CCQ A;  1QVG S;  3NTK A;  1QCF A;  1QKX A;  3P8D A;  3NTI A;  4O6J A;  2E5K A;  3I56 T;  1XNI A;  3OBY A;  3I5R A;  3GNG A;  1ACM B;  4DQ2 A;  3OS2 A;  4NL3 A;  1UDL A;  4LDV A;  4M7A E;  4BE1 A;  4HCK A;  3OYA A;  2YSQ A;  1E7O A;  1JBM A;  1TG0 A;  1JJ2 A;  3EG3 A;  1M1F A;  3RDV A;  2GNC A;  3KUF A;  2PUO B;  3V7S A;  1BBZ A;  4JJB A;  1PD1 A;  1WJS A;  3GLX A;  2B8A A;  3CME Q;  2MI6 A;  4N0A C;  3L2R A;  4MZM A;  3CCR A;  2L5Q A;  1X2K A;  1PRL C;  2VC8 A;  3LYI A;  2HSE B;  4BY6 C;  2X4W A;  3CXC S;  1G83 A;  2XDD A;  5LJ3 h;  4M77 A;  3TEE A;  4C5E A;  4RTX A;  1WGS A;  1YJW A;  1J3T A;  1QQJ A;  2CSQ A;  5CKD A;  2DET A;  1PCX A;  3LWH A;  2K9G A;  2ED0 A;  1VIF A;  5HY6 A;  3VU3 C;  5CO7 A;  3URG A;  5GAN g;  2QEX A;  5LJ5 e;  1LNX A;  1JEG A;  3ASK A;  5CR2 A;  4EMK C;  2OTJ A;  1YHQ A;  2DTI A;  1IHW A;  1VQO Q;  2JUF A;  5LJ5 j;  5IAY A;  2R5M A;  3MEV A;  4E7I A;  2E5Q A;  1QVG P;  2AT1 B;  1OYX A;  4XU2 A;  2EBP A;  4Z02 A;  5GAM f;  3FJ5 A;  2OTJ Q;  5AYF A;  4IIO A;  2KRS A;  3UF4 A;  4M7A G;  2ZPE B;  1VQL A;  2RJE A;  1GFC A;  3SEM A;  3A1P A;  1OZ2 A;  1GRI A;  4E7Z A;  5I21 A;  2IIM A;  1AWO A;  3JCM W;  2HQH A;  4C8Q G;  4PFZ A;  1K4U S;  1NEG A;  2DXB A;  3IQL A;  3VV0 A;  3GOX A;  2FVU A;  5GAO p;  2VWF A;  2DL5 A;  2SRC A;  4EMK B;  3N5B B;  1A0N B;  2XKO C;  2M51 A;  2RI2 A;  1LVK A;  1B34 B;  4E47 A;  1M30 A;  5KYY B;  1RAG B;  2RN8 A;  2CP5 A;  1PNJ A;  2DXC A;  3M0R A;  5DM7 R;  1MV3 A;  1YJ9 A;  2EWN A;  5FRM A;  4FCY A;  5HKC A;  1FMK A;  2OI3 A;  2RI5 A;  1P92 A;  1MGQ A;  4PJJ A;  3MP8 A;  2PUK B;  1ABO A;  3J7A F;  2EQJ A;  1WHG A;  5GAN 8;  3OY9 A;  1RAA B;  1VQ5 Q;  2HZY A;  1YJ9 Q;  4QW2 A;  2F2W A;  2FPE A;  4C0Z A;  5M9O A;  1AVZ C;  4QT7 A;  2ZGW A;  1WJR A;  4V2S A;  4EMG A;  3A8G B;  2IG0 A;  1Q7Y U;  1PM3 A;  3OS5 A;  1X01 A;  3EFR A;  4QKU A;  3CC7 A;  1U5S A;  2YRV A;  3I55 Q;  1VUB A;  4RTZ A;  2KDS A;  3CPW S;  1K8A U;  1KG1 A;  5GAO l;  2CUD A;  5ECA A;  3V8J A;  4JRI A;  3EFO A;  3O5Z A;  2C06 A;  3G71 A;  3M0Q A;  5CQX A;  5IN1 A;  2MOX A;  3M53 A;  2QA4 Q;  3J81 E;  3QDF A;  2MCN A;  1WFW A;  3CD6 A;  5D6X A;  3UAT A;  5GAO r;  1W1F A;  2OTL Q;  4FYX B;  3EH1 A;  1WQW A;  2CH4 A;  4RTV A;  1YJW Q;  1BYM A;  4OMQ A;  4ATO