1WHLA

Solution structure of the 1st cap-gly domain in human cylindromatosis tumor suppressor cyld
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
95
structure length
95
Chain Sequence
b'GSSGSSGIDVGCPVKVQLRSGEEKFPGVVRFRGPLLAERTVSGIFFGVELLEEGRGQGFTDGVYQGKQLFQCDEDCGVFVALDKLELIESGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cylindromatosis tumor suppressor CYLD
publication title Solution structure of the 1st CAP-Gly domain in human cylindromatosis tumor suppressor CYLD
rcsb
source organism Homo sapiens
molecule tags Antitumor protein
total genus 7
structure length 95
sequence length 95
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2004-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01302 CAP_GLY CAP-Gly domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.190 Mainly Beta Roll SH3 type barrels. CAP Gly-rich-like domain 1whlA00
2HKQB 2COZA 2HL3A 2QK0A 2CP2A 2CP3A 2CP5A 2COWA 2CP7A 2HQHA 4B6MA 2E4HA 1WHKA 2HL5C 1WHLA 2M02A 3E2UA 1TXQA 2COYA 2Z0WA 2HKNA 3TQ7P 2CP0A 1WHHA 1IXDA 1WHGA 2CP6A 1WHJA 1WHMA 2MPXC 1TOVA 2E3IA 1LPLA 2E3HA 3RDVA
chains in the Genus database with same CATH superfamily
2CSQA 5CCAA 1M90U 3CCJA 2ENMA 2B86A 3CCET 4QQDA 3M5AA 1TUDA 1YIJT 1AWWA 5FRMA 4M7AD 2CZ1B 4FYXB 3HRUA 2KGTA 4MZPA 4Z02A 1VYUA 4A54A 1YJNT 3JCMV 5IAYA 2DETA 1OX9A 1Y71A 2QGGA 4AMCA 1NJIR 1RI0A 4OMMA 5GAMj 3M4GA 5IXBA 2QQBA 3CCEQ 3JAME 4E7IA 1HK9A 3QZ5B 5KYWB 2DFUA 2WSEE 3CCQA 4EDUA 4XU0A 4PJOE 2RM4A 2CZ0B 3EGUA 4BD3A 3OW2P 1MNDA 2ROTA 1YJNQ 5DM7R 1B34B 1VQKA 4C5IA 2XIDA 2QDYB 1BIAA 2RK2A 3LGLA 1SHFA 3QDFA 4XQ3A 1WIEA 2MCNA 2CP7A 2F2WA 2WSCE 4DEYA 1S72T 1R77A 3QYHB 3PVQA 2E41A 8ATCB 2ROLA 3JB9J 4M75E 3R6NA 4JPBW 5IHNA 1UUEA 4J9HA 2KT1A 1BU1A 4N4HA 1X2KA 2DIGA 5CQYA 3EGDB 4QVDA 5IH2A 1W2BP 4HT9A 1S72Q 2AZVA 4OVAA 2RHIA 1M2VA 2HL5C 4X1VA 1G83A 2FPEA 2DTIA 2A37A 3ZBDA 4RMOA 1YI2A 3I55Q 2OAWA 4JJBA 2LZ6B 2C0OA 2HBWA 2LTOA 2E3IA 1M8MA 3P8BB 3CXCS 1IB8A 4KH0B 2M51A 5HCKA 4F7UB 2AK5A 2JUFA 1AWJA 4OP0A 2F2XA 3A8LB 1UFFA 3QZ9B 1JJ2P 2FPFA 1NG2A 2PU9B 3VS2A 2E12A 5FROA 2K5FA 1K1ZA 2PTKA 5GAN7 1D1BA 3MCAB 2YUOA 4LDVA 4JJCA 2E5QA 2AKKA 4HCBA 3CCEA 1JEGA 4R0KA 1Q86R 2CT3A 2YUPA 4RTZA 1AZGB 1KK7A 2V1RA 3OS5A 4KULA 1YJNA 1TSFA 2E64A 2LP5A 1M8VA 2XK0A 5HK3A 5AYFA 1VIEA 2BKDN 2JZ2A 3CMAT 4X9DA 2LDMA 2OX7A 3G4SQ 2FRWA 3EFSA 2MOXA 5GMKj 3X20B 2CS7A 5FRNA 4CC3A 2RHXA 1W70A 4C0DB 1G2BA 3VUBA 3OQ5A 3UA6A 2X51A 1DJ7B 2VGNA 4RTXA 3EG2A 2P0PA 3S3MA 4M77F 1X6OA 4C0ZA 1BI2A 3MHXA 3M59A 5CKFA 2XDPA 1GCPA 4Z8AA 2DXUA 2OTJT 4PFZA 2VWFA 1VQ9T 1S72A 1K76A 5KYXA 2EJ9A 3V7SA 2M9UA 2JM9A 4C0DC 2EQJA 2DZ9A 2NUTB 3OYYA 1QWEA 3H8ZA 4A4GA 5KCHA 2E65A 1OX8A 4M77E 3OBWA 1IZ6A 4XTYA 1VQLQ 4KRTA 4HCKA 3LLRA 3CPWA 2CDTA 2M0YA 1VQPQ 3O5ZA 4D6WA 4RKUE 5GAOp 2DM1A 1NPPA 1Z9ZA 1LCKA 1WHJA 3RNJA 4FSXA 1KQ1A 1VQ6T 3EG3A 2LCLA 4OMOA 3O8VA 3CPFA 3J7AF 3MP8A 4C8QA 3JCMW 1LJOA 2YUNA 4LN2A 4XTWA 1WXUA 2F5TX 3CC4T 1M3BA 1SF9A 5GAN5 4M7AC 1YNZA 2BTTA 5FU6C 1C6VX 2JMCA 3VYGA 4A63B 1S1NA 2DTOA 1UGRB 1PKTA 3SB2A 4ESRA 1N9SA 5DY9A 1NM7A 2W10A 3A98A 3OYHA 2E5KA 1X27A 3EG9A 2L3QA 3JCMd 2XHCA 4MDWA 1BKBA 1QWFA 3GIBA 1OV3A 4M77D 1NLOC 2YLBA 2EYYA 4RTYA 3H6ZA 1GFDA 5GAMh 4JRPA 4AFUC 1X69A 3D7SB 5GANd 3I9QA 2GNCA 2CKKA 1M2VB 1ZX6A 1KQSS 4M7DG 2EJFA 1X75C 4BI8B 4BDZA 4M7AG 4J9GA 3SHWA 1UJYA 3THKA 4KGXB 1MMDA 3QJYA 5KYNA 1VQLA 1VQMT 1RUWA 4L59A 5GAN3 3FB9A 2MWPA 1VQ8T 2OTJA 3J80E 3GF5A 2KRMA 3GLXA 5A0GA 3OMGA 2RF0A 5CIUA 1FX7A 2Z0WA 3TEEA 1QP3A 3CC7Q 3UPUA 1V76A 1PNJA 3VUZA 3G7ZA 4GBQA 1OZ2A 3GP8A 2FEIA 4EIKA 1MHNA 3SEMA 2HBPA 1OU8A 4PJOC 1B3QA 2CP3A 1K73C 1MV3A 2RD1A 4J9CA 1MGQA 3OSSC 3C94A 3T9NA 5GAOr 1IREB 1KD1R 3H0IA 5FU7C 4JLIA 2PVDB 1UHFA 2ZAEA 2ZPEB 4XK8E 1AT1B 2YWWA 4FIBA 4E6RA 1KC8R 1AWXA 4EPCA 1IRXA 2VC8A 3CBPA 3OA6A 4E7LA 4E7ZA 1U1SA 3L1AA 2FG0A 2DEUA 1UTIA 2DD4A 1D3BA 4EMKC 2RK1A 1WHGA 1OYXA 2J6OA 3FLGA 1V29B 3JSCA 1PSFA 3M56A 4PNOA 5KYXB 4PJOG 3I56Q 1XQHA 3QXEB 2JMAA 3EAEA 2AT1B 1FMWA 3MEVA 5HK0A 1D1CA 1O9SA 1D0YA 1QQJA 2GFUA 2XKOC 3HFOA 3OBYA 2HQXA 3ZEHA 2DMOA 4L5GA 2OI3A 2ZPGB 4UC4A 4IUQA 5GMKh 5D6XA 2NUZA 2E3HA 