1WHKA

Solution structure of the 3rd cap-gly domain in mouse 1700024k14rik hypothetical protein
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
91
structure length
91
Chain Sequence
b'GSSGSSGEGTVKLHEGSQVLLTSSNEMATVRYVGPTDFASGIWLGLELRSAKGKNDGAVGDKRYFTCKPNYGVLVRPSRVTYRGISGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIKEN cDNA 1700024K14
publication title Solution structure of the 3rd CAP-Gly domain in mouse 1700024K14Rik hypothetical protein
rcsb
source organism Mus musculus
molecule tags Structural genomics, unknown function
total genus 4
structure length 91
sequence length 91
ec nomenclature
pdb deposition date 2004-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01302 CAP_GLY CAP-Gly domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.190 Mainly Beta Roll SH3 type barrels. CAP Gly-rich-like domain 1whkA00
2HL5C 2HQHA 2CP6A 2CP7A 2COZA 2CP2A 4B6MA 2E3IA 2COYA 2E4HA 2M02A 1WHHA 3TQ7P 2HKNA 2MPXC 1TOVA 2Z0WA 1WHJA 1WHMA 2QK0A 2HKQB 1WHLA 2CP0A 1WHGA 2E3HA 2COWA 1TXQA 3RDVA 1WHKA 1IXDA 2HL3A 1LPLA 3E2UA 2CP5A 2CP3A
chains in the Genus database with same CATH superfamily
1S72Q 1JQQA 4L5GA 3CCSQ 1XNIA 1NJIU 3JB9G 3A5ZB 3PT9A 2KSSA 4ME7A 3I56Q 4Z02A 3VYHB 4DBHA 4MMLA 4M78E 2MWPA 3LLRA 3R6OA 2JTMA 2HKQB 3QO3A 1YP5A 2FZCB 2DL8A 3RDVA 1VQNA 3X24B 2XHCA 1M1FA 1PSEA 1FMKA 2X9HA 4RTYA 2HQHA 2LJ3A 3ULRB 1RAHB 5GANe 1KFZA 1C0MA 3M55A 1VQNT 1RAEB 1MMGA 1W70A 2E6NA 3JRZA 4GY5A 3CMET 3G71Q 2PQWA 5GMKm 3N5BB 3U23A 3BE3A 2QQAA 1RUWA 1KQSP 4R55A 3RUXA 3ZEHA 5GMKe 4MMKA 2ENMA 5FU6C 4A4GA 3SWNA 1MGQA 3KUFA 3PVQA 3CC2A 2X4JA 4PJMA 3X25B 3QJ6A 2DVEA 2F69A 5GAOq 1OI1A 4HVUA 1JEGA 5CKDA 1K8AC 2YLBA 2DVJA 2QI2A 5IAYA 2HL5C 3ZFJA 1H8KA 2FPEA 2WSEE 3EFOB 3I55Q 4KGXB 1AHJB 4PJLA 3JCMe 3CCMQ 1BI0A 3CCJQ 4FSSA 2ZPFB 2A3LA 3SHWA 4E7SA 2CH4W 1VQ7T 1ZLMA 4LDVA 2P4RA 2R5MA 2X4XA 4NOYA 3TU4K 3I5RA 5D6WA 4M7AF 1VQ5A 1HXDA 5GANj 1YCYA 4CC3A 1R77A 2FRYA 1Y7XA 2IVWA 2LJ0A 1JBMA 1U8RA 2YDLA 3TQ7P 1X6BA 3C95A 2YUOA 4R56A 1VQ5T 1OV3A 2QTXA 2QGGA 4Z89A 1UGPB 4F7UF 2XIDA 1WNLA 1EIFA 2I0NA 4HT8A 3URGA 3J81E 2K2VA 2RHIA 3FLGA 2RQRA 3BW1A 1JJ2S 5LL6S 3CCQA 1TUCA 3EHQA 2LCSA 1M1KC 2EIFA 2DE0X 5HCKA 3CD6T 3OYEA 4JJDA 2EYQA 1YHQA 1FMVA 3CPFA 2LP5A 2KROA 1KC8U 2DEQA 1YITT 1I0CA 3EG0A 1D3BA 2HQEA 4XTUA 4F7UB 1K9AA 3CCRT 2VB6A 3FC3A 1H92A 1AWOA 1YHQT 1QQJA 2L3RA 2DIQA 3CBPA 4OMPA 4OB3B 2AIRB 3KBGA 4BY6C 2HKNA 1ZSZC 3QDRB 5D6YA 3SB2A 5IH2A 3GBQA 2M9UA 3SFMA 2R5AA 2FEIA 1AZEA 1O75A 3OYKA 5GAN6 3UPUA 2EVRA 8ATCB 2EBPA 5KH6A 5EC7A 4OB1B 4C92G 1K76A 4RTUA 2IG0A 5GJWB 1AZGB 4XTXA 4FT2A 4ELYC 2AKKA 2EJGA 2YHTA 4C8QD 2NUPA 3JB9D 4X1VA 4FW2A 1X43A 3WVEB 4A63B 2ZCFB 1VYTA 2LQWA 5FROA 1G2BA 1R0CB 1K8AU 4DBQA 2DBKA 4ZGDB 1JB0E 3QYGB 1T0JA 1OU9A 1VQKA 2QDYB 1WHJA 4C8QE 1OPKA 3LWIA 1N8RU 4ELZC 1UGQB 5GANh 3V8KA 1GXIE 3RERA 2RM4A 2FRWA 4ORZA 5LJ5f 3MEWA 2E12A 1OULA 4AG2C 2RQUA 1TU0B 4FU6A 2QA4T 4M7AC 3VS2A 1KD1R 2RK2A 1VQLA 5GMKh 2DTHA 2LVMA 2PUKB 2KE9A 3INZA 1YJWA 2RK1A 4JJCA 1Y07A 1Q82C 1M2OA 2CP3A 2OJ2A 3NPFA 3CCEQ 3M58A 3HSBA 4M78A 4HCBA 1VQLT 2VUBA 2YRVA 2JJ9A 3Q1JA 5LJ5g 1WYXA 2VWFA 3V7RA 1JO8A 2DIGA 5FU7C 3TSZA 3CCVQ 1YN8A 2QQSA 1QP3A 2RQTA 2F5KA 4V2SA 1W1FA 4FL6A 5KE2A 2RHZA 3JCMh 2FHDA 3M4YA 1VQMA 4J7IA 4J9EA 5IN1A 3RR6A 3FIFA 4B9XA 5LJ3j 2A08A 2MIOA 2MPXC 2DXTA 1NG2A 4FYYB 4JJBA 3GPLA 3JCMW 3UT1A 3P8DA 1TWBA 1A0NB 1VQMT 3G4SA 1OYXA 1TXQA 1WHKA 4OMLA 1KHIA 2KAFA 3CCMA 1NLOC 1JJ2A 1SEMA 4DEYA 2DMOA 4D6WA 3HKSA 4LUEA 1WQ7A 2E6ZA 4PFOA 3CC4A 1H3HA 2KXDA 1VYVA 4M77G 4IIMA 2K3YA 2KEAA 3G6EA 1BI3A 3EHRA 1ZUUA 1Y0MA 3MEAA 2O9VA 3CC4T 4EDUA 2AZSA 1N5ZA 3ZBDA 4M78G 3HL8A 3CCUT 3GLXA 1OQKA 1TUDA 4F17A 2J6OA 3OBYA 4BE0A 4A53A 1RAFB 4AFSC 3PIOA 3QIIA 1VQNQ 2DTOA 1ABOA 2B8AA 3CMEQ 2DL5A 1W4SA 1RABB 2E70A 2L3QA 2CZ1B 2XKOC 2V1QA 2LT4A 4CRIA 1YJ9T 2NWMA 4X9DA 4FSXA 3QZ9B 4EMKC 5GAN2 1QVGP 3THKA 1R0BG 3OYDA 3VRZA 3NMZC 2RI2A 3GIBA 2GFUA 4C0ZA 3ME9A 2JUFA 4C92D 4KT0E 2QQ9A 1Y96B 3R6NA 3CC2Q 5KYXB 2RHXA 4J6XA 1OX8A 3CC7A 1X01A 2XMFA 3OS5A 2OX7A 1SSHA 2EQKA 3V8LA 4VUBA 2L3SA 1KQ1A 2DPPB 4DEXA 2QK0A 4F16A 3G1JA 1AD5A 