1WHOA

Allergen phl p 2
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
94
structure length
94
Chain Sequence
b'VPKVTFTVEKGSNEKHLAVLVKYEGDTMAEVELREHGSDEWVAMTKGEGGVWTFDSEEPLQGPFNFRFLTEKGMKNVFDDVVPEKYTIGATYAP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ALLERGEN PHL P 2
publication title Crystal Structure of Phl P 2, a Major Timothy Grass (Phleum Pratense) Pollen Allergen
rcsb
source organism Phleum pratense
molecule tags Allergen
total genus 18
structure length 94
sequence length 94
ec nomenclature
pdb deposition date 1997-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01357 Pollen_allerg_1 Pollen allergen
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.760 Mainly Beta Sandwich Immunoglobulin-like Expansin, cellulose-binding-like domain 1whoA00
3D30A 4FFTA 4FG4A 4JS7A 4FG2A 2VXQA 4FERA 3FT9A 1WHPA 2BH0A 4JJOA 2JNZA 3FT1A 2HCZX 1BMWA 4JCWA 4L48A 1N10A 1WHOA
chains in the Genus database with same CATH superfamily
2A4CA 4K3HA 5BUAA 1BZ7A 3Q06A 2YAMA 5CM1A 5IMOA 4EIUA 3VFOB 4I3RH 1UT1A 3K5SA 1TVBA 2F7RA 4PGBB 2BHZA 4IRZA 5E4OA 1JGEA 4PJFB 1MOEA 3W0WE 3MV7A 4YH6A 5EN2B 2BO0A 5F7MC 5HGGS 1MCPL 2PLTA 3HFFA 3QUXA 4TTDC 3TV3L 4JY4B 4QLWA 2BSTB 2DIJA 3ARRA 4AEHL 2QL1A 3LQAH 5D72H 4HWBA 3QUZB 3A6CH 2OMTA 3B5HA 2C9AA 3BE1H 1D9KC 3DV4B 1KYOK 4MWFA 3WTUA 4PP2B 5F3BB 1KN4H 2P5ED 3NUKA 2OP4L 1KLGA 3R1GL 2EXSA 5H4ZA 3O8XB 1X6LA 4U1IA 3PABB 3LRKA 3BFOA 4M43H 1YQVH 4ZXBA 3T0AA 5DS1A 4L3ED 1A9BB 2JELL 1TFHA 3RTQA 5BVJA 2AEWA 4NPYA 4YUEL 1MHPH 4CKVX 1B90A 3AQDA 5GRWA 5I5IA 2FB4H 1U8OA 2LVCA 2NUPB 1ECYA 3UABA 1V05A 4PRAA 4XCEA 5FK9A 1NCGA 5LCVA 1PKQA 1O5PA 3WJJA 4JX0A 1YEHL 1P4LB 4YHYB 2VN5A 1WBYA 4TPRL 4WCYH 1E9QB 4BUHA 2HFTA 5DS2A 3ECQA 1JK8A 2D8KA 4JHUA 1LNUA 4DZ8A 1YO4A 3MUHL 5KS9E 3LZOA 3NA4A 3OSKA 4Q58C 1FCCA 3FB8A 4PV9B 2I25N 1H15A 1PX8A 4CVXA 4QRTA 5CBAA 4NUQA 3CVBA 4Z0XB 5TFSL 1QFOA 