1WHLA

Solution structure of the 1st cap-gly domain in human cylindromatosis tumor suppressor cyld
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
95
structure length
95
Chain Sequence
GSSGSSGIDVGCPVKVQLRSGEEKFPGVVRFRGPLLAERTVSGIFFGVELLEEGRGQGFTDGVYQGKQLFQCDEDCGVFVALDKLELIESGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the 1st CAP-Gly domain in human cylindromatosis tumor suppressor CYLD
rcsb
source organism Homo sapiens
molecule tags Antitumor protein
molecule keywords Cylindromatosis tumor suppressor CYLD
total genus 7
structure length 95
sequence length 95
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2004-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01302 CAP_GLY CAP-Gly domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.190 Mainly Beta Roll SH3 type barrels. CAP Gly-rich-like domain 1whlA00
2CP2A 2HQHA 2E4HA 4B6MA 3TQ7P 1TOVA 2CP0A 2HKQB 1WHKA 2CP7A 2HKNA 2COYA 2E3IA 2CP3A 2E3HA 3E2UA 2CP6A 1WHHA 1TXQA 2CP5A 2COWA 1WHMA 1WHJA 2HL3A 2M02A 2Z0WA 1IXDA 2MPXC 1LPLA 1WHLA 2QK0A 2HL5C 2COZA 1WHGA 3RDVA
chains in the Genus database with same CATH superfamily
2KRNA 3CD6Q 1M3BA 8ATCB 1K8AR 2E6NA 2YUNA 1WHKA 4KH0B 4KGZB 2QEXT 2F69A 2RJCA 2K3XA 2C06A 4M77F 2LCSA 5FROA 4BACA 1WXBA 1M90C 1G2BA 5GANe 3HL8A 1BI1A 1VQNT 2MAMA 2KSSA 2DNUA 3JCMc 3RNJA 1PRMC 2EJ9A 1TUDA 1VQMT 4DOVA 2DRKA 2O01E 4PFZA 4CI0C 1ZUUA 2K57A 2YUPA 1R8OB 1VQPT 2DO3A 2RQUA 3LGLA 1C1AA 3P8BB 1YWPA 2CGHA 3OSSC 3RKWA 4BE0A 1AZEA 2RM4A 2IVWA 1NEBA 3A8HB 1VOMA 4R56A 1OZ3A 2GFUA 3CC2T 2ECZA 2XI9A 1JJ2A 1VQ9Q 1PD0A 1WDXA 4Q5WA 4F7UA 4YTLA 3OYNA 4M7DC 5A0LA 1WFWA 2CUDA 5GAN4 3OYAA 1YNZA 1MMNA 3DLMA 1ZSZA 2K5LA 4FIBA 4E7JA 2A7YA 3UT1A 2JW4A 4L6V5 3VS2A 4FT2A 3CCRT 4J9EA 2FL7A 1VQNA 2GTOA 3DB4A 1UTIA 1C6VX 2FZGB 2LNHB 5IN1A 2DVJA 4PK4A 2FG0A 4L59A 1PSFA 1R77A 3P8DA 3C4SA 2KQWA 1KC8C 4FW1A 3ER0A 1F1BB 3PFSA 4M7AF 2LMJA 3Q1JA 5GAN2 2EYXA 3CCUT 2O88A 1PD1A 2DX1A 2M02A 4EMKA 2EFIA 4EMGA 5KYWB 4OB3B 1Q82R 1OYXA 3OBWA 5FLXE 5KCOA 1H3HA 2CDTA 1BI2A 4RG2A 3RDVA 1VA7A 2XMFA 4XTZA 5D6XA 4M7AB 4QT7A 4BE1A 4M7DG 3MP8A 4FM4B 2QXFA 2ZPBB 4KBMB 3UATA 2PU9B 1QVFS 3OYCA 3PTAA 4XK8E 2RN8A 1U3OA 2LX7A 2KT1A 4FCYA 4GLKA 4JJBA 3LH5A 1AT1B 2W0ZA 3DB3A 1BB9A 5GMKh 2DJZA 1K76A 1ACMB 5KE3A 2QA4Q 3QDRB 2EQIA 1X6GA 1YN8A 2ZAEA 2VB6A 4A53A 2YLBA 1QVFP 5C6SA 3RKXA 1M8MA 3VS0A 2DIQA 4LDXA 1JEGA 2F2VA 4EMKC 2K6DA 3UA7A 1B7TA 4DQ2A 5J39A 3RUXA 2DD5A 4ELYC 2VYTA 1WPYA 1QP2A 3CMET 1VQLT 4GBQA 3CC2A 3X28B 3HRTA 2NUTA 4OMPA 2DVEA 1YJNQ 1Q82C 3JCMd 1KFZA 1IXDA 3CCVQ 3FDRA 4FYYB 1M3AA 1BI0A 3CCUQ 3OYBA 4ESRA 5AYFA 4ZTFA 2D8HA 4FYXB 5FWBA 1WGSA 1XJWB 5LJ3h 1M2VA 2CREA 1YITA 3CMAA 2L2PA 2MYSA 1HD3A 4WF2A 2DYBA 1VQMQ 1YJ9T 4CC3A 3KUFA 5FU6C 3CCRA 4CRIA 3INZA 1RAFB 2NLUA 5AT1B 5KYWA 1TUGB 3CC7T 2KEAA 4D8DA 1FX7A 1NEGA 4MZTA 1M1GA 1G5VA 3QWYA 1GCQA 2HKQB 2KDSA 4JLIA 1UUEA 3HFOA 1KD1R 2D0NA 1JU5C 1ZBXA 4PJOA 3EGXA 3NMZC 4RTWA 1BYMA 4B9XA 1KIKA 3VRZA 3I56T 1VQKQ 1SG5A 1VQKA 1B34B 2EVRA 3CC4Q 1PM3A 4E7LA 5KYNA 2E1HA 3HRUA 1NBEB 1BBZA 2KROA 2CT3A 1N8RR 5FWCA 3OS2A 3HRSA 4D8KA 1FYNA 3OQ5A 2JJ9A 4GLMA 3VS6A 5LJ3e 1VQ4A 3OW2P 4BD3A 1VQOA 2JN0A 2VGNA 2P0PA 2O9VA 3OYIA 1PKSA 1JBMA 2I2LA 4DBHA 2ABLA 3OYGA 1WXTA 2LJ0A 8AT1B 1WQ7A 2ENMA 1VYUA 3PNWC 2HZYA 2CP0A 3CBPA 1D0ZA 2D9TA 1V29B 2EPDA 4ANJA 2YRVA 3V8JA 1WHHA 1WHMA 2RHXA 3E1SA 2BZ8A 1JXMA 2EKOA 2IPOB 2PUOB 1NM7A 3PE0A 2L0AA 4A54A 2MWPA 5LJ5j 1FMVA 2ZPFB 2YRDA 4B6MA 1IGQA 1N9SA 2XK0A 3CC4T 4E7KA 4CC7A 2DYIA 2QYZA 1OU8A 2E41A 1VQKT 5GAN5 2IIMA 4PLLA 3S6WA 5GAMd 1S72T 2J6KA 1X6OA 3M0SA 3MO8A 1TWBA 3V7CA 1SF9A 1K73C 2FRYA 5IT9E 1ZSZC 1WX6A 2DXBA 1FMWA 3UDCA 3EG9B 4R55A 1TU0B 2L3SA 3QKJA 2DL8A 4LUEA 5KE2A 3H41A 2QTXA 4FU6A 4GY5A 2X3XD 4J6YA 4N4IA 3VRYA 2DFUA 3ASKA 2CP6A 5LJ5e 2LCCA 4C0ZA 1QKWA 3TVTA 3TEEA 4HA8A 3FJ5A 3SDZA 5GAOn 3CCEA 3UF4A 2LQWA 2O31A 4DBFA 3CCVT 3MJXA 4QVZA 3FLGA 2ATCB 2LJ1A 3JCMh 4ZGDB 5IHKA 3JCMX 3HSBA 1WZOA 3SB2A 4WTOB 1T3SA 4AFQC 4OMLA 2KNBB 4M7DE 1SEMA 3OW2S 1GCPA 5IXFA 1RACB 2M16A 1BCMA 4KGXB 3JB9J 4ATOA 3RIRA 3MHXA 4J9GA 2CP5A 3H0IA 1MNDA 1M4ZA 2JUFA 4LD6A 