1WHLA

Solution structure of the 1st cap-gly domain in human cylindromatosis tumor suppressor cyld
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
95
structure length
95
Chain Sequence
GSSGSSGIDVGCPVKVQLRSGEEKFPGVVRFRGPLLAERTVSGIFFGVELLEEGRGQGFTDGVYQGKQLFQCDEDCGVFVALDKLELIESGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the 1st CAP-Gly domain in human cylindromatosis tumor suppressor CYLD
rcsb
source organism Homo sapiens
molecule tags Antitumor protein
molecule keywords Cylindromatosis tumor suppressor CYLD
total genus 7
structure length 95
sequence length 95
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2004-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01302 CAP_GLY CAP-Gly domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.190 Mainly Beta Roll SH3 type barrels. CAP Gly-rich-like domain 1whlA00
1IXDA 1WHGA 1WHKA 4B6MA 2E3HA 3E2UA 2HL3A 2CP0A 2HKNA 1TOVA 3RDVA 1WHHA 2QK0A 3TQ7P 1WHJA 2COZA 2M02A 1TXQA 2HL5C 2CP7A 2HKQB 2CP6A 2CP2A 2CP5A 1LPLA 2COWA 1WHLA 2E4HA 2CP3A 2E3IA 1WHMA 2Z0WA 2HQHA 2MPXC 2COYA
chains in the Genus database with same CATH superfamily
2NLUA 5DM7R 1R0CB 1SPKA 3A1PA 4XTUA 9ATCB 1G3WA 2KRSA 2RMOA 2DM1A 3CPWA 3OQ5A 4XTYA 1IRXA 3OYJA 2AZVA 3M0RA 2KMTA 3N5BB 2HKQB 4J83A 1VQ8Q 4XAXB 1AD5A 3RKYA 1GRIA 2DRKA 3GIBA 3PFSA 3UA6A 4EDUA 2DXUA 1Q81U 2FB7A 2EQIA 3QHSA 1FXXA 3E2UA 1UGVA 4FT4A 5KE2A 5KYYA 3A8OB 1PWTA 3H0IA 2V1RA 4FYWB 4J9CA 5GAOp 3KFVA 1OULA 2EAYA 4EPCA 3QJ6A 3VV0A 2LT4A 2RI5A 4HKEA 4HT8A 1GFCA 1SRLA 2HD0A 1KG1A 2EYYA 1WDXA 1IGUA 1UJ0A 3CCST 1VQLQ 4D6WA 4CI0C 4RTWA 3JCMc 3I9QA 3NHNA 2X4WA 4IURA 2K2VA 1K9MR 3CCRT 1M1KC 3JCMW 3QKJA 1V29B 1Q7YC 2EJ9A 3UWNA 4MDXA 3VRZA 4KGZB 3G71A 1NJIR 1LNXA 2XDPA 3MEAA 3CCLT 3CCUA 2RQUA 4M75D 3QWYA 3O8VA 2RI3A 4Y92A 4M7AE 5FU6C 1Q86U 5FROA 5GAMh 3MHXA 2R5MA 2QDYB 3CC2T 3VYHB 4A54A 5GAMe 2C0TA 4P5NA 3L2RA 2L3PA 2VGNA 1WFWA 4LDYA 2E1HA 3OMGA 5C0MA 2NYSA 1VQ5T 3PNWC 1UDLA 2MCNA 2C06A 3JCMe 3I35A 3OYEA 2PUKB 4BY6B 1KC8C 4M7DE 3OYHA 3VU3C 2H3JA 2VASA 1VYTA 1AHJB 2KT1A 4NL2A 2X51A 4N4IA 3QZ5B 2EGCA 1UGQB 4FYYB 1VQ7T 2CT3A 2A36A 4C0DC 1JB0E 2FPEA 1NEGA 5GAN4 1UG1A 1JO8A 4M7DB 1MNEA 2D0QB 3BW1A 2V8JA 4M75E 2HCKA 1TUGB 2JM9A 4OB1B 1X27A 2QTXA 5GAOq 5KYXA 2E6NA 2DETA 5CKFA 1Q82C 4ZGEB 3OS1A 3LX7A 1KQSA 2DXCA 2RQRA 1YIJQ 2G3RA 2DVJA 2WSEE 2LJ0A 4QKUA 5J39A 4BB7A 3JCMg 1N8RR 5D6YA 3CMEA 3OYGA 2YLBA 1K8AU 1RACB 1KFZA 5LJ5f 3TVTA 2ZPFB 3MEUA 5CKBA 4BDZA 1VQNT 4JZ3A 1WPYA 1ABQA 2DL5A 2BUDA 2GFAA 2MIOA 1W2BS 2E70A 3C4SA 4N4HA 5A0LA 1KQSP 1D1CA 1NPPA 2FG0A 4M78E 2QEXA 3S3OA 1WYXA 2J6FA 1ARKA 5GJVB 1QKWA 2CP7A 4LUDA 4QT7A 3L42A 3I55A 4LD9K 2DERA 5FU7C 1ZA1B 3OSSC 1IZ6A 1M30A 1PSFA 3PIPA 2D6FA 1NM7A 3VUBA 2FO0A 4RTYA 3EH2A 2OTLQ 3C94A 2NUTB 2XMFA 1VQ4Q 4IUTA 1Q81C 1VA7A 1TXQA 3I5RA 1YHQA 2YWWA 2O9SA 1JJ2P 4M4ZA 1QCOA 1G5VA 1X75C 4C0ZA 4KT0E 2CGHA 1TU0B 4HCZA 1OX8A 1YJNA 3G4ST 2RNAA 1N8RU 5KH6A 1UGSB 4AG1C 2R57A 1G83A 3LGLA 1VQ8T 1K73R 4HVWA 3LWIA 1H3HA 4MMLA 1UFFA 3FIFA 2K3XA 1GFDA 1QLYA 3M0QA 2H3EB 2CH4A 1QWEA 1SSHA 1I5OB 1QP2A 3M0TA 2PU9B 4AFSC 2ZGWA 4Y91A 1KJWA 1D1AA 4XTXA 1YHQT 1M4ZA 4PLLA 4J9GA 4ANJA 3X26B 2PVDB 1K9MC 1G3SA 2YUPA 3AHUA 2E12A 2QASA 4CC3A 1QVFP 4HCCA 1G8XA 4IIOA 2EJFA 2OAUA 5KYUB 2CSIA 1B07A 3M5AA 4L59A 2IVWA 1WQWA 2F5TX 4FCYA 4J9IA 3MP6A 1I0CA 2AIRB 1BIBA 5CK9A 4GY5A 3DB3A 2JZ2A 2EYZA 1FMWA 2C0OA 3BDLA 3CCVA 3NPFA 3ASKA 3QPHA 3HFNA 3QYHB 1E6GA 4LN2A 3PGGA 1VQKA 1H92A 2DNUA 3BFMA 4BACA 2NUPA 3IQLA 3V7CA 1JEGA 3SEMA 2X4XA 4J5YA 1WJRA 1PD0A 4BY6C 5AYFA 1MMNA 2VVKA 1YI2A 2DMOA 3RNJA 4EMGA 4PJOE 2COZA 3CCUQ 1S1NA 4ZGDB 1Q7YR 1RAEB 2MAMA 3UATA 4MZTA 2EIFA 4A4KA 5LJ5h 3PIOA 4OGCA 1NJIC 2DE0X 4DEYA 2H8HA 2X4YA 4PL6A 2CH4W 4C8QE 1VQ7A 2KYMA 2BE9B 3TQ7P 1G3YA 3CCMA 4OB0B 4KUDK 1QKXA 1KQ1A 3O5ZA 1W2BP 3M59A 2P4RA 1KD1C 2CYZB 1TWBA 3A98A 2COYA 4KRTA 3T9NA 1ACMB 4ZTFA 3M53A 3I5SA 2EYXA 1XOVA 1B34B 1HSQA 1KK7A 8ATCB 1W2BA 1YIJT 1D09B 3F70A 1YFNA 2FZGB 5GAOm 2VXEA 4JJNK 3JCMd 2ROTA 1AWXA 4FYVB 3FC3A 1IB8A 2DFUA 1YI2T 1KD1U 3QO3A 5A0DA 4HCBA 1VQMA 2P0PA 2V1QA 5HKCA 3R6OA 3J80E 1I5LA 1OU9A 