2L8AA 1VDGA 3QJQB 3SPJA 2HAZA 1TZAA 5C3TA 3Q8BA 3JWDH 4FJZA 4L3AA 3ROOA 3MRLA 4OV5A 5HYEA 3GHBL 4M93C 3ATFA 4NKIH 4FEMA 2FR4A 3NCEB 3DSNB 5I5RA 1E9OB 1QBBA 4JLRB 4WUUB 2HMID 2R51A 1HHKB 3K0YA 3TN0B 1GGIH 5AKTA 4RMTA 4PBDA 5SWZE 3RVVD 5CN1A 4L0PB 1AQDB 3VYNA 4JFOA 4NFBA 3K6IA 4UT9A 2P9RA 4ZS7L 4WLCA 4GBXD 1A25A 1U8HB 2XWTA 4ZUWA 1KIPB 2VDMB 1GGTA 1IB5A 4HXBH 3OKOA 1U91A 4K5NA 5FYKE 3PCYA 3ZT5A 1UKTA 2ZX8A 1PJWA 4XP9L 2CHWA 4UNIA 4B9YA 4DGVH 1JMXA 4OZHF 5JW5A 3IT8D 5HTSA 4CADB 2IV8A 2Y2YA 2ZQKA 3CFMA 1FGNL 1IC5H 2CRIA 3HKZA 4MJIA 2ROYA 1PZDA 1T83C 2YZ8A 1KZQA 5T1DL 4HBCH 4LNRB 2CO3A 2O72A 2HMIC 4ZPTA 4Q4EA 5B39A 4IBSA 2VZ1A 3T1FB 4ACPA 2EICA 4MB4A 3RVVC 3VWKA 2ZKHH 4UBDD 1EZSA 4U6VL 1KGXA 1ZS8B 2HTLD 4YBLB 3W9DA 2EDHA 4YEEA 2VLRB 2XETA 4W9IC 3BP4A 5A7BA 3DUHA 4GBXC 1FNHA 4LASH 4IGBA 1ZEAH 2G2RA 4KY1H 3WTXA 1M3IA 4NDMA 4JO2H 4JHWL 5DYOA 3RJQB 5J1SC 4Y5VA 1C5DB 4AZUA 4KNQA 2R15A 5CLYA 1A64A 4A04A 1HCVA 1Z0MA 4NAQA 4EUPA 3O11B 1UOLA 2NW3B 4FLRA 2HX9A 3ARBD 3B7TA 1R5WB 4PJEA 3V52L 4DEUA 1JYVA 2AP2A 3ZHKA 5K9QI 3X11A 1HSAA 2HPOA 3SCMD 5T1MA 2VDKB 1NGYA 3QIBC 4KROD 3Q1EA 1DFBL 4PIBA 1YN6A 5T3XE 5I1KL 3D08A 1CPUA 1JI2A 2FJGA 4OLXL 5TDNB 2W65B 1KPUB 3ULVD 1CE1L 2VDQL 4K7PH 4UBDC 4KK5D 4E2OA 2R0LL 4PGEB 1KTDA 3OWEA 4P05A 2NXZB 5A2BA 2WB1A 3BZ4A 3WN5B 4K15A 4JGUA 4W68A 1D7BA 4J4PD 3T71A 5JIMA 2WSPA 2RJMA 3BSZL 4NNXA 4OVUA 2BOBB 2YD7A 4MMYA 1QFWH 1RUQH 2ICES 3FMGH 1TQVA 3MJ7A 4XMWA 4OCLC 5F1SA 1G9HA 2CHDA 3PGDA 1SYSB 2GJ6D 2NY0D 4DTGL 5IJVA 2PCFA 3MLZH 3TGXA 3ZKND 2XBZA 3H55A 4U49A 5I28A 5F71A 5HVFB 5FR3A 3ARBC 1IAIM 3HBZA 4PRHA 1L4IA 1S9XB 4RBPK 3HR6A 3SCMC 4AVIA 4PD4J 3SD2A 2OR8A 1XF5B 3CVHA 5SWSA 1I8AA 4JPKL 3Q6FB 1KFGA 4OFQA 4ZMTA 3ULVC 1ZIBA 3EH5B 1T1ZB 2AQPA 4KK5C 4KZDH 2OW7A 4XP4L 5KSBB 4UDUB 3FB6A 3WKML 1HXMB 5BXFA 3VU2A 5GGVH 2OMWA 5IFJB 4XP1H 4OF6A 3LQZA 4HC1A 4HIEA 4HPYL 1RK1B 1T1YA 3SQOH 3D39B 