2CZ7B 3G4ST 5KYUB 4J7IA 2V26A 1BI3A 2K5FA 2QAZA 2DKGA 2CP7A 2LQNA 2QTVA 3CXCS 3E2UA 3NTIA 3CCJT 2Z0WA 4OMNA 4E6RA 1EIFA 2DERA 2KT8A 2L89A 3QG1A 4E7IA 3X20B 2DBKA 1ZBJA 2PQWA 4M75C 2ESWA 1Y96B 3OYMA 4JDSA 1TTHB 5LJ5f 3META 4M7AD 1HXDA 2YUOA 4Z89A 5GANd 1UHCA 5GAOl 2JTFA 3CCUA 1PWTA 3O8VA 5CIUA 2KMTA 3FC3A 4PJNA 2E12A 1YJWA 1VQ6Q 3EFRA 3FJPA 1O9SA 2HBWA 3PVLA 5GAN7 3ME9A 2HQXA 3M57A 2LNVA 4RCCA 4JZ3A 5IXBA 2KRMA 2CH4W 4NL3A 5GANj 2XKOC 1KC8U 2E70A 4AMCA 4MDXA 2AKLA 1K8AU 4JPBW 2JTEA 2DIGA 3CCMT 1AWWA 3PGGA 3TCJA 3H0FA 3JB9F 2DLPA 4CC4B 4E7SA 1LCKA 3LLRA 1VQ5Q 4FSSA 4J9FA 4KRTA 4LDVA 1RAIB 1UB4A 3C0CA 3CCSQ 5D6YA 2KE9A 2Y4XA 1N8RC 9ATCB 1KQ2A 2FPDA 3OMCA 1VQLQ 1KK7A 2GTJA 2MK5A 3G71Q 1PG5B 4FSXA 5M9OA 3G1JA 1M27C 3A1PA 2RQTA 2D8JA 3OSVA 2X4XA 1K9AA 2M0YA 3JRZA 5GAMe 2AIRB 4BY6C 1JJ2S 1P92A 1KJWA 3FEOA 1M3CA 1VQOQ 5L23A 2HNIA 3JCMb 4F14A 1U5SA 2K2VA 3JCMQ 1MGQA 4M7AC 4OB0B 3OA6A 2DEQA 3QJ6A 3X24B 3MPUB 4PLIA 2BZXA 3M9QA 2EKHA 4DBRA 1MMDA 1D1AA 5I2SA 1BKBA 1VQ7Q 5DLOA 1YWOA 1SKUB 1YP5A 1U8RA 1Q7YU 4HKEA 1K9MC 1WYXA 5CKBA 4J9HA 4IUPA 4C8QE 1K1ZA 2QQRA 4RKUE 3EG3A 1Q7YR 4HVUA 5IHIA 5D6WA 2L3PA 5LJ3j 3GF5A 2EYQA 3JCMP 4MMLA 2DTHA 1YIJT 4A4FA 1AHJB 1EX4A 3JCMg 1YI2T 4A63B 5I21A 2AHJB 2L3QA 2RHZA 1GRIA 1WXUA 3L2VA 1DJ7B 1D0YA 1U06A 4HCZA 1QKXA 2XICA 4JJNK 2M0OA 4D6WA 3SWNB 5FRNA 3CCRQ 3OS5A 4BDYA 2P0QA 1MHNA 4C92B 1JO8A 2HKNA 1LNXA 2GBQA 2MOXA 3BE3A 4PFOA 3S3MA 5HK3A 2HSPA 2DF6A 2QQ9A 2VXFA 2K2MA 2YT6A 1YJWT 4BI3A 2HDAA 5FW9A 3I35A 3M4GA 4X34A 3L2WA 1QVPA 2HQHA 4XU3A 1N6AA 1UGRB 1RI9A 1VQLA 4XTYA 4X1VA 2COYA 3OW2A 1VYTA 2GQVA 4M77G 1Q7YC 1MMGA 1OEBA 1GFCA 2EW3A 2EWNA 2GNCA 2BIVA 3J7AF 3U23A 5GJVB 1SHGA 1WHGA 4M7DD 1VUBA 4N0AC 2J6OA 3BDUA 3QJYA 1TOVA 3QPHA 1YHQT 4ZGJB 2FZKB 5FU7C 1Y0MA 4JRIA 3JCMe 3CBMA 2QDLA 4KUIA 4OP0A 1Y57A 1YFNA 1UECA 4NL2A 4FT4A 2OTJA 3L2UA 2CSQA 1KQSP 3KXTA 4F17A 2J6FA 1M90R 2P4TA 1UGVA 1U1TA 5KYXA 4PNOA 1D0XA 4QVDA 2BE7D 4LDWA 3M0TA 1G3WA 3A8LB 5CAIA 4AG2C 2CKKA 2CH4A 2RPNA 2QQBA 2KAFA 1WI7A 1K4US 3D7SB 1OX8A 1NJIR 1NG2A 3FB9A 3TU4K 5KYYA 4RG8A 1AWXA 2ZPIB 2GCXA 2H3JA 2PNIA 4M78B 2C0OA 2RI3A 1UHFA 3CCVA 3MEAA 5GAMg 4WCIA 2MPXC 3QYHB 3LWHA 1E7OA 2P84A 3HP9A 4HT8A 3CCET 3X25B 1OX9A 2EYYA 2HBPA 3J81E 1TUCA 4II1A 3C12A 1IGUA 2V8IA 5I22A 2WACA 1J3TA 2VC8A 4C92C 3I55A 2DL7A 3RBBB 2OAWA 3SHWA 2D6FA 4ORZA 4PJOE 2DAQA 2A28A 2X4JA 5GAOp 2P4RA 2RK1A 2LC4A 1UJ0A 1BIAA 4P5NA 1W6XA 2VVKA 2H3EB 2X9HA 2RQWA 2A37A 3G71T 3VS3A 1NPPA 4JUVA 4J9CA 2E6ZA 2PUKB 5CQXA 2WSCE 4BB7A 4ZN3A 2OX7A 2NUZA 1E6HA 3L42A 1MV0B 1YBYA 1ZHIA 2L8DA 2RNAA 2VWFA 1VQMA 1KQSS 2R57A 4RTYA 4RCBA 2QA4T 2RO0A 4MMKA 1X69A 3CEYA 4OMMA 3E9GA 2YUQA 2ZGWA 4X9DA 4M78A 2JOYA 3CCQQ 1YCYA 3M5AA 4M75D 2QG9B 1YHQA 1QLYA 3GNGA 3PMTA 4M7DB 4OB1B 5LJ3f 1Q86C 3QO3A 4Y28E 2ED0A 1VQ6T 5KYUA 2L5QA 4RUGA 4LDYA 1C0MA 4J83A 2E65A 2K3BA 3VS7A 2EQMA 4R0KA 3BDLA 1BIBA 3M0QA 2EYWA 4C8QA 3EHRA 2BKDN 1Q86U 5GAOr 1IHVA 2VASA 4IKFA 1U1SA 1FWZA 3I5SA 1QP3A 4HCCA 4PJMA 2ZPEB 3GNFB 1B07A 4Z02A 5IAYA 2ZZDA 2QASA 1VIEA 3QHSA 4M75A 3V8LA 4JRPA 4OVAA 1O75A 3VS1A 2YWWA 1LVKA 2L3RA 1ZX6A 1CKBA 3HFNA 1XQHA 4JJCA 1GCQC 4LDUA 4PJOF 3EG0A 4Y92A 2E4HA 2QA4A 3G4SA 1RLPC 1NJIU 2YSQA 3CPWP 3M54A 1FMKA 4ZNXA 2QQAA 2JM8A 3DKMA 6AT1B 1PCXA 1H641 1UFFA 2EJGA 4ELZC 1D1CA 1Q81U 1UE9A 1T0HA 1OQKA 3EFSA 2JXBA 4N4GA 1K0SA 4DOWA 1UGQB 3X26B 1X01A 1RAAB 5LJ5g 1RAHB 4C0DB 4C0GA 4OMFB 2O4XB 4Z8AA 1XOVA 2X3WD 2FPFA 3CBOA 3LX7A 3RESA 2LX9A 4FYWB 4QVCA 1VQPQ 3HHTB 3CPWA 2MWOA 1M8VA 5KH6A 3QWXX 2D1XA 3E19A 4OMOA 1RAGB 2CT4A 3I55T 2RI2A 1QCFA 1YJWQ 1VQ8A 2RJFA 4MDWA 3VJPA 3WVEB 2BE9B 1VQ4Q 3C95A 4J9IA 5EG2A 2DTIA 1UGPB 3M55A 4K11A 2RB6A 5CR2A 2EJFA 1ZA2B 3EG2A 1D09B 1VQNQ 2NUPB 2OTJT 2J05A 1I81A 3H6ZA 4HVWA 3V7SA 2EIFA 3CMAT 1NLOC 3UWNA 3L1AA 1AWJA 2A36A 2HSEB 1W4SA 1OPKA 4J6XA 4OGCA 2DM1A 3L2QA 5CKFA 2RQVA 2EBPA 2XIDA 2ZCFB 2YDLA 1MNEA 4M78G 2MIOA 4HXJA 1X6BA 1W1FA 1I5LA 4M78F 1YI2Q 2KBTA 3OB9A 2Y4YA 1IZ6A 1YIJQ 4JS5A 4F7UG 2R5MA 3UA6A 4HT9A 4JZ4A 3EG9A 2KI7A 3M53A 3CPFA 4RTZA 4IUVA 1WJRA 1Q81C 5HCKA 3T9NA 4M78D 5LJ3g 1UGSB 3VS5A 2ZPHB 2EQJA 1IREB 4M78E 5CKDA 