2I2LA 2MOXA 4PJOF 1D1AA 3CC7T 1M9SA 2E3HA 2L3PA 2EQMA 1SKUB 3CEYA 2EJ9A 1VQ7Q 2DA9A 4Y92A 5LJ3h 4EPCA 2E1HA 1KD1U 2DJZA 1M5Q1 1UE9A 4C0FA 1RAIB 1HSQA 3JB9J 2DKGA 4JRQA 2HDAA 1RLPC 2D8HA 4XU0A 4WTOB 1MNEA 3MP6A 3QZ5B 3JB9H 5KYYB 4Y28E 4ATOA 1X6OA 1Q95G 2VXEA 1GL5A 2BZXA 1WXTA 2RQVA 1VQ5Q 3H0IA 1ARKA 2MK5A 3RMQA 2DERA 2QQRA 4OMNA 2J05A 2E5QA 2XICA 2VKNA 2XK0A 2XI9A 4GLMA 4HXJA 3OW2S 3RKXA 4KUDK 3CD6Q 3OMGA 5CR2A 1KSWA 2EQIA 2XD0A 3S3NA 4M7DC 1YITQ 2CZ6B 4BUGA 4LDYA 1Q81C 3M0UA 3CCRQ 1U1TA 3JCMV 2NUZA 1UEBA 1YHQQ 4C8QA 2HSPA 3NTKA 2BIVA 1VA7A 3I9QA 2HEQA 3X26B 1U06A 2RI3A 4OMMA 4QQDA 3M53A 2MAMA 4JUVA 2R57A 5AYFA 4XU1A 2JW4A 3EFSA 5C6SA 1ZSGA 1ZUKA 5GMKl 2K7AA 4RMOA 2O88A 1ZBJA 2QTVA 1QMCA 1GBQA 3RMSA 1RADB 1WJRA 3QJYA 4R0KA 2HMAA 5GAMf 3RIRA 5GAOm 4E7JA 1I4K1 1VIEA 2FL7A 1QCNA 1N9RA 4LDXA 4M77D 1IHWA 1TSFA 2QQBA 3H9NA 2HBWA 2A28A 1UTIA 2VVKA 3QDFA 4ZGJB 2IPOB 3SD4A 1WLPB 3FB9A 1KC8R 3E9FA 3J7AF 1UUEA 3EG3A 2Z0WA 4PK4A 4M78D 2J6FA 3QPHA 2ROTA 5AT1B 3S3MA 3CQTA 5GAMg 1M3BA 3FRNA 2X35A 4PJOC 2GBQA 2D6FA 3RESA 2OAWA 4OMQA 2JM8A 4C8QG 4JS4A 1VQKQ 1IRXA 1WX6A 2JMAA 3ASKA 4M7AE 5HK0A 2QA4Q 3OW2P 1K9MC 2RH2A 1NBEB 1OZ3A 1M90C 2KY9A 2F5TX 5ECAA 4C92B 1PNJA 4QVZA 2KK4A 1GCQC 2XDBA 2DZCA 4M75C 2Y4YA 5IHIA 3S6WA 2D0QB 3REBB 3JCMc 4ZGEB 4NL2A 1VQLQ 3CMEA 3VU3C 3OBWA 1UGVA 2O9SA 3MJXA 1YJWQ 1G8XA 1AWJA 2RN8A 2X4YA 1K8AR 4IUPA 2ZPHB 2ED1A 1G83A 1T3LA 2X4WA 2XU8A 3E2UA 1WJQA 4BE1A 3NTHA 1RACB 1BYMA 1N8RR 2KR3A 1B3QA 1D3BB 4EMHA 2L89A 4EIKA 4ZN3A 2XG8D 2GGRA 2K2MA 3CMAA 1VQMQ 4LUDA 3PTAA 4OP0A 3SWNC 4BB7A 1Y71A 4HCKA 2YWWA 1AWWA 1NYGA 1IGUA 1PD1A 2YLCA 5L23A 1Q86U 2EYWA 4MZMA 3CMAT 4J7FA 4GBQA 3GF5A 1YFNA 5GAN3 2HQXA 2AZVA 2CP2A 4HCCA 3OW2A 2KRNA 1G3SA 2O31A 3G4SQ 1VQ7A 2E4HA 2CS7A 4RCCA 1PKTA 4OGCA 3ZL7C 5M9OA 3PNWC 2KMTA 2EQUA 3CC4Q 2V26A 3MCAB 1QWEA 2LQ8A 1LJOA 4HVWA 3CCUQ 2NUPB 3G6EQ 9ATCB 3QKJA 1PRLC 4IUUA 4PL6A 2K3XA 4C92A 2ZGWA 2FYKA 2RNAA 4OF1A 2DD5A 2M51A 2RQWA 3EG9B 2HAXA 2GCXA 3CD6A 1Q7YC 1YJ9Q 3QYHB 3GP8A 1IZ6A 5GMKi 2FO0A 2RJDA 1YITA 2GQVA 3OS2A 2YXYA 3CCRA 3MEVA 3NFCA 1N9SA 2ED0A 1K9MU 3CCLA 4MDXA 1OOTA 4M77B 1CKAA 1QCOA 1U5SA 3M0SA 1EZZB 1M90U 1I5LA 1F1BB 3M9QA 1D09B 4IUVA 1E6HA 5FLXE 4DQ2A 1RAGB 1N6AA 3A8MB 1VQPA 3JB9I 1ZUYA 3PFSA 3CCLT 1TG0A 3L2ZA 4KUIA 4M78B 1MMNA 3VS1A 4O5VA 1W2BS 3AHUA 1H641 1NZ9A 1W6XA 4BI8B 3CC7Q 5FWBA 4RTXA 3P8BB 3VS5A 4MZTA 1VQPT 4ZN1A 4QVCA 3H6ZA 2JXBA 4A4KA 1I1JA 1M30A 2C0IA 1VYUA 1ZSZA 5LJ5d 3META 2L0AA 1VQ8A 2VC8A 1C1AA 2KDSA 1VQOA 2K5IA 1KQ2A 5CIUA 4FM4B 1M8VA 2YRDA 1AT1B 3OYAA 1Z9ZA 5CVIA 5GAN4 2LT1A 1VQ8T 1VQOT 1NEBA 1PWTA 2NYSA 1ZA1B 1D1BA 4WCIA 5LJ3e 3EG9A 2C0TA 4LD9K 3G7ZA 3L2RA 1ZHIA 1Q82R 2FZGB 4FYXB 3WXMB 2JTFA 2QA4A 5KYNA 4C5EA 2MWOA 1UECA 2QASA 4PLLA 4M7DE 2FPDA 5D6XA 3UDCA 4JS5A 4F04B 1K73C 2E65A 1TS9A 1MV0B 2YSQA 4FCYA 1JJ2P 2LNVA 4JRIA 4J83A 2BKDN 5D7UA 2MF2A 1HK9A 2M0YA 3UATA 5KE3A 3JV3A 4M77A 2VV5A 3JCMX 4XTWA 3F70A 4J9BA 4OMFB 1LVKA 1NE8A 2LMJA 1UDLA 4PNOA 2FG0A 2M1HA 3I5SA 4JRPA 3OSVA 3EAEA 4Z8AA 4N0AC 3I56T 1UB4A 1TH7A 2DXUA 2CGHA 1YI2T 3MKDA 1Q7YU 1NLPC 1JXMA 2J06A 1VQ6T 5GAOn 3M57A 4E7ZA 2EQJA 2VYTA 5IHNA 2PVOB 3OYBA 2HD0A 1WHGA 1RL2A 4A4EA 5KCOA 5GAN8 2VXFA 1M1KU 1NPRA 3QWXX 2CUBA 2JT4A 2KRSA 4B6MA 3QXEB 2CSIA 3C12A 2YUQA 4DOVA 2FPFA 5DM7R 4J6YA 3JAME 3QHSA 2CYZB 3T9NA 3G71T 1XJWB 1FMWA 1D0ZA 4E7IA 2F2VA 1UHFA 4PJOE 3GNFB 4M75D 2F2WA 1M3AA 2DAQA 2DL3A 3VS4A 2K5LA 5CCAA 2C06A 1WHHA 3CCUA 3VV0A 3VKIA 3KFVA 4KH1B 4C0DB 1VQ4T 5A2QE 1D1CA 1B34A 2ATCB 3CBMA 3RNJA 4KRTA 1B07A 4LD6A 2AKLA 4UC4A 4M7AG 1JRIA 1IO6A 4M75E 3OY9A 2KI7A 2RD1A 3M4GA 1FX7A 2RJEA 2RB6A 1QWFA 4C8QF 2ZPGB 1W2BA 1SSFA 2AT1B 2WSFE 1SPKA 4JPBW 3JB9F 3CCJT 1E6GA 1YJ9A 2JN0A 4XTYA 1WHLA 2V8KA 6AT1B 3EG1A 1IB8A 5HY6A 2P4TA 3FEOA 3A1PA 1MMDA 3KXTA 2DLPA 5GANf 3CXCS 2CZ7B 2JZ2A 2QG9B 4J9DA 1K73U 4N4HA 4C8QB 1XOVA 2ECZA 4FIBA 1WHMA 7AT1B 1M27C 2DYIA 2KBTA 3D7SB 3I35A 3JCMd 4J9IA 1Y57A 3CBOA 2MI6A 2CREA 3CMAQ 2G6FX 3C94A 1JXOA 1Q82U 2HBPA 5FRMA 4HKEA 5A0GA 4ZNXA 3M54A 4D8DA 3M0PA 2CDTA 5GANg 4EMGA 1C6VX 1ZQ1A 4RTTA 3WVDB 2DYBA 2OI3A 5GAOl 1NYFA 1XQHA 2GNCA 3QBYA 