3ASWA 4WDIB 3FUEA 5GGTA 1ASQA 1MHEB 2NY0C 1Y6MR 4MD4B 2VDOH 3DLQR 2XN9B 3VI3E 1M7DA 3POCA 4L4VB 4TVPE 3ZKNC 2HJLA 2XJLA 2IV9A 4FZEH 3WS6A 3Q5OA 5B22A 4PJ5E 3FFCA 1EHLH 1T7WA 4XPAL 1ZRUA 2F2HA 3MGTA 4OGAD 2X4SA 3S98A 5I8OL 3TIEB 1FC1A 3NIDE 3KJ4B 4AYMC 1DJIA 1ADWA 6FABL 1IM3B 1NCTA 1MJUH 2BNRB 3SDAD 1ED3B 1EFQA 2NLJB 3KYMB 5A43C 2I7SA 3UTSD 1G9NC 1ACXA 4PCKA 3ULUF 2F8XC 2B4CH 5HHQA 4RRPM 3AREA 2G0LA 2GITB 3QR1A 2BH0A 4YE4L 5IMMA 4M8QA 3A47A 4M1CD 4HK0B 2R59A 4ENZA 3W0WA 3NSCA 4M8VA 2YSTA 1YNLH 3VFRA 4MZRA 3WNKA 5ITBL 3MR9A 3BGMA 3F01A 3O3DA 3BO8B 1OAJA 3I9PA 4OGAC 2IWKA 4HD9A 3EJYD 5HGDB 4LCYA 1C8QA 4OUUA 3WXVL 2WSKA 1CZ8L 5KVEE 1K3ZA 1P7KB 3K46A 4TRPH 4JFFB 5HHMB 1B3IA 3SDAC 2AJUL 5ALBH 3N91A 3K8LA 3NJIA 1IGJB 4KMLB 1QRNB 3SBWA 4QEGA 4KPHH 5DWUH 2V7HB 4A6YB 4DEPB 2R1YA 2XWJA 3L9BA 5IW6B 3AVEA 3NCJH 4TV3A 5B21A 5ETUB 3TZVB 2ENPA 4G6FD 1KIRA 1N4XL 2JKXA 5BJTB 1I8KB 2RFXB 2Y7QB 2R1WA 4JANB 4M1CC 5L2KE 3S88L 4Z76A 1NIDA 2OZ4H 4JVPA 4P5TA 3TTYA 1KPRB 2Y36L 1AGCB 4YLCA 5I15L 1BZOA 2OMVA 5I66B 4XNMA 5LNDA 2IMNA 3BPCA 5KVFE 5FUZL 3QJHA 3EJYC 2ZXGA 4GO8A 4CVZA 4HXAH 2VCOA 2FJHB 4WJ5B 5EU3B 5DRWB 4YDVA 1SQMA 4XNXL 4JG1H 4YSEA 1JNJA 3TVMD 4KUCF 4YR6A 5KS9A 4IIQA 3VH8G 2JJTC 4QHKI 4FJYA 1NCDH 3FQXA 3CV5A 2NY3B 4F8NA 3G6JF 4BJLA 2YUZA 4O02B 4B53A 3UAEA 3ARGA 5F89A 1FN4A 4HS6A 2V7NB 2IF7A 2HSIA 4F1SA 1FGVL 2VGLM 4Y16A 1QFUL 3VFGL 2OA9A 4XO5A 1H3UA 4N8VG 2I32A 2V5SA 3H3PL 3Q2WA 4GAGH 2I7OA 1I3GH 3VWJB 2DJ4A 4JW3A 1RUAH 1XVSA 4OB5L 3RNKB 3DX9A 4JBSA 2BSRB 3FQTA 3O45A 5SWZA 3O2VL 4HISA 4DN4H 1I4FA 3TVMC 3KPSE 5D4QA 3UH8A 3P1VA 3T1WA 4FLQA 1U3YA 1EWHA 1J8RA 2K0RA 3MX0B 1LP9B 4N9GB 2W07B 5CP3A 4GUPB 1K5NB 5ENWA 2H45A 4OZFB 5E8PA 1RJYA 3NVQA 4GS7C 4Q74A 5I18L 3V0FA 1Y1DA 1IE5A 1UXSA 2AJVL 4Q6KA 3UZEC 1XZ0B 2EVFA 1JVKA 3A3YB 3EO0A 2LOEA 4ZOEA 1HCZA 2WXQA 1Z66A 1AE6L 1KYDA 4GJTB 5T33H 3JTSB 5D71L 5GGUB 5FB8B 1Q8MA 1KG0B 