4XAXB 2E3IA 2KYBA 1SRLA 3A8MB 4QQDA 1UEBA 1M9SA 1ZLMA 3EGXB 3R6OA 1NLPC 1UDLA 3M59A 5LJ3d 1LJOA 3QZ5B 1N8RU 5GAN3 2QDYB 5GAOm 2RI5A 2JMCA 3HPWA 4TVRA 1RAEB 1JB0E 2G3RA 1RL2A 2MI6A 2V8JA 1N27A 4M77B 5L8RE 4AFZC 2RMOA 2M9UA 2KVQG 2BUDA 4QQGA 4RTXA 3QDFA 2VKNA 2JT4A 2VGMA 4E7HA 1VQ8T 3GIBA 4M78C 1Y07A 1RABB 3OYKA 3EFOA 2BTTA 2FRWA 2VXEA 2F5TX 4Y91A 3MCAB 2CZ0B 2ROLA 4C92D 3SWNA 1QW1A 2PTKA 4IIMA 4OB2B 4C92E 1QVGP 4LNPA 3R6NA 2OI3A 3I56A 3NPFA 1KQSA 4KUDK 5GANh 5CCAA 4M7DF 2JMAA 1YITQ 3I9QA 4KH1B 2WSEE 3JCMJ 1VQ5T 4PJOC 3HTRA 2DL4A 3JB9H 1RADB 1GBQA 2EGCA 4M75F 2DZ9A 2HMAA 1I07A 3CCMQ 3TSWA 4BDZA 1TXQA 2IG0A 1WHJA 3TSZA 1K73R 2XDBA 2OTJQ 3OY9A 4JLGA 5GMKe 2KRSA 2R5AA 2A3LA 2PVDB 1YJ9A 1SSHA 2A0FB 1ZUKA 1I8FA 4JJDA 1YJ9Q 3SWNC 2DTOA 4M75B 4EDUA 1S1NA 3P8HA 4C8QG 3TQ7P 3A5ZB 5A2QE 1X43A 2DBMA 4F16A 1JQQA 4BI8B 3OS0A 2E3HA 2E5QA 1S72A 2FB7A 1GXIE 2DPPB 3L2ZA 4M75G 2RH2A 1YJNT 1JRIA 3QZ9B 1K9MR 1OPLA 1KD1U 3L2RA 3M0PA 1KC8R 1WLPB 3SEMA 3CMEQ 1IO6A 3NTKA 5CVIA 3UPUA 1TS9A 5GAN8 2CP2A 5J3BA 2VUBA 4J8OA 3MP1A 2DRMA 4XTUA 3CQTA 1VQ7T 1VQ6A 3JB9I 4IIOA 2XDDA 1ABQA 1VYVA 3NGPA 3CCLA 4FYVB 2BZYA 4OGEA 4XU0A 3CCMA 4DA4A 3QBYA 1ZSGA 3G4SQ 1D3BA 1SSFA 4AFSC 1M5Q1 2DK3A 3PIOA 1RI0A 2RHIA 2K7AA 1AWOA 4RTTA 4C8QC 1M1KU 2Y90A 4LUDA 2LVMA 3CCSA 4FL6A 4QW2A 1R0CB 1M1KR 2XU8A 3H9NA 2HD0A 3OS1A 7AT1B 3MKDA 1GL5A 1X2QA 3G71A 2OTLT 4XTVA 3F70A 2NYSA 4C92G 1YJNA 1UG1A 4IUUA 3CCST 2DETA 2ED1A 2HEQA 2QI2A 3LH0A 4EMKB 3OYDA 1HK9A 2COZA 3EGDB 2V1RA 5D7UA 3LW5E 1V1CA 3VV0A 3GBQA 2C0TA 3CC7A 1IHWA 1QCNA 1QMCA 1MUZA 4VUBA 3ZL7C 1BU1A 4M7AG 1B34A 1H3ZA 1M90U 1ZQ1A 1OOTA 2JS2A 3OYLA 1LPLA 2EAYA 1I4K1 1YITT 3RKYA 3A98A 4J6WA 2X4YA 2GQIA 1Q81R 1S72Q 4F04B 3JB9D 1NPRA 1OI1A 1AVZC 1D3BB 2NWMA 3CC2Q 4EIKA 5KYXB 5FU7B 1M1KC 1ZA1B 1PNJA 3QSUA 5GAOq 2HAXA 5GANg 4UC4A 2CUBA 3CMEA 3CCJA 2W10A 2OJ2A 4MZMA 2PZ1A 2DL3A 4RMOA 4J7FA 3KBGA 3AHUA 2F5KA 4A4KA 1VQ8Q 3JCMW 1PKTA 2NUTB 3BW1A 2DZCA 3H0HA 2LZ6B 3FRNA 1OULA 1E6GA 3CCQA 1W2BA 1M2OA 2FEIA 1KG1A 3REBB 3OYJA 4J5YA 5IH2A 1YHQQ 1JJ2P 1KHIA 2E64A 2AZVA 3WXMB 3EG1A 4E7ZA 4PL6A 3EGDA 2F2XA 4IUQA 5CKEA 3SD4A 4ZN1A 3NHNA 3M56A 2LDMA 1WNLA 5GMKj 2QEXA 1D1BA 1HYOA 2HL5C 4PJOG 1AD5A 2FYKA 1I0CA 1WJSA 5J26A 3HKSA 1AEYA 1G8XA 2K5IA 3OYFA 4HCBA 3URGA 2JZ2A 4QKUA 2XHCA 1RLQC 3I56Q 1M30A 1SRMA 2GF7A 1OV3A 3RMQA 2FPEA 1A0NB 4PFPA 1G3SA 3J80E 2I0NA 3G7ZA 1T0JA 1G3TA 3OYYA 3RR6A 2RD1A 2LQ8A 3CC7Q 2CYZB 2E10A 1AOJA 2F1LA 4M77E 1Z9ZA 2K3YA 4C5IA 1NYGA 4CC2A 4KULA 1PHTA 3G6EA 2GFAA 2M51A 5GMKl 4O6JA 4F7UB 2CZ1B 4M4ZA 2CS7A 2DA9A 3CCLT 4PKCC 1VQ4T 2DXUA 4QQ6A 1Y71A 2F2WA 3ZEHA 1ZSZB 2QGGA 1W70A 3NFCA 3VUZA 3QXEB 1JXOA 1FXXA 4LN2A 1YI2A 3SFMA 1B3QA 1GBRA 5GANf 1ABOA 3H8ZA 3VU3C 2J06A 3GOXA 2E5KA 4LXCA 1I1JA 2LP5A 2LT4A 4M77C 2G6FX 3EAEA 2FHDA 1KSWA 2NUPA 3GP8A 2X4WA 1BCOA 1G83A 3S3NA 1I5OB 2PVGB 3M4YA 4JRQA 3IQLA 1W2BS 2XG8D 3GLXA 4F7UF 3TREA 1YCSB 2KK4A 2KY9A 4C8QB 5EC7A 2JS0A 2AKKA 3M58A 3PT9A 3EH2A 2DE0X 3OBYA 2KXDA 4ME7A 3ULRB 2QK0A 1QVGA 1VQOT 4Z88A 3FIFA 1K73U 3JCMV 1Q82U 1EZZB 2LQKA 2RHUA 2YRCA 2ZPGB 2HCKA 1GFDA 3PVQA 5A0DA 5GMKm 1XNIA 3MP6A 4C5GA 1VQ5A 1OZ2A 2M1HA 1KQ1A 3QIIA 2RHYA 3ZFJA 2RJEA 1V76A 4KGVB 4C0FA 2DXCA 2EGAA 2V8KA 3O5ZA 2FO0A 4PJOD 1N9RA 2MF2A 3MEVA 4XQ3A 5KCHA 3VUBA 2SRCA 1TH7A 3MEUA 3OYHA 4M77A 2JNGA 3V8KA 3C94A 1NE8A 4AT1B 4AG1C 3CMAQ 4C5HA 1QCOA 5LJ5h 5CO7A 3M0UA 4AFUC 5C0MA 3LWIA 2RJDA 1Q95G 4XTXA 4A4HA 5LL6S 3S3OA 2EQKA 4XTWA 2LRQA 3I5RA 4E2FB 2O9SA 1RUWA 2B8AA 5GAMh 2JTMA 4OMQA 3I55Q 3LGFA 2AK5A 2GGRA 2AZSA 4LE9A 5GJWB 1Z9QA 2DILA 4E47A 1MMAA 1H8KA 2C0IA 2QGFB 2X51A 5CQYA 4EPCA 2OTLQ 1MV3A 5GAMf 4M7AE 1VQ9T 2EGEA 4N0AA 4C8QD 2DXTA 2LJ3A 4F7UE 3EGUA 1IB8A 2EQUA 2HL3A 2RK2A 2WSFE 2ROTA 3VKIA 2A08A 1VQ9A 1WHLA 1NZ9A 3A8GB 3CD6A 4BUGA 1SHFA 3VYGA 3CCJQ 1TSFA 2LT1A 4L5GA 1OU9A 1KD1C 2O2OA 3DLLA 1VIFA 4DEYA 1QVFA 1KHCA 2YLCA 4BI4A 4KT0E 1QWFA 3CPWS 2OAUA 1Q86R 4ZGEB 4DBQA 5CK9A 4V2SA 2YXYA 3RERA 2CZ6B 5HY6A 4PJOB 2B86A 5A0GA 4O5VA 3QUIA 2KR3A 2QQSA 1VQ7A 1X75C 2O4XA 3CCEQ 5DY9A 3EHQA 1TG0A 4PJJA 2PVOB 1K8AC 4NS5A 4HCKA 3WVDB 2EYZA 2J7IA 2K9GA 3ZBDA 2QEXQ 1YIJA 1T3LA 