4FYWB 2QEXA 1OU8A 1WI7A 4CC2A 4HT9A 2KRMA 2LCLA 4NS5A 2B86A 3MPUB 4J8OA 1YIJA 3C0CA 2HCKA 1QW1A 5IT9E 3JCMf 2QEXT 3OYLA 1B7TA 5C0MA 1X2QA 1E7OA 5IXFA 1NJIC 2OAUA 1V29B 1QKXA 2EKOA 1YIJT 2NUTA 4RTVA 4QW2A 2EPDA 4KH0B 2VGMA 1QVPA 4IIOA 3VS3A 1WPYA 4QVDA 1WXBA 2O01E 3OA6A 3CPWS 3UA7A 1Q86R 3QUIA 4RG2A 3V7SA 2DX1A 2V8IA 4TVRA 1ABQA 4AFQC 3JCMg 3IQLA 5GAMd 5KYUB 2M16A 1PHTA 4C5HA 3FDRA 4OGEA 2RF0A 3TEEA 1VIFA 2PNIA 5J39A 3A98A 3PIPA 3CCLQ 3H41A 3RKWA 2ZPEB 2DNUA 3A8OB 4M7DA 2EGAA 2ZZDA 2K4YA 1VQPQ 3C4SA 2PVGB 1YWPA 3HRUA 2A37A 1M4ZA 1BI1A 1LOJA 3NTIA 5CQYA 2RHYA 1SF9A 2OTJA 1AWXA 2DF6A 1NM7A 2RJFA 2X3WD 2KT1A 5I21A 4IUTA 4KULA 1VQ9A 3QSUA 3OB9A 1BIAA 2D9TA 3VYGA 1BB9A 1GRIA 1U1SA 3H0FA 2OTJT 1N27A 1VQ9T 1BK2A 3AT1B 2JVVA 3LH5A 2E64A 1K9MR 1VQ8Q 3GNGA 5FU6B 4B9WA 1VQOQ 2KYMA 5GJVB 2DJQA 2PTKA 4Y91A 1M90R 1DJ7B 4C5IA 3MHXA 4M7AD 4C92F 1OX9A 3BDUA 3LGLA 2L5QA 5DY9A 3LGFA 1PRMC 3L2VA 5LJ5j 5J26A 5IXBA 3CXCA 4LXCA 3NHNA 2PVDB 2ZPIB 4QQ6A 2GF7A 1RLQC 1M3CA 5LJ3f 1K1ZA 1M2VB 2JNGA 2ZAEA 4M7DG 5I2MA 1KK7A 2P0KA 5EG2A 4PJOA 1OZ2A 4J9FA 1M1GA 2AHJB 3EGXA 5FRNA 1BCOA 3HRTA 1BKBA 5KYUA 4M4ZA 2PZ1A 4XQ3A 4O6JA 2DL4A 4PJNA 1ZA2B 2LRQA 5DLQE 5GAN7 4F7UE 4N4GA 1YI2Q 5I11A 2HNIA 1GCQA 1SRLA 1YNZA 4M75A 5J3BA 3OS0A 1PD0A 1VQ6Q 1KC8C 1RI9A 2V1RA 3HTRA 5CO7A 5LJ3g 1H3ZA 1WFWA 2EGCA 2HL3A 3OMCA 5CKBA 1Z9QA 3TREA 4DA4A 4J9HA 2RMOA 1WZOA 1V1CA 4AMCA 2LQNA 1UGSB 4J5YA 4XK8E 4F14A 1BCMA 3EH2A 1Q81U 2EYZA 2DD4A 1TOVA 1PG5B 1PKSA 2W10A 4XTZA 2EYXA 2JS2A 4L6V5 3A8LB 3EGDA 1G3WA 2K79A 1RI0A 3MEUA 2YT6A 2RO0A 2EFIA 3TSWA 3CPWA 2E3IA 4BY6B 1BU1A 1QCFA 3MO8A 4PJOG 1ZSZB 1UGRB 3M0QA 1VQ4Q 2O2OA 4LDWA 2K57A 2JMCA 2LQKA 2R58A 1Q7YR 1BBZA 2K3BA 2NLUA 4N4IA 4E6RA 2H3EB 1G3TA 3CC2T 1M8MA 2GTOA 2EWNA 1M2VA 3LW5E 1YWOA 2LZ6B 4DBFA 4E2FB 1N8RC 2SEMA 1QLYA 4M75G 3HPWA 2FVUA 1MUZA 1M1KR 4JRKA 1PC0A 3QWYA 5LJ5h 4OB2B 4M77F 4RUGA 1YBYA 4NL3A 2GTJA 4C92C 4Z88A 3ER0A 2CUDA 1IXDA 4BDYA 2F1LA 2EYYA 3EFRA 1UFFA 2J7IA 4JJNK 1WGSA 4M78F 2RI5A 2FZKB 3BFMA 4JLGA 2MMPA 2LC4A 3O8VA 3OQ5A 4L59A 1GFDA 4E7HA 1PCXA 1KQSA 5GMKj 2E5KA 1WJSA 2DL7A 4M7AB 2L8DA 3NGPA 4DBRA 3H0HA 3PMIA 1EFNA 1YJNA 2D0NA 2YUPA 1MNDA 1SG5A 3CCQT 1I8FA 3VS0A 4PJJA 1GBRA 2P0QA 2GFAA 4RCBA 3VS6A 2A7YA 1YJNT 2D8JA 4LDUA 3REAB 1KIKA 5FU7B 2QEXQ 4BI3A 5GAMe 4XU3A 3PGGA 2DRMA 3VRYA 1WA7A 2EW3A 2LTOA 2VASA 1IREB 3M0RA 1YIJQ 3EFOA 2BE7D 1K73R 2KQWA 4RG8A 1FYNA 1V76A 4BI4A 4WF2A 4M7DD 2RHUA 4YTLA 1RAAB 4XU2A 3FJPA 3O5ZA 2EAYA 1R8OB 1NEGA 2V8JA 4C0GA 3M5AA 3DB4A 2OTLA 3OYYA 2CP0A 3HHTB 1B34B 1CSKA 4PFZA 2CP7A 4OB0B 4BDZA 1X75C 2DXBA 2OTLT 1CKBA 2CT4A 5CQXA 3EH1A 1S72A 3CCSA 3PVLA 2DFUA 3JCMQ 2KYBA 4PLIA 1QP2A 3I56A 3E19A 1YI2A 4LE9A 2BUDA 2BZYA 4M77C 2QGFB 1VQ6A 3OYJA 4M7AA 4RTZA 4QQGA 3VUBA 3J80E 1S72T 1VQKT 3CCST 3OSSC 5GAOp 2DZ9A 2H8HA 5CKHA 2GQIA 2CH4A 4BE2A 5GAMj 4M78C 2XDDA 2A36A 1W2BP 4CI0C 2BE9B 4F7UA 4QKUA 3LX7A 2HSEB 2OTJQ 1P92A 4AT1B 1SHGA 3X20B 4N0AA 4E7LA 1VQ9Q 3E9GA 2LJ1A 3G71A 4PJOD 1TUGB 2LX7A 1LNXA 4AG1C 4EMKB 2CKKA 4HA8A 2QXFA 2W0ZA 1EX4A 1YJWT 2COYA 1QVGS 2BZ8A 1IHVA 3PE0A 1KG1A 1KD1C 5I2SA 1KJWA 5IHKA 3L42A 1VOMA 4PKCC 1QVFS 3DKMA 3L2UA 4FYVB 4A4FA 3HFOA 1VQ4A 2ABLA 2C0OA 2COZA 3PMTA 1MV3A 3DLLA 2DEUA 3OYCA 4JDSA 3H8ZA 4LN2A 4ZTJA 3OYGA 4KGZB 5GANd 1J3TA 3I55A 2JOYA 2RJCA 2O4XB 2CSQA 1KHCA 1HJDA 3UWNA 4KGVB 3CCJA 1BI2A 2NUTB 1TTHB 4J9CA 3I55T 3G4ST 1K4US 4C5GA 2KT8A 1HD3A 4LNPA 2DTIA 3CCMT 1S1NA 4OMOA 4F7UG 4M7DF 4X34A 2LCCA 2COWA 4IURA 1VUBA 2WSCE 2DILA 3MP8A 4HVVA 3G6ET 1GFCA 4HCZA 1BIBA 4PFPA 2PUOB 2KVQG 4IKFA 3LWHA 2DK3A 1UG1A 3HRSA 5GAOr 2M0OA 4E47A 3OYNA 3OYIA 1X6GA 2K9GA 3RKYA 1SRMA 2JM9A 2ROLA 3E1SA 4XAXB 4M7DB 4X9CA 1WXUA 3L1AA 4EMKA 5KYWB 5GAMh 4RTWA 4J9GA 3JCMP 2KXCA 4A54A 2A0FB 3BY7A 1JU5C 1SHFA 2M02A 2DO3A 4OVAA 5CK9A 3V7CA 4BD3A 1HYOA 2BTTA 1PSFA 2DRKA 1G3YA 1AOJA 1ZX6A 2YUNA 1NJIR 1QVFP 1I81A 3JCMJ 2WACA 2Y4XA 2CP5A 2KNBB 1T0HA 1WQWA 2SRCA 1I07A 5FWCA 5A0LA 4JZ3A 2ESWA 4Q5WA 4KBMB 1ACMB 1X27A 3BDLA 4AFUC 4MZPA 2VGNA 2E41A 2O4XA 5GAN5 4C0DC 2JTEA 4ANJA 3VUZA 4C92E 1K0XA 2AK5A 2DBMA 4JLIA 2G3RA 2L2PA 1Q81R 4ZTFA 4A4HA 2YRCA 1QKWA 1FXXA 