1OP4A 4XMLL 3LY6A 2DLFL 4J12A 3SYQA 3WHXB 2HA1A 2OKMA 5GGRB 3OQ3B 4FTVD 5FLVA 2DF3A 3L3OB 5K93A 1NUFA 3BHBB 4ZOBA 4PJHE 3LMJL 3PV7A 5AVYB 3U9WA 1KCSH 4XMKL 1XGQA 5DDHA 1G7QA 1NC2D 3F7QA 1I8MB 5JLZA 3S97C 3BH9B 2FO4A 1GXEA 3O6KL 5KSAB 43CAA 3N1MC 5I76A 1C7TA 1ZJBA 2PYFB 4N2MA 3TT3L 3FQWA 1BF8A 1JF6A 1S3RA 3O2WH 5D1XB 4B3VA 1NIBA 5L4JA 4OU3A 1NKOA 3MOAL 3V6OC 5CU9A 4UMSA 3IF1B 3P3YA 1WA0X 3GJEA 2NZIA 3DK2A 3TO2B 2EADA 2CQVA 1HI6B 2NY1D 3IAQA 4G7QB 4RMRA 5E0QA 1DANT 5D1QD 3WI9A 4N68A 5C70A 2PWFA 5F21B 5K59F 1DBMH 1LD9B 3FQRB 5DRNA 4MLIA 2Y2TA 5HYQB 1PQZA 5CGYD 4ZMLA 3LD8B 1KV3A 4DOHB 4N28A 4P2OB 5E4AA 4IU3A 4J1UB 1U8CB 4L4TB 5A16B 4ZPVA 3F62A 4WEEA 2VUYA 3TONA 1GJWA 2HRLA 1MSPA 2OR9L 2ZONA 4FQIH 4I85A 1KGIA 5F7BA 3V0DA 3QNXB 1R24A 1KJVB 1AD0B 2N7SA 4AZ8A 1IAIL 3LN5A 3BAEL 1JG9A 1ZT4A 3HE7B 1RZ8A 4JHAL 2NY1C 4KVCL 4BCYA 5FHBL 1A6AA 4XMZA 5D1QC 4C59B 4L0ZA 4G8IA 2VITB 4G80A 3SO5A 4XPGL 3WN5A 1SDAB 2E46A 1I1FA 4NQUA 1G43A 5FAAA 1PD1A 4FL4B 5F1IA 2WZ6A 3R0MA 2K1MA 3NK4A 5E1AB 4HUCA 3IDGA 1NBZA 4FQQA 4I3SL 4JO8A 3HHRB 4J8RA 5J6SA 3VI3A 1TU2A 1JNLL 4K2UL 3WAKA 3C6LD 1BYPA 4EZMA 4YHLH 1U9KA 4W4OA 5I9QC 3LXBA 5GS2D 1JHKL 2G3XA 2NPLX 1QBMH 3L4CA 4PJ5A 5IFHL 2YPLB 1RZGB 5AZEH 5JHAA 2AV7B 5I8CB 2P4AB 4XCCH 4ANWA 1KEGH 3IJSB 1ZDQA 3UBXB 1XF2B 2ESVD 2KUTA 1MXDA 2AEQH 4MA1C 5CJQL 2IDQA 1BZ8A 5E9DB 1OY3B 3P4MA 3FYIB 2X3BA 4JRFA 5JQ6H 2KLRA 3I2CH 2XWCA 4TS6A 3T2NL 2GABA 3CSFA 1GZQB 3O41A 4RDBA 4PJ9B 3N6YA 1BX2B 2ZOLB 4YHZH 3ZOAA 3ESPA 1LDPL 1LLAA 4G7SB 4XXDA 5IWLC 1FCGA 4P4RA 1HTYA 2QQLL 1WGOA 4IRJA 3HZ3A 3VXME 2WUCH 3C8DA 1AAJA 3C6LC 5I1EL 3OKMA 2X4RA 4Q97A 2C1OB 3MLWH 3DIDA 4JFQB 1X6NA 2IPTH 3PQYE 3QXAA 2QSQA 2VDRH 5AB0A 3RE0A 1RK7A 3B9KA 2J3SA 4HUNB 2DOCA 5L4FA 4XE5B 5BQ7B 1KXHA 4ODVH 1JWSB 4HV8B 2AVGA 1JZHA 3V4UL 2WQ8A 1WHPA 4BH7B 5T1LA 3W2DH 2CK0L 3LDBB 1TOXA 2VB5A 4KV5F 1XXDC 4TNVF 3QAZC 5KYYA 5I1CH 3V0JA 3D5OF 1XV8A 1YPZE 4XMPL 5A2FA 2VJXA 3UBHA 2EIZB 3ZDXB 3MA7A 1FRGH 2O61A 4BQ9A 4FFTA 4PR5B 5D2NB 3BP5A 3IN0A 5L2KA 4LPVA 3L08A 4NM4L 1H3VA 5D2LE 1B0RB 2AAAA 1H3WM 4J23A 5JHLH 2NSMA 4Z7QB 2YUWA 2GSGB 1MCRA 3PREA 2YD6A 1U8IA 4XVJH 3S2CA 4PSRA 4DP5X 4M61A 1GGCH 3TCTA 1FFPA 4PJ6A 4UIMB 3SGJA 1ZHKA 5IUCA 3HHMA 3QORB 4BIKA 1M7UA 3FK3A 5KG9B 4A67A 3D25B 1TITA 4Y19E 3Q8EA 5FM4A 5IJDC 4PRNA 1Y18A 4PJIB 3H9HB 3FB5A 2Z34A 5C8JA 3MKGA 3WFHB 3IBOA 4B7IA 4F9PC 4XO3A 4RDQF 9PCYA 1MNUL 4P3CL 3BKCH 1OZTG 1G5AA 1NEZG 2HN7B 3OVUB 4DQAA 5LN4A 2PTUA 4L8SA 2FGWL 5HGAA 2PYEB 3LKOA 5F96L 1RJLA 5HHPA 5AW2B 5EBWA 3ZYJA 4ZSOE 1UXMA 2HRPL 3ME0A 2ZXWB 3DURA 3GO1L 1BMWA 3FQ1A 1X9UA 3CN1A 4P07A 5FDWA 5IW1B 1EO8L 3EOYG 2CKBB 4LVOC 1HXYB 3BUDA 1CK0L 4PH8A 3L3IA 4NQEB 3V4LA 1Z5LA 1TZ8A 5IMOB 1T2QL 4JR9L 4JRWA 5IJKC 3KPSA 5DVNA 4FHBD 2W91A 4H26A 2M2DA 1UC6A 1RAMA 5F8QC 2XG5A 4OZGB 5E1QA 4KKLD 1NH6A 1TZHA 1N8ZA 2ZG1A 1F11B 5CR1A 1QLFA 1NUNB 4M7ZC 2PO6D 3ULVL 1A7QL 1MG2C 5JW4Q 3QNZA 3IGKA 4BK5C 1H3PH 5F7YC 2QADD 2VN3A 2KERA 4FEIA 4LCCC 3MLPA 4U1GC 4K3GA 3MNVB 1N26A 3MLVL 1M71A 2ODHA 3DJSA 3I9GH 4O4YH 3VFNB 5BQDA 5DQJA 2VXTL 1D7CA 4U1IB 4LVHC 2CGRL 4PJ8D 3FTYA 3LNEA 1N70A 3GK8L 1RL1A 4IJTA 3IJEB 4GXUN 4MS8D 4DH2A 4PJHA 3MRMA 3N0PB 4AT6A 4YJZL 1KCUH 4ZXBB 2J6EH 1FZKA 5AZUA 4RFOH 1SEBB 4F9LC 3IJYB 3MJ6A 3V9FA 2IH3B 3RTQB 2F5BH 1QWHA 1PEZA 1WBZB 4NCC1 1YAIA 1F58H 4O51A 4PS4L 5BV7L 1ZTXE 2PO6C 3QJTB 4QO1B 5AW6B 4PRAB 2NNAA 4JN1L 3IGFA 1NC4D 2EDYA 2QADC 3VE0A 4ZUUA 4HS8L 1JI1A 4ZUVA 2F18A 2P5WD 3JV6A 1QD0A 4UQIM 3AS1A 4X4KA 1EEQA 5DEFB 3FO0H 3L3HA 5FPIA 1KWGA 3EHBB 5SX4I 2Q8BL 3QDGD 1A4KA 5HDLA 2DQCL 1G9NL 2V3FA 3E3QE 4XI5D 4Z7IA 5HYFA 4Q9RH 2ILLA 3FT4A 4PJ8C 4ZFQA 4UDTA 4MS8C 4RVBA 5CBAB 2GUOA 3CX5J 4R0LB 1AXTL 5EZOL 1NAMA 3NZHL 1NGZA 4JY6B 5JYMA 1KXTA 3T3ME 4ZOAA 3MJ9L 4GAYB 1KDJA 5CEYA 5A6MA 1A7NH 2IFFH 1UA6L 2VKWA 4BZ1L 3WMSA 43C9B 