4J9DA 5HK0A 3PIPA 4RTUA 1NYFA 3VYHB 3EH1A 1HSQA 1QVGS 3THKA 4XU1A 1H92A 2MCNA 4C92A 3NTHA 1NJIC 5DLQE 2DEUA 3V7RA 2DL5A 4M7DA 1N5ZA 3OYEA 3EFOB 1WJQA 2MMPA 2SEMA 1QQJA 1WQWA 4HVVA 1PRLC 2JM9A 2KGTA 2LCLA 3BFMA 4MZPA 2RQRA 1PC0A 5FRMA 2V1QA 3CCQT 1WIEA 1XTDA 3E9FA 1HJDA 1X2KA 5ECAA 4C92F 4M75E 1X27A 4M77D 2H8HA 3QYGB 3G6EQ 2CSIA 2X35A 2JVVA 2YHTA 1EFNA 5I11A 1Y96A 5I2MA 4BE2A 4M7AA 4RTVA 2D0QB 2K79A 4JS4A 1CKAA 4C8QF 3M0RA 4OF1A 3JV3A 4IUTA 4J9BA 4ZTJA 1UJYA 4FW2A 5GMKi 2VV5A 3KFVA 2KXCA 3JCMf 2KYMA 3VS4A 4B9WA 4EMHA 4A4EA 4N4HA 3CC4A 1BK2A 2K4YA 4NOYA 1CSKA 3JAME 1VQPA 4C0DC 1PSEA 1W2BP 2DD4A 1SPKA 3CXCP 5CKHA 2DMOA 4XU2A 4PJLA 3OMGA 4X9CA 1K9MU 2XD0A 1G3YA 3N5BB 5GAN6 2CP3A 2P0KA 2DJQA 5IHNA 3CCLQ 2RF0A 3G6ET 2HQEA 5KYYB 2R58A 4A4GA 2RA2A 4DEXA 2LTOA 3MEWA 4JRKA 3AT1B 3GPLA 5DM7R 1K0XA 1WA7A 1Y7XA 2XDPA 3JB9G 5GAMj 1ARKA 1M1FA 3CXCA 3A8OB 4BY6B 2AT1B 4C5EA 2FVUA 1M2VB 4IURA 3CD6T 2COWA 1IRXA 1LOJA 2OTLA 3BY7A 1QWEA 5LJ5d 3JSCA 1R0BG 5HKCA 5FU6B 1ZUYA 3RMSA 3REAB 4LD9K 1AZGB 3LYIA 3PMIA 2FZCB
chains in the Genus database with same CATH topology
2CP2A 2HQHA 2E4HA 4B6MA 3TQ7P 1TOVA 2CP0A 2HKQB 1WHKA 2CP7A 2HKNA 2COYA 2E3IA 2CP3A 2E3HA 3E2UA 2CP6A 1WHHA 1TXQA 2CP5A 2COWA 1WHMA 1WHJA 2HL3A 2M02A 2Z0WA 1IXDA 2MPXC 1LPLA 1WHLA 2QK0A 2HL5C 2COZA 1WHGA 3RDVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CP2 A;  2HQH A;  2E4H A;  4B6M A;  3TQ7 P;  1TOV A;  2CP0 A;  2HKQ B;  1WHK A;  2CP7 A;  2HKN A;  2COY A;  2E3I A;  2CP3 A;  2E3H A;  3E2U A;  2CP6 A;  1WHH A;  1TXQ A;  2CP5 A;  2COW A;  1WHM A;  1WHJ A;  2HL3 A;  2M02 A;  2Z0W A;  1IXD A;  2MPX C;  1LPL A;  1WHL A;  2QK0 A;  2HL5 C;  2COZ A;  1WHG A;  3RDV A; 
#chains in the Genus database with same CATH topology
 2KRN A;  3CD6 Q;  1M3B A;  8ATC B;  1K8A R;  2E6N A;  2YUN A;  1WHK A;  4KH0 B;  4KGZ B;  2QEX T;  2F69 A;  2RJC A;  2K3X A;  2C06 A;  4M77 F;  2LCS A;  5FRO A;  4BAC A;  1WXB A;  1M90 C;  1G2B A;  5GAN e;  3HL8 A;  1BI1 A;  1VQN T;  2MAM A;  2KSS A;  2DNU A;  3JCM c;  3RNJ A;  1PRM C;  2EJ9 A;  1TUD A;  1VQM T;  4DOV A;  2DRK A;  2O01 E;  4PFZ A;  4CI0 C;  1ZUU A;  2K57 A;  2YUP A;  1R8O B;  1VQP T;  2DO3 A;  2RQU A;  3LGL A;  1C1A A;  3P8B B;  1YWP A;  2CGH A;  3OSS C;  3RKW A;  4BE0 A;  1AZE A;  2RM4 A;  2IVW A;  1NEB A;  3A8H B;  1VOM A;  4R56 A;  1OZ3 A;  2GFU A;  3CC2 T;  2ECZ A;  2XI9 A;  1JJ2 A;  1VQ9 Q;  1PD0 A;  1WDX A;  4Q5W A;  4F7U A;  4YTL A;  3OYN A;  4M7D C;  5A0L A;  1WFW A;  2CUD A;  5GAN 4;  3OYA A;  1YNZ A;  1MMN A;  3DLM A;  1ZSZ A;  2K5L A;  4FIB A;  4E7J A;  2A7Y A;  3UT1 A;  2JW4 A;  4L6V 5;  3VS2 A;  4FT2 A;  3CCR T;  4J9E A;  2FL7 A;  1VQN A;  2GTO A;  3DB4 A;  1UTI A;  1C6V X;  2FZG B;  2LNH B;  5IN1 A;  2DVJ A;  4PK4 A;  2FG0 A;  4L59 A;  1PSF A;  1R77 A;  3P8D A;  3C4S A;  2KQW A;  1KC8 C;  4FW1 A;  3ER0 A;  1F1B B;  3PFS A;  4M7A F;  2LMJ A;  3Q1J A;  5GAN 2;  2EYX A;  3CCU T;  2O88 A;  1PD1 A;  2DX1 A;  2M02 A;  4EMK A;  2EFI A;  4EMG A;  5KYW B;  4OB3 B;  1Q82 R;  1OYX A;  3OBW A;  5FLX E;  5KCO A;  1H3H A;  2CDT A;  1BI2 A;  4RG2 A;  3RDV A;  1VA7 A;  2XMF A;  4XTZ A;  5D6X A;  4M7A B;  4QT7 A;  4BE1 A;  4M7D G;  3MP8 A;  4FM4 B;  2QXF A;  2ZPB B;  4KBM B;  3UAT A;  2PU9 B;  1QVF S;  3OYC A;  3PTA A;  4XK8 E;  2RN8 A;  1U3O A;  2LX7 A;  2KT1 A;  4FCY A;  4GLK A;  4JJB A;  3LH5 A;  1AT1 B;  2W0Z A;  3DB3 A;  1BB9 A;  5GMK h;  2DJZ A;  1K76 A;  1ACM B;  5KE3 A;  2QA4 Q;  3QDR B;  2EQI A;  1X6G A;  1YN8 A;  2ZAE A;  2VB6 A;  4A53 A;  2YLB A;  1QVF P;  5C6S A;  3RKX A;  1M8M A;  3VS0 A;  2DIQ A;  4LDX A;  1JEG A;  2F2V A;  4EMK C;  2K6D A;  3UA7 A;  1B7T A;  4DQ2 A;  5J39 A;  3RUX A;  2DD5 A;  4ELY C;  2VYT A;  1WPY A;  1QP2 A;  3CME T;  1VQL T;  4GBQ A;  3CC2 A;  3X28 B;  3HRT A;  2NUT A;  4OMP A;  2DVE A;  1YJN Q;  1Q82 C;  3JCM d;  1KFZ A;  1IXD A;  3CCV Q;  3FDR A;  4FYY B;  1M3A A;  1BI0 A;  3CCU Q;  3OYB A;  4ESR A;  5AYF A;  4ZTF A;  2D8H A;  4FYX B;  5FWB A;  1WGS A;  1XJW B;  5LJ3 h;  1M2V A;  2CRE A;  1YIT A;  3CMA A;  2L2P A;  2MYS A;  1HD3 A;  4WF2 A;  2DYB A;  