3UA6A 3OYMA 4K11A 5L8RE 2LDMA 3FJ5A 2E10A 4JZ4A 5DLOA 4M75F 2JS0A 3P8HA 1XTDA 1K0SA 2EJFA 1UJ0A 2QAZA 3MP1A 4DOWA 2MCNA 3V8JA 4PJOB 3EGXB 3OS1A 3M59A 3OYFA 2CT3A 2K6DA 4RKUE 5LJ5e 3A8HB 2HZYA 3CXCP 5FW9A 3LYIA 1LCKA 1QVGA 2ZPBB 1FWZA 2LX9A 3L2QA 1UJYA 3LH0A 1MHNA 2MYSA 2RPNA 3A8GB 1IGQA 4J6WA 1OPLA 4QT7A 1QVFA 4ESRA 4C8QC 2DXCA 3X28B 5CKEA 3HP9A 4M75B 5KYWA 3TVTA 2H3JA 2Y90A 3JSCA 3CCQQ 2P84A 2DETA 5HKCA 2CZ0B 2X3XD 3QG1A 3RBBB 4FT4A 2EKHA 1WIEA 1X2KA 4GLKA 1WDXA 4CC4B 1O9SA 4CC7A 2EGEA 1YJNQ 1X69A 5HK3A 3CCEA 3DB3A 3GOXA 2K5FA 2XDPA 2KGTA 3EGUA 1Q86C 5CAIA 4AFZC 4FW1A 1Y96A 2QDLA 5KYXA 3SDZA 1ZBXA 5LJ3d 5A0DA 1G5VA 3OYHA 1OEBA 4P5NA 3CCET 3CCVA 2P0PA 4E7KA 1GCPA 3EG2A 1D0YA 4II1A 3EGDB 1KQSS 3M0TA 2IIMA 1UHCA 1AEYA 1MMAA 2PU9B 5KCHA 3JCMb 3SEMA 3CCVT 3SWNB 2FB7A 4XTVA 5I22A 2F2XA 2LNHB 2QYZA 3VS7A 2RA2A 3DLMA 1LPLA 3UF4A 4BACA 2J6KA 2CP6A 4IUQA 5KYYA 1NPPA 4MDWA 1T3SA 1YCSB 2OTLQ 3TCJA 2D1XA 1AVZC 5CKFA 3CPWP 3M56A 3L2WA 1U3OA 2X51A 1D0XA 4D8KA 8AT1B 1I5OB 3S3OA 3VJPA 2DM1A 4M77E 1PM3A 3HFNA
chains in the Genus database with same CATH topology
2HL5C 2HQHA 2CP6A 2CP7A 2COZA 2CP2A 4B6MA 2E3IA 2COYA 2E4HA 2M02A 1WHHA 3TQ7P 2HKNA 2MPXC 1TOVA 2Z0WA 1WHJA 1WHMA 2QK0A 2HKQB 1WHLA 2CP0A 1WHGA 2E3HA 2COWA 1TXQA 3RDVA 1WHKA 1IXDA 2HL3A 1LPLA 3E2UA 2CP5A 2CP3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HL5 C;  2HQH A;  2CP6 A;  2CP7 A;  2COZ A;  2CP2 A;  4B6M A;  2E3I A;  2COY A;  2E4H A;  2M02 A;  1WHH A;  3TQ7 P;  2HKN A;  2MPX C;  1TOV A;  2Z0W A;  1WHJ A;  1WHM A;  2QK0 A;  2HKQ B;  1WHL A;  2CP0 A;  1WHG A;  2E3H A;  2COW A;  1TXQ A;  3RDV A;  1WHK A;  1IXD A;  2HL3 A;  1LPL A;  3E2U A;  2CP5 A;  2CP3 A; 
#chains in the Genus database with same CATH topology
 1S72 Q;  1JQQ A;  4L5G A;  3CCS Q;  1XNI A;  1NJI U;  3JB9 G;  3A5Z B;  3PT9 A;  2KSS A;  4ME7 A;  3I56 Q;  4Z02 A;  3VYH B;  4DBH A;  4MML A;  4M78 E;  2MWP A;  3LLR A;  3R6O A;  2JTM A;  2HKQ B;  3QO3 A;  1YP5 A;  2FZC B;  2DL8 A;  3RDV A;  1VQN A;  3X24 B;  2XHC A;  1M1F A;  1PSE A;  1FMK A;  2X9H A;  4RTY A;  2HQH A;  2LJ3 A;  3ULR B;  1RAH B;  5GAN e;  1KFZ A;  1C0M A;  3M55 A;  1VQN T;  1RAE B;  1MMG A;  1W70 A;  2E6N A;  3JRZ A;  4GY5 A;  3CME T;  3G71 Q;  2PQW A;  5GMK m;  3N5B B;  3U23 A;  3BE3 A;  2QQA A;  1RUW A;  1KQS P;  4R55 A;  3RUX A;  3ZEH A;  5GMK e;  4MMK A;  2ENM A;  5FU6 C;  4A4G A;  3SWN A;  1MGQ A;  3KUF A;  3PVQ A;  3CC2 A;  2X4J A;  4PJM A;  3X25 B;  3QJ6 A;  2DVE A;  2F69 A;  5GAO q;  1OI1 A;  4HVU A;  1JEG A;  5CKD A;  1K8A C;  2YLB A;  2DVJ A;  2QI2 A;  5IAY A;  2HL5 C;  3ZFJ A;  1H8K A;  2FPE A;  2WSE E;  3EFO B;  3I55 Q;  4KGX B;  1AHJ B;  4PJL A;  3JCM e;  3CCM Q;  1BI0 A;  3CCJ Q;  4FSS A;  2ZPF B;  2A3L A;  3SHW A;  4E7S A;  2CH4 W;  1VQ7 T;  1ZLM A;  4LDV A;  2P4R A;  2R5M A;  2X4X A;  4NOY A;  3TU4 K;  3I5R A;  5D6W A;  4M7A F;  1VQ5 A;  1HXD A;  5GAN j;  1YCY A;  4CC3 A;  1R77 A;  2FRY A;  1Y7X A;  2IVW A;  2LJ0 A;  1JBM A;  1U8R A;  2YDL A;  3TQ7 P;  1X6B A;  3C95 A;  2YUO A;  4R56 A;  1VQ5 T;  1OV3 A;  2QTX A;  2QGG A;  4Z89 A;  1UGP B;  4F7U F;  2XID A;  1WNL A;  1EIF A;  2I0N A;  4HT8 A;  3URG A;  3J81 E;  2K2V A;  2RHI A;  3FLG A;  2RQR A;  3BW1 A;  1JJ2 S;  5LL6 S;  3CCQ A;  1TUC A;  3EHQ A;  2LCS A;  1M1K C;  2EIF A;  2DE0 X;  5HCK A;  3CD6 T;  3OYE A;  4JJD A;  2EYQ A;  1YHQ A;  1FMV A;  3CPF A;  2LP5 A;  2KRO A;  1KC8 U;  2DEQ A;  1YIT T;  1I0C A;  3EG0 A;  1D3B A;  2HQE A;  4XTU A;  4F7U B;  1K9A A;  3CCR T;  2VB6 A;  3FC3 A;  1H92 A;  1AWO A;  1YHQ T;  1QQJ A;  2L3R A;  2DIQ A;  3CBP A;  4OMP A;  4OB3 B;  2AIR B;  3KBG A;  4BY6 C;  2HKN A;  1ZSZ C;  3QDR B;  5D6Y A;  3SB2 A;  5IH2 A;  3GBQ A;  2M9U A;  3SFM A;  2R5A A;  2FEI A;  1AZE A;  1O75 A;  3OYK A;  5GAN 6;  3UPU A;  2EVR A;  8ATC B;  2EBP A;  5KH6 A;  5EC7 A;  4OB1 B;  4C92 G;  1K76 A;  4RTU A;  2IG0 A;  5GJW B;  1AZG B;  4XTX A;  4FT2 A;  4ELY C;  2AKK A;  2EJG A;  2YHT A;  4C8Q D;  2NUP A;  3JB9 D;  4X1V A;  4FW2 A;  1X43 A;  3WVE B;  4A63 B;  2ZCF B;  1VYT A;  2LQW A;  5FRO A;  1G2B A;  1R0C B;  