2BTTA 3BY7A 3L1AA 5GANe 5ECAA 1HD3A 4E7SA 5I21A 3CEYA 4LDWA 3EFOA 1QWFA 3EG9B 4K11A 2QEXQ 4V2SA 2OTJQ 1ZSZC 1OEBA 3G71Q 2D8HA 3EFOB 2AKLA 4BI4A 2VKNA 4RUGA 2RQWA 4CC7A 1FMKA 3MP1A 2ED0A 3QWXX 3VJPA 2J06A 3C12A 2A7YA 4PFPA 2XKOC 2E10A 5L23A 2M0YA 5GMKh 3G4SQ 2K3YA 2LNVA 4DOVA 5FRNA 1BBZA 2BZYA 3SWNB 5LJ3j 1M27C 2DIQA 2CUBA 2RN8A 1W4SA 2RJDA 1ZUUA 5FWCA 4DA4A 1AZEA 4BI3A 1QVFS 2HNIA 2PTKA 3M4GA 2XDDA 3S3MA 4KGXB 5LL6S 3WXMB 1JJ2S 4HXJA 1QVPA 4X1VA 2E65A 3JB9G 3REAB 2Y4XA 2F2XA 5GAMj 4RTZA 3VKIA 4M78D 2JS2A 2ZPGB 1RLPC 1D0XA 2YLCA 2CREA 2ESWA 5D6XA 1SF9A 4M78C 2DKGA 2HSPA 4C8QG 1RI9A 1RL2A 2RK2A 1V1CA 2KDSA 3RKWA 1I07A 3INZA 3M57A 1PKTA 2FZCB 3EGDA 3UPUA 1MGQA 5DY9A 2NWMA 2VB6A 4RTUA 1TH7A 1XTDA 4Z88A 3MP8A 1KC8R 3V8JA 2DIGA 4VUBA 1TOVA 4KH0B 2ZCFB 4OMLA 1NPRA 4D8KA 4FIBA 1YITQ 4DBRA 2KVQG 2VXFA 4FYXB 4OMOA 3JCMQ 3G6EA 5GMKl 1HJDA 2VGMA 4MZPA 1WXBA 3CCET 3L2ZA 1BKBA 4N4GA 4JZ4A 5LJ3e 4LUEA 1I1JA 4J6XA 3P8HA 1N6AA 3HRTA 4Z89A 1OZ3A 5KYXB 3X25B 4PK4A 3JRZA 4C92E 3EFSA 1N8RC 3A8LB 1EZZB 3EG9A 5IHKA 1NEBA 1TUCA 4FM4B 3JB9J 2HQXA 1RAAB 3OBWA 2VYTA 2KNBB 4QQGA 4AMCA 2J6OA 2QYZA 3CBMA 3HRSA 3RUXA 1VQ4A 1Z9ZA 2Y90A 1R77A 3NMZC 2JJ9A 1YJNQ 1J3TA 2F69A 1WI7A 4C5HA 1KD1R 1YCYA 2DL4A 3M0UA 1YJWQ 1X6GA 4C0GA 1N9SA 2JT4A 1QQJA 4QVZA 4XQ3A 2GTJA 1E6HA 1SEMA 3E9GA 2K79A 3HFOA 2QQ9A 3C0CA 3ZFJA 4XTVA 5HY6A 1S72T 2BE7D 2PVGB 2QTVA 1U1TA 2R58A 4DBFA 2L3RA 2COWA 3CCEQ 1NYGA 4X9CA 4F7UA 2QQBA 3HRUA 2WSFE 3CCRQ 3GNFB 1VQOA 1ZSZB 2X35A 2RPNA 2DAQA 3TCJA 3CXCP 2DTHA 5CKEA 2D8JA 1OQKA 5GAN7 2KBTA 4BDYA 1X69A 3P8BB 3MO8A 4J7FA 1AWWA 5GAN8 1VQ8A 2YRDA 2CP3A 2E41A 1OYXA 4C92F 4ELYC 1BCMA 3A5ZB 3L2VA 3CXCA 5CKHA 5GMKm 1D1BA 5GMKi 1YJNT 1K9AA 1OU8A 2FHDA 5LJ3g 3G71T 1GCQA 1VQLA 3JCMf 4C8QB 1JQQA 1PC0A 5LJ3h 3M54A 1YJ9Q 1KQ2A 2X4JA 1VQMQ 2P4TA 2DTOA 3M0SA 3ER0A 1IXDA 1Q86R 2LTOA 5IXFA 2LNHB 4X9DA 3ZL7C 1LCKA 1M3CA 3FLGA 3Q1JA 2BZXA 3SD4A 4C0DB 4A4HA 1MHNA 7AT1B 1BB9A 2K9GA 3SB2A 3FB9A 4N0AC 2FYKA 2KI7A 3SDZA 2L89A 2JTMA 2HQHA 2QEXT 4PJJA 3LYIA 5KYUA 3J81E 2GTOA 2C0IA 2J05A 2X3WD 2PUOB 3OYFA 5I11A 2QDLA 1VQ7Q 4PJLA 1C0MA 1H8KA 4JJCA 3OYKA 2KRNA 3UT1A 2GBQA 3CPFA 1WNLA 2JOYA 3JCMV 4HA8A 2DJZA 3MEWA 2CZ0B 2F2VA 4BE2A 3GF5A 2J7IA 5I2SA 1R8OB 4C92A 4NL3A 5D7UA 1U3OA 1HXDA 4QQ6A 4J6WA 4J9HA 1EX4A 2RI2A 1WQ7A 1X6OA 2DD4A 3ULRB 2KXCA 5LJ3d 2LDMA 4D8DA 3CBPA 2QQSA 4E7HA 3EGXB 1GL5A 4C92D 2DK3A 2AHJB 2CP6A 1ZQ1A 3DKMA 1WJSA 2QAZA 2LQ8A 4M75G 2VUBA 5GANf 4A4EA 2JTFA 3AT1B 4A63B 3MPUB 2KR3A 2CZ7B 3PT9A 2ROLA 3PMTA 1VIFA 3V8KA 4DQ2A 1KHCA 2D1XA 1G3TA 4E7KA 4M75C 4M7AC 4JDSA 3JCMX 2K6DA 5AT1B 1M90R 4E7ZA 3EG2A 2RA2A 3M56A 1LPLA 5GANh 1YIJA 4M75A 2QQAA 5HCKA 1YITT 4PJOA 3V7SA 5IHNA 3CMEQ 4J8OA 1Y96B 3PE0A 2OTLT 4BI8B 2YHTA 4KUIA 4Y28E 2KEAA 4M78A 3L2UA 5GAOn 4PFOA 2O4XA 4F04B 4A4FA 3S3NA 2P0QA 4PFZA 3VS6A 2A08A 3HSBA 1GCQC 5DLOA 3CCLQ 1O9SA 2IG0A 2LJ3A 1QVFA 2DYBA 2LC4A 1XQHA 1PRMC 2GFUA 2A0FB 4HVVA 2I0NA 4M7DF 3A8HB 4RG8A 1KQSS 1P92A 4GLMA 3GP8A 3X24B 4EMHA 1PNJA 3PVLA 2HL5C 1CSKA 2BKDN 4LDXA 2EGAA 1T3SA 1WLPB 2MYSA 3CC2Q 4E7JA 1VQ6Q 4HVUA 3RIRA 6AT1B 2LMJA 2FRWA 2E3HA 4DEXA 1EIFA 1FX7A 4JRQA 1ZHIA 5GMKe 2PQWA 4N0AA 1PG5B 1QP3A 1Y57A 2HAXA 5CQXA 2RQTA 1YBYA 2IPOB 3CCQA 3CXCS 3P8DA 1YHQQ 1M2OA 4TVRA 1WXUA 3CMET 4Q5WA 1YWPA 2E64A 1KC8U 3EHRA 1H3ZA 2SRCA 1QVGA 1LOJA 3JCMb 2GQVA 2M02A 1ZX6A 4NS5A 3QBYA 2KGTA 1NE8A 5FW9A 2EYQA 3H9NA 1ZA2B 3CCEA 2XI9A 1D0ZA 1AWOA 2MF2A 2D0NA 5EC7A 2BZ8A 1VQ5A 2LJ1A 3G6ET 3KUFA 3HL8A 2ECZA 3L2QA 5FU7B 1TSFA 5D6WA 1ZUYA 5L8RE 4JLIA 4M78F 3EG1A 1UGPB 1XJWB 2L3QA 3CPWS 1IHVA 3QUIA 2NUZA 1YITA 1KSWA 3HHTB 1ZSZA 3S6WA 1SKUB 1X6BA 5KYYB 1U8RA 2EPDA 5GAOr 1OX9A 2RHUA 5FWBA 3VUZA 1BI3A 2EJGA 3URGA 4JRPA 5M9OA 5J3BA 4O5VA 2QK0A 2DEUA 1MNDA 2KYBA 1AEYA 1D3BA 3LLRA 3OS0A 1JRIA 2DXTA 3DLMA 5I2MA 5KE3A 1Q81R 4QVCA 3KBGA 1M5Q1 1KIKA 4C5EA 4OMFB 1IREB 2QGGA 2HZYA 1VQKQ 2L2PA 5LJ5e 3CC4Q 1MMAA 1NJIU 3H6ZA 3V8LA 4RMOA 4LDUA 2EQJA 3OW2S 4IUVA 1V76A 3ZEHA 1U5SA 1VYUA 1BK2A 4NOYA 5CVIA 3CCVQ 1YJ9A 1YI2Q 4OVAA 1BI1A 3PTAA 5GAMd 3HKSA 4RCCA 3OB9A 4B9WA 4QVDA 2K5FA 1RAHB 4XTZA 3DLLA 3HP9A 2YT6A 2A28A 2M9UA 