1VQM Q;  1YJ9 T;  4CC3 A;  3KUF A;  5FU6 C;  3CCR A;  4CRI A;  3INZ A;  1RAF B;  2NLU A;  5AT1 B;  5KYW A;  1TUG B;  3CC7 T;  2KEA A;  4D8D A;  1FX7 A;  1NEG A;  4MZT A;  1M1G A;  1G5V A;  3QWY A;  1GCQ A;  2HKQ B;  2KDS A;  4JLI A;  1UUE A;  3HFO A;  1KD1 R;  2D0N A;  1JU5 C;  1ZBX A;  4PJO A;  3EGX A;  3NMZ C;  4RTW A;  1BYM A;  4B9X A;  1KIK A;  3VRZ A;  3I56 T;  1VQK Q;  1SG5 A;  1VQK A;  1B34 B;  2EVR A;  3CC4 Q;  1PM3 A;  4E7L A;  5KYN A;  2E1H A;  3HRU A;  1NBE B;  1BBZ A;  2KRO A;  2CT3 A;  1N8R R;  5FWC A;  3OS2 A;  3HRS A;  4D8K A;  1FYN A;  3OQ5 A;  2JJ9 A;  4GLM A;  3VS6 A;  5LJ3 e;  1VQ4 A;  3OW2 P;  4BD3 A;  1VQO A;  2JN0 A;  2VGN A;  2P0P A;  2O9V A;  3OYI A;  1PKS A;  1JBM A;  2I2L A;  4DBH A;  2ABL A;  3OYG A;  1WXT A;  2LJ0 A;  8AT1 B;  1WQ7 A;  2ENM A;  1VYU A;  3PNW C;  2HZY A;  2CP0 A;  3CBP A;  1D0Z A;  2D9T A;  1V29 B;  2EPD A;  4ANJ A;  2YRV A;  3V8J A;  1WHH A;  1WHM A;  2RHX A;  3E1S A;  2BZ8 A;  1JXM A;  2EKO A;  2IPO B;  2PUO B;  1NM7 A;  3PE0 A;  2L0A A;  4A54 A;  2MWP A;  5LJ5 j;  1FMV A;  2ZPF B;  2YRD A;  4B6M A;  1IGQ A;  1N9S A;  2XK0 A;  3CC4 T;  4E7K A;  4CC7 A;  2DYI A;  2QYZ A;  1OU8 A;  2E41 A;  1VQK T;  5GAN 5;  2IIM A;  4PLL A;  3S6W A;  5GAM d;  1S72 T;  2J6K A;  1X6O A;  3M0S A;  3MO8 A;  1TWB A;  3V7C A;  1SF9 A;  1K73 C;  2FRY A;  5IT9 E;  1ZSZ C;  1WX6 A;  2DXB A;  1FMW A;  3UDC A;  3EG9 B;  4R55 A;  1TU0 B;  2L3S A;  3QKJ A;  2DL8 A;  4LUE A;  5KE2 A;  3H41 A;  2QTX A;  4FU6 A;  4GY5 A;  2X3X D;  4J6Y A;  4N4I A;  3VRY A;  2DFU A;  3ASK A;  2CP6 A;  5LJ5 e;  2LCC A;  4C0Z A;  1QKW A;  3TVT A;  3TEE A;  4HA8 A;  3FJ5 A;  3SDZ A;  5GAO n;  3CCE A;  3UF4 A;  2LQW A;  2O31 A;  4DBF A;  3CCV T;  3MJX A;  4QVZ A;  3FLG A;  2ATC B;  2LJ1 A;  3JCM h;  4ZGD B;  5IHK A;  3JCM X;  3HSB A;  1WZO A;  3SB2 A;  4WTO B;  1T3S A;  4AFQ C;  4OML A;  2KNB B;  4M7D E;  1SEM A;  3OW2 S;  1GCP A;  5IXF A;  1RAC B;  2M16 A;  1BCM A;  4KGX B;  3JB9 J;  4ATO A;  3RIR A;  3MHX A;  4J9G A;  2CP5 A;  3H0I A;  1MND A;  1M4Z A;  2JUF A;  4LD6 A;  2CZ7 B;  3G4S T;  5KYU B;  4J7I A;  2V26 A;  1BI3 A;  2K5F A;  2QAZ A;  2DKG A;  2CP7 A;  2LQN A;  2QTV A;  3CXC S;  3E2U A;  3NTI A;  3CCJ T;  2Z0W A;  4OMN A;  4E6R A;  1EIF A;  2DER A;  2KT8 A;  2L89 A;  3QG1 A;  4E7I A;  3X20 B;  2DBK A;  1ZBJ A;  2PQW A;  4M75 C;  2ESW A;  1Y96 B;  3OYM A;  4JDS A;  1TTH B;  5LJ5 f;  3MET A;  4M7A D;  1HXD A;  2YUO A;  4Z89 A;  5GAN d;  1UHC A;  5GAO l;  2JTF A;  3CCU A;  1PWT A;  3O8V A;  5CIU A;  2KMT A;  3FC3 A;  4PJN A;  2E12 A;  1YJW A;  1VQ6 Q;  3EFR A;  3FJP A;  1O9S A;  2HBW A;  3PVL A;  5GAN 7;  3ME9 A;  2HQX A;  3M57 A;  2LNV A;  4RCC A;  4JZ3 A;  5IXB A;  2KRM A;  2CH4 W;  4NL3 A;  5GAN j;  2XKO C;  1KC8 U;  2E70 A;  4AMC A;  4MDX A;  2AKL A;  1K8A U;  4JPB W;  2JTE A;  2DIG A;  3CCM T;  1AWW A;  3PGG A;  3TCJ A;  3H0F A;  3JB9 F;  2DLP A;  4CC4 B;  4E7S A;  1LCK A;  3LLR A;  1VQ5 Q;  4FSS A;  4J9F A;  4KRT A;  4LDV A;  1RAI B;  1UB4 A;  3C0C A;  3CCS Q;  5D6Y A;  2KE9 A;  2Y4X A;  1N8R C;  9ATC B;  1KQ2 A;  2FPD A;  3OMC A;  1VQL Q;  1KK7 A;  2GTJ A;  2MK5 A;  3G71 Q;  1PG5 B;  4FSX A;  5M9O A;  3G1J A;  1M27 C;  3A1P A;  2RQT A;  2D8J A;  3OSV A;  2X4X A;  1K9A A;  2M0Y A;  3JRZ A;  5GAM e;  2AIR B;  4BY6 C;  1JJ2 S;  1P92 A;  1KJW A;  3FEO A;  1M3C A;  1VQO Q;  5L23 A;  2HNI A;  3JCM b;  4F14 A;  1U5S A;  2K2V A;  3JCM Q;  1MGQ A;  4M7A C;  4OB0 B;  3OA6 A;  2DEQ A;  3QJ6 A;  3X24 B;  3MPU B;  4PLI A;  2BZX A;  3M9Q A;  2EKH A;  4DBR A;  1MMD A;  1D1A A;  5I2S A;  1BKB A;  1VQ7 Q;  5DLO A;  1YWO A;  1SKU B;  1YP5 A;  1U8R A;  1Q7Y U;  4HKE A;  1K9M C;  1WYX A;  5CKB A;  4J9H A;  4IUP A;  4C8Q E;  1K1Z A;  2QQR A;  4RKU E;  3EG3 A;  1Q7Y R;  4HVU A;  5IHI A;  5D6W A;  2L3P A;  5LJ3 j;  3GF5 A;  2EYQ A;  3JCM P;  4MML A;  2DTH A;  1YIJ T;  4A4F A;  1AHJ B;  1EX4 A;  3JCM g;  1YI2 T;  4A63 B;  5I21 A;  2AHJ B;  2L3Q A;  2RHZ A;  1GRI A;  1WXU A;  3L2V A;  1DJ7 B;  1D0Y A;  1U06 A;  4HCZ A;  1QKX A;  2XIC A;  4JJN K;  2M0O A;  4D6W A;  3SWN B;  5FRN A;  3CCR