1K8A U;  4DBQ A;  2DBK A;  4ZGD B;  1JB0 E;  3QYG B;  1T0J A;  1OU9 A;  1VQK A;  2QDY B;  1WHJ A;  4C8Q E;  1OPK A;  3LWI A;  1N8R U;  4ELZ C;  1UGQ B;  5GAN h;  3V8K A;  1GXI E;  3RER A;  2RM4 A;  2FRW A;  4ORZ A;  5LJ5 f;  3MEW A;  2E12 A;  1OUL A;  4AG2 C;  2RQU A;  1TU0 B;  4FU6 A;  2QA4 T;  4M7A C;  3VS2 A;  1KD1 R;  2RK2 A;  1VQL A;  5GMK h;  2DTH A;  2LVM A;  2PUK B;  2KE9 A;  3INZ A;  1YJW A;  2RK1 A;  4JJC A;  1Y07 A;  1Q82 C;  1M2O A;  2CP3 A;  2OJ2 A;  3NPF A;  3CCE Q;  3M58 A;  3HSB A;  4M78 A;  4HCB A;  1VQL T;  2VUB A;  2YRV A;  2JJ9 A;  3Q1J A;  5LJ5 g;  1WYX A;  2VWF A;  3V7R A;  1JO8 A;  2DIG A;  5FU7 C;  3TSZ A;  3CCV Q;  1YN8 A;  2QQS A;  1QP3 A;  2RQT A;  2F5K A;  4V2S A;  1W1F A;  4FL6 A;  5KE2 A;  2RHZ A;  3JCM h;  2FHD A;  3M4Y A;  1VQM A;  4J7I A;  4J9E A;  5IN1 A;  3RR6 A;  3FIF A;  4B9X A;  5LJ3 j;  2A08 A;  2MIO A;  2MPX C;  2DXT A;  1NG2 A;  4FYY B;  4JJB A;  3GPL A;  3JCM W;  3UT1 A;  3P8D A;  1TWB A;  1A0N B;  1VQM T;  3G4S A;  1OYX A;  1TXQ A;  1WHK A;  4OML A;  1KHI A;  2KAF A;  3CCM A;  1NLO C;  1JJ2 A;  1SEM A;  4DEY A;  2DMO A;  4D6W A;  3HKS A;  4LUE A;  1WQ7 A;  2E6Z A;  4PFO A;  3CC4 A;  1H3H A;  2KXD A;  1VYV A;  4M77 G;  4IIM A;  2K3Y A;  2KEA A;  3G6E A;  1BI3 A;  3EHR A;  1ZUU A;  1Y0M A;  3MEA A;  2O9V A;  3CC4 T;  4EDU A;  2AZS A;  1N5Z A;  3ZBD A;  4M78 G;  3HL8 A;  3CCU T;  3GLX A;  1OQK A;  1TUD A;  4F17 A;  2J6O A;  3OBY A;  4BE0 A;  4A53 A;  1RAF B;  4AFS C;  3PIO A;  3QII A;  1VQN Q;  2DTO A;  1ABO A;  2B8A A;  3CME Q;  2DL5 A;  1W4S A;  1RAB B;  2E70 A;  2L3Q A;  2CZ1 B;  2XKO C;  2V1Q A;  2LT4 A;  4CRI A;  1YJ9 T;  2NWM A;  4X9D A;  4FSX A;  3QZ9 B;  4EMK C;  5GAN 2;  1QVG P;  3THK A;  1R0B G;  3OYD A;  3VRZ A;  3NMZ C;  2RI2 A;  3GIB A;  2GFU A;  4C0Z A;  3ME9 A;  2JUF A;  4C92 D;  4KT0 E;  2QQ9 A;  1Y96 B;  3R6N A;  3CC2 Q;  5KYX B;  2RHX A;  4J6X A;  1OX8 A;  3CC7 A;  1X01 A;  2XMF A;  3OS5 A;  2OX7 A;  1SSH A;  2EQK A;  3V8L A;  4VUB A;  2L3S A;  1KQ1 A;  2DPP B;  4DEX A;  2QK0 A;  4F16 A;  3G1J A;  1AD5 A;  2I2L A;  2MOX A;  4PJO F;  1D1A A;  3CC7 T;  1M9S A;  2E3H A;  2L3P A;  2EQM A;  1SKU B;  3CEY A;  2EJ9 A;  1VQ7 Q;  2DA9 A;  4Y92 A;  5LJ3 h;  4EPC A;  2E1H A;  1KD1 U;  2DJZ A;  1M5Q 1;  1UE9 A;  4C0F A;  1RAI B;  1HSQ A;  3JB9 J;  2DKG A;  4JRQ A;  2HDA A;  1RLP C;  2D8H A;  4XU0 A;  4WTO B;  1MNE A;  3MP6 A;  3QZ5 B;  3JB9 H;  5KYY B;  4Y28 E;  4ATO A;  1X6O A;  1Q95 G;  2VXE A;  1GL5 A;  2BZX A;  1WXT A;  2RQV A;  1VQ5 Q;  3H0I A;  1ARK A;  2MK5 A;  3RMQ A;  2DER A;  2QQR A;  4OMN A;  2J05 A;  2E5Q A;  2XIC A;  2VKN A;  2XK0 A;  2XI9 A;  4GLM A;  4HXJ A;  3OW2 S;  3RKX A;  4KUD K;  3CD6 Q;  3OMG A;  5CR2 A;  1KSW A;  2EQI A;  2XD0 A;  3S3N A;  4M7D C;  1YIT Q;  2CZ6 B;  4BUG A;  4LDY A;  1Q81 C;  3M0U A;  3CCR Q;  1U1T A;  3JCM V;  2NUZ A;  1UEB A;  1YHQ Q;  4C8Q A;  2HSP A;  3NTK A;  2BIV A;  1VA7 A;  3I9Q A;  2HEQ A;  3X26 B;  1U06 A;  2RI3 A;  4OMM A;  4QQD A;  3M53 A;  2MAM A;  4JUV A;  2R57 A;  5AYF A;  4XU1 A;  2JW4 A;  3EFS A;  5C6S A;  1ZSG A;  1ZUK A;  5GMK l;  2K7A A;  4RMO A;  2O88 A;  1ZBJ A;  2QTV A;  1QMC A;  1GBQ A;  3RMS A;  1RAD B;  1WJR A;  3QJY A;  4R0K A;  2HMA A;  5GAM f;  3RIR A;  5GAO m;  4E7J A;  1I4K 1;  1VIE A;  2FL7 A;  1QCN A;  1N9R A;  4LDX A;  4M77 D;  1IHW A;  1TSF A;  2QQB A;  3H9N A;  2HBW A;  2A28 A;  1UTI A;  2VVK A;  3QDF A;  4ZGJ B;  2IPO B;  3SD4 A;  1WLP B;  3FB9 A;  1KC8 R;  3E9F A;  3J7A F;  1UUE A;  3EG3 A;  2Z0W A;  4PK4 A;  4M78 D;  2J6F A;  3QPH A;  2ROT A;  5AT1 B;  3S3M A;  3CQT A;  5GAM g;  1M3B A;  3FRN A;  2X35 A;  4PJO C;  2GBQ A;  2D6F A;  3RES A;  2OAW A;  4OMQ A;  2JM8 A;  4C8Q G;  4JS4 A;  1VQK Q;  1IRX A;  1WX6 A;  2JMA A;  3ASK A;  4M7A E;  5HK0 A;  2QA4 Q;  3OW2 P;  1K9M C;  2RH2 A;  1NBE B;  1OZ3 A;  1M90 C;  2KY9 A;  2F5T X;  5ECA A;  4C92 B;  1PNJ A;  4QVZ A;  2KK4 A;  1GCQ C;  2XDB A;  2DZC A;  4M75 C;  2Y4Y A;  5IHI A;  3S6W A;  2D0Q B;  3REB B;  3JCM c;  4ZGE B;  4NL2 A;  1VQL Q;  3CME A;  3VU3 C;  3OBW A;  1UGV A;  2O9S A;  3MJX A;  1YJW