2MIOA 1ZA1B 4Z89A 1M1KC 3OYDA 2COZA 3VYHB 2DRMA 2JJ9A 5CQXA 2DEQA 3LH0A 4IUUA 4B6MA 1ZQ1A 1JRIA 1XNIA 1H3HA 2QASA 4C8QB 4M75G 4PJNA 3KFVA 1VQMA 2HDAA 2BE9B 2D0NA 1EX4A 3INZA 5LJ5e 3EHQA 2OJ2A 5LJ5f 1UJ0A 1IHWA 2HZYA 4LNPA 2DL5A 1Q81C 3G1JA 1VQ5Q 2EW3A 4RCCA 1TTHB 4E2FB 1I5OB 4AG1C 2YHTA 4B9WA 2EYZA 3OYJA 2QGFB 2FZKB 1Z9QA 3M0RA 2QG9B 5IHKA 2JT4A 1TWBA 3EG9B 1M90R 3SDZA 2YDLA 3H0FA 1RAFB 2I0NA 1QCOA 2KVQG 3VS6A 2AHJB 2LX7A 3JCMX 5J3BA 3OW2S 4OMFB 4D8DA 2CP2A 3JRZA 4OGCA 3L2QA 2COWA 4RTUA 2LJ3A 3TSWA 5CKDA 2K79A 3FJ5A 4QT7A 1RAHB 1BIBA 4CC7A 3BY7A 2EKOA 2RHYA 2LNVA 1N9RA 4KUDK 3KXTA 4E7KA 3QWXX 2DL4A 3HFNA 1ZUKA 4F04B 3I56A 1EZZB 2O2OA 2M02A 1K9MC 3JCMe 4ZGJB 4M77C 4C5GA 2QI2A 1YHQT 2Y4XA 3HL8A 3M54A 1VQ7Q 2B8AA 3AT1B 4M7DF 2E10A 1HJDA 1OOTA 1VYVA 5KCOA 2H8HA 3DB3A 1Q7YC 1ZLMA 1AZEA 1WZOA 3CEYA 1W2BS 2M16A 1MMAA 3RR6A 5GANe 2MMPA 1UGVA 2P4RA 1TOVA 4BE0A 4AFQC 3ZL7C 4MMLA 5LJ3e 3E9GA 4ELZC 3L2WA 1U8RA 5LJ3f 1MV0B 3JCMg 2XMFA 2ESWA 3SD4A 2ZCFB 4QW2A 1VQNT 1EIFA 1RACB 4ANJA 2K2MA 4XAXB 1JJ2S 3A8HB 2E6ZA 1VQ5A 1TG0A 4M78E 3REAB 3A8MB 2GGRA 1SPKA 3CBMA 2XG8D 4M77G 5L23A 4BY6B 4HVUA 3QJ6A 1G3WA 1YI2T 3OS2A 4C92E 4LDYA 2MWOA 2J06A 2ABLA 2AKLA 4DOVA 3VRZA 4OGEA 1TH7A 3TCJA 4FW2A 2V26A 3MJXA 1D3BB 3CCMT 4WTOB 2GTJA 3M55A 2DL3A 5IN1A 2EGCA 3RDVA 1YJ9Q 3HRSA 3VS3A 5A0DA 2JS2A 4J9EA 2FHDA 2HSEB 2QAZA 4AFZC 2GF7A 3X25B 2D8JA 4M7DD 1QP2A 1RAGB 1N8RU 3CCMQ 2RQRA 3JB9G 4M7DA 3PNWC 5GAN8 4M7AA 4ZGEB 4PJOF 3M57A 2EQMA 1A0NB 4HA8A 2RN8A 1G3TA 2RQVA 1QVFA 2PZ1A 2D9TA 3MEUA 3QIIA 5DLOA 3M0SA 3REBB 1OQKA 3GOXA 1T3LA 4XU1A 3JCMJ 1WHLA 4AG2C 5KE2A 1WGSA 4MZTA 5CKEA 1YHQA 5M9OA 4FYWB 1I5LA 2EYQA 1HD3A 2DLPA 4LE9A 2CP6A 3M0PA 1F1BB 1TUCA 2EGEA 2W0ZA 3HP9A 4DBFA 1U3OA 1D0ZA 1X43A 1BBZA 4M75F 1ABQA 2X4JA 1MUZA 3LYIA 5FWBA 1H3ZA 3OMCA 1G3YA 2EPDA 2F2VA 2PUOB 3AHUA 2HEQA 1KQSA 1RAEB 1H641 4CC4B 3JCMP 3I55T 5GAN6 4KT0E 3TSZA 1I0CA 3M4YA 3N5BB 1VQNA 1SG5A 1YFNA 4BI4A 3QSUA 3LH5A 1RLPC 2MF2A 4IURA 1GBQA 1WJQA 2J7IA 2GCXA 4BB7A 2CYZB 3OS1A 2ZPBB 4P5NA 2QTXA 2DRKA 1M1GA 2C0TA 4J9FA 2DBKA 4PJOD 4PK4A 2PVOB 5D6WA 3CCVQ 3V8KA 4PJOA 5HKCA 2EYXA 4XTXA 1XTDA 3CCMA 2RJFA 2YRDA 3OYLA 4EMHA 4J6XA 4PFOA 1YWOA 2VXEA 3RIRA 6AT1B 7AT1B 4LXCA 2RH2A 3EG1A 2DYBA 3G4ST 1ZA2B 1I81A 2IIMA 1KHCA 1JXMA 2A08A 2RQWA 2LX9A 1NJIC 3NGPA 4M75D 3DLLA 2VYTA 5GAMe 3UF4A 5GAMf 4VUBA 2JS0A 3OB9A 1MMNA 4EMKA 4BUGA 4A4KA 3NTKA 4DQ2A 1G8XA 2DE0X 1SRMA 3CCUQ 4RG2A 4JS5A 1VQLT 2EBPA 4J9BA 1BI3A 1H92A 1VQPT 4HKEA 2LQWA 2O4XA 4QVCA 2K3YA 4MDXA 3CC2Q 3S3OA 3FEOA 4DBHA 1VQOT 2VASA 1PRMC 2HQHA 5CO7A 3ULRB 2ZPIB 3QO3A 3J81E 3GBQA 5LJ5d 2ECZA 1OI1A 3I55A 3OYEA 1QVGP 4IUPA 1QW1A 1VA7A 3MEAA 3JB9I 2LCCA 3JV3A 4M7DB 3CCVA 4M7AB 1YITQ 1VQOQ 2MI6A 3F70A 5FU6B 4DBRA 2HMAA 4D8KA 3RUXA 2G3RA 3ASKA 3JB9F 4JJDA 1N6AA 2X4XA 4DA4A 2F5KA 4XTUA 4J6WA 5EC7A 3CD6T 1QKWA 3NFCA 4XU3A 2HKNA 2YXYA 4M7DC 1E6HA 4CI0C 4OMPA 1LOJA 2H3JA 2DERA 3RKXA 3WVEB 2JM8A 4LUEA 2ZZDA 2X4WA 2JVVA 1LVKA 2CT4A 3OW2A 3EFRA 3URGA 3CD6Q 1M5Q1 1Y07A 3VS1A 1OZ3A 2HD0A 2JTEA 3OSVA 2YRVA 1Q86C 3BDLA 3LWIA 4L6V5 3FRNA 3G4SA 3QWYA 4M78C 3TQ7P 2RNAA 4N0AC 2DX1A 2RQUA 2AZSA 1ZSZC 3EGXA 1YN8A 1NPRA 4X9CA 4C92C 4M77A 2KAFA 1Y57A 2L5QA 1PSEA 5GAOl 2EFIA 1X01A 3I5RA 5GMKe 3L2UA 4ZN3A 3VV0A 3DKMA 4Q5WA 1ZHIA 2M0OA 2DXBA 1PHTA 1WNLA 4R55A 1D0XA 2KK4A 1PCXA 4PJJA 2JW4A 5LJ3d 2VV5A 4FYVB 4ZNXA 1K8AU 1C1AA 3CC7T 4PJMA 4AFSC 5CVIA 2L0AA 2RA2A 2HAXA 3CCLT 4ATOA 4HVVA 1VQPA 4PJOB 2E4HA 2KE9A 2LC4A 1FXXA 5GAOm 3JB9D 1M9SA 3H9NA 3QHSA 2OTLQ 4M78G 1YITA 1VQOA 1IHVA 2XDBA 5FU7B 1K0XA 3PT9A 1E6GA 1W6XA 3U23A 4C92G 3CCLQ 2GBQA 1FMVA 2JTMA 1EFNA 1BYMA 4QKUA 2X3WD 2HL3A 1UECA 4OMQA 1BB9A 3G6EQ 1PG5B 3TREA 1YJWQ 4NOYA 3M53A 2EQUA 2DVJA 1X6GA 2VKNA 1G5VA 3VS0A 2Y4YA 4FT4A 4PLIA 3OYIA 4EMKB 2V8JA 2DA9A 1QCFA 4LDUA 3CD6A 2K3XA 4XTVA 1K73U 2LQNA 4LDWA 4OB0B 4ZN1A 2F1LA 1FWZA 3I56T 4Y91A 2ZPHB 4Z88A 4M75C 2LNHB 2RI3A 3RESA 1WDXA 4BE2A 4J9DA 4A4HA 2K57A 2KRNA 4CRIA 5GAN2 1ZSGA 2O4XB 4A4FA 2VUBA 4K11A 1ABOA 3S6WA 1Q82R 4C0FA 2DYIA 2K4YA 5KYUA 4PFPA 4E7SA 1KSWA 2LT1A 1KHIA 2ATCB 3V7RA 3HKSA 1HSQA 4JUVA 3A5ZB 2SRCA 2GQIA 