1AOJA 3OYDA 1WHHA 2HDAA 2KK4A 1VUBA 1R0BG 5C6SA 4FSXA 2EKHA 3VS7A 2BIVA 2W10A 3CCQT 2DF6A 4OMPA 1T0JA 3VS0A 3I55T 3NTHA 2YUNA 4EMKB 3KXTA 3E1SA 1MV0B 4E47A 4JLGA 2K57A 5KYWB 2RO0A 1VQ9T 2HSEB 3M0PA 4HCKA 3V7RA 5FU6B 2CZ1B 1ZUKA 3QYGB 3PVQA 5KYWA 3JB9F 2HBPA 4LNPA 2EYWA 3BDUA 3META 4M7AD 2K7AA 4WTOB 3EH1A 4Z8AA 1I81A 4M77B 2RHIA 2OTJT 2EWNA 1OPLA 2L5QA 2KSSA 2MK5A 1VIEA 2HEQA 1BYMA 2RK1A 2YRCA 1EFNA 4WF2A 4J7IA 2DO3A 1UGRB 1H641 1BIAA 1M3BA 3JAME 2RJEA 1VQOT 4MDWA 1C1AA 1CKBA 1SSFA 1M90C 4F7UF 4JJDA 4M77C 1GXIE 2L3SA 1SRMA 3GLXA 5LJ5d 3QXEB 1WHMA 1AZGB 4AFQC 1RAFB 2ZAEA 3CCJT 1NZ9A 2RHZA 2OAWA 5GAN3 4II1A 4B9XA 2DX1A 2XICA 4XU3A 1B7TA 3CCUT 3CCLA 2DTIA 1E7OA 1M1GA 3CC2A 4E7LA 1RUWA 2D9TA 4EMKC 1NG2A 1K4US 2FRYA 1K1ZA 3RMSA 1BI0A 4IUQA 2L0AA 5GMKj 1SG5A 1M9SA 1WHGA 2CP0A 2JXBA 3VS4A 3RDVA 2E5KA 3FJ5A 4E7IA 1YN8A 2G6FX 2DLPA 3FRNA 2EQKA 1GBQA 4LDVA 1SHGA 1WJQA 2RM4A 2V8KA 3OMCA 1FWZA 3CBOA 2EGEA 2JW4A 4X34A 4F7UG 3CPWP 4OGEA 2Z0WA 3DB4A 3OY9A 2O88A 3EGDB 3RMQA 3GNGA 2QI2A 1AWJA 2CKKA 5HK3A 4DBQA 3CQTA 3EHQA 3CC7A 4C92C 1QCFA 3H41A 3HTRA 4OF1A 3CCSA 2JUFA 1RAIB 2B8AA 2DBKA 2J6KA 4C5GA 2AZSA 2LQNA 4CRIA 2DEQA 3SHWA 4M7DD 2R5AA 3OW2A 1SHFA 2KT8A 3CCSQ 3RKXA 5LJ5g 5GAN2 2O2OA 2QG9B 3LW5E 2X9HA 1B34A 2EFIA 3FDRA 1WIEA 2B86A 2E5QA 4KH1B 1TS9A 3RESA 4M7DA 2HL3A 3QG1A 1O75A 2RJFA 4LD6A 3H8ZA 1YWOA 3MKDA 3TSWA 2DZ9A 2PZ1A 1Q95G 1XNIA 2QA4T 3CMAT 5KCHA 4M78G 4C8QC 3I56Q 1VQ5Q 3OW2P 1JU5C 1G2BA 2E4HA 2V8IA 4J9BA 4ZN3A 1IO6A 5GAMg 1QVGS 3OYNA 5GAMf 4JS4A 5A2QE 3QIIA 3EGXA 4O6JA 4BE0A 4Z02A 1ZBJA 3QZ9B 1RABB 4JRKA 3EFRA 3REBB 1M8MA 2LP5A 3OYIA 1UB4A 3QJYA 2LQWA 2ZPBB 1YJWT 2ATCB 4MZMA 4M75F 3GBQA 2O01E 4M7AA 1F1BB 2OTJA 1W1FA 2EKOA 3QSUA 3JCMP 2GF7A 1UHFA 3RERA 1PRLC 2EBPA 2MOXA 2KQWA 4M7AB 4M75B 4M7DC 3R6NA 4PJOB 2LCCA 4CC4B 2JM8A 2FVUA 1N27A 2YSQA 1GCPA 5I22A 2NUTA 1OOTA 2WSCE 2EQMA 4LXCA 3CCQQ 4M78B 1VQ6A 3LH5A 2MMPA 3NTKA 1PCXA 4FW1A 2DL7A 1MV3A 1MMGA 4JRIA 2KY9A 2MWOA 2W0ZA 5KYNA 3J7AF 2IIMA 5LJ3f 3G1JA 3HPWA 4R56A 1DJ7B 2Y4YA 4RG2A 1K8AR 2XG8D 1X2KA 1M3AA 3E19A 2K3BA 2LCSA 2JMAA 2XIDA 1QMCA 1UJYA 2CP2A 2FL7A 2CP5A 4M77E 4BD3A 3NGPA 4PKCC 2YRVA 3QDRB 1UHCA 4WCIA 4JPBW 1M90U 1VQ9Q 1UEBA 4A53A 4R0KA 2P0KA 3JB9D 4M7AF 3JCMJ 2OI3A 1Q7YU 2KXDA 1OV3A 1VQ4T 1VQNA 4E2FB 1LJOA 4ELZC 4J9FA 4F7UB 3M58A 5CR2A 1KHIA 3TSZA 1Y96A 2LX7A 1VQNQ 3OS5A 2P84A 3EGUA 4C0FA 1GBRA 4PJOG 4R55A 4F7UE 1PHTA 1ZLMA 1JBMA 3TREA 2V26A 1VQMT 4ME7A 4IKFA 1FMVA 4RTXA 2DPPB 2RJCA 2QGFB 2E6ZA 3C95A 1VQOQ 4ATOA 2LCLA 1U1SA 1M1KR 1YP5A 1X2QA 2AT1B 2HQEA 1IHWA 1PM3A 4AFZC 3UA7A 3ZBDA 4IUPA 4KGVB 1WZOA 4PJMA 4M77A 3SFMA 3D7SB 4J9EA 3UDCA 1M2VB 4OP0A 5DLQE 2K5IA 1W6XA 2JS0A 4AG2C 4C8QA 3L2WA 2HKNA 2PVOB 5J26A 1VQPT 3M55A 4OMNA 2M0OA 1RAGB 2ED1A 2LX9A 2JMCA 2PNIA 4RKUE 5KCOA 3OYMA 2DL8A 4ZGJB 3M4YA 4DBHA 2LZ6B 1N5ZA 1VQPA 2MPXC 5HK0A 3JB9H 1Y07A 2A3LA 4PJOD 1OI1A 1ABOA 2VWFA 1Y7XA 3FEOA 5GAOl 2AK5A 1WXTA 4M77F 3CD6Q 2O31A 3VS1A 4C92B 3CCJQ 2CS7A 1BI2A 1QCNA 1MUZA 4PNOA 3CD6A 4F17A 1YJWA 3EG3A 2ZPHB 3H0HA 1WX6A 4DOWA 3OSVA 1JJ2A 2CUDA 4XU1A 4RTTA 5CCAA 2M51A 4FSSA 1NBEB 4ESRA 2JN0A 2RH2A 2JVVA 4IUUA 5GANg 2RHXA 1ZSGA 2JTEA 3X28B 1PD1A 3A8MB 2OJ2A 4PJOF 2FZKB 3CCMQ 3CMAA 2QA4A 4FU6A 4B6MA 5CAIA 2LT1A 1Q82R 4C92G 4BUGA 1BCOA 4ZNXA 4OMQA 3G7ZA 4M77D 2MI6A 3CMAQ 2QA4Q 3I56T 5FLXE 3MCAB 4PJNA 4C5IA 3NTIA 1WGSA 2EW3A 2F1LA 2QXFA 3PMIA 4MMKA 2ABLA 1B3QA 4F14A 4ORZA 1QVGP 8AT1B 2AKKA 2LVMA 1M1KU 5GJWB 3LH0A 2FPDA 2CZ6B 3H0FA 4KBMB 3CC7T 4RTVA 1M1FA 2DA9A 3NFCA 3BE3A 1VQ6T 2FEIA 1K0XA 4BE1A 1AVZC 2DZCA 5A0GA 1I4K1 2DD5A 2X3XD 1LVKA 3JSCA 4AT1B 2O9VA 1YJ9T 1I8FA 5IN1A 2RB6A 3X20B 3I56A 2O4XB 1K0SA 1N9RA 3VS3A 4IIMA 5IXBA 1VOMA 5IH2A 3G6EQ 3VYGA 1AT1B 2K5LA 1X43A 2DL3A 4XU2A 4XU0A 3LGFA 2EVRA 3ME9A 3OBYA 1M2VA 5GANj 2GQIA 2WACA 3QDFA 4KULA 1HYOA 1VQLT 4HT9A 3WVEB 4M7DG 1X01A 1ZBXA 4OB2B 3GOXA 3THKA 5IT9E 1K76A 1NLOC 2L8DA 2K4YA 1WHKA 2QQRA 3OYAA 3G4SA 4QQDA 4J6YA 2XHCA 2ZPIB 3OYYA 1WHJA 2JNGA 2KRMA 4FT2A 2DRMA 5CQYA 1M8VA 1K73C 2RQVA 1C6VX 3EG0A 1WA7A 3MEVA 3JCMh 2LQKA 3SWNA 3OS2A 3RR6A 2DXBA 3OA6A 3TEEA 1A0NB 2YUQA 3CC7Q 2YDLA 2M16A 