A;  2ESW A;  1WHJ A;  3OYL A;  1KC8 U;  2K3Y A;  2VXE A;  2RHY A;  3EGX A;  4ELY C;  3DB3 A;  1VIE A;  4PFO A;  5GJW B;  5GAN 2;  4AFZ C;  2OTL A;  2QGF B;  2YHT A;  4M75 C;  3NHN A;  4WTO B;  4NL2 A;  2DPP B;  2QTV A;  1YIJ A;  2HCK A;  1FWZ A;  3M59 A;  4XTW A;  1WNL A;  4B6M A;  3OSS C;  4M75 G;  4QQG A;  2HDA A;  1W2B A;  3VS2 A;  1TUG B;  5LJ5 g;  4J9D A;  2KE9 A;  1FMW A;  1Y7X A;  1BKB A;  1UGP B;  1TU0 B;  3BDL A;  3D7S B;  5KYW B;  4BE2 A;  2JOY A;  1SHG A;  2FG0 A;  1OX8 A;  2DBM A;  5LL6 S;  5IT9 E;  1TS9 A;  1Z9Q A;  1UFF A;  2E3H A;  2RA2 A;  4M78 E;  1OU8 A;  2AHJ B;  5A0D A;  4LUD A;  4HT8 A;  3QJY A;  2DTH A;  2OTL T;  4RG8 A;  1VQ7 T;  2XID A;  1QVG A;  2EYW A;  4M78 B;  2RH2 A;  1FX7 A;  4E2F B;  2F2V A;  1G2B A;  2IPO B;  4UC4 A;  2RI3 A;  3HRT A;  5FLX E;  3GBQ A;  4IUT A;  2V1R A;  3CCU A;  2A08 A;  3JB9 I;  1NJI R;  2CT4 A;  1K9A A;  4FL6 A;  4OP0 A;  2LCL A;  4CC7 A;  5GAN d;  3OYF A;  2KT1 A;  3M4G A;  3CCR Q;  4C92 A;  2R5A A;  1Q81 R;  2K6D A;  4M77 D;  1K73 C;  2CZ0 B;  2EYQ A;  1QKW A;  3LH5 A;  1PKS A;  3PMI A;  5A0G A;  1U8R A;  1VQN T;  1VA7 A;  5KE3 A;  2EYY A;  1KK7 A;  3CMA A;  2CZ1 B;  4F7U G;  2RQW A;  4Z88 A;  1JQQ A;  2HSP A;  5CK9 A;  3E9G A;  3OYB A;  4C0F A;  2NYS A;  4JDS A;  3VKI A;  1PSE A;  3FDR A;  2JTF A;  2MK5 A;  4FSX A;  4HVW A;  3EG9 B;  4PJO F;  1ZSZ B;  4M77 F;  1VQ8 A;  3I5S A;  1X43 A;  3MO8 A;  1YI2 A;  4C0D C;  3AT1 B;  1V29 B;  2DM1 A;  5GAN h;  4C8Q A;  1VQM Q;  3JCM X;  1Q86 C;  2WAC A;  2QEX Q;  1VQ5 T;  1RI0 A;  2QGG A;  4ESR A;  3M57 A;  4YTL A;  3VS1 A;  5EG2 A;  1TTH B;  2JT4 A;  4RTT A;  1PG5 B;  2GTO A;  5CKF A;  3I56 Q;  4HCZ A;  1SHF A;  1AWX A;  4EIK A;  2LX9 A;  4KGZ B;  2LCC A;  5LJ3 g;  3VS7 A;  1KIK A;  3MCA B;  1AT1 B;  2H3E B;  3HRS A;  1O75 A;  2EPD A;  4XTU A;  3V8K A;  2RJF A;  1C6V X;  4J8O A;  3QO3 A;  2D8J A;  2O31 A;  2MYS A;  1VQL Q;  2LQ8 A;  3CEY A;  4JUV A;  4F7U E;  3M0S A;  5LJ5 d;  1ZSZ A;  5KYN A;  1VQK A;  2VYT A;  3PVQ A;  3QII A;  1VQ4 T;  3TRE A;  1WPY A;  4JJN K;  2X4Y A;  2DNU A;  1WIE A;  4F7U B;  2C0T A;  1I81 A;  3JCM f;  3G71 T;  1KSW A;  3CME T;  1RLP C;  1QP2 A;  2HQE A;  2EKO A;  2LC4 A;  3CCL A;  2EAY A;  3UA6 A;  5GAO q;  2I0N A;  4K11 A;  3CD6 T;  1NM7 A;  2MWP A;  3DLL