1VUBA 1WFWA 5GANj 3E19A 2RMOA 2OTLA 3OYKA 3SWNC 4J7IA 5A2QE 1VQ5T 1RABB 3QG1A 3CC7A 1QVFP 1R8OB 2DXTA 2CREA 4OB1B 4NS5A 3CCLA 1AVZC 3RKWA 4F14A 2FRYA 2QDLA 2DK3A 3OYFA 2BZYA 3C4SA 1M1KU 1RI9A 1QMCA 2YT6A 2LT4A 3PMIA 2P4TA 4CC2A 2EJGA 3CPWS 3M0TA 5IT9E 4F7UE 3CCSQ 2A3LA 3BFMA 1KIKA 2KNBB 1UB4A 1UG1A 2V8IA 1UDLA 4RTWA 3GPLA 3KUFA 2DO3A 1NBEB 1KD1C 1ACMB 2H3EB 1Q81U 1U1TA 3EGXB 1K0SA 4M77B 3L42A 3CXCA 4BACA 1N8RR 5LJ5g 1VQ7T 1KC8C 9ATCB 2AIRB 2KEAA 3MPUB 1TXQA 3NPFA 1ZBJA 2DIQA 3UA7A 2QQ9A 1WX6A 2LVMA 3OYGA 2BUDA 5FW9A 5GAOn 1JQQA 4OB3B 2C06A 5GAMd 5KE3A 1M30A 4IIMA 1PD0A 3CCJQ 1WXTA 4MMKA 1GFCA 5C6SA 2O01E 4FU6A 1NEBA 1UGPB 5GMKl 1Q82U 3EH1A 1JXOA 2MPXC 2O31A 4WCIA 1IGUA 3FIFA 1CKAA 4DBQA 3VU3C 4GLMA 1UEBA 3I5SA 4M78F 1AD5A 4TVRA 1SKUB 1WYXA 3E2UA 1Q7YU 1Y96A 4C92F 1KJWA 1RL2A 4ORZA 1WJRA 3CCQQ 1LNXA 3UATA 3HHTB 1SHGA 2K5IA 3NMZC 1OPKA 1M3AA 3HTRA 1V1CA 5GANg 3RKYA 4B9XA 3RBBB 1YJ9T 3HRTA 2LJ0A 1IO6A 4QQ6A 2RB6A 2RJCA 1SSFA 2DF6A 3QBYA 5I11A 5LJ3g 2XI9A 1JBMA 2LQKA 2HNIA 3MP1A 1QCNA 3C12A 4Y28E 3VJPA 3JB9H 1XOVA 2CH4A 4F16A 1J3TA 3ME9A 1N5ZA 1M90C 1Q95G 5CR2A 5KH6A 5LJ5h 3NTHA 1NYFA 2BIVA 2F69A 2QA4T 3CMET 3MO8A 1KQ2A 2VGMA 5KYUB 1B7TA 1O75A 3QDRB 5D7UA 2L8DA 1IXDA 1VQ4T 3OYCA 3UDCA 2CSIA 1VQ7A 1W4SA 3CPWP 3MKDA 1RAIB 2LCSA 1UE9A 4KGVB 2NLUA 2P0QA 2DL7A 2MAMA 2ZPFB 2QA4Q 4O6JA 3CMEQ 2EIFA 4M78D 1VIFA 1VQ4Q 1UHCA 3M0UA 3TVTA 4M78A 1OPLA 1GXIE 2KRSA 4II1A 4N0AA 4C92D 5J39A 3PFSA 1ZSZA 2P84A 1QVGS 4C92A 3PVLA 4BI3A 3KBGA 2ZGWA 1FMKA 2DL8A 4IUVA 2K7AA 1G3SA 3I35A 2CP5A 1YIJQ 4AT1B 2IG0A 1TU0B 1M27C 4E47A 2RHZA 5I2SA 3JCMh 4KBMB 2KROA 3DLMA 1WQWA 2JNGA 4FYYB 2MK5A 3FC3A 1BCMA 3EFOA 1NYGA 1I4K1 2CUDA 4JZ3A 3QUIA 2KI7A 1YCSB 5GANh 3L2VA 3H0HA 1R0BG 3CCVT 3L2ZA 5I22A 1OU9A 2XDDA 5LJ3h 3CCRT 2KT8A 2FPDA 3FDRA 5HY6A 1Y0MA 4JZ4A 4RCBA 1WLPB 4HT8A 1YJ9A 4OB2B 1WHMA 3S3NA 1X6BA 3BDUA 1RLQC 2HKQB 4HXJA 1QKXA 2DJQA 2CZ6B 2OAUA 2EKHA 1U06A 3BE3A 1P92A 2K6DA 4GY5A 3VS5A 3CCRQ 1BCOA 1T0HA 2QQRA 2M1HA 4N4IA 2PUKB 3PE0A 2L3PA 1PRLC 2YRCA 2QA4A 5GJWB 3CMEA 1RADB 1CKBA 3OYBA 4JRKA 1VQ4A 2A7YA 2O9VA 2FB7A 2FZGB 2EGAA 2KYBA 2X9HA 3CCUT 4IIOA 5GMKi 1Y96B 4M75A 2O9SA 4C8QF 3LGFA 3PTAA 1WXBA 1YIJA 1C0MA 3CBOA 2RHUA 3WXMB 2PQWA 3CC2T 2EQIA 3Q1JA 2DTHA 1T0JA 1NJIU 2A28A 5GAOq 1K8AR 1BI0A 3PMTA 3JCMQ 4C8QE 1PC0A 4KGZB 2C0IA 3DB4A 3NHNA 2E70A 3NTIA 3M9QA 2ED0A 3P8DA 4FSSA 1NEGA 1D1AA 4YTLA 1SEMA 5GAMg 2NUPA 4M4ZA 1YITT 1IGQA 3SWNA 5I2MA 5A0LA 2KY9A 4KUIA 2EAYA 3CMAQ 2KSSA 2V1QA 1VOMA 2J6FA 2QQSA 4IKFA 4ME7A 2ED1A 3QYGB 1ZBXA 2A0FB 2DILA 3A1PA 3M0QA 4F7UG 1UGSB 2E6NA 4A53A 1N27A 4WF2A 3CCRA 4HVWA 2YSQA 4J5YA 5L8RE 3WVDB 2G6FX 2OTJQ 5FWCA 3V7CA 4FT2A 2JXBA 3C0CA 1NE8A 1VQ9Q 4M78B 1M2OA 4PL6A 1K73R 2GTOA 2FYKA 2FL7A 4IUTA 3EH2A 1ZSZB 2X4YA 4C92B 4EMGA 4C8QD 2YLCA 3HPWA 4HCCA 3LWHA 4C5EA 3PIPA 5KYYA 1WA7A 2KDSA 2KXDA 4QVZA 2J05A 1ZUYA 2COYA 2R58A 2YUQA 2LJ1A 3OYNA 2L3RA 4XU2A 3A8OB 4RUGA 8AT1B 2SEMA 2IPOB 1FYNA 1SSHA 1QVFS 1VQ6Q 1PM3A 2K5LA 1I1JA 3EFOB 2LRQA 3GNFB 3CCUA 4JDSA 4HCZA 1R0CB 2CUBA 1AOJA 4MZMA 3QKJA 3IQLA 2DPPB 2DBMA 2EYWA 5D6YA 3CC4Q 2L89A 1M3CA 1Q86U 3CXCP 1W2BA 4DOWA 3CC2A 3META 2OTLT 2GQVA 1K8AC 3EG0A 1ARKA 2PNIA 4FW1A 1W1FA 3M58A 4E7HA 2O88A 1TS9A 1OULA 3QPHA 2QEXT 3MEWA 2QK0A 4RTTA 3CMAA 2XD0A 3A8GB 3OYAA 1PKSA 1JU5C 3G6ET 1K9AA 3GNGA 5AT1B 2FO0A 2WSFE 3RMQA 1YJWT 3L2RA 1MNEA 1M1KR 4FM4B 3FJPA 2MYSA 5ECAA 4F17A 4BE1A 1JJ2A 1HXDA 1AWOA 1LPLA 2QEXQ 2DKGA 2L3SA 1XJWB 5LJ5j 4PKCC 2DNUA 2EQKA 4FCYA 1VQ9A 4RG8A 4X34A 3VRYA 1KG1A 1Q81R 3PGGA 4M75B 2RO0A 1VQMQ 2X35A 2RJDA 2KMTA 4C0GA 3BW1A 3UT1A 2JTFA 5DLQE 1VQ8Q 2DJZA 5GJVB 3VS4A 2RJEA 2VVKA 1WI7A 3LW5E 3JCMb 2DZCA 2RI2A 1GCQA 3RERA 1H8KA 1VQ6A 2CP0A 2XU8A 3JCMc 3H41A 1Y7XA 1AHJB 3CC4A 1CSKA 2NUPB 1YBYA 1WHKA 3R6OA 2D8HA 3SWNB 5CK9A 4ZTFA 4LUDA 4J9IA 1K9MR 1AEYA 3X28B 4PJLA 2CZ7B 4QQGA 1PWTA 2WACA 3EHRA 4JLGA 2DD5A 4R56A 4J7FA 1QVGA 1Q7YR 2DVEA 1JB0E 4E7JA 1RAAB 5IXFA 1WQ7A 2FVUA 1ZUUA 4RTVA 2DXCA 4J8OA 3CQTA 3MP6A 4JRIA 2IVWA 3CCST 4LD9K 2KR3A 1BI1A 5I21A 5LJ3j 4JS4A 1YP5A 4F7UF 3X26B 2QEXA 3G71T 4BDYA 1NZ9A 1TUGB 2QTVA 1YWPA 1GBRA 4NL3A 1SRLA 