3VRYA 3CC4T 4LE9A 4JUVA 2DVEA 2ENMA 2DILA 2YXYA 4JJBA 1T3LA 1QW1A 2SEMA 5EG2A 5LJ5j 5FRMA 3WVDB 1Q82U 5CO7A 2GGRA 1K73U 2HBWA 1S72A 1U06A 3FJPA 1RLQC 3SWNC 1OZ2A 2CDTA 4C8QF 4XK8E 1K8AC 1S72Q 2ZZDA 4PLIA 1T0HA 2XDBA 2XD0A 2HMAA 4RCBA 2K2MA 4PJOC 2I2LA 2RD1A 4OB3B 1VYVA 1VQKT 3EAEA 1MMDA 4JS5A 2E3IA 2KROA 3CCVT 2NUPB 3JB9I 3GPLA 1TG0A 4C8QD 2ZPEB 3VS5A 1JXMA 5GAN6 1CKAA 5GAN5 4FL6A 2GNCA 1YNZA 1NLPC 2VC8A 4M7AG 1UECA 4FW2A 3A8GB 1D3BB 1IGQA 1TUDA 5IHIA 5CIUA 5CKDA 3U23A 3OYLA 2A37A 4L5GA 2LRQA 1TTHB 3LWHA 4J9DA 3OYBA 4ZTJA 4L6V5 4CC2A 2FPFA 2DJQA 3CD6T 1PKSA 4A4GA 1UUEA 1Y0MA 1UTIA 2KE9A 4GLKA 3E9FA 5IAYA 3I55Q 1VQPQ 4OMMA 2DBMA 4E6RA 3CC4A 2RF0A 1FYNA 2DYIA 1Y71A 4ZN1A 2OTLA 1W70A 3CCJA 3RBBB 4EIKA 4F16A 4M77G 1NYFA 4UC4A 1HK9A 2CSQA 1RADB 1D0YA 3UF4A 1Q86C 1UE9A 2F5KA 3CCMT 1OPKA 2YUOA 1Z9QA 4GBQA 1JXOA 2OX7A 1BU1A 2KAFA 3OYCA 2M1HA 1PSEA 2CT4A 4EMKA 2MWPA 1YCSB 3VS2A 3JV3A 2XU8A 1K9MU 1WHLA 1VQ9A 2XK0A 2GCXA 2RHYA 3M9QA 3CCRA 4AFUC 2EQUA 4XTWA 2F2WA 1RI0A 3MJXA 2VV5A 4YTLA 4QW2A 3TU4K 5GANd
chains in the Genus database with same CATH topology
1IXDA 1WHGA 1WHKA 4B6MA 2E3HA 3E2UA 2HL3A 2CP0A 2HKNA 1TOVA 3RDVA 1WHHA 2QK0A 3TQ7P 1WHJA 2COZA 2M02A 1TXQA 2HL5C 2CP7A 2HKQB 2CP6A 2CP2A 2CP5A 1LPLA 2COWA 1WHLA 2E4HA 2CP3A 2E3IA 1WHMA 2Z0WA 2HQHA 2MPXC 2COYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IXD A;  1WHG A;  1WHK A;  4B6M A;  2E3H A;  3E2U A;  2HL3 A;  2CP0 A;  2HKN A;  1TOV A;  3RDV A;  1WHH A;  2QK0 A;  3TQ7 P;  1WHJ A;  2COZ A;  2M02 A;  1TXQ A;  2HL5 C;  2CP7 A;  2HKQ B;  2CP6 A;  2CP2 A;  2CP5 A;  1LPL A;  2COW A;  1WHL A;  2E4H A;  2CP3 A;  2E3I A;  1WHM A;  2Z0W A;  2HQH A;  2MPX C;  2COY A; 
#chains in the Genus database with same CATH topology
 2NLU A;  5DM7 R;  1R0C B;  1SPK A;  3A1P A;  4XTU A;  9ATC B;  1G3W A;  2KRS A;  2RMO A;  2DM1 A;  3CPW A;  3OQ5 A;  4XTY A;  1IRX A;  3OYJ A;  2AZV A;  3M0R A;  2KMT A;  3N5B B;  2HKQ B;  4J83 A;  1VQ8 Q;  4XAX B;  1AD5 A;  3RKY A;  1GRI A;  2DRK A;  3GIB A;  3PFS A;  3UA6 A;  4EDU A;  2DXU A;  1Q81 U;  2FB7 A;  2EQI A;  3QHS A;  1FXX A;  3E2U A;  1UGV A;  4FT4 A;  5KE2 A;  5KYY A;  3A8O B;  1PWT A;  3H0I A;  2V1R A;  4FYW B;  4J9C A;  5GAO p;  3KFV A;  1OUL A;  2EAY A;  4EPC A;  3QJ6 A;  3VV0 A;  2LT4 A;  2RI5 A;  4HKE A;  4HT8 A;  1GFC A;  1SRL A;  2HD0 A;  1KG1 A;  2EYY A;  1WDX A;  1IGU A;  1UJ0 A;  3CCS T;  1VQL Q;  4D6W A;  4CI0 C;  4RTW A;  3JCM c;  3I9Q A;  3NHN A;  2X4W A;  4IUR A;  2K2V A;  1K9M R;  3CCR T;  1M1K C;  3JCM W;  3QKJ A;  1V29 B;  1Q7Y C;  2EJ9 A;  3UWN A;  4MDX A;  3VRZ A;  4KGZ B;  3G71 A;  1NJI R;  1LNX A;  2XDP A;  3MEA A;  3CCL T;  3CCU A;  2RQU A;  4M75 D;  3QWY A;  3O8V A;  2RI3 A;  4Y92 A;  4M7A E;  5FU6 C;  1Q86 U;  5FRO A;  5GAM h;  3MHX A;  2R5M A;  2QDY B;  3CC2 T;  3VYH B;  4A54 A;  5GAM e;  2C0T A;  4P5N A;  3L2R A;  2L3P A;  2VGN A;  1WFW A;  4LDY A;  2E1H A;  3OMG A;  5C0M A;  2NYS A;  1VQ5 T;  3PNW C;  1UDL A;  2MCN A;  2C06 A;  3JCM e;  3I35 A;  3OYE A;  2PUK B;  4BY6 B;  1KC8 C;  4M7D E;  3OYH A;  3VU3 C;  2H3J A;  2VAS A;  1VYT A;  1AHJ B;  2KT1 A;  4NL2 A;  2X51 A;  4N4I A;  3QZ5 B;  2EGC A;  1UGQ B;  4FYY B;  1VQ7 T;  2CT3 A;  2A36 A;  4C0D C;  1JB0 E;  2FPE A;  1NEG A;  5GAN 4;  1UG1 A;  1JO8 A;  4M7D B;  1MNE A;  2D0Q B;  3BW1 A;  2V8J A;  4M75 E;  2HCK A;  1TUG B;  2JM9 A;  4OB1 B;  1X27 A;  2QTX A;  5GAO q;  5KYX A;  2E6N A;  2DET A;  5CKF A;  1Q82 C;  4ZGE B;  3OS1 A;  3LX7 A;  1KQS A;  2DXC A;  2RQR A;  1YIJ Q;  2G3R A;  2DVJ A;  2WSE E;  2LJ0 A;  4QKU A;  5J39 A;  4BB7 A;  3JCM g;  1N8R R;  5D6Y A;  3CME A;  3OYG A;  2YLB A;  1K8A U;  1RAC B;  1KFZ A;  5LJ5 f;  3TVT A;  2ZPF B;  3MEU A;  5CKB A;  4BDZ A;  1VQN T;  4JZ3 A;  1WPY A;  1ABQ A;  2DL5 A;  2BUD A;  2GFA A;  2MIO A;  1W2B S;  2E70 A;  3C4S A;  4N4H A;  5A0L A;  1KQS P;  1D1C A;  1NPP A;  2FG0 A;  4M78 E;  2QEX A;  3S3O A;  1WYX A;  2J6F A;  1ARK A;  5GJV B;  1QKW A;  2CP7 A;  4LUD A;  4QT7 A;  3L42 A;  3I55 A;  4LD9 K;  2DER A;  5FU7 C;  1ZA1 B;  3OSS C;  1IZ6 A;  1M30 A;  1PSF A;  3PIP A;  