Q;  3OS5 A;  4BDY A;  2P0Q A;  1MHN A;  4C92 B;  1JO8 A;  2HKN A;  1LNX A;  2GBQ A;  2MOX A;  3BE3 A;  4PFO A;  3S3M A;  5HK3 A;  2HSP A;  2DF6 A;  2QQ9 A;  2VXF A;  2K2M A;  2YT6 A;  1YJW T;  4BI3 A;  2HDA A;  5FW9 A;  3I35 A;  3M4G A;  4X34 A;  3L2W A;  1QVP A;  2HQH A;  4XU3 A;  1N6A A;  1UGR B;  1RI9 A;  1VQL A;  4XTY A;  4X1V A;  2COY A;  3OW2 A;  1VYT A;  2GQV A;  4M77 G;  1Q7Y C;  1MMG A;  1OEB A;  1GFC A;  2EW3 A;  2EWN A;  2GNC A;  2BIV A;  3J7A F;  3U23 A;  5GJV B;  1SHG A;  1WHG A;  4M7D D;  1VUB A;  4N0A C;  2J6O A;  3BDU A;  3QJY A;  1TOV A;  3QPH A;  1YHQ T;  4ZGJ B;  2FZK B;  5FU7 C;  1Y0M A;  4JRI A;  3JCM e;  3CBM A;  2QDL A;  4KUI A;  4OP0 A;  1Y57 A;  1YFN A;  1UEC A;  4NL2 A;  4FT4 A;  2OTJ A;  3L2U A;  2CSQ A;  1KQS P;  3KXT A;  4F17 A;  2J6F A;  1M90 R;  2P4T A;  1UGV A;  1U1T A;  5KYX A;  4PNO A;  1D0X A;  4QVD A;  2BE7 D;  4LDW A;  3M0T A;  1G3W A;  3A8L B;  5CAI A;  4AG2 C;  2CKK A;  2CH4 A;  2RPN A;  2QQB A;  2KAF A;  1WI7 A;  1K4U S;  3D7S B;  1OX8 A;  1NJI R;  1NG2 A;  3FB9 A;  3TU4 K;  5KYY A;  4RG8 A;  1AWX A;  2ZPI B;  2GCX A;  2H3J A;  2PNI A;  4M78 B;  2C0O A;  2RI3 A;  1UHF A;  3CCV A;  3MEA A;  5GAM g;  4WCI A;  2MPX C;  3QYH B;  3LWH A;  1E7O A;  2P84 A;  3HP9 A;  4HT8 A;  3CCE T;  3X25 B;  1OX9 A;  2EYY A;  2HBP A;  3J81 E;  1TUC A;  4II1 A;  3C12 A;  1IGU A;  2V8I A;  5I22 A;  2WAC A;  1J3T A;  2VC8 A;  4C92 C;  3I55 A;  2DL7 A;  3RBB B;  2OAW A;  3SHW A;  2D6F A;  4ORZ A;  4PJO E;  2DAQ A;  2A28 A;  2X4J A;  5GAO p;  2P4R A;  2RK1 A;  2LC4 A;  1UJ0 A;  1BIA A;  4P5N A;  1W6X A;  2VVK A;  2H3E B;  2X9H A;  2RQW A;  2A37 A;  3G71 T;  3VS3 A;  1NPP A;  4JUV A;  4J9C A;  2E6Z A;  2PUK B;  5CQX A;  2WSC E;  4BB7 A;  4ZN3 A;  2OX7 A;  2NUZ A;  1E6H A;  3L42 A;  1MV0 B;  1YBY A;  1ZHI A;  2L8D A;  2RNA A;  2VWF A;  1VQM A;  1KQS S;  2R57 A;  4RTY A;  4RCB A;  2QA4 T;  2RO0 A;  4MMK A;  1X69 A;  3CEY A;  4OMM A;  3E9G A;  2YUQ A;  2ZGW A;  4X9D A;  4M78 A;  2JOY A;  3CCQ Q;  1YCY A;  3M5A A;  4M75 D;  2QG9 B;  1YHQ A;  1QLY A;  3GNG A;  3PMT A;  4M7D B;  4OB1 B;  5LJ3 f;  1Q86 C;  3QO3 A;  4Y28 E;  2ED0 A;  1VQ6 T;  5KYU A;  2L5Q A;  4RUG A;  4LDY A;  1C0M A;  4J83 A;  2E65 A;  2K3B A;  3VS7 A;  2EQM A;  4R0K A;  3BDL A;  1BIB A;  3M0Q A;  2EYW A;  4C8Q A;  3EHR A;  2BKD N;  1Q86 U;  5GAO r;  1IHV A;  2VAS A;  4IKF A;  1U1S A;  1FWZ A;  3I5S A;  1QP3 A;  4HCC A;  4PJM A;  2ZPE B;  3GNF B;  1B07 A;  4Z02 A;  5IAY A;  2ZZD A;  2QAS A;  1VIE A;  3QHS A;  4M75 A;  3V8L A;  4JRP A;  4OVA A;  1O75 A;  3VS1 A;  2YWW A;  1LVK A;  2L3R A;  1ZX6 A;  1CKB A;  3HFN A;  1XQH A;  4JJC A;  1GCQ C;  4LDU A;  4PJO F;  3EG0 A;  4Y92 A;  2E4H A;  2QA4 A;  3G4S A;  1RLP C;  1NJI U;  2YSQ A;  3CPW P;  3M54 A;  1FMK A;  4ZNX A;  2QQA A;  2JM8 A;  3DKM A;  6AT1 B;  1PCX A;  1H64 1;  1UFF A;  2EJG A;  4ELZ C;  1D1C A;  1Q81 U;  1UE9 A;  1T0H A;  1OQK A;  3EFS A;  2JXB A;  4N4G A;  1K0S A;  4DOW A;  1UGQ B;  3X26 B;  1X01 A;  1RAA B;  5LJ5 g;  1RAH B;  4C0D B;  4C0G A;  4OMF B;  2O4X B;  4Z8A A;  1XOV A;  2X3W D;  2FPF A;  3CBO A;  3LX7 A;  3RES A;  2LX9 A;  4FYW B;  4QVC A;  1VQP Q;  3HHT B;  3CPW A;  2MWO A;  1M8V A;  5KH6 A;  3QWX X;  2D1X A;  3E19 A;  4OMO A;  1RAG B;  2CT4 A;  3I55 T;  2RI2 A;  1QCF A;  1YJW Q;  1VQ8 A;  2RJF A;  4MDW A;  3VJP A;  3WVE B;  2BE9 B;  1VQ4 Q;  3C95 A;  4J9I A;  5EG2 A;  2DTI A;  1UGP B;  3M55 A;  4K11 A;  2RB6 A;  5CR2 A;  2EJF A;  1ZA2 B;  3EG2 A;  1D09 B;  1VQN Q;  2NUP B;  2OTJ T;  2J05 A;  1I81 A;  3H6Z A;  4HVW A;  3V7S A;  2EIF A;  3CMA T;  1NLO C;  3UWN A;  3L1A A;  1AWJ A;  2A36 A;  2HSE B;  1W4S A;  1OPK A;  4J6X A;  4OGC A;  2DM1 A;  3L2Q A;  5CKF A;  2RQV A;  2EBP A;  2XID A;  2ZCF B;  2YDL A;  1MNE A;  4M78 G;  2MIO A;  4HXJ A;  1X6B A;  1W1F A;  1I5L A;  4M78 F;  1YI2 Q;  2KBT A;  3OB9 A;  2Y4Y A;  1IZ6 A;  1YIJ Q;  4JS5 A;  4F7U G;  2R5M A;  3UA6 A;  4HT9 A;  4JZ4 A;  3EG9 A;  2KI7 A;  3M53 A;  3CPF A;  4RTZ A;  4IUV A;  1WJR A;  1Q81 C;  5HCK A;  3T9N A;  4M78 D;  5LJ3 g;  1UGS B;  3VS5 A;  2ZPH B;  2EQJ A;  