Q;  1G8X A;  1AWJ A;  2RN8 A;  2X4Y A;  1K8A R;  4IUP A;  2ZPH B;  2ED1 A;  1G83 A;  1T3L A;  2X4W A;  2XU8 A;  3E2U A;  1WJQ A;  4BE1 A;  3NTH A;  1RAC B;  1BYM A;  1N8R R;  2KR3 A;  1B3Q A;  1D3B B;  4EMH A;  2L89 A;  4EIK A;  4ZN3 A;  2XG8 D;  2GGR A;  2K2M A;  3CMA A;  1VQM Q;  4LUD A;  3PTA A;  4OP0 A;  3SWN C;  4BB7 A;  1Y71 A;  4HCK A;  2YWW A;  1AWW A;  1NYG A;  1IGU A;  1PD1 A;  2YLC A;  5L23 A;  1Q86 U;  2EYW A;  4MZM A;  3CMA T;  4J7F A;  4GBQ A;  3GF5 A;  1YFN A;  5GAN 3;  2HQX A;  2AZV A;  2CP2 A;  4HCC A;  3OW2 A;  2KRN A;  1G3S A;  2O31 A;  3G4S Q;  1VQ7 A;  2E4H A;  2CS7 A;  4RCC A;  1PKT A;  4OGC A;  3ZL7 C;  5M9O A;  3PNW C;  2KMT A;  2EQU A;  3CC4 Q;  2V26 A;  3MCA B;  1QWE A;  2LQ8 A;  1LJO A;  4HVW A;  3CCU Q;  2NUP B;  3G6E Q;  9ATC B;  3QKJ A;  1PRL C;  4IUU A;  4PL6 A;  2K3X A;  4C92 A;  2ZGW A;  2FYK A;  2RNA A;  4OF1 A;  2DD5 A;  2M51 A;  2RQW A;  3EG9 B;  2HAX A;  2GCX A;  3CD6 A;  1Q7Y C;  1YJ9 Q;  3QYH B;  3GP8 A;  1IZ6 A;  5GMK i;  2FO0 A;  2RJD A;  1YIT A;  2GQV A;  3OS2 A;  2YXY A;  3CCR A;  3MEV A;  3NFC A;  1N9S A;  2ED0 A;  1K9M U;  3CCL A;  4MDX A;  1OOT A;  4M77 B;  1CKA A;  1QCO A;  1U5S A;  3M0S A;  1EZZ B;  1M90 U;  1I5L A;  1F1B B;  3M9Q A;  1D09 B;  4IUV A;  1E6H A;  5FLX E;  4DQ2 A;  1RAG B;  1N6A A;  3A8M B;  1VQP A;  3JB9 I;  1ZUY A;  3PFS A;  3CCL T;  1TG0 A;  3L2Z A;  4KUI A;  4M78 B;  1MMN A;  3VS1 A;  4O5V A;  1W2B S;  3AHU A;  1H64 1;  1NZ9 A;  1W6X A;  4BI8 B;  3CC7 Q;  5FWB A;  4RTX A;  3P8B B;  3VS5 A;  4MZT A;  1VQP T;  4ZN1 A;  4QVC A;  3H6Z A;  2JXB A;  4A4K A;  1I1J A;  1M30 A;  2C0I A;  1VYU A;  1ZSZ A;  5LJ5 d;  3MET A;  2L0A A;  1VQ8 A;  2VC8 A;  1C1A A;  2KDS A;  1VQO A;  2K5I A;  1KQ2 A;  5CIU A;  4FM4 B;  1M8V A;  2YRD A;  1AT1 B;  3OYA A;  1Z9Z A;  5CVI A;  5GAN 4;  2LT1 A;  1VQ8 T;  1VQO T;  1NEB A;  1PWT A;  2NYS A;  1ZA1 B;  1D1B A;  4WCI A;  5LJ3 e;  3EG9 A;  2C0T A;  4LD9 K;  3G7Z A;  3L2R A;  1ZHI A;  1Q82 R;  2FZG B;  4FYX B;  3WXM B;  2JTF A;  2QA4 A;  5KYN A;  4C5E A;  2MWO A;  1UEC A;  2QAS A;  4PLL A;  4M7D E;  2FPD A;  5D6X A;  3UDC A;  4JS5 A;  4F04 B;  1K73 C;  2E65 A;  1TS9 A;  1MV0 B;  2YSQ A;  4FCY A;  1JJ2 P;  2LNV A;  4JRI A;  4J83 A;  2BKD N;  5D7U A;  2MF2 A;  1HK9 A;  2M0Y A;  3UAT A;  5KE3 A;  3JV3 A;  4M77 A;  2VV5 A;  3JCM X;  4XTW A;  3F70 A;  4J9B A;  4OMF B;  1LVK A;  1NE8 A;  2LMJ A;  1UDL A;  4PNO A;  2FG0 A;  2M1H A;  3I5S A;  4JRP A;  3OSV A;  3EAE A;  4Z8A A;  4N0A C;  3I56 T;  1UB4 A;  1TH7 A;  2DXU A;  2CGH A;  1YI2 T;  3MKD A;  1Q7Y U;  1NLP C;  1JXM A;  2J06 A;  1VQ6 T;  5GAO n;  3M57 A;  4E7Z A;  2EQJ A;  2VYT A;  5IHN A;  2PVO B;  3OYB A;  2HD0 A;  1WHG A;  1RL2 A;  4A4E A;  5KCO A;  5GAN 8;  2VXF A;  1M1K U;  1NPR A;  3QWX X;  2CUB A;  2JT4 A;  2KRS A;  4B6M A;  3QXE B;  2CSI A;  3C12 A;  2YUQ A;  4DOV A;  2FPF A;  5DM7 R;  4J6Y A;  3JAM E;  3QHS A;  2CYZ B;  3T9N A;  3G71 T;  1XJW B;  1FMW A;  1D0Z A;  4E7I A;  2F2V A;  1UHF A;  4PJO E;  3GNF B;  4M75 D;  2F2W A;  1M3A A;  2DAQ A;  2DL3 A;  3VS4 A;  2K5L A;  5CCA A;  2C06 A;  1WHH A;  3CCU A;  3VV0 A;  3VKI A;  3KFV A;  4KH1 B;  4C0D B;  1VQ4 T;  5A2Q E;  1D1C A;  1B34 A;  2ATC B;  3CBM A;  3RNJ A;  4KRT A;  1B07 A;  4LD6 A;  2AKL A;  4UC4 A;  4M7A G;  1JRI A;  1IO6 A;  4M75 E;  3OY9 A;  2KI7 A;  2RD1 A;  3M4G A;  1FX7 A;  2RJE A;  2RB6 A;  1QWF A;  4C8Q F;  2ZPG B;  1W2B A;  1SSF A;  2AT1 B;  2WSF E;  1SPK A;  4JPB W;  3JB9 F;  3CCJ T;  1E6G A;  1YJ9 A;  2JN0 A;  4XTY A;  1WHL A;  2V8K A;  6AT1 B;  3EG1 A;  1IB8 A;  5HY6 A;  2P4T A;  3FEO A;  3A1P A;  1MMD A;  3KXT A;  2DLP A;  5GAN f;  3CXC S;  2CZ7 B;  2JZ2 A;  2QG9 B;  4J9D A;  1K73 U;  4N4H A;  4C8Q B;  1XOV A;  2ECZ A;  4FIB A;  1WHM A;  7AT1 B;  1M27 C;  2DYI A;  2KBT A;  3D7S B;  3I35 A;  3JCM d;  4J9I A;  1Y57 A;  3CBO A;  2MI6 A;  2CRE A;  3CMA Q;  2G6F X;  3C94 A;  1JXO A;  1Q82 U;  2HBP A;  5FRM A;  4HKE A;  5A0G A;  4ZNX A;  3M54 A;  4D8D A;  3M0P A;  2CDT A;  5GAN g;  4EMG A;  1C6V X;  1ZQ1 A;  4RTT A;  3WVD B;  2DYB A;  2OI3 A;  5GAO l;  1NYF A;  1XQH A;  2GNC A;  3QBY A;  4FYW B;  2QEX A;  1OU8 A;  1WI7 A;  4CC2 A;  4HT9 A;  2KRM A;  2LCL A;  4NS5 A;  2B86 A;  3MPU B;  4J8O A;  1YIJ A;  3C0C A;  2HCK A;  1QW1 A;  5IT9 E;  3JCM f;  2QEX T;  3OYL A;  1B7T A;  5C0M A;  1X2Q A;  1E7O A;  5IXF A;  1NJI C;  2OAU A;  1V29 B;  1QKX A;  2EKO A;  1YIJ T;  2NUT A;  4RTV A;  4QW2 A;  2EPD A;  4KH0 B;  2VGM A;  1QVP A;  4IIO A;  3VS3 A;  1WPY A;  4QVD A;  1WXB A;  2O01 E;  3OA6 A;  3CPW S;  3UA7 A;  1Q86 R;  3QUI A;  4RG2 A;  3V7S A;  2DX1 A;  2V8I A;  4TVR A;  1ABQ A;  4AFQ C;  3JCM g;  3IQL A;  5GAM d;  5KYU B;  2M16 A;  1PHT A;  4C5H A;  3FDR A;  4OGE A;  2RF0 A;  3TEE A;  1VIF A;  2PNI A;  5J39 A;  3A98 A;  3PIP A;  3CCL Q;  3H41 A;  3RKW A;  2ZPE B;  2DNU A;  3A8O B;  4M7D A;  2EGA A;  2ZZD A;  2K4Y A;  1VQP Q;  3C4S A;  2PVG B;  1YWP A;  3HRU A;  2A37 A;  1M4Z A;  1BI1 A;  1LOJ A;  3NTI A;  5CQY A;  2RHY A;  1SF9 A;  2OTJ A;  1AWX A;  2DF6 A;  1NM7 A;  2RJF A;  2X3W D;  2KT1 A;  5I21 A;  4IUT A;  4KUL A;  1VQ9 A;  3QSU A;  3OB9 A;  1BIA A;  2D9T A;  3VYG A;  1BB9 A;  1GRI A;  1U1S A;  3H0F A;  2OTJ T;  1N27 A;  1VQ9 T;  1BK2 A;  3AT1 B;  2JVV A;  3LH5 A;  2E64 A;  1K9M R;  1VQ8 Q;  3GNG A;  5FU6 B;  4B9W A;  1VQO Q;  2KYM A;  5GJV B;  2DJQ A;  2PTK A;  4Y91 A;  1M90 R;  1DJ7 B;  4C5I A;  3MHX A;  4M7A D;  4C92 F;  1OX9 A;  3BDU A;  3LGL A;  2L5Q A;  5DY9 A;  3LGF A;  1PRM C;  3L2V A;  5LJ5 j;  5J26 A;  5IXB A;  3CXC A;  4LXC A;  3NHN A;  2PVD B;  2ZPI B;  4QQ6 A;  2GF7 A;  1RLQ C;  1M3C A;  5LJ3 f;  1K1Z A;  1M2V B;  2JNG A;  2ZAE A;  4M7D G;  5I2M A;  1KK7 A;  2P0K A;  5EG2 A;  4PJO A;  1OZ2 A;  4J9F A;  1M1G A;  2AHJ B;  3EGX A;  5FRN A;  1BCO A;  3HRT A;  1BKB A;  5KYU A;  4M4Z A;  2PZ1 A;  4XQ3 A;  4O6J A;  2DL4 A;  4PJN A;  1ZA2 B;  2LRQ A;  5DLQ E;  5GAN 7;  4F7U E;  4N4G A;  1YI2 Q;  5I11 A;  2HNI A;  1GCQ A;  1SRL A;  1YNZ A;  4M75 A;  5J3B A;  3OS0 A;  1PD0 A;  1VQ6 Q;  1KC8 C;  1RI9 A;  2V1R A;  3HTR A;  5CO7 A;  5LJ3 g;  1H3Z A;  1WFW A;  2EGC A;  2HL3 A;  3OMC A;  5CKB A;  1Z9Q A;  3TRE A;  4DA4 A;  4J9H A;  2RMO A;  1WZO A;  1V1C A;  4AMC A;  2LQN A;  1UGS B;  4J5Y A;  4XK8 E;  4F14 A;  1BCM A;  3EH2 A;  1Q81 U;  2EYZ A;  2DD4 A;  1TOV A;  1PG5 B;  1PKS A;  2W10 A;  4XTZ A;  2EYX A;  2JS2 A;  4L6V 5;  3A8L B;  3EGD A;  1G3W A;  2K79 A;  1RI0 A;  3MEU A;  2YT6 A;  2RO0 A;  2EFI A;  3TSW A;  3CPW A;  2E3I A;  4BY6 B;  1BU1 A;  1QCF A;  3MO8 A;  4PJO G;  1ZSZ B;  1UGR B;  3M0Q A;  1VQ4 Q;  2O2O A;  4LDW A;  2K57 A;  2JMC A;  2LQK A;  2R58 A;  1Q7Y R;  1BBZ A;  2K3B A;  2NLU A;  4N4I A;  4E6R A;  2H3E B;  1G3T A;  3CC2 T;  1M8M A;  2GTO A;  2EWN A;  1M2V A;  3LW5 E;  1YWO A;  2LZ6 B;  4DBF A;  4E2F B;  1N8R C;  2SEM A;  1QLY A;  4M75 G;  3HPW A;  2FVU A;  1MUZ A;  1M1K R;  4JRK A;  1PC0 A;  3QWY A;  5LJ5 h;  4OB2 B;  4M77 F;  4RUG A;  1YBY A;  4NL3 A;  2GTJ A;  4C92 C;  4Z88 A;  3ER0 A;  2CUD A;  1IXD A;  4BDY A;  2F1L A;  2EYY A;  3EFR A;  1UFF A;  2J7I A;  4JJN K;  1WGS A;  4M78 F;  2RI5 A;  2FZK B;  3BFM A;  4JLG A;  2MMP A;  2LC4 A;  3O8V A;  3OQ5 A;  4L59 A;  1GFD A;  4E7H A;  1PCX A;  1KQS A;  5GMK j;  2E5K A;  1WJS A;  2DL7 A;  4M7A B;  2L8D A;  3NGP A;  4DBR A;  3H0H A;  3PMI A;  1EFN A;  1YJN A;  2D0N A;  2YUP A;  1MND A;  1SG5 A;  3CCQ T;  1I8F A;  3VS0 A;  4PJJ A;  1GBR A;  2P0Q A;  2GFA A;  4RCB A;  3VS6 A;  2A7Y A;  1YJN T;  2D8J A;  4LDU A;  3REA B;  1KIK A;  5FU7 B;  2QEX Q;  4BI3 A;  5GAM e;  4XU3 A;  3PGG A;  2DRM A;  3VRY A;  1WA7 A;  2EW3 A;  2LTO A;  2VAS A;  1IRE B;  3M0R A;  1YIJ Q;  3EFO A;  2BE7 D;  1K73 R;  2KQW A;  4RG8 A;  1FYN A;  1V76 A;  4BI4 A;  4WF2 A;  4M7D D;  2RHU A;  4YTL A;  1RAA B;  4XU2 A;  3FJP A;  3O5Z A;  2EAY A;  1R8O B;  1NEG A;  2V8J A;  4C0G A;  3M5A A;  3DB4 A;  2OTL A;  3OYY A;  2CP0 A;  3HHT B;  1B34 B;  1CSK A;  4PFZ A;  2CP7 A;  4OB0 B;  4BDZ A;  1X75 C;  2DXB A;  2OTL T;  1CKB A;  2CT4 A;  5CQX A;  3EH1 A;  1S72 A;  3CCS A;  3PVL A;  2DFU A;  3JCM Q;  2KYB A;  4PLI A;  1QP2 A;  3I56 A;  3E19 A;  1YI2 A;  4LE9 A;  2BUD A;  2BZY A;  4M77 C;  2QGF B;  1VQ6 