2D6F A;  1NM7 A;  3VUB A;  2FO0 A;  4RTY A;  3EH2 A;  2OTL Q;  3C94 A;  2NUT B;  2XMF A;  1VQ4 Q;  4IUT A;  1Q81 C;  1VA7 A;  1TXQ A;  3I5R A;  1YHQ A;  2YWW A;  2O9S A;  1JJ2 P;  4M4Z A;  1QCO A;  1G5V A;  1X75 C;  4C0Z A;  4KT0 E;  2CGH A;  1TU0 B;  4HCZ A;  1OX8 A;  1YJN A;  3G4S T;  2RNA A;  1N8R U;  5KH6 A;  1UGS B;  4AG1 C;  2R57 A;  1G83 A;  3LGL A;  1VQ8 T;  1K73 R;  4HVW A;  3LWI A;  1H3H A;  4MML A;  1UFF A;  3FIF A;  2K3X A;  1GFD A;  1QLY A;  3M0Q A;  2H3E B;  2CH4 A;  1QWE A;  1SSH A;  1I5O B;  1QP2 A;  3M0T A;  2PU9 B;  4AFS C;  2ZGW A;  4Y91 A;  1KJW A;  1D1A A;  4XTX A;  1YHQ T;  1M4Z A;  4PLL A;  4J9G A;  4ANJ A;  3X26 B;  2PVD B;  1K9M C;  1G3S A;  2YUP A;  3AHU A;  2E12 A;  2QAS A;  4CC3 A;  1QVF P;  4HCC A;  1G8X A;  4IIO A;  2EJF A;  2OAU A;  5KYU B;  2CSI A;  1B07 A;  3M5A A;  4L59 A;  2IVW A;  1WQW A;  2F5T X;  4FCY A;  4J9I A;  3MP6 A;  1I0C A;  2AIR B;  1BIB A;  5CK9 A;  4GY5 A;  3DB3 A;  2JZ2 A;  2EYZ A;  1FMW A;  2C0O A;  3BDL A;  3CCV A;  3NPF A;  3ASK A;  3QPH A;  3HFN A;  3QYH B;  1E6G A;  4LN2 A;  3PGG A;  1VQK A;  1H92 A;  2DNU A;  3BFM A;  4BAC A;  2NUP A;  3IQL A;  3V7C A;  1JEG A;  3SEM A;  2X4X A;  4J5Y A;  1WJR A;  1PD0 A;  4BY6 C;  5AYF A;  1MMN A;  2VVK A;  1YI2 A;  2DMO A;  3RNJ A;  4EMG A;  4PJO E;  2COZ A;  3CCU Q;  1S1N A;  4ZGD B;  1Q7Y R;  1RAE B;  2MAM A;  3UAT A;  4MZT A;  2EIF A;  4A4K A;  5LJ5 h;  3PIO A;  4OGC A;  1NJI C;  2DE0 X;  4DEY A;  2H8H A;  2X4Y A;  4PL6 A;  2CH4 W;  4C8Q E;  1VQ7 A;  2KYM A;  2BE9 B;  3TQ7 P;  1G3Y A;  3CCM A;  4OB0 B;  4KUD K;  1QKX A;  1KQ1 A;  3O5Z A;  1W2B P;  3M59 A;  2P4R A;  1KD1 C;  2CYZ B;  1TWB A;  3A98 A;  2COY A;  4KRT A;  3T9N A;  1ACM B;  4ZTF A;  3M53 A;  3I5S A;  2EYX A;  1XOV A;  1B34 B;  1HSQ A;  1KK7 A;  8ATC B;  1W2B A;  1YIJ T;  1D09 B;  3F70 A;  1YFN A;  2FZG B;  5GAO m;  2VXE A;  4JJN K;  3JCM d;  2ROT A;  1AWX A;  4FYV B;  3FC3 A;  1IB8 A;  2DFU A;  1YI2 T;  1KD1 U;  3QO3 A;  5A0D A;  4HCB A;  1VQM A;  2P0P A;  2V1Q A;  5HKC A;  3R6O A;  3J80 E;  1I5L A;  1OU9 A;  2BTT A;  3BY7 A;  3L1A A;  5GAN e;  5ECA A;  1HD3 A;  4E7S A;  5I21 A;  3CEY A;  4LDW A;  3EFO A;  1QWF A;  3EG9 B;  4K11 A;  2QEX Q;  4V2S A;  2OTJ Q;  1ZSZ C;  1OEB A;  3G71 Q;  2D8H A;  3EFO B;  2AKL A;  4BI4 A;  2VKN A;  4RUG A;  2RQW A;  4CC7 A;  1FMK A;  3MP1 A;  2ED0 A;  3QWX X;  3VJP A;  2J06 A;  3C12 A;  2A7Y A;  4PFP A;  2XKO C;  2E10 A;  5L23 A;  2M0Y A;  5GMK h;  3G4S Q;  2K3Y A;  2LNV A;  4DOV A;  5FRN A;  1BBZ A;  2BZY A;  3SWN B;  5LJ3 j;  1M27 C;  2DIQ A;  2CUB A;  2RN8 A;  1W4S A;  2RJD A;  1ZUU A;  5FWC A;  4DA4 A;  1AZE A;  4BI3 A;  1QVF S;  2HNI A;  2PTK A;  3M4G A;  2XDD A;  3S3M A;  4KGX B;  5LL6 S;  3WXM B;  1JJ2 S;  4HXJ A;  1QVP A;  4X1V A;  2E65 A;  3JB9 G;  3REA B;  2Y4X A;  2F2X A;  5GAM j;  4RTZ A;  3VKI A;  4M78 D;  2JS2 A;  2ZPG B;  1RLP C;  1D0X A;  2YLC A;  2CRE A;  2ESW A;  5D6X A;  1SF9 A;  4M78 C;  2DKG A;  2HSP A;  4C8Q G;  1RI9 A;  1RL2 A;  2RK2 A;  1V1C A;  2KDS A;  3RKW A;  1I07 A;  3INZ A;  3M57 A;  1PKT A;  2FZC B;  3EGD A;  3UPU A;  1MGQ A;  5DY9 A;  2NWM A;  2VB6 A;  4RTU A;  1TH7 A;  1XTD A;  4Z88 A;  3MP8 A;  1KC8 R;  3V8J A;  2DIG A;  4VUB A;  1TOV A;  4KH0 B;  2ZCF B;  4OML A;  1NPR A;  4D8K A;  4FIB A;  1YIT Q;  4DBR A;  2KVQ G;  2VXF A;  4FYX B;  4OMO A;  3JCM Q;  3G6E A;  5GMK l;  1HJD A;  2VGM A;  4MZP A;  1WXB A;  3CCE T;  3L2Z A;  1BKB A;  4N4G A;  4JZ4 A;  5LJ3 e;  4LUE A;  1I1J A;  4J6X A;  3P8H A;  1N6A A;  3HRT A;  4Z89 A;  1OZ3 A;  5KYX B;  3X25 B;  4PK4 A;  3JRZ A;  4C92 E;  3EFS A;  1N8R C;  3A8L B;  1EZZ B;  3EG9 A;  5IHK A;  1NEB A;  1TUC A;  4FM4 B;  3JB9 J;  2HQX A;  1RAA B;  3OBW A;  2VYT A;  2KNB B;  4QQG A;  4AMC A;  2J6O A;  2QYZ A;  3CBM A;  3HRS A;  3RUX A;  1VQ4 A;  1Z9Z A;  2Y90 A;  1R77 A;  3NMZ C;  2JJ9 A;  1YJN Q;  1J3T A;  2F69 A;  1WI7 A;  4C5H A;  1KD1 R;  1YCY A;  2DL4 A;  3M0U A;  1YJW Q;  1X6G A;  4C0G A;  1N9S A;  2JT4 A;  1QQJ A;  4QVZ A;  4XQ3 A;  2GTJ A;  1E6H A;  1SEM A;  3E9G A;  2K79 A;  3HFO A;  2QQ9 A;  3C0C A;  3ZFJ A;  4XTV A;  5HY6 A;  1S72 T;  2BE7 D;  2PVG B;  2QTV A;  1U1T A;  2R58 A;  4DBF A;  2L3R A;  2COW A;  3CCE Q;  1NYG A;  4X9C A;  4F7U A;  2QQB A;  3HRU A;  2WSF E;  3CCR Q;  3GNF B;  1VQO A;  1ZSZ B;  2X35 A;  2RPN A;  2DAQ A;  3TCJ A;  3CXC P;  2DTH A;  5CKE A;  2D8J A;  1OQK A;  5GAN 7;  2KBT A;  4BDY A;  1X69 A;  3P8B B;  3MO8 A;  4J7F A;  1AWW A;  5GAN 8;  1VQ8 A;  2YRD A;  2CP3 A;  2E41 A;  1OYX A;  4C92 F;  4ELY C;  1BCM A;  3A5Z B;  3L2V A;  3CXC A;  5CKH A;  5GMK m;  1D1B A;  5GMK i;  1YJN T;  1K9A A;  1OU8 A;  2FHD A;  5LJ3 g;  3G71 T;  1GCQ A;  1VQL A;  3JCM f;  4C8Q B;  1JQQ A;  1PC0 A;  5LJ3 h;  3M54 A;  1YJ9 Q;  1KQ2 A;  2X4J A;  1VQM Q;  2P4T A;  2DTO A;  3M0S A;  3ER0 A;  1IXD A;  1Q86 R;  2LTO A;  5IXF A;  2LNH B;  4X9D A;  3ZL7 C;  1LCK A;  1M3C A;  3FLG A;  3Q1J A;  2BZX A;  3SD4 A;  4C0D B;  4A4H A;  1MHN A;  7AT1 B;  1BB9 A;  2K9G A;  3SB2 A;  3FB9 A;  4N0A C;  2FYK A;  2KI7 A;  3SDZ A;  2L89 A;  2JTM A;  2HQH A;  2QEX T;  4PJJ A;  3LYI A;  5KYU A;  3J81 E;  2GTO A;  2C0I A;  2J05 A;  2X3W D;  2PUO B;  3OYF A;  5I11 A;  2QDL A;  1VQ7 Q;  4PJL A;  1C0M A;  1H8K A;  4JJC A;  3OYK A;  2KRN A;  3UT1 A;  2GBQ A;  3CPF A;  1WNL A;  2JOY A;  3JCM V;  4HA8 A;  2DJZ A;  3MEW A;  2CZ0 B;  2F2V A;  4BE2 A;  3GF5 A;  2J7I A;  5I2S A;  1R8O B;  4C92 A;  4NL3 A;  5D7U A;  1U3O A;  1HXD A;  4QQ6 A;  4J6W A;  4J9H A;  1EX4 A;  2RI2 A;  1WQ7 A;  1X6O A;  2DD4 A;  3ULR B;  2KXC A;  5LJ3 d;  2LDM A;  4D8D A;  3CBP A;  2QQS A;  4E7H A;  3EGX B;  1GL5 A;  4C92 D;  2DK3 A;  2AHJ B;  2CP6 A;  1ZQ1 A;  3DKM A;  1WJS A;  2QAZ A;  2LQ8 A;  4M75 G;  2VUB A;  5GAN f;  4A4E A;  2JTF A;  3AT1 B;  4A63 B;  3MPU B;  2KR3 A;  2CZ7 B;  3PT9 A;  2ROL A;  3PMT A;  1VIF A;  3V8K A;  4DQ2 A;  1KHC A;  2D1X A;  1G3T A;  4E7K A;  4M75 C;  4M7A C;  4JDS A;  3JCM X;  2K6D A;  5AT1 B;  1M90 R;  4E7Z A;  3EG2 A;  2RA2 A;  3M56 A;  1LPL A;  5GAN h;  1YIJ A;  4M75 A;  2QQA A;  5HCK A;  1YIT T;  4PJO A;  3V7S A;  5IHN A;  3CME Q;  4J8O A;  1Y96 B;  3PE0 A;  2OTL T;  4BI8 B;  2YHT A;  4KUI A;  4Y28 E;  2KEA A;  4M78 A;  3L2U A;  5GAO n;  4PFO A;  2O4X A;  4F04 B;  4A4F A;  3S3N A;  2P0Q A;  4PFZ A;  3VS6 A;  2A08 A;  3HSB A;  1GCQ C;  5DLO A;  3CCL Q;  1O9S A;  2IG0 A;  2LJ3 A;  1QVF A;  2DYB A;  2LC4 A;  1XQH A;  1PRM C;  2GFU A;  2A0F B;  4HVV A;  2I0N A;  4M7D F;  3A8H B;  4RG8 A;  1KQS S;  1P92 A;  4GLM A;  3GP8 A;  3X24 B;  4EMH A;  1PNJ A;  3PVL A;  2HL5 C;  1CSK A;  2BKD N;  4LDX A;  2EGA A;  1T3S A;  1WLP B;  2MYS A;  3CC2 Q;  4E7J A;  1VQ6 Q;  4HVU A;  3RIR A;  6AT1 B;  2LMJ A;  2FRW A;  2E3H A;  4DEX A;  1EIF A;  1FX7 A;  4JRQ A;  1ZHI A;  5GMK e;  2PQW A;  4N0A A;  1PG5 B;  1QP3 A;  1Y57 A;  2HAX A;  5CQX A;  2RQT A;  1YBY A;  2IPO B;  3CCQ A;  3CXC S;  3P8D A;  1YHQ Q;  1M2O A;  4TVR A;  1WXU A;  3CME T;  4Q5W A;  1YWP A;  2E64 A;  1KC8 U;  3EHR A;  1H3Z A;  2SRC A;  1QVG A;  1LOJ A;  3JCM b;  2GQV A;  2M02 A;  1ZX6 A;  4NS5 A;  3QBY A;  2KGT A;  1NE8 A;  5FW9 A;  2EYQ A;  3H9N A;  1ZA2 B;  3CCE A;  2XI9 A;  1D0Z A;  1AWO A;  2MF2 A;  2D0N A;  5EC7 A;  2BZ8 A;  1VQ5 A;  2LJ1 A;  3G6E T;  3KUF A;  3HL8 A;  2ECZ A;  3L2Q A;  5FU7 B;  1TSF A;  5D6W A;  1ZUY A;  5L8R E;  4JLI A;  4M78 F;  3EG1 A;  1UGP B;  1XJW B;  2L3Q A;  3CPW S;  1IHV A;  3QUI A;  2NUZ A;  1YIT A;  1KSW A;  3HHT B;  1ZSZ A;  3S6W A;  1SKU B;  1X6B A;  5KYY B;  1U8R A;  2EPD A;  5GAO r;  1OX9 A;  2RHU A;  5FWB A;  3VUZ A;  1BI3 A;  2EJG A;  3URG A;  4JRP A;  5M9O A;  5J3B A;  4O5V A;  2QK0 A;  2DEU A;  1MND A;  2KYB A;  1AEY A;  1D3B A;  3LLR A;  3OS0 A;  1JRI A;  2DXT A;  3DLM A;  5I2M A;  5KE3 A;  1Q81 R;  4QVC A;  3KBG A;  1M5Q 1;  1KIK A;  4C5E A;  4OMF B;  1IRE B;  2QGG A;  2HZY A;  1VQK Q;  2L2P A;  5LJ5 e;  3CC4 Q;  1MMA A;  1NJI U;  3H6Z A;  3V8L A;  4RMO A;  4LDU A;  2EQJ A;  3OW2 S;  4IUV A;  1V76 A;  3ZEH A;  1U5S A;  1VYU A;  1BK2 A;  4NOY A;  5CVI A;  3CCV Q;  1YJ9 A;  1YI2 Q;  4OVA A;  1BI1 A;  3PTA A;  5GAM d;  3HKS A;  4RCC A;  3OB9 A;  4B9W A;  4QVD A;  2K5F A;  1RAH B;  4XTZ A;  3DLL A;  3HP9 A;  