1IRE B;  4M78 E;  5CKD A;  4XAX B;  2E3I A;  2KYB A;  1SRL A;  3A8M B;  4QQD A;  1UEB A;  1M9S A;  1ZLM A;  3EGX B;  3R6O A;  1NLP C;  1UDL A;  3M59 A;  5LJ3 d;  1LJO A;  3QZ5 B;  1N8R U;  5GAN 3;  2QDY B;  5GAO m;  2RI5 A;  2JMC A;  3HPW A;  4TVR A;  1RAE B;  1JB0 E;  2G3R A;  1RL2 A;  2MI6 A;  2V8J A;  1N27 A;  4M77 B;  5L8R E;  4AFZ C;  2RMO A;  2M9U A;  2KVQ G;  2BUD A;  4QQG A;  4RTX A;  3QDF A;  2VKN A;  2JT4 A;  2VGM A;  4E7H A;  1VQ8 T;  3GIB A;  4M78 C;  1Y07 A;  1RAB B;  3OYK A;  3EFO A;  2BTT A;  2FRW A;  2VXE A;  2F5T X;  4Y91 A;  3MCA B;  2CZ0 B;  2ROL A;  4C92 D;  3SWN A;  1QW1 A;  2PTK A;  4IIM A;  4OB2 B;  4C92 E;  1QVG P;  4LNP A;  3R6N A;  2OI3 A;  3I56 A;  3NPF A;  1KQS A;  4KUD K;  5GAN h;  5CCA A;  4M7D F;  2JMA A;  1YIT Q;  3I9Q A;  4KH1 B;  2WSE E;  3JCM J;  1VQ5 T;  4PJO C;  3HTR A;  2DL4 A;  3JB9 H;  1RAD B;  1GBQ A;  2EGC A;  4M75 F;  2DZ9 A;  2HMA A;  1I07 A;  3CCM Q;  3TSW A;  4BDZ A;  1TXQ A;  2IG0 A;  1WHJ A;  3TSZ A;  1K73 R;  2XDB A;  2OTJ Q;  3OY9 A;  4JLG A;  5GMK e;  2KRS A;  2R5A A;  2A3L A;  2PVD B;  1YJ9 A;  1SSH A;  2A0F B;  1ZUK A;  1I8F A;  4JJD A;  1YJ9 Q;  3SWN C;  2DTO A;  4M75 B;  4EDU A;  1S1N A;  3P8H A;  4C8Q G;  3TQ7 P;  3A5Z B;  5A2Q E;  1X43 A;  2DBM A;  4F16 A;  1JQQ A;  4BI8 B;  3OS0 A;  2E3H A;  2E5Q A;  1S72 A;  2FB7 A;  1GXI E;  2DPP B;  3L2Z A;  4M75 G;  2RH2 A;  1YJN T;  1JRI A;  3QZ9 B;  1K9M R;  1OPL A;  1KD1 U;  3L2R A;  3M0P A;  1KC8 R;  1WLP B;  3SEM A;  3CME Q;  1IO6 A;  3NTK A;  5CVI A;  3UPU A;  1TS9 A;  5GAN 8;  2CP2 A;  5J3B A;  2VUB A;  4J8O A;  3MP1 A;  2DRM A;  4XTU A;  3CQT A;  1VQ7 T;  1VQ6 A;  3JB9 I;  4IIO A;  2XDD A;  1ABQ A;  1VYV A;  3NGP A;  3CCL A;  4FYV B;  2BZY A;  4OGE A;  4XU0 A;  3CCM A;  4DA4 A;  3QBY A;  1ZSG A;  3G4S Q;  1D3B A;  1SSF A;  4AFS C;  1M5Q 1;  2DK3 A;  3PIO A;  1RI0 A;  2RHI A;  2K7A A;  1AWO A;  4RTT A;  4C8Q C;  1M1K U;  2Y90 A;  4LUD A;  2LVM A;  3CCS A;  4FL6 A;  4QW2 A;  1R0C B;  1M1K R;  2XU8 A;  3H9N A;  2HD0 A;  3OS1 A;  7AT1 B;  3MKD A;  1GL5 A;  1X2Q A;  3G71 A;  2OTL T;  4XTV A;  3F70 A;  2NYS A;  4C92 G;  1YJN A;  1UG1 A;  4IUU A;  3CCS T;  2DET A;  2ED1 A;  2HEQ A;  2QI2 A;  3LH0 A;  4EMK B;  3OYD A;  1HK9 A;  2COZ A;  3EGD B;  2V1R A;  5D7U A;  3LW5 E;  1V1C A;  3VV0 A;  3GBQ A;  2C0T A;  3CC7 A;  1IHW A;  1QCN A;  1QMC A;  1MUZ A;  4VUB A;  3ZL7 C;  1BU1 A;  4M7A G;  1B34 A;  1H3Z A;  1M90 U;  1ZQ1 A;  1OOT A;  2JS2 A;  3OYL A;  1LPL A;  2EAY A;  1I4K 1;  1YIT T;  3RKY A;  3A98 A;  4J6W A;  2X4Y A;  2GQI A;  1Q81 R;  1S72 Q;  4F04 B;  3JB9 D;  1NPR A;  1OI1 A;  1AVZ C;  1D3B B;  2NWM A;  3CC2 Q;  4EIK A;  5KYX B;  5FU7 B;  1M1K C;  1ZA1 B;  1PNJ A;  3QSU A;  5GAO q;  2HAX A;  5GAN g;  4UC4 A;  2CUB A;  3CME A;  3CCJ A;  2W10 A;  2OJ2 A;  4MZM A;  2PZ1 A;  2DL3 A;  4RMO A;  4J7F A;  3KBG A;  3AHU A;  2F5K A;  4A4K A;  1VQ8 Q;  3JCM W;  1PKT A;  2NUT B;  3BW1 A;  2DZC A;  3H0H A;  2LZ6 B;  3FRN A;  1OUL A;  1E6G A;  3CCQ A;  1W2B A;  1M2O A;  2FEI A;  1KG1 A;  3REB B;  3OYJ A;  4J5Y A;  5IH2 A;  1YHQ Q;  1JJ2 P;  1KHI A;  2E64 A;  2AZV A;  3WXM B;  3EG1 A;  4E7Z A;  4PL6 A;  3EGD A;  2F2X A;  4IUQ A;  5CKE A;  3SD4 A;  4ZN1 A;  3NHN A;  3M56 A;  2LDM A;  1WNL A;  5GMK j;  2QEX A;  1D1B A;  1HYO A;  2HL5 C;  4PJO G;  1AD5 A;  2FYK A;  1I0C A;  1WJS A;  5J26 A;  3HKS A;  1AEY A;  1G8X A;  2K5I A;  3OYF A;  4HCB A;  3URG A;  2JZ2 A;  4QKU A;  2XHC A;  1RLQ C;  3I56 Q;  1M30 A;  1SRM A;  2GF7 A;  1OV3 A;  3RMQ A;  2FPE A;  1A0N B;  4PFP A;  1G3S A;  3J80 E;  2I0N A;  3G7Z A;  1T0J A;  1G3T A;  3OYY A;  3RR6 A;  2RD1 A;  2LQ8 A;  3CC7 Q;  2CYZ B;  2E10 A;  1AOJ A;  2F1L A;  4M77 E;  1Z9Z A;  2K3Y A;  4C5I A;  1NYG A;  4CC2 A;  4KUL A;  1PHT A;  3G6E A;  2GFA A;  2M51 A;  5GMK l;  4O6J A;  4F7U B;  2CZ1 B;  4M4Z A;  2CS7 A;  2DA9 A;  3CCL T;  4PKC C;  1VQ4 T;  2DXU A;  4QQ6 A;  1Y71 A;  2F2W A;  3ZEH A;  1ZSZ B;  2QGG A;  1W70 A;  3NFC A;  3VUZ A;  3QXE B;  1JXO A;  1FXX A;  4LN2 A;  1YI2 A;  3SFM A;  1B3Q A;  1GBR A;  5GAN f;  1ABO A;  3H8Z A;  3VU3 C;  2J06 