3G6EA 4C5HA 2QXFA 2KQWA 4V2SA 1E7OA 5KYWA 4OMLA 1YJWA 1NLPC 1OEBA 2BZXA 2HSPA 3UWNA 5KYYB 3PIOA 2BE7D 2VXFA 4DEXA 1M1FA 3G71Q 1B34A 4A4EA 3TU4K 3V8JA 2K9GA 1VQ8A 2R5MA 4OF1A 1KQSP 1D09B 2GFAA 2R57A 4C8QC 3LX7A 3OS0A 1UGQB 3OY9A 3CCJT 2QQAA 3V8LA 2EVRA 1U5SA 1WHHA 2FZCB 4J83A 4N4GA 4ELYC 1WJSA 1KD1U 3EGDA 2RQTA 2Y90A 5J26A 2XICA 3VS7A 4ZTJA 3VKIA 1KC8U 2NYSA 2PVGB 1M4ZA 1T3SA 1Q82C 3C95A 2P0KA 4LD6A 2LQ8A 2HCKA 3CCQT 1MMGA 2NWMA 2X3XD 1GL5A 2KXCA 1WPYA 3SFMA 1K9MU 3JCMf 1GRIA 4F7UA 2LMJA 2R5AA 4PLLA 1B07A 1VQKT 1I07A 4M7AF 2JN0A 4C8QG 3ER0A 2RPNA 2VB6A 3RMSA 2QYZA 2D0QB 5GANf 5CAIA 1YHQQ 4M7DE 1HYOA 5LL6S 4M7AE 5GMKm 4XTZA 2CH4W 4NL2A 2K2VA 3E9FA 1VQKQ 2BZ8A 3CCSA 5C0MA 2JOYA 1BK2A 2V8KA 5EG2A 3G71A 2K3BA 4ZGDB 2L2PA 4KH1B 4JJNK 3HSBA 4GLKA 4FL6A 3E1SA 2DAQA 5GAN4 2KBTA 1K4US 1KFZA 2EWNA 3OYMA 2KYMA 4JRQA 4O5VA 5CKHA 2RI5A 1PD1A 3ZFJA 1VQNQ 5IHIA 2HQEA 1VYTA 5CKBA 4LDXA 5FLXE 2A36A 4J6YA 2J6KA 1N8RC 4Y92A 2I2LA 2D6FA 1QVPA 4OMNA 1GCQC 1JO8A 1QLYA 3P8HA 3X24B 2E1HA 2CGHA 2D1XA 4BY6C 1YCYA 1I8FA 1YI2Q 1X2QA 2NUTA
chains in the Genus database with same CATH topology
2HKQB 2COZA 2HL3A 2QK0A 2CP2A 2CP3A 2CP5A 2COWA 2CP7A 2HQHA 4B6MA 2E4HA 1WHKA 2HL5C 1WHLA 2M02A 3E2UA 1TXQA 2COYA 2Z0WA 2HKNA 3TQ7P 2CP0A 1WHHA 1IXDA 1WHGA 2CP6A 1WHJA 1WHMA 2MPXC 1TOVA 2E3IA 1LPLA 2E3HA 3RDVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HKQ B;  2COZ A;  2HL3 A;  2QK0 A;  2CP2 A;  2CP3 A;  2CP5 A;  2COW A;  2CP7 A;  2HQH A;  4B6M A;  2E4H A;  1WHK A;  2HL5 C;  1WHL A;  2M02 A;  3E2U A;  1TXQ A;  2COY A;  2Z0W A;  2HKN A;  3TQ7 P;  2CP0 A;  1WHH A;  1IXD A;  1WHG A;  2CP6 A;  1WHJ A;  1WHM A;  2MPX C;  1TOV A;  2E3I A;  1LPL A;  2E3H A;  3RDV A; 
#chains in the Genus database with same CATH topology
 2CSQ A;  5CCA A;  1M90 U;  3CCJ A;  2ENM A;  2B86 A;  3CCE T;  4QQD A;  3M5A A;  1TUD A;  1YIJ T;  1AWW A;  5FRM A;  4M7A D;  2CZ1 B;  4FYX B;  3HRU A;  2KGT A;  4MZP A;  4Z02 A;  1VYU A;  4A54 A;  1YJN T;  3JCM V;  5IAY A;  2DET A;  1OX9 A;  1Y71 A;  2QGG A;  4AMC A;  1NJI R;  1RI0 A;  4OMM A;  5GAM j;  3M4G A;  5IXB A;  2QQB A;  3CCE Q;  3JAM E;  4E7I A;  1HK9 A;  3QZ5 B;  5KYW B;  2DFU A;  2WSE E;  3CCQ A;  4EDU A;  4XU0 A;  4PJO E;  2RM4 A;  2CZ0 B;  3EGU A;  4BD3 A;  3OW2 P;  1MND A;  2ROT A;  1YJN Q;  5DM7 R;  1B34 B;  1VQK A;  4C5I A;  2XID A;  2QDY B;  1BIA A;  2RK2 A;  3LGL A;  1SHF A;  3QDF A;  4XQ3 A;  1WIE A;  2MCN A;  2CP7 A;  2F2W A;  2WSC E;  4DEY A;  1S72 T;  1R77 A;  3QYH B;  3PVQ A;  2E41 A;  8ATC B;  2ROL A;  3JB9 J;  4M75 E;  3R6N A;  4JPB W;  5IHN A;  1UUE A;  4J9H A;  2KT1 A;  1BU1 A;  4N4H A;  1X2K A;  2DIG A;  5CQY A;  3EGD B;  4QVD A;  5IH2 A;  1W2B P;  4HT9 A;  1S72 Q;  2AZV A;  4OVA A;  2RHI A;  1M2V A;  2HL5 C;  4X1V A;  1G83 A;  2FPE A;  2DTI A;  2A37 A;  3ZBD A;  4RMO A;  1YI2 A;  3I55 Q;  2OAW A;  4JJB A;  2LZ6 B;  2C0O A;  2HBW A;  2LTO A;  2E3I A;  1M8M A;  3P8B B;  3CXC S;  1IB8 A;  4KH0 B;  2M51 A;  5HCK A;  4F7U B;  2AK5 A;  2JUF A;  1AWJ A;  4OP0 A;  2F2X A;  3A8L B;  1UFF A;  3QZ9 B;  1JJ2 P;  2FPF A;  1NG2 A;  2PU9 B;  3VS2 A;  2E12 A;  5FRO A;  2K5F A;  1K1Z A;  2PTK A;  5GAN 7;  1D1B A;  3MCA B;  2YUO A;  4LDV A;  4JJC A;  2E5Q A;  2AKK A;  4HCB A;  3CCE A;  1JEG A;  4R0K A;  1Q86 R;  2CT3 A;  2YUP A;  4RTZ A;  1AZG B;  1KK7 A;  2V1R A;  3OS5 A;  4KUL A;  1YJN A;  1TSF A;  2E64 A;  2LP5 A;  1M8V A;  2XK0 A;  5HK3 A;  5AYF A;  1VIE A;  2BKD N;  2JZ2 A;  3CMA T;  4X9D A;  2LDM A;  2OX7 A;  3G4S Q;  2FRW A;  3EFS A;  2MOX A;  5GMK j;  3X20 B;  2CS7 A;  5FRN A;  4CC3 A;  2RHX A;  1W70 A;  4C0D B;  1G2B A;  3VUB A;  3OQ5 A;  3UA6 A;  2X51 A;  1DJ7 B;  2VGN A;  4RTX A;  3EG2 A;  2P0P A;  3S3M A;  4M77 F;  1X6O A;  4C0Z A;  1BI2 A;  3MHX A;  3M59 A;  5CKF A;  2XDP A;  1GCP A;  4Z8A A;  2DXU A;  2OTJ T;  4PFZ A;  2VWF A;  1VQ9 T;  1S72 A;  1K76 A;  5KYX A;  2EJ9 A;  3V7S A;  2M9U A;  2JM9 A;  4C0D C;  2EQJ A;  2DZ9 A;  2NUT B;  3OYY A;  1QWE A;  3H8Z A;  4A4G A;  5KCH A;  2E65 A;  1OX8 A;  4M77 E;  3OBW A;  1IZ6 A;  4XTY A;  1VQL Q;  4KRT A;  4HCK A;  3LLR A;  