2YT6 A;  2A28 A;  2M9U A;  1AOJ A;  3OYD A;  1WHH A;  2HDA A;  2KK4 A;  1VUB A;  1R0B G;  5C6S A;  4FSX A;  2EKH A;  3VS7 A;  2BIV A;  2W10 A;  3CCQ T;  2DF6 A;  4OMP A;  1T0J A;  3VS0 A;  3I55 T;  3NTH A;  2YUN A;  4EMK B;  3KXT A;  3E1S A;  1MV0 B;  4E47 A;  4JLG A;  2K57 A;  5KYW B;  2RO0 A;  1VQ9 T;  2HSE B;  3M0P A;  4HCK A;  3V7R A;  5FU6 B;  2CZ1 B;  1ZUK A;  3QYG B;  3PVQ A;  5KYW A;  3JB9 F;  2HBP A;  4LNP A;  2EYW A;  3BDU A;  3MET A;  4M7A D;  2K7A A;  4WTO B;  3EH1 A;  4Z8A A;  1I81 A;  4M77 B;  2RHI A;  2OTJ T;  2EWN A;  1OPL A;  2L5Q A;  2KSS A;  2MK5 A;  1VIE A;  2HEQ A;  1BYM A;  2RK1 A;  2YRC A;  1EFN A;  4WF2 A;  4J7I A;  2DO3 A;  1UGR B;  1H64 1;  1BIA A;  1M3B A;  3JAM E;  2RJE A;  1VQO T;  4MDW A;  1C1A A;  1CKB A;  1SSF A;  1M90 C;  4F7U F;  4JJD A;  4M77 C;  1GXI E;  2L3S A;  1SRM A;  3GLX A;  5LJ5 d;  3QXE B;  1WHM A;  1AZG B;  4AFQ C;  1RAF B;  2ZAE A;  3CCJ T;  1NZ9 A;  2RHZ A;  2OAW A;  5GAN 3;  4II1 A;  4B9X A;  2DX1 A;  2XIC A;  4XU3 A;  1B7T A;  3CCU T;  3CCL A;  2DTI A;  1E7O A;  1M1G A;  3CC2 A;  4E7L A;  1RUW A;  2D9T A;  4EMK C;  1NG2 A;  1K4U S;  2FRY A;  1K1Z A;  3RMS A;  1BI0 A;  4IUQ A;  2L0A A;  5GMK j;  1SG5 A;  1M9S A;  1WHG A;  2CP0 A;  2JXB A;  3VS4 A;  3RDV A;  2E5K A;  3FJ5 A;  4E7I A;  1YN8 A;  2G6F X;  2DLP A;  3FRN A;  2EQK A;  1GBQ A;  4LDV A;  1SHG A;  1WJQ A;  2RM4 A;  2V8K A;  3OMC A;  1FWZ A;  3CBO A;  2EGE A;  2JW4 A;  4X34 A;  4F7U G;  3CPW P;  4OGE A;  2Z0W A;  3DB4 A;  3OY9 A;  2O88 A;  3EGD B;  3RMQ A;  3GNG A;  2QI2 A;  1AWJ A;  2CKK A;  5HK3 A;  4DBQ A;  3CQT A;  3EHQ A;  3CC7 A;  4C92 C;  1QCF A;  3H41 A;  3HTR A;  4OF1 A;  3CCS A;  2JUF A;  1RAI B;  2B8A A;  2DBK A;  2J6K A;  4C5G A;  2AZS A;  2LQN A;  4CRI A;  2DEQ A;  3SHW A;  4M7D D;  2R5A A;  3OW2 A;  1SHF A;  2KT8 A;  3CCS Q;  3RKX A;  5LJ5 g;  5GAN 2;  2O2O A;  2QG9 B;  3LW5 E;  2X9H A;  1B34 A;  2EFI A;  3FDR A;  1WIE A;  2B86 A;  2E5Q A;  4KH1 B;  1TS9 A;  3RES A;  4M7D A;  2HL3 A;  3QG1 A;  1O75 A;  2RJF A;  4LD6 A;  3H8Z A;  1YWO A;  3MKD A;  3TSW A;  2DZ9 A;  2PZ1 A;  1Q95 G;  1XNI A;  2QA4 T;  3CMA T;  5KCH A;  4M78 G;  4C8Q C;  3I56 Q;  1VQ5 Q;  3OW2 P;  1JU5 C;  1G2B A;  2E4H A;  2V8I A;  4J9B A;  4ZN3 A;  1IO6 A;  5GAM g;  1QVG S;  3OYN A;  5GAM f;  4JS4 A;  5A2Q E;  3QII A;  3EGX A;  4O6J A;  4BE0 A;  4Z02 A;  1ZBJ A;  3QZ9 B;  1RAB B;  4JRK A;  3EFR A;  3REB B;  1M8M A;  2LP5 A;  3OYI A;  1UB4 A;  3QJY A;  2LQW A;  2ZPB B;  1YJW T;  2ATC B;  4MZM A;  4M75 F;  3GBQ A;  2O01 E;  4M7A A;  1F1B B;  2OTJ A;  1W1F A;  2EKO A;  3QSU A;  3JCM P;  2GF7 A;  1UHF A;  3RER A;  1PRL C;  2EBP A;  2MOX A;  2KQW A;  4M7A B;  4M75 B;  4M7D C;  3R6N A;  4PJO B;  2LCC A;  4CC4 B;  2JM8 A;  2FVU A;  1N27 A;  2YSQ A;  1GCP A;  5I22 A;  2NUT A;  1OOT A;  2WSC E;  2EQM A;  4LXC A;  3CCQ Q;  4M78 B;  1VQ6 A;  3LH5 A;  2MMP A;  3NTK A;  1PCX A;  4FW1 A;  2DL7 A;  1MV3 A;  1MMG A;  4JRI A;  2KY9 A;  2MWO A;  2W0Z A;  5KYN A;  3J7A F;  2IIM A;  5LJ3 f;  3G1J A;  3HPW A;  4R56 A;  1DJ7 B;  2Y4Y A;  4RG2 A;  1K8A R;  2XG8 D;  1X2K A;  1M3A A;  3E19 A;  2K3B A;  2LCS A;  2JMA A;  2XID A;  1QMC A;  1UJY A;  2CP2 A;  2FL7 A;  2CP5 A;  4M77 E;  4BD3 A;  3NGP A;  4PKC C;  2YRV A;  3QDR B;  1UHC A;  4WCI A;  4JPB W;  1M90 U;  1VQ9 Q;  1UEB A;  4A53 A;  4R0K A;  2P0K A;  3JB9 D;  4M7A F;  3JCM J;  2OI3 A;  1Q7Y U;  2KXD A;  1OV3 A;  1VQ4 T;  1VQN A;  4E2F B;  1LJO A;  4ELZ C;  4J9F A;  4F7U B;  3M58 A;  5CR2 A;  1KHI A;  3TSZ A;  1Y96 A;  2LX7 A;  1VQN Q;  3OS5 A;  2P84 A;  3EGU A;  4C0F A;  1GBR A;  4PJO G;  4R55 A;  4F7U E;  1PHT A;  1ZLM A;  1JBM A;  3TRE A;  2V26 A;  1VQM T;  4ME7 A;  4IKF A;  1FMV A;  4RTX A;  2DPP B;  2RJC A;  2QGF B;  2E6Z A;  3C95 A;  1VQO Q;  4ATO A;  2LCL A;  1U1S A;  1M1K R;  1YP5 A;  1X2Q A;  2AT1 B;  2HQE A;  1IHW A;  1PM3 A;  4AFZ C;  3UA7 A;  3ZBD A;  4IUP A;  4KGV B;  1WZO A;  4PJM A;  4M77 A;  3SFM A;  3D7S B;  4J9E A;  3UDC A;  1M2V B;  4OP0 A;  5DLQ E;  2K5I A;  1W6X A;  2JS0 A;  4AG2 C;  4C8Q A;  3L2W A;  2HKN A;  2PVO B;  5J26 A;  1VQP