A;  2M0O A;  1WHM A;  5HK3 A;  2WSC E;  1PHT A;  3OBW A;  4L59 A;  3VRY A;  1R8O B;  3M0T A;  1NJI C;  1UTI A;  2D1X A;  1QWE A;  1UJ0 A;  3H8Z A;  2CRE A;  4A4H A;  4A63 B;  3EFS A;  3PNW C;  3CC2 Q;  1M1K C;  2FZG B;  2KT8 A;  2QQB A;  1WXT A;  3CCE T;  4M7A F;  1S1N A;  1M8M A;  3G1J A;  5LJ5 h;  1M5Q 1;  4DBF A;  1T3S A;  2V1Q A;  3RBB B;  1YIJ T;  4DEX A;  2JS0 A;  1B3Q A;  2K79 A;  2DD5 A;  3CC7 T;  5FRO A;  4IUU A;  1G5V A;  1MMG A;  5GAM e;  3J80 E;  2FO0 A;  1ZUU A;  1I0C A;  3MPU B;  2KNB B;  2F2X A;  3VRZ A;  2KMT A;  2QQA A;  3OYM A;  2E64 A;  3RR6 A;  1YI2 T;  4HCB A;  2HEQ A;  2LJ0 A;  4BDZ A;  3L2U A;  3X25 B;  1IGU A;  4LDU A;  3H0H A;  2BZX A;  4F04 B;  1YJN Q;  4QVZ A;  1I5O B;  2DZC A;  3QWY A;  3G71 Q;  4J9E A;  3CMA Q;  4P5N A;  2NUT B;  3QXE B;  4XTY A;  5C6S A;  2HBW A;  3JAM E;  3OA6 A;  2MMP A;  1NLO C;  2GGR A;  3ZBD A;  4XTZ A;  3FJP A;  2EQM A;  1ZQ1 A;  1UHC A;  2LX7 A;  2DL3 A;  1HK9 A;  2ROL A;  2K2M A;  2PQW A;  4R55 A;  1C1A A;  2VXF A;  1BIA A;  3OYE A;  1VQ7 A;  1YHQ Q;  3VJP A;  3OSV A;  4A4G A;  2GBQ A;  1RAB B;  1I07 A;  2J6F A;  2Z0W A;  4L6V 5;  3SD4 A;  3CC4 T;  5FRN A;  1K73 R;  3CPF A;  1FXX A;  4ORZ A;  1LPL A;  4M7D C;  2GTJ A;  4EMH A;  4Y91 A;  4N0A A;  3CCU T;  1RAC B;  2MIO A;  2O01 E;  1Q81 U;  1AD5 A;  1OU9 A;  1I8F A;  4IIM A;  4M7A C;  3EGD B;  3UPU A;  2XMF A;  5IHN A;  4KH0 B;  3FLG A;  3OYK A;  1SF9 A;  4PJO G;  7AT1 B;  1QVP A;  3NTH A;  5CAI A;  2CP2 A;  2EGE A;  2IVW A;  5GMK j;  2O9V A;  1K0S A;  4KBM B;  5D6W A;  1KQS P;  2EJ9 A;  4J9H A;  1W70 A;  4M78 D;  4GLM A;  5HK0 A;  2H8H A;  2JTE A;  1RAI B;  2X4J A;  1MHN A;  3SFM A;  5L8R E;  2QK0 A;  2DYI A;  3JCM e;  2E6Z A;  4M78 A;  4JPB W;  4DOW A;  2EQU A;  1VQ8 T;  3JCM Q;  3UT1 A;  5I2M A;  2CUB A;  4FIB A;  5KCO A;  4ZTF A;  4KUI A;  4C5I A;  2ED1 A;  2ECZ A;  1WXB A;  2X9H A;  1ARK A;  4OMF B;  3SDZ A;  3OMC A;  4C8Q B;  1SSF A;  3FEO A;  1N6A A;  3PVL A;  2CKK A;  1VQM T;  2ZCF B;  1VQP Q;  3M5A A;  4PJO C;  4JLG A;  2KYM A;  3S3N A;  3A8O B;  2K5L A;  4XTV A;  1M2V A;  4C92 F;  2HL3 A;  3BY7 A;  2DRK A;  1M2O A;  1GCQ C;  2YUQ A;  3UA7 A;  3JB9 J;  1VQK T;  4KGX B;  4RTY A;  8ATC B;  3NMZ C;  2L89 A;  1JU5 C;  1XOV A;  1T0J A;  2BUD A;  1IGQ A;  1I4K 1;  