3CPW A;  2CDT A;  2M0Y A;  1VQP Q;  3O5Z A;  4D6W A;  4RKU E;  5GAO p;  2DM1 A;  1NPP A;  1Z9Z A;  1LCK A;  1WHJ A;  3RNJ A;  4FSX A;  1KQ1 A;  1VQ6 T;  3EG3 A;  2LCL A;  4OMO A;  3O8V A;  3CPF A;  3J7A F;  3MP8 A;  4C8Q A;  3JCM W;  1LJO A;  2YUN A;  4LN2 A;  4XTW A;  1WXU A;  2F5T X;  3CC4 T;  1M3B A;  1SF9 A;  5GAN 5;  4M7A C;  1YNZ A;  2BTT A;  5FU6 C;  1C6V X;  2JMC A;  3VYG A;  4A63 B;  1S1N A;  2DTO A;  1UGR B;  1PKT A;  3SB2 A;  4ESR A;  1N9S A;  5DY9 A;  1NM7 A;  2W10 A;  3A98 A;  3OYH A;  2E5K A;  1X27 A;  3EG9 A;  2L3Q A;  3JCM d;  2XHC A;  4MDW A;  1BKB A;  1QWF A;  3GIB A;  1OV3 A;  4M77 D;  1NLO C;  2YLB A;  2EYY A;  4RTY A;  3H6Z A;  1GFD A;  5GAM h;  4JRP A;  4AFU C;  1X69 A;  3D7S B;  5GAN d;  3I9Q A;  2GNC A;  2CKK A;  1M2V B;  1ZX6 A;  1KQS S;  4M7D G;  2EJF A;  1X75 C;  4BI8 B;  4BDZ A;  4M7A G;  4J9G A;  3SHW A;  1UJY A;  3THK A;  4KGX B;  1MMD A;  3QJY A;  5KYN A;  1VQL A;  1VQM T;  1RUW A;  4L59 A;  5GAN 3;  3FB9 A;  2MWP A;  1VQ8 T;  2OTJ A;  3J80 E;  3GF5 A;  2KRM A;  3GLX A;  5A0G A;  3OMG A;  2RF0 A;  5CIU A;  1FX7 A;  2Z0W A;  3TEE A;  1QP3 A;  3CC7 Q;  3UPU A;  1V76 A;  1PNJ A;  3VUZ A;  3G7Z A;  4GBQ A;  1OZ2 A;  3GP8 A;  2FEI A;  4EIK A;  1MHN A;  3SEM A;  2HBP A;  1OU8 A;  4PJO C;  1B3Q A;  2CP3 A;  1K73 C;  1MV3 A;  2RD1 A;  4J9C A;  1MGQ A;  3OSS C;  3C94 A;  3T9N A;  5GAO r;  1IRE B;  1KD1 R;  3H0I A;  5FU7 C;  4JLI A;  2PVD B;  1UHF A;  2ZAE A;  2ZPE B;  4XK8 E;  1AT1 B;  2YWW A;  4FIB A;  4E6R A;  1KC8 R;  1AWX A;  4EPC A;  1IRX A;  2VC8 A;  3CBP A;  3OA6 A;  4E7L A;  4E7Z A;  1U1S A;  3L1A A;  2FG0 A;  2DEU A;  1UTI A;  2DD4 A;  1D3B A;  4EMK C;  2RK1 A;  1WHG A;  1OYX A;  2J6O A;  3FLG A;  1V29 B;  3JSC A;  1PSF A;  3M56 A;  4PNO A;  5KYX B;  4PJO G;  3I56 Q;  1XQH A;  3QXE B;  2JMA A;  3EAE A;  2AT1 B;  1FMW A;  3MEV A;  5HK0 A;  1D1C A;  1O9S A;  1D0Y A;  1QQJ A;  2GFU A;  2XKO C;  3HFO A;  3OBY A;  2HQX A;  3ZEH A;  2DMO A;  4L5G A;  2OI3 A;  2ZPG B;  4UC4 A;  4IUQ A;  5GMK h;  5D6X A;  2NUZ A;  2E3H A;  2MIO A;  1ZA1 B;  4Z89 A;  1M1K C;  3OYD A;  2COZ A;  3VYH B;  2DRM A;  2JJ9 A;  5CQX A;  2DEQ A;  3LH0 A;  4IUU A;  4B6M A;  1ZQ1 A;  1JRI A;  1XNI A;  1H3H A;  2QAS A;  4C8Q B;  4M75 G;  4PJN A;  3KFV A;  1VQM A;  2HDA A;  2BE9 B;  2D0N A;  1EX4 A;  3INZ A;  5LJ5 e;  3EHQ A;  2OJ2 A;  5LJ5 f;  1UJ0 A;  1IHW A;  2HZY A;  4LNP A;  2DL5 A;  1Q81 C;  3G1J A;  1VQ5 Q;  2EW3 A;  4RCC A;  1TTH B;  4E2F B;  1I5O B;  4AG1 C;  2YHT A;  4B9W A;  2EYZ A;  3OYJ A;  2QGF B;  2FZK B;  1Z9Q A;  3M0R A;  2QG9 B;  5IHK A;  2JT4 A;  1TWB A;  3EG9 B;  1M90 R;  3SDZ A;  2YDL A;  3H0F A;  1RAF B;  2I0N A;  1QCO A;  2KVQ G;  3VS6 A;  2AHJ B;  2LX7 A;  3JCM X;  5J3B A;  3OW2 S;  4OMF B;  4D8D A;  2CP2 A;  3JRZ A;  4OGC A;  3L2Q A;  2COW A;  4RTU A;  2LJ3 A;  3TSW A;  5CKD A;  2K79 A;  3FJ5 A;  4QT7 A;  1RAH B;  1BIB A;  4CC7 A;  3BY7 A;  2EKO A;  2RHY A;  2LNV A;  1N9R A;  4KUD K;  3KXT A;  4E7K A;  3QWX X;  2DL4 A;  3HFN A;  1ZUK A;  4F04 B;  3I56 A;  1EZZ B;  2O2O A;  2M02 A;  1K9M C;  3JCM e;  4ZGJ B;  4M77 C;  4C5G A;  2QI2 A;  1YHQ T;  2Y4X A;  3HL8 A;  3M54 A;  1VQ7 Q;  2B8A A;  3AT1 B;  4M7D F;  2E10 A;  1HJD A;  1OOT A;  1VYV A;  5KCO A;  2H8H A;  3DB3 A;  1Q7Y C;  1ZLM A;  1AZE A;  1WZO A;  3CEY A;  1W2B S;  2M16 A;  1MMA A;  3RR6 A;  5GAN e;  2MMP A;  1UGV A;  2P4R A;  1TOV A;  4BE0 A;  4AFQ C;  3ZL7 C;  4MML A;  5LJ3 e;  3E9G A;  4ELZ C;  3L2W A;  1U8R A;  5LJ3 f;  1MV0 B;  3JCM g;  2XMF A;  2ESW A;  3SD4 A;  2ZCF B;  4QW2 A;  1VQN T;  1EIF A;  1RAC B;  4ANJ A;  2K2M A;  4XAX B;  1JJ2 S;  3A8H B;  2E6Z A;  1VQ5 A;  1TG0 A;  4M78 E;  3REA B;  3A8M B;  2GGR A;  1SPK A;  3CBM A;  2XG8 D;  4M77 G;  5L23 A;  4BY6 B;  4HVU A;  3QJ6 A;  1G3W A;  1YI2 T;  3OS2 A;  4C92 E;  4LDY A;  2MWO A;  2J06 A;  2ABL A;  2AKL A;  4DOV A;  3VRZ A;  4OGE A;  1TH7 A;  3TCJ A;  4FW2 A;  2V26 A;  3MJX A;  1D3B B;  3CCM T;  4WTO B;  2GTJ A;  3M55 A;  2DL3 A;  5IN1 A;  2EGC A;  3RDV A;  1YJ9 Q;  3HRS A;  3VS3 A;  5A0D A;  2JS2 A;  4J9E A;  2FHD A;  2HSE B;  2QAZ A;  4AFZ C;  2GF7 A;  3X25 B;  2D8J A;  4M7D D;  1QP2 A;  1RAG B;  1N8R U;  3CCM Q;  2RQR A;  3JB9 G;  4M7D A;  3PNW C;  5GAN 8;  4M7A A;  4ZGE B;  4PJO F;  3M57 A;  2EQM A;  1A0N B;  4HA8 A;  2RN8 A;  1G3T A;  2RQV A;  1QVF A;  2PZ1 A;  2D9T A;  3MEU A;  3QII A;  5DLO A;  3M0S A;  3REB B;  1OQK A;  3GOX A;  1T3L A;  4XU1 A;  3JCM J;  1WHL A;  4AG2 C;  5KE2 A;  1WGS A;  4MZT A;  5CKE A;  1YHQ A;  5M9O A;  4FYW B;  1I5L A;  2EYQ A;  1HD3 A;  2DLP A;  4LE9 A;  2CP6 A;  3M0P A;  1F1B B;  1TUC A;  2EGE A;  2W0Z A;  3HP9 A;  4DBF A;  1U3O A;  1D0Z A;  1X43 A;  1BBZ A;  4M75 F;  1ABQ A;  2X4J A;  1MUZ A;  3LYI A;  5FWB A;  1H3Z A;  3OMC A;  1G3Y A;  2EPD A;  2F2V A;  2PUO B;  3AHU A;  2HEQ A;  1KQS A;  1RAE B;  1H64 1;  4CC4 B;  3JCM P;  3I55 T;  5GAN 6;  4KT0 E;  3TSZ A;  1I0C A;  3M4Y A;  3N5B B;  1VQN A;  1SG5 A;  1YFN A;  4BI4 A;  3QSU A;  3LH5 A;  1RLP C;  2MF2 A;  4IUR A;  1GBQ A;  1WJQ A;  2J7I A;  2GCX A;  4BB7 A;  2CYZ B;  3OS1 A;  2ZPB B;  4P5N A;  2QTX A;  2DRK A;  1M1G A;  2C0T A;  4J9F A;  2DBK A;  4PJO D;  4PK4 A;  2PVO B;  5D6W A;  3CCV Q;  3V8K A;  4PJO A;  5HKC A;  2EYX A;  4XTX A;  1XTD A;  3CCM A;  2RJF A;  2YRD A;  3OYL A;  4EMH A;  4J6X A;  4PFO A;  1YWO A;  2VXE A;  3RIR A;  6AT1 B;  7AT1 B;  4LXC A;  2RH2 A;  3EG1 A;  2DYB A;  3G4S T;  1ZA2 B;  1I81 A;  2IIM A;  1KHC A;  1JXM A;  2A08 A;  2RQW A;  2LX9 A;  1NJI C;  3NGP A;  4M75 D;  3DLL A;  2VYT A;  5GAM e;  3UF4 A;  5GAM f;  4VUB A;  2JS0 A;  3OB9 A;  1MMN A;  4EMK A;  4BUG A;  4A4K A;  3NTK A;  4DQ2 A;  1G8X A;  2DE0 X;  1SRM A;  3CCU Q;  4RG2 A;  4JS5 A;  1VQL T;  2EBP A;  4J9B A;  1BI3 A;  1H92 A;  1VQP T;  4HKE A;  2LQW A;  2O4X A;  4QVC A;  2K3Y A;  4MDX A;  3CC2 Q;  3S3O A;  3FEO A;  4DBH A;  1VQO T;  2VAS A;  1PRM C;  2HQH A;  5CO7 A;  3ULR B;  2ZPI B;  3QO3 A;  3J81 E;  3GBQ A;  5LJ5 d;  2ECZ A;  1OI1 A;  3I55 A;  3OYE A;  1QVG P;  4IUP A;  1QW1 A;  1VA7 A;  3MEA A;  3JB9 I;  2LCC A;  3JV3 A;  4M7D B;  3CCV A;  4M7A B;  1YIT Q;  1VQO Q;  2MI6 A;  3F70 A;  5FU6 B;  4DBR A;  2HMA A;  4D8K A;  3RUX A;  2G3R A;  3ASK A;  3JB9 F;  4JJD A;  1N6A A;  2X4X A;  4DA4 A;  2F5K A;  4XTU A;  4J6W A;  5EC7 A;  3CD6 T;  1QKW A;  3NFC A;  4XU3 A;  2HKN A;  2YXY A;  4M7D C;  1E6H A;  4CI0 C;  4OMP A;  1LOJ A;  2H3J A;  2DER A;  3RKX A;  3WVE B;  2JM8 A;  4LUE A;  2ZZD A;  2X4W A;  2JVV A;  1LVK A;  2CT4 A;  3OW2 A;  3EFR A;  3URG A;  3CD6 Q;  1M5Q 1;  1Y07 A;  3VS1 A;  1OZ3 A;  2HD0 A;  2JTE A;  3OSV A;  2YRV A;  1Q86 C;  3BDL A;  3LWI A;  4L6V 5;  3FRN A;  3G4S A;  3QWY A;  4M78 C;  3TQ7 P;  2RNA A;  4N0A C;  2DX1 A;  2RQU A;  2AZS A;  1ZSZ C;  3EGX A;  1YN8 A;  1NPR A;  4X9C A;  4C92 C;  4M77 A;  2KAF A;  1Y57 A;  2L5Q A;  1PSE A;  5GAO l;  2EFI A;  1X01 A;  3I5R A;  5GMK e;  3L2U A;  4ZN3 A;  3VV0 A;  3DKM A;  4Q5W A;  1ZHI A;  2M0O A;  2DXB A;  1PHT A;  1WNL A;  4R55 A;  1D0X A;  2KK4 A;  1PCX A;  4PJJ A;  2JW4 A;  5LJ3 d;  2VV5 A;  4FYV B;  4ZNX A;  1K8A U;  1C1A A;  3CC7 T;  4PJM A;  4AFS C;  5CVI A;  2L0A A;  2RA2 A;  2HAX A;  3CCL T;  4ATO A;  4HVV A;  1VQP A;  4PJO B;  2E4H A;  2KE9 A;  2LC4 A;  1FXX A;  5GAO m;  3JB9 D;  1M9S A;  3H9N A;  3QHS A;  2OTL Q;  4M78 G;  1YIT A;  1VQO A;  1IHV A;  2XDB A;  5FU7 B;  1K0X A;  3PT9 A;  1E6G A;  1W6X A;  3U23 A;  4C92 G;  3CCL Q;  2GBQ A;  1FMV A;  2JTM A;  1EFN A;  1BYM A;  4QKU A;  2X3W D;  2HL3 A;  1UEC A;  4OMQ A;  1BB9 A;  3G6E Q;  1PG5 B;  3TRE A;  1YJW Q;  4NOY A;  3M53 A;  2EQU A;  2DVJ A;  1X6G A;  2VKN A;  1G5V A;  3VS0 A;  2Y4Y A;  4FT4 A;  4PLI A;  3OYI A;  4EMK B;  2V8J A;  2DA9 A;  1QCF A;  4LDU A;  3CD6 A;  2K3X A;  4XTV A;  1K73 U;  2LQN A;  4LDW A;  4OB0 B;  4ZN1 A;  2F1L A;  1FWZ A;  3I56 T;  4Y91 A;  2ZPH B;  4Z88 A;  4M75 C;  2LNH B;  2RI3 A;  3RES A;  1WDX A;  4BE2 A;  4J9D A;  4A4H A;  2K57 A;  2KRN A;  4CRI A;  5GAN 2;  1ZSG A;  2O4X B;  4A4F A;  2VUB A;  4K11 A;  1ABO A;  3S6W A;  1Q82 R;  4C0F A;  2DYI A;  2K4Y A;  5KYU A;  4PFP A;  4E7S A;  1KSW A;  2LT1 A;  1KHI A;  2ATC B;  3V7R A;  3HKS A;  1HSQ A;  4JUV A;  3A5Z B;  2SRC A;  2GQI