T;  3M55 A;  4OMN A;  2M0O A;  1RAG B;  2ED1 A;  2LX9 A;  2JMC A;  2PNI A;  4RKU E;  5KCO A;  3OYM A;  2DL8 A;  4ZGJ B;  3M4Y A;  4DBH A;  2LZ6 B;  1N5Z A;  1VQP A;  2MPX C;  5HK0 A;  3JB9 H;  1Y07 A;  2A3L A;  4PJO D;  1OI1 A;  1ABO A;  2VWF A;  1Y7X A;  3FEO A;  5GAO l;  2AK5 A;  1WXT A;  4M77 F;  3CD6 Q;  2O31 A;  3VS1 A;  4C92 B;  3CCJ Q;  2CS7 A;  1BI2 A;  1QCN A;  1MUZ A;  4PNO A;  3CD6 A;  4F17 A;  1YJW A;  3EG3 A;  2ZPH B;  3H0H A;  1WX6 A;  4DOW A;  3OSV A;  1JJ2 A;  2CUD A;  4XU1 A;  4RTT A;  5CCA A;  2M51 A;  4FSS A;  1NBE B;  4ESR A;  2JN0 A;  2RH2 A;  2JVV A;  4IUU A;  5GAN g;  2RHX A;  1ZSG A;  2JTE A;  3X28 B;  1PD1 A;  3A8M B;  2OJ2 A;  4PJO F;  2FZK B;  3CCM Q;  3CMA A;  2QA4 A;  4FU6 A;  4B6M A;  5CAI A;  2LT1 A;  1Q82 R;  4C92 G;  4BUG A;  1BCO A;  4ZNX A;  4OMQ A;  3G7Z A;  4M77 D;  2MI6 A;  3CMA Q;  2QA4 Q;  3I56 T;  5FLX E;  3MCA B;  4PJN A;  4C5I A;  3NTI A;  1WGS A;  2EW3 A;  2F1L A;  2QXF A;  3PMI A;  4MMK A;  2ABL A;  1B3Q A;  4F14 A;  4ORZ A;  1QVG P;  8AT1 B;  2AKK A;  2LVM A;  1M1K U;  5GJW B;  3LH0 A;  2FPD A;  2CZ6 B;  3H0F A;  4KBM B;  3CC7 T;  4RTV A;  1M1F A;  2DA9 A;  3NFC A;  3BE3 A;  1VQ6 T;  2FEI A;  1K0X A;  4BE1 A;  1AVZ C;  2DZC A;  5A0G A;  1I4K 1;  2DD5 A;  2X3X D;  1LVK A;  3JSC A;  4AT1 B;  2O9V A;  1YJ9 T;  1I8F A;  5IN1 A;  2RB6 A;  3X20 B;  3I56 A;  2O4X B;  1K0S A;  1N9R A;  3VS3 A;  4IIM A;  5IXB A;  1VOM A;  5IH2 A;  3G6E Q;  3VYG A;  1AT1 B;  2K5L A;  1X43 A;  2DL3 A;  4XU2 A;  4XU0 A;  3LGF A;  2EVR A;  3ME9 A;  3OBY A;  1M2V A;  5GAN j;  2GQI A;  2WAC A;  3QDF A;  4KUL A;  1HYO A;  1VQL T;  4HT9 A;  3WVE B;  4M7D G;  1X01 A;  1ZBX A;  4OB2 B;  3GOX A;  3THK A;  5IT9 E;  1K76 A;  1NLO C;  2L8D A;  2K4Y A;  1WHK A;  2QQR A;  3OYA A;  3G4S A;  4QQD A;  4J6Y A;  2XHC A;  2ZPI B;  3OYY A;  1WHJ A;  2JNG A;  2KRM A;  4FT2 A;  2DRM A;  5CQY A;  1M8V A;  1K73 C;  2RQV A;  1C6V X;  3EG0 A;  1WA7 A;  3MEV A;  3JCM h;  2LQK A;  3SWN A;  3OS2 A;  3RR6 A;  2DXB A;  3OA6 A;  3TEE A;  1A0N B;  2YUQ A;  3CC7 Q;  2YDL A;  2M16 A;  3VRY A;  3CC4 T;  4LE9 A;  4JUV A;  2DVE A;  2ENM A;  2DIL A;  2YXY A;  4JJB A;  1T3L A;  1QW1 A;  2SEM A;  5EG2 A;  5LJ5 j;  5FRM A;  3WVD B;  1Q82 U;  5CO7 A;  2GGR A;  1K73 U;  2HBW A;  1S72 A;  1U06 A;  3FJP A;  1RLQ C;  3SWN C;  1OZ2 A;  2CDT A;  4C8Q F;  4XK8 E;  1K8A C;  1S72 Q;  2ZZD A;  4PLI A;  1T0H A;  2XDB A;  2XD0 A;  2HMA A;  4RCB A;  2K2M A;  4PJO C;  2I2L A;  2RD1 A;  4OB3 B;  1VYV A;  1VQK T;  3EAE A;  1MMD A;  4JS5 A;  2E3I A;  2KRO A;  3CCV T;  2NUP B;  3JB9 I;  3GPL A;  1TG0 A;  4C8Q D;  2ZPE B;  3VS5 A;  1JXM A;  5GAN 6;  1CKA A;  5GAN 5;  4FL6 A;  2GNC A;  1YNZ A;  1NLP C;  2VC8 A;  4M7A G;  1UEC A;  4FW2 A;  3A8G B;  1D3B B;  1IGQ A;  1TUD A;  5IHI A;  5CIU A;  5CKD A;  3U23 A;  3OYL A;  2A37 A;  4L5G A;  2LRQ A;  1TTH B;  3LWH A;  4J9D A;  3OYB A;  4ZTJ A;  4L6V 5;  4CC2 A;  2FPF A;  2DJQ A;  3CD6 T;  1PKS A;  4A4G A;  1UUE A;  1Y0M A;  1UTI A;  2KE9 A;  4GLK A;  3E9F A;  5IAY A;  3I55 Q;  1VQP Q;  4OMM A;  2DBM A;  4E6R A;  3CC4 A;  2RF0 A;  1FYN A;  2DYI A;  1Y71 A;  4ZN1 A;  2OTL A;  1W70 A;  3CCJ A;  3RBB B;  4EIK A;  4F16 A;  4M77 G;  1NYF A;  4UC4 A;  1HK9 A;  2CSQ A;  1RAD B;  1D0Y A;  3UF4 A;  1Q86 C;  1UE9 A;  2F5K A;  3CCM T;  1OPK A;  2YUO A;  1Z9Q A;  4GBQ A;  1JXO A;  2OX7 A;  1BU1 A;  2KAF A;  3OYC A;  2M1H A;  1PSE A;  2CT4 A;  4EMK A;  2MWP A;  1YCS B;  3VS2 A;  3JV3 A;  2XU8 A;  1K9M U;  1WHL A;  1VQ9 A;  2XK0 A;  2GCX A;  2RHY A;  3M9Q A;  3CCR A;  4AFU C;  2EQU A;  4XTW A;  2F2W A;  1RI0 A;  3MJX A;  2VV5 A;  4YTL A;  4QW2 A;  3TU4 K;  5GAN d; 
#chains in the Genus database with same CATH homology
 1IXD A;  1WHG A;  1WHK A;  4B6M A;  2E3H A;  3E2U A;  2HL3 A;  2CP0 A;  2HKN A;  1TOV A;  3RDV A;  1WHH A;  2QK0 A;  3TQ7 P;  1WHJ A;  2COZ A;  2M02 A;  1TXQ A;  2HL5 C;  2CP7 A;  2HKQ B;  2CP6 A;  2CP2 A;  2CP5 A;  1LPL A;  2COW A;  1WHL A;  2E4H A;  2CP3 A;  2E3I A;  1WHM A;  2Z0W A;  2HQH A;  2MPX C;  2COY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...