A;  3OYJ A;  4M7A A;  4RTZ A;  4QQG A;  3VUB A;  3J80 E;  1S72 T;  1VQK T;  3CCS T;  3OSS C;  5GAO p;  2DZ9 A;  2H8H A;  5CKH A;  2GQI A;  2CH4 A;  4BE2 A;  5GAM j;  4M78 C;  2XDD A;  2A36 A;  1W2B P;  4CI0 C;  2BE9 B;  4F7U A;  4QKU A;  3LX7 A;  2HSE B;  2OTJ Q;  1P92 A;  4AT1 B;  1SHG A;  3X20 B;  4N0A A;  4E7L A;  1VQ9 Q;  3E9G A;  2LJ1 A;  3G71 A;  4PJO D;  1TUG B;  2LX7 A;  1LNX A;  4AG1 C;  4EMK B;  2CKK A;  4HA8 A;  2QXF A;  2W0Z A;  1EX4 A;  1YJW T;  2COY A;  1QVG S;  2BZ8 A;  1IHV A;  3PE0 A;  1KG1 A;  1KD1 C;  5I2S A;  1KJW A;  5IHK A;  3L42 A;  1VOM A;  4PKC C;  1QVF S;  3DKM A;  3L2U A;  4FYV B;  4A4F A;  3HFO A;  1VQ4 A;  2ABL A;  2C0O A;  2COZ A;  3PMT A;  1MV3 A;  3DLL A;  2DEU A;  3OYC A;  4JDS A;  3H8Z A;  4LN2 A;  4ZTJ A;  3OYG A;  4KGZ B;  5GAN d;  1J3T A;  3I55 A;  2JOY A;  2RJC A;  2O4X B;  2CSQ A;  1KHC A;  1HJD A;  3UWN A;  4KGV B;  3CCJ A;  1BI2 A;  2NUT B;  1TTH B;  4J9C A;  3I55 T;  3G4S T;  1K4U S;  4C5G A;  2KT8 A;  1HD3 A;  4LNP A;  2DTI A;  3CCM T;  1S1N A;  4OMO A;  4F7U G;  4M7D F;  4X34 A;  2LCC A;  2COW A;  4IUR A;  1VUB A;  2WSC E;  2DIL A;  3MP8 A;  4HVV A;  3G6E T;  1GFC A;  4HCZ A;  1BIB A;  4PFP A;  2PUO B;  2KVQ G;  4IKF A;  3LWH A;  2DK3 A;  1UG1 A;  3HRS A;  5GAO r;  2M0O A;  4E47 A;  3OYN A;  3OYI A;  1X6G A;  2K9G A;  3RKY A;  1SRM A;  2JM9 A;  2ROL A;  3E1S A;  4XAX B;  4M7D B;  4X9C A;  1WXU A;  3L1A A;  4EMK A;  5KYW B;  5GAM h;  4RTW A;  4J9G A;  3JCM P;  2KXC A;  4A54 A;  2A0F B;  3BY7 A;  1JU5 C;  1SHF A;  2M02 A;  2DO3 A;  4OVA A;  5CK9 A;  3V7C A;  4BD3 A;  1HYO A;  2BTT A;  1PSF A;  2DRK A;  1G3Y A;  1AOJ A;  1ZX6 A;  2YUN A;  1NJI R;  1QVF P;  1I81 A;  3JCM J;  2WAC A;  2Y4X A;  2CP5 A;  2KNB B;  1T0H A;  1WQW A;  2SRC A;  1I07 A;  5FWC A;  5A0L A;  4JZ3 A;  2ESW A;  4Q5W A;  4KBM B;  1ACM B;  1X27 A;  3BDL A;  4AFU C;  4MZP A;  2VGN A;  2E41 A;  2O4X A;  5GAN 5;  4C0D C;  2JTE A;  4ANJ A;  3VUZ A;  4C92 E;  1K0X A;  2AK5 A;  2DBM A;  4JLI A;  2G3R A;  2L2P A;  1Q81 R;  4ZTF A;  4A4H A;  2YRC A;  1QKW A;  1FXX A;  3UA6 A;  3OYM A;  4K11 A;  5L8R E;  2LDM A;  3FJ5 A;  2E10 A;  4JZ4 A;  5DLO A;  4M75 F;  2JS0 A;  3P8H A;  1XTD A;  1K0S A;  2EJF A;  1UJ0 A;  2QAZ A;  3MP1 A;  4DOW A;  2MCN A;  3V8J A;  4PJO B;  3EGX B;  3OS1 A;  3M59 A;  3OYF A;  2CT3 A;  2K6D A;  4RKU E;  5LJ5 e;  3A8H B;  2HZY A;  3CXC P;  5FW9 A;  3LYI A;  1LCK A;  1QVG A;  2ZPB B;  1FWZ A;  2LX9 A;  3L2Q A;  1UJY A;  3LH0 A;  1MHN A;  2MYS A;  2RPN A;  3A8G B;  1IGQ A;  4J6W A;  1OPL A;  4QT7 A;  1QVF A;  4ESR A;  4C8Q C;  2DXC A;  3X28 B;  5CKE A;  3HP9 A;  4M75 B;  5KYW A;  3TVT A;  2H3J A;  2Y90 A;  3JSC A;  3CCQ Q;  2P84 A;  2DET A;  5HKC A;  2CZ0 B;  2X3X D;  3QG1 A;  3RBB B;  4FT4 A;  2EKH A;  1WIE A;  1X2K A;  4GLK A;  1WDX A;  4CC4 B;  1O9S A;  4CC7 A;  2EGE A;  1YJN Q;  1X69 A;  5HK3 A;  3CCE A;  3DB3 A;  3GOX A;  2K5F A;  2XDP A;  2KGT A;  3EGU A;  1Q86 C;  5CAI A;  4AFZ C;  4FW1 A;  1Y96 A;  2QDL A;  5KYX A;  3SDZ A;  1ZBX A;  5LJ3 d;  5A0D A;  1G5V A;  3OYH A;  1OEB A;  4P5N A;  3CCE T;  3CCV A;  2P0P A;  4E7K A;  1GCP A;  3EG2 A;  1D0Y A;  4II1 A;  3EGD B;  1KQS S;  3M0T A;  2IIM A;  1UHC A;  1AEY A;  1MMA A;  2PU9 B;  5KCH A;  3JCM b;  3SEM A;  3CCV T;  3SWN B;  2FB7 A;  4XTV A;  5I22 A;  2F2X A;  2LNH B;  2QYZ A;  3VS7 A;  2RA2 A;  3DLM A;  1LPL A;  3UF4 A;  4BAC A;  2J6K A;  2CP6 A;  4IUQ A;  5KYY A;  1NPP A;  4MDW A;  1T3S A;  1YCS B;  2OTL Q;  3TCJ A;  2D1X A;  1AVZ C;  5CKF A;  3CPW P;  3M56 A;  3L2W A;  1U3O A;  2X51 A;  1D0X A;  4D8K A;  8AT1 B;  1I5O B;  3S3O A;  3VJP A;  2DM1 A;  4M77 E;  1PM3 A;  3HFN A; 
#chains in the Genus database with same CATH homology
 2HL5 C;  2HQH A;  2CP6 A;  2CP7 A;  2COZ A;  2CP2 A;  4B6M A;  2E3I A;  2COY A;  2E4H A;  2M02 A;  1WHH A;  3TQ7 P;  2HKN A;  2MPX C;  1TOV A;  2Z0W A;  1WHJ A;  1WHM A;  2QK0 A;  2HKQ B;  1WHL A;  2CP0 A;  1WHG A;  2E3H A;  2COW A;  1TXQ A;  3RDV A;  1WHK A;  1IXD A;  2HL3 A;  1LPL A;  3E2U A;  2CP5 A;  2CP3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...