1NLBH 4XVSH 5IR1B 3MRLB 2FIKA 5CLZA 4OV5B 1HN1A 3HMXH 4X80L 4JZOA 2FSDA 1CD9B 1FIGH 1K6QH 1NUGA 1RUPL 1RZFH 1KGCD 3FZUC 3LZRA 4GAAA 3X1BA 3BKYH 5HSFA 3KNBB 4XCYA 2B2XH 1CLZL 3LH2H 1OWRM 3DYOA 2FEJA 3RAJH 3WJMA 1A1NA 3BAWA 1BPVA 4MQ7A 3VJ6A 1J8SA 2VSMB 1GW0A 4XI5C 2M26A 4U0RB 2GBVA 1S46A 5EIIA 5IREA 6TAAA 1HHIA 2KLTA 2QZ5A 1LWHA 3K74B 4F37F 4HWEL 3GMMA 4M5YH 4ZUWB 4ZX5A 2PXYA 2F58L 4WU7A 3VD3A 4X4ME 5DC4B 3MXWH 4N6RA 5ISZE 4W6YB 1E5UI 1JFQH 4P2QB 2XV2A 1C5BL 5I75B 3NSFA 1SGKA 3I6SA 2C9QA 4NBZB 2Q7NA 3FO9B 4P06A 3RHWK 3LS5L 3U1QA 2XOTA 3QQ3A 4CN1A 3LQAC 4HIIB 2JB6B 1S9VA 3B9VA 1TJMA 4R7DB 3RZCD 5EF3A 4U31A 2OL3H 1JPTL 1M4KA 1OAZH 1M7IB 2YR3A 1UM6H 4K4KA 4UTAA 2CUAA 3BP4B 3L7FA 4BHUA 2CK2A 1DSFH 4IGBB 3WKYA 1WK0A 4DWHA 1OP5H 1SOKA 3ESUF 2IAMD 4FZ8H 4QRQA 3H42L 4FKKA 5D1ZI 5DT1H 1L5GA 3FQ2A 3D2TA 3HPJA 4APXA 3H9SB 3NRFA 1KTRL 4HSCX 3LEYH 5DRZB 3X14B 3UTTB 4C47A 1GOHA 1YQ2A 2Z7UA 1HSAB 4IKJA 5EO1A 3MFGB 5D7IE 3VXMA 3C5ZA 1J48A 3IRZA 3IRCA 4ABQA 3OC8A 1G1KA 1CL7H 3RZCC 3BZFA 3QCUL 4V2BA 1Q94B 3C5JB 3HC3H 1I8UA 1RHHB 3ARPA 3MRPA 5IGXL 1IM9B 4P3DB 1E2WA 3KGTA 1F1AA 5MHSD 3G5ZB 3O3BA 3CDYA 1QFHA 1LO2H 2NQDA 3HUJB 4K23L 2W92A 4KJYA 4LE8A 5E6IA 4XOCA 5FO8A 3DBXA 3UPRA 4DN3H 4Y1AD 4NHUA 1N0XH 3MUGB 4GEJA 1CFQB 5JIQA 4MDJB 2YD8A 4MKTA 4AQEB 5D9SB 2FNWA 2BINA 3O0LA 3NFNB 4XXWA 5F1NB 3FBKA 3N40F 3ZHFA 1EJ6A 1L7TL 4NBXB 1YPZA 3JWDC 4PJBE 2R56H 4YHOL 1ZIAA 4WV1B 1LE9A 1MRCH 2KHAA 5DR5L 5B1BB 2CIIB 1A6UH 1D5IH 2GAZB 4ZAKB 3HPLB 4APQB 5L6YH 4UT6H 1JGUH 4JE0A 3T3PB 3FUMA 5D2LA 3F7YA 5TF1L 3FTVA 3FB6B 2D9CA 3T0EB 5BXFB 3M1BB 3U6XS 3WEAA 2HRHA 2PCYA 3HR5B 3LKPB 4KRNA 1RD6A 2OMWB 3LKSA 3LQZB 3HMWL 2W94A 3NJGA 4AITA 4R4ND 4BA8A 3U6RA 5I6OA 2R9HD 4I48A 4EZJA 3LZFH 4JVUA 4O2EA 4PWEA 4WSJA 1LO5A 1A3RL 1ZA3A 3C8KA 2K3TA 4JQIH 1E7UA 4WHDA 4Y19A 2DAVA 4FERA 3LKNB 1EX0A 4HT1H 5EC2A 3B9AA 1PDKA 4HPOH 4MQSB 3BZDA 3FFCB 1EHAA 3BP6A 