A;  3GOX A;  2E5K A;  4LXC A;  1I1J A;  2LP5 A;  2LT4 A;  4M77 C;  2G6F X;  3EAE A;  2FHD A;  1KSW A;  2NUP A;  3GP8 A;  2X4W A;  1BCO A;  1G83 A;  3S3N A;  1I5O B;  2PVG B;  3M4Y A;  4JRQ A;  3IQL A;  1W2B S;  2XG8 D;  3GLX A;  4F7U F;  3TRE A;  1YCS B;  2KK4 A;  2KY9 A;  4C8Q B;  5EC7 A;  2JS0 A;  2AKK A;  3M58 A;  3PT9 A;  3EH2 A;  2DE0 X;  3OBY A;  2KXD A;  4ME7 A;  3ULR B;  2QK0 A;  1QVG A;  1VQO T;  4Z88 A;  3FIF A;  1K73 U;  3JCM V;  1Q82 U;  1EZZ B;  2LQK A;  2RHU A;  2YRC A;  2ZPG B;  2HCK A;  1GFD A;  3PVQ A;  5A0D A;  5GMK m;  1XNI A;  3MP6 A;  4C5G A;  1VQ5 A;  1OZ2 A;  2M1H A;  1KQ1 A;  3QII A;  2RHY A;  3ZFJ A;  2RJE A;  1V76 A;  4KGV B;  4C0F A;  2DXC A;  2EGA A;  2V8K A;  3O5Z A;  2FO0 A;  4PJO D;  1N9R A;  2MF2 A;  3MEV A;  4XQ3 A;  5KCH A;  3VUB A;  2SRC A;  1TH7 A;  3MEU A;  3OYH A;  4M77 A;  2JNG A;  3V8K A;  3C94 A;  1NE8 A;  4AT1 B;  4AG1 C;  3CMA Q;  4C5H A;  1QCO A;  5LJ5 h;  5CO7 A;  3M0U A;  4AFU C;  5C0M A;  3LWI A;  2RJD A;  1Q95 G;  4XTX A;  4A4H A;  5LL6 S;  3S3O A;  2EQK A;  4XTW A;  2LRQ A;  3I5R A;  4E2F B;  2O9S A;  1RUW A;  2B8A A;  5GAM h;  2JTM A;  4OMQ A;  3I55 Q;  3LGF A;  2AK5 A;  2GGR A;  2AZS A;  4LE9 A;  5GJW B;  1Z9Q A;  2DIL A;  4E47 A;  1MMA A;  1H8K A;  2C0I A;  2QGF B;  2X51 A;  5CQY A;  4EPC A;  2OTL Q;  1MV3 A;  5GAM f;  4M7A E;  1VQ9 T;  2EGE A;  4N0A A;  4C8Q D;  2DXT A;  2LJ3 A;  4F7U E;  3EGU A;  1IB8 A;  2EQU A;  2HL3 A;  2RK2 A;  2WSF E;  2ROT A;  3VKI A;  2A08 A;  1VQ9 A;  1WHL A;  1NZ9 A;  3A8G B;  3CD6 A;  4BUG A;  1SHF A;  3VYG A;  3CCJ Q;  1TSF A;  2LT1 A;  4L5G A;  1OU9 A;  1KD1 C;  2O2O A;  3DLL A;  1VIF A;  4DEY A;  1QVF A;  1KHC A;  2YLC A;  4BI4 A;  4KT0 E;  1QWF A;  3CPW S;  2OAU A;  1Q86 R;  4ZGE B;  4DBQ A;  5CK9 A;  4V2S A;  2YXY A;  3RER A;  2CZ6 B;  5HY6 A;  4PJO B;  2B86 A;  5A0G A;  4O5V A;  3QUI A;  2KR3 A;  2QQS A;  1VQ7 A;  1X75 C;  2O4X A;  3CCE Q;  5DY9 A;  3EHQ A;  1TG0 A;  4PJJ A;  2PVO B;  1K8A C;  4NS5 A;  4HCK A;  3WVD B;  2EYZ A;  2J7I A;  2K9G A;  3ZBD A;  2QEX Q;  1YIJ A;  1T3L A;  4J9D A;  5HK0 A;  3PIP A;  4RTU A;  1NYF A;  3VYH B;  3EH1 A;  1HSQ A;  1QVG S;  3THK A;  4XU1 A;  1H92 A;  2MCN A;  4C92 A;  3NTH A;  1NJI C;  5DLQ E;  2DEU A;  3V7R A;  2DL5 A;  4M7D A;  1N5Z A;  3OYE A;  3EFO B;  1WJQ A;  2MMP A;  2SEM A;  1QQJ A;  1WQW A;  4HVV A;  1PRL C;  2JM9 A;  2KGT A;  2LCL A;  3BFM A;  4MZP A;  2RQR A;  1PC0 A;  5FRM A;  2V1Q A;  3CCQ T;  1WIE A;  1XTD A;  3E9F A;  1HJD A;  1X2K A;  5ECA A;  4C92 F;  4M75 E;  1X27 A;  4M77 D;  2H8H A;  3QYG B;  3G6E Q;  2CSI A;  2X35 A;  2JVV A;  2YHT A;  1EFN A;  5I11 A;  1Y96 A;  5I2M A;  4BE2 A;  4M7A A;  4RTV A;  2D0Q B;  2K79 A;  4JS4 A;  1CKA A;  4C8Q F;  3M0R A;  4OF1 A;  3JV3 A;  4IUT A;  4J9B A;  4ZTJ A;  1UJY A;  4FW2 A;  5GMK i;  2VV5 A;  3KFV A;  2KXC A;  3JCM f;  2KYM A;  3VS4 A;  4B9W A;  4EMH A;  4A4E A;  4N4H A;  3CC4 A;  1BK2 A;  2K4Y A;  4NOY A;  1CSK A;  3JAM E;  1VQP A;  4C0D C;  1PSE A;  1W2B P;  2DD4 A;  1SPK A;  3CXC P;  5CKH A;  2DMO A;  4XU2 A;  4PJL A;  3OMG A;  4X9C A;  1K9M U;  2XD0 A;  1G3Y A;  3N5B B;  5GAN 6;  2CP3 A;  2P0K A;  2DJQ A;  5IHN A;  3CCL Q;  2RF0 A;  3G6E T;  2HQE A;  5KYY B;  2R58 A;  4A4G A;  2RA2 A;  4DEX A;  2LTO A;  3MEW A;  4JRK A;  3AT1 B;  3GPL A;  5DM7 R;  1K0X A;  1WA7 A;  1Y7X A;  2XDP A;  3JB9 G;  5GAM j;  1ARK A;  1M1F A;  3CXC A;  3A8O B;  4BY6 B;  2AT1 B;  4C5E A;  2FVU A;  1M2V B;  4IUR A;  3CD6 T;  2COW A;  1IRX A;  1LOJ A;  2OTL A;  3BY7 A;  1QWE A;  5LJ5 d;  3JSC A;  1R0B G;  5HKC A;  5FU6 B;  1ZUY A;  3RMS A;  3REA B;  4LD9 K;  1AZG B;  3LYI A;  3PMI A;  2FZC B; 
#chains in the Genus database with same CATH homology
 2CP2 A;  2HQH A;  2E4H A;  4B6M A;  3TQ7 P;  1TOV A;  2CP0 A;  2HKQ B;  1WHK A;  2CP7 A;  2HKN A;  2COY A;  2E3I A;  2CP3 A;  2E3H A;  3E2U A;  2CP6 A;  1WHH A;  1TXQ A;  2CP5 A;  2COW A;  1WHM A;  1WHJ A;  2HL3 A;  2M02 A;  2Z0W A;  1IXD A;  2MPX C;  1LPL A;  1WHL A;  2QK0 A;  2HL5 C;  2COZ A;  1WHG A;  3RDV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...