A;  1VUB A;  1WFW A;  5GAN j;  3E19 A;  2RMO A;  2OTL A;  3OYK A;  3SWN C;  4J7I A;  5A2Q E;  1VQ5 T;  1RAB B;  3QG1 A;  3CC7 A;  1QVF P;  1R8O B;  2DXT A;  2CRE A;  4OB1 B;  4NS5 A;  3CCL A;  1AVZ C;  3RKW A;  4F14 A;  2FRY A;  2QDL A;  2DK3 A;  3OYF A;  2BZY A;  3C4S A;  1M1K U;  1RI9 A;  1QMC A;  2YT6 A;  2LT4 A;  3PMI A;  2P4T A;  4CC2 A;  2EJG A;  3CPW S;  3M0T A;  5IT9 E;  4F7U E;  3CCS Q;  2A3L A;  3BFM A;  1KIK A;  2KNB B;  1UB4 A;  1UG1 A;  2V8I A;  1UDL A;  4RTW A;  3GPL A;  3KUF A;  2DO3 A;  1NBE B;  1KD1 C;  1ACM B;  2H3E B;  1Q81 U;  1U1T A;  3EGX B;  1K0S A;  4M77 B;  3L42 A;  3CXC A;  4BAC A;  1N8R R;  5LJ5 g;  1VQ7 T;  1KC8 C;  9ATC B;  2AIR B;  2KEA A;  3MPU B;  1TXQ A;  3NPF A;  1ZBJ A;  2DIQ A;  3UA7 A;  2QQ9 A;  1WX6 A;  2LVM A;  3OYG A;  2BUD A;  5FW9 A;  5GAO n;  1JQQ A;  4OB3 B;  2C06 A;  5GAM d;  5KE3 A;  1M30 A;  4IIM A;  1PD0 A;  3CCJ Q;  1WXT A;  4MMK A;  1GFC A;  5C6S A;  2O01 E;  4FU6 A;  1NEB A;  1UGP B;  5GMK l;  1Q82 U;  3EH1 A;  1JXO A;  2MPX C;  2O31 A;  4WCI A;  1IGU A;  3FIF A;  1CKA A;  4DBQ A;  3VU3 C;  4GLM A;  1UEB A;  3I5S A;  4M78 F;  1AD5 A;  4TVR A;  1SKU B;  1WYX A;  3E2U A;  1Q7Y U;  1Y96 A;  4C92 F;  1KJW A;  1RL2 A;  4ORZ A;  1WJR A;  3CCQ Q;  1LNX A;  3UAT A;  3HHT B;  1SHG A;  2K5I A;  3NMZ C;  1OPK A;  1M3A A;  3HTR A;  1V1C A;  5GAN g;  3RKY A;  4B9X A;  3RBB B;  1YJ9 T;  3HRT A;  2LJ0 A;  1IO6 A;  4QQ6 A;  2RB6 A;  2RJC A;  1SSF A;  2DF6 A;  3QBY A;  5I11 A;  5LJ3 g;  2XI9 A;  1JBM A;  2LQK A;  2HNI A;  3MP1 A;  1QCN A;  3C12 A;  4Y28 E;  3VJP A;  3JB9 H;  1XOV A;  2CH4 A;  4F16 A;  1J3T A;  3ME9 A;  1N5Z A;  1M90 C;  1Q95 G;  5CR2 A;  5KH6 A;  5LJ5 h;  3NTH A;  1NYF A;  2BIV A;  2F69 A;  2QA4 T;  3CME T;  3MO8 A;  1KQ2 A;  2VGM A;  5KYU B;  1B7T A;  1O75 A;  3QDR B;  5D7U A;  2L8D A;  1IXD A;  1VQ4 T;  3OYC A;  3UDC A;  2CSI A;  1VQ7 A;  1W4S A;  3CPW P;  3MKD A;  1RAI B;  2LCS A;  1UE9 A;  4KGV B;  2NLU A;  2P0Q A;  2DL7 A;  2MAM A;  2ZPF B;  2QA4 Q;  4O6J A;  3CME Q;  2EIF A;  4M78 D;  1VIF A;  1VQ4 Q;  1UHC A;  3M0U A;  3TVT A;  4M78 A;  1OPL A;  1GXI E;  2KRS A;  4II1 A;  4N0A A;  4C92 D;  5J39 A;  3PFS A;  1ZSZ A;  2P84 A;  1QVG S;  4C92 A;  3PVL A;  4BI3 A;  3KBG A;  2ZGW A;  1FMK A;  2DL8 A;  4IUV A;  2K7A A;  1G3S A;  3I35 A;  2CP5 A;  1YIJ Q;  4AT1 B;  2IG0 A;  1TU0 B;  1M27 C;  4E47 A;  2RHZ A;  5I2S A;  3JCM h;  4KBM B;  2KRO A;  3DLM A;  1WQW A;  2JNG A;  4FYY B;  2MK5 A;  3FC3 A;  1BCM A;  3EFO A;  1NYG A;  1I4K 1;  2CUD A;  4JZ3 A;  3QUI A;  2KI7 A;  1YCS B;  5GAN h;  3L2V A;  3H0H A;  1R0B G;  3CCV T;  3L2Z A;  5I22 A;  1OU9 A;  2XDD A;  5LJ3 h;  3CCR T;  2KT8 A;  2FPD A;  3FDR A;  5HY6 A;  1Y0M A;  4JZ4 A;  4RCB A;  1WLP B;  4HT8 A;  1YJ9 A;  4OB2 B;  1WHM A;  3S3N A;  1X6B A;  3BDU A;  1RLQ C;  2HKQ B;  4HXJ A;  1QKX A;  2DJQ A;  2CZ6 B;  2OAU A;  2EKH A;  1U06 A;  3BE3 A;  1P92 A;  2K6D A;  4GY5 A;  3VS5 A;  3CCR Q;  1BCO A;  1T0H A;  2QQR A;  2M1H A;  4N4I A;  2PUK B;  3PE0 A;  2L3P A;  1PRL C;  2YRC A;  2QA4 A;  5GJW B;  3CME A;  1RAD B;  1CKB A;  3OYB A;  4JRK A;  1VQ4 A;  2A7Y A;  2O9V A;  2FB7 A;  2FZG B;  2EGA A;  2KYB A;  2X9H A;  3CCU T;  4IIO A;  5GMK i;  1Y96 B;  4M75 A;  2O9S A;  4C8Q F;  3LGF A;  3PTA A;  1WXB A;  1YIJ A;  1C0M A;  3CBO A;  2RHU A;  3WXM B;  2PQW A;  3CC2 T;  2EQI A;  3Q1J A;  2DTH A;  1T0J A;  1NJI U;  2A28 A;  5GAO q;  1K8A R;  1BI0 A;  3PMT A;  3JCM Q;  4C8Q E;  1PC0 A;  4KGZ B;  2C0I A;  3DB4 A;  3NHN A;  2E70 A;  3NTI A;  3M9Q A;  2ED0 A;  3P8D A;  4FSS A;  1NEG A;  1D1A A;  4YTL A;  1SEM A;  5GAM g;  2NUP A;  4M4Z A;  1YIT T;  1IGQ A;  3SWN A;  5I2M A;  5A0L A;  2KY9 A;  4KUI A;  2EAY A;  3CMA Q;  2KSS A;  2V1Q A;  1VOM A;  2J6F A;  2QQS A;  4IKF A;  4ME7 A;  2ED1 A;  3QYG B;  1ZBX A;  2A0F B;  2DIL A;  3A1P A;  3M0Q A;  4F7U G;  1UGS B;  2E6N A;  4A53 A;  1N27 A;  4WF2 A;  3CCR A;  4HVW A;  2YSQ A;  4J5Y A;  5L8R E;  3WVD B;  2G6F X;  2OTJ Q;  5FWC A;  3V7C A;  4FT2 A;  2JXB A;  3C0C A;  1NE8 A;  1VQ9 Q;  4M78 B;  1M2O A;  4PL6 A;  1K73 R;  2GTO A;  2FYK A;  