1JGVH 2WNXA 4QRPE 4KQ4H 4FXKB 4PN6A 4L5FL 5TQ0H 2R69H 3VGBA 4G9FD 4N0YH 1MHHB 4ICWA 1A6VL 1F8TL 4I18B 3FH5A 2DRUA 1QUNB 3OB8A 1JIBA 2A5UA 4X7SH 4EN3D 3D3VE 3NPZB 4ZSOA 1KC5L 4PYHA 1HDMA 4FI6A 1E4XH 1VFAA 4WWKA 3DOIA 4NQXA 1IEBA 3BQUA 3OMNB 3OR7A 4LBAA 2XWBA 1SY6A 4Q8BA 4R4NC 2R9HC 1COBA 1R3HA 3IE9A 4CSTA 1PTZA 3QDJD 4M5TA 1PFOA 3CLFH 1JMZA 3RFRA 4M8QB 3QCTH 3LQMA 3S3DB 2Y7OA 2IJ0C 2BVQA 2Q87A 1IMHC 3W0WB 2XVLA 2UZYA 1XR8B 3VFRB 3WSQH 4FFZL 3HRZC 1BSIA 3O3DB 3KCPA 4I77H 3F7LA 3L4XA 1AR1D 4OT1L 1RIUL 4QCIA 2EE6A 2MEJB 1UXWA 4CSZA 3S5LG 4EN3C 1FYHB 1G4MA 1JZ7A 1F4WH 4FQCL 3POHA 3BZEA 3DJ9A 3DRQA 3FRPG 4NUPA 3VSVA 2G75A 2R1YB 3APMA 3NJXA 2BVOA 2XWJB 3QT2A 4U3CA 3X3GH 3QZOA 4U1KB 2PR4H 3RG1C 4FQXD 2VZSA 3ZHDA 5TE6H 5L4MA 2KZ1B 3OKNA 4KI5D 1E90A 4YIQA 3QZWB 5I71C 3GXPA 2AXGA 4QY8A 4W81A 2L0DA 1IEAA 1BBJA 4AIZB 3K7UA 2FLRT 3UTQB 4KGLA 1T6BX 3WNJA 3O3AB 3MGAA 1AR1C 4CMHB 3A4EA 3BPCB 4G3YH 1F6AA 3N04A 3G5WA 1QLEB 3U0WH 3GIZH 4RRPA 2BWDA 5DD5H 1I1AB 3I75A 2FWOA 2LTQC 3HNSL 4PY7A 5LCVH 2ZWNA 3QUMA 5KVGE 4BZYA 2YD0A 1F3DJ 3H56A 4FFWD 3RWEA 4FQXC 2BSDA 3WO4C 1PFCA 3NDYE 1JD7A 2ZAHA 4AG4H 5F89B 15C8H 1FN4B 1U8QA 4KI5C 2EDOA 2K70A 1E40A 1URIA 3PF2A 5BZWB 4W9EC 4Y16B 2X1PA 3CC1A 5DJCB 3RIFK 2JKNA 1JXJA 1RUML 1KYOJ 2XXFA 4E9WA 1E4KC 1YYML 2ZWKA 3FO2B 1CT8B 1B4JL 4JJHA 3VXUB 1A7RH 2J1KA 2RH0A 1IKNC 3FULA 3HNVH 2DMBA 4PJEF 5FM5M 3OM3B 3TJEH 4DPBX 2JIXA 4HF5L 4X4YB 4LCUB 3EYUL 3O45B 1KIQA 4LMQE 4HZAA 5L9DH 1J5OL 1OP3H 3T8VA 5F93C 3RVXD 4PJCE 3HAEB 1QO3A 2FT7A 3Q13A 4G6MH 1ML0A 1SM3H 2QKIB 4GBXA 1DQMH 1R3JB 5GISH 3MC0A 3UJTL 2Z1PA 3L5XL 3VVWA 4R83A 2B4CC 4FNLL 1NMBL 1RJYB 3QZNA 4X4MA 3ZGHA 3J07A 2GKIA 3N43F 1MXGA 4M6MH 5GRUH 5ISZA 3WFCH 5A3ID 3L9RB 4P9ML 3GXTA 3V6OE 2A9NH 3OTTA 3RU8L 4KOBA 2WWKT 1Q72H 2D03H 4LIQL 4N26A 4YK4B 5AQ0A 1LE5B 2H8PA 5DHYB 4X0NA 3A24A 3QIBA 2A9DA 2HPTA 5GSVB 4KX8A 2YGOA 3LKQA 1H0DA 3BAXA 