3NFC A;  1Q82 C;  4LN2 A;  3M0U A;  4M78 F;  1ZA2 B;  1V76 A;  1VQ9 A;  4J9I A;  1B34 A;  3OB9 A;  3I56 A;  3SWN C;  4M7D E;  3EG0 A;  2G3R A;  2CS7 A;  4C5H A;  4FYV B;  4M7A B;  4M75 F;  4Q5W A;  2A37 A;  3OW2 P;  3V8L A;  4ME7 A;  5EC7 A;  4DBH A;  1KC8 R;  4ELZ C;  4M7A A;  4LDX A;  1YIJ Q;  1TUD A;  3GNF B;  3JCM c;  3MP1 A;  2VGM A;  2COY A;  2OAU A;  1BCO A;  1N5Z A;  4XU1 A;  4MZT A;  2RHX A;  4IUR A;  2D0N A;  1D09 B;  1UB4 A;  1U06 A;  2DA9 A;  2KYB A;  2QDL A;  4J7I A;  1GXI E;  4X9D A;  2L8D A;  1NYF A;  1GCP A;  1WX6 A;  3G6E Q;  4JJC A;  2LRQ A;  4C92 E;  1YJN T;  1H64 1;  3X26 B;  1IHV A;  4J6Y A;  1EZZ B;  5DLQ E;  4F7U A;  4Z89 A;  3CCQ T;  5GAO n;  1RL2 A;  2DEU A;  2QDY B;  4J6X A;  5DY9 A;  2JW4 A;  3UDC A;  1Q95 G;  2DIQ A;  2LDM A;  1ZUY A;  2DKG A;  3CCM Q;  4M78 C;  3CCL Q;  4DA4 A;  1Y96 A;  4R0K A;  2QXF A;  4BDY A;  4ZTJ A;  2DVJ A;  3PE0 A;  3CXC P;  4PJM A;  3CC4 Q;  2B86 A;  2KRO A;  3INZ A;  4CI0 C;  5GAM j;  1AEY A;  2O88 A;  1UGV A;  4JS5 A;  5GMK e;  2M1H A;  3H6Z A;  1WXU A;  2YUP A;  3OYN A;  1W2B S;  2YXY A;  4PLI A;  3QDR B;  2FZC B;  2GCX A;  5C0M A;  2CP7 A;  4OB1 B;  1K9M U;  4F7U F;  1QVF P;  4PJO D;  1IB8 A;  3G6E T;  4PJN A;  1QP3 A;  1TUC A;  2DEQ A;  3QWX X;  1BB9 A;  1WDX A;  1OOT A;  1OPL A;  2O4X A;  1AWW A;  2LJ1 A;  4GLK A;  4M77 C;  3QYG B;  4BB7 A;  3OYJ A;  1VQ4 Q;  4ZGJ B;  2WSF E;  3QG1 A;  1D1C A;  5L23 A;  3S3O A;  2OTJ T;  1KD1 R;  1M4Z A;  4IUQ A;  3CCM T;  3CQT A;  1DJ7 B;  2CZ6 B;  1M3C A;  2XIC A;  3LGF A;  1M8V A;  1YN8 A;  5GAM g;  4XTX A;  4DBR A;  1OV3 A;  4FW1 A;  3BFM A;  2RK2 A;  3EGU A;  2A36 A;  1K8A C;  4LDW A;  4ZN3 A;  3F70 A;  1B07 A;  3A98 A;  2FEI A;  2RHI A;  4GY5 A;  4XU0 A;  2KSS A;  1N9R A;  2DO3 A;  2YLB A;  2L3P A;  1RAH B;  3ULR B;  1D0X A;  3CCV T;  4M77 G;  1GCQ A;  3VUZ A; 
#chains in the Genus database with same CATH homology
 1WHL A;  4B6M A;  1LPL A;  2COW A;  2CP2 A;  2HKN A;  3E2U A;  2E3H A;  2MPX C;  2E3I A;  1TOV A;  2COZ A;  3TQ7 P;  2CP5 A;  2COY A;  2HL3 A;  2M02 A;  1WHJ A;  1WHK A;  3RDV A;  1WHH A;  2CP7 A;  2HQH A;  2QK0 A;  2CP6 A;  2E4H A;  1TXQ A;  2HKQ B;  2HL5 C;  2CP0 A;  2CP3 A;  1IXD A;  2Z0W A;  1WHM A;  1WHG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...