2FL7 A;  4IUT A;  3EH2 A;  1ZSZ B;  2X4Y A;  4C92 B;  4EMG A;  4C8Q D;  2YLC A;  3HPW A;  4HCC A;  3LWH A;  4C5E A;  3PIP A;  5KYY A;  1WA7 A;  2KDS A;  2KXD A;  4QVZ A;  2J05 A;  1ZUY A;  2COY A;  2R58 A;  2YUQ A;  2LJ1 A;  3OYN A;  2L3R A;  4XU2 A;  3A8O B;  4RUG A;  8AT1 B;  2SEM A;  2IPO B;  1FYN A;  1SSH A;  1QVF S;  1VQ6 Q;  1PM3 A;  2K5L A;  1I1J A;  3EFO B;  2LRQ A;  3GNF B;  3CCU A;  4JDS A;  4HCZ A;  1R0C B;  2CUB A;  1AOJ A;  4MZM A;  3QKJ A;  3IQL A;  2DPP B;  2DBM A;  2EYW A;  5D6Y A;  3CC4 Q;  2L89 A;  1M3C A;  1Q86 U;  3CXC P;  1W2B A;  4DOW A;  3CC2 A;  3MET A;  2OTL T;  2GQV A;  1K8A C;  3EG0 A;  1ARK A;  2PNI A;  4FW1 A;  1W1F A;  3M58 A;  4E7H A;  2O88 A;  1TS9 A;  1OUL A;  3QPH A;  2QEX T;  3MEW A;  2QK0 A;  4RTT A;  3CMA A;  2XD0 A;  3A8G B;  3OYA A;  1PKS A;  1JU5 C;  3G6E T;  1K9A A;  3GNG A;  5AT1 B;  2FO0 A;  2WSF E;  3RMQ A;  1YJW T;  3L2R A;  1MNE A;  1M1K R;  4FM4 B;  3FJP A;  2MYS A;  5ECA A;  4F17 A;  4BE1 A;  1JJ2 A;  1HXD A;  1AWO A;  1LPL A;  2QEX Q;  2DKG A;  2L3S A;  1XJW B;  5LJ5 j;  4PKC C;  2DNU A;  2EQK A;  4FCY A;  1VQ9 A;  4RG8 A;  4X34 A;  3VRY A;  1KG1 A;  1Q81 R;  3PGG A;  4M75 B;  2RO0 A;  1VQM Q;  2X35 A;  2RJD A;  2KMT A;  4C0G A;  3BW1 A;  3UT1 A;  2JTF A;  5DLQ E;  1VQ8 Q;  2DJZ A;  5GJV B;  3VS4 A;  2RJE A;  2VVK A;  1WI7 A;  3LW5 E;  3JCM b;  2DZC A;  2RI2 A;  1GCQ A;  3RER A;  1H8K A;  1VQ6 A;  2CP0 A;  2XU8 A;  3JCM c;  3H41 A;  1Y7X A;  1AHJ B;  3CC4 A;  1CSK A;  2NUP B;  1YBY A;  1WHK A;  3R6O A;  2D8H A;  3SWN B;  5CK9 A;  4ZTF A;  4LUD A;  4J9I A;  1K9M R;  1AEY A;  3X28 B;  4PJL A;  2CZ7 B;  4QQG A;  1PWT A;  2WAC A;  3EHR A;  4JLG A;  2DD5 A;  4R56 A;  4J7F A;  1QVG A;  1Q7Y R;  2DVE A;  1JB0 E;  4E7J A;  1RAA B;  5IXF A;  1WQ7 A;  2FVU A;  1ZUU A;  4RTV A;  2DXC A;  4J8O A;  3CQT A;  3MP6 A;  4JRI A;  2IVW A;  3CCS T;  4LD9 K;  2KR3 A;  1BI1 A;  5I21 A;  5LJ3 j;  4JS4 A;  1YP5 A;  4F7U F;  3X26 B;  2QEX A;  3G71 T;  4BDY A;  1NZ9 A;  1TUG B;  2QTV A;  1YWP A;  1GBR A;  4NL3 A;  1SRL A;  3G6E A;  4C5H A;  2QXF A;  2KQW A;  4V2S A;  1E7O A;  5KYW A;  4OML A;  1YJW A;  1NLP C;  1OEB A;  2BZX A;  2HSP A;  3UWN A;  5KYY B;  3PIO A;  2BE7 D;  2VXF A;  4DEX A;  1M1F A;  3G71 Q;  1B34 A;  4A4E A;  3TU4 K;  3V8J A;  2K9G A;  1VQ8 A;  2R5M A;  4OF1 A;  1KQS P;  1D09 B;  2GFA A;  2R57 A;  4C8Q C;  3LX7 A;  3OS0 A;  1UGQ B;  3OY9 A;  3CCJ T;  2QQA A;  3V8L A;  2EVR A;  1U5S A;  1WHH A;  2FZC B;  4J83 A;  4N4G A;  4ELY C;  1WJS A;  1KD1 U;  3EGD A;  2RQT A;  2Y90 A;  5J26 A;  2XIC A;  3VS7 A;  4ZTJ A;  3VKI A;  1KC8 U;  2NYS A;  2PVG B;  1M4Z A;  1T3S A;  1Q82 C;  3C95 A;  2P0K A;  4LD6 A;  2LQ8 A;  2HCK A;  3CCQ T;  1MMG A;  2NWM A;  2X3X D;  1GL5 A;  2KXC A;  1WPY A;  3SFM A;  1K9M U;  3JCM f;  1GRI A;  4F7U A;  2LMJ A;  2R5A A;  4PLL A;  1B07 A;  1VQK T;  1I07 A;  4M7A F;  2JN0 A;  4C8Q G;  3ER0 A;  2RPN A;  2VB6 A;  3RMS A;  2QYZ A;  2D0Q B;  5GAN f;  5CAI A;  1YHQ Q;  4M7D E;  1HYO A;  5LL6 S;  4M7A E;  5GMK m;  4XTZ A;  2CH4 W;  4NL2 A;  2K2V A;  3E9F A;  1VQK Q;  2BZ8 A;  3CCS A;  5C0M A;  2JOY A;  1BK2 A;  2V8K A;  5EG2 A;  3G71 A;  2K3B A;  4ZGD B;  2L2P A;  4KH1 B;  4JJN K;  3HSB A;  4GLK A;  4FL6 A;  3E1S A;  2DAQ A;  5GAN 4;  2KBT A;  1K4U S;  1KFZ A;  2EWN A;  3OYM A;  2KYM A;  4JRQ A;  4O5V A;  5CKH A;  2RI5 A;  1PD1 A;  3ZFJ A;  1VQN Q;  5IHI A;  2HQE A;  1VYT A;  5CKB A;  4LDX A;  5FLX E;  2A36 A;  4J6Y A;  2J6K A;  1N8R C;  4Y92 A;  2I2L A;  2D6F A;  1QVP A;  4OMN A;  1GCQ C;  1JO8 A;  1QLY A;  3P8H A;  3X24 B;  2E1H A;  2CGH A;  2D1X A;  4BY6 C;  1YCY A;  1I8F A;  1YI2 Q;  1X2Q A;  2NUT A; 
#chains in the Genus database with same CATH homology
 2HKQ B;  2COZ A;  2HL3 A;  2QK0 A;  2CP2 A;  2CP3 A;  2CP5 A;  2COW A;  2CP7 A;  2HQH A;  4B6M A;  2E4H A;  1WHK A;  2HL5 C;  1WHL A;  2M02 A;  3E2U A;  1TXQ A;  2COY A;  2Z0W A;  2HKN A;  3TQ7 P;  2CP0 A;  1WHH A;  1IXD A;  1WHG A;  2CP6 A;  1WHJ A;  1WHM A;  2MPX C;  1TOV A;  2E3I A;  1LPL A;  2E3H A;  3RDV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...