3DTXB 4QTIL 3RVXC 4MB1A 5I71B 3RP1A 4P4KB 4UINH 5DDHB 2AJYH 3OHXC 2IEPA 3ILDA 4Q89A 1O5DT 1AZUA 1XR9B 2JE8A 3ABLB 4LO9A 1ZGLP 4XZUA 3E6HB 4X8JA 2EDEA 5D8JH 1IQWH 1Q0XL 1AFVH 1RJZA 5A3IC 1D5BB 2XKNB 3QJFA 1MCSA 5D4JA 3DV6A 4YZFF 3UP6A 2ADGA 3CXDH 4ISVA 5DLMH 4L29A 4FG2A 3NP3A 1E28B 5T5NG 1I7RB 3GJEB 5D7IA 3T4AC 1A6ZA 2C9SA 3DUUB 1XF4B 2NSQA 4QT5A 4G6KL 4DW2L 4M1DL 4LDOB 5I1DA 4FFYA 4E9SA 2IALA 2E9IA 1J11A 1FIEA 3ECBA 4UILL 4B5ZA 3MDJA 5FKAA 4S11A 1G7LA 2Y3NA 2A77H 3CVIL 1X4YA 2IADB 4IU3B 1T5XA 5BVPL 2ZCKL 2VH5H 4OLYH 3CHOA 2F5AH 4K8RD 4M7JH 4C57C 3U4AA 2DQIH 1GVIA 4AYFA 5LQBH 1QACA 4BCZA 1HX0A 3LKRA 4PJBA 1SFHA 4F15B 5JIPA 5KTEL 2W81C 5J6HB 1AXSB 1IRAY 2CDFA 1OT1A 4ODHH 3NTCL 1G6VK 1QFWM 4KBPA 1CGYA 3C08H 3S5ZA 1MFNA 4PG9B 1OT2A 1T0MA 4QJ5B 1QP1A 3I9AA 4Z7VB 4G7YL 1CJYA 3G04A 3L7EA 1TNNA 4G80B 3HNTL 3QEGH 4KX7A 1ADQL 1HOCB 1I1FB 3K6OA 1NL0L 4ZFOA 2X05A 5J9PB 1JAEA 4NQVA 3RA7H 1UJ3A 4OQ1A 2EH7L 5DJAA 4UQ3A 4Q9QL 5HHOE 3J7HA 2YFOA 1I9RL 3GUFA 4MD5B 4N2IA 5KJRH 4K71C 4J8RB 1J0YA 1KLFA 1MJ7H 3VI3B 1TU2B 1XSJA 1YMMB 4F7PA 1HVXA 2XYBA 2VO5A 3HE6B 4QYOB 1YMHA 1AD9A 1RIVH 4UZSA 5F0PB 4QRPA 4X9BA 5ERWA 3QIWB 1T03L 2ZUWA 3ATAA 3B5GA 3CIAA 2ESVE 1KYUA 2CR6A 1MNNA 4PGZA 1CDJA 3HI1B 3D3VA 3L3GA 2DJUA 3GI8H 2TRYA 3JVFC 5IQ7H 2ZICA 4XPTL 5DJ8A 4Y4KB 4YO0A 5I0XA 4ZDHB 2WM0A 5EIVA 4TOYH 2BZ7A 2DQJL 5ILTH 3IU3B 4A2EA 4AL8H 3A6BH 1U8NB 2ZAGA 4Y5YC 5G55A 1KFAL 1MFCL 4XXDB 1SMAA 4ALAC 3W57A 5KS9F 1UYWH 3D4CA 4UIKL 4N87A 1IKFL 1LTXA 1UD5A 1CE6B 3ET9F 3HC4L 3L4WA 3F05A 4FQ2L 4IRJB 4FNPA 4MVBD 4UZUA 4B6ZA 4KTGA 1WFUA 1BIIB 32C2B 4XNQA 2X4RB 2AJXH 3H2QA 1ZLVH 4GQPH 3BEVB 1MFDL 4JM2D 4PJAB 3B9KB 1LO4H 2NY5H 3H2PA 3QA3B 1W8OA 25C8L 2VSCA 2YD5A 4I1NB 1IGIH 2PETA 5EDXA 3VB8A 3T8XA 3W81A 4D94A 2IDSA 1V3LA 4I3RL 4QRUA 1JF1B 5F3FA 2OXGA 1GGBL 3HC0B 1YEDB 4MX7B 2Z8WC 3HI6L 1ZLDA 4ZZFA 1OPGH 2QEJA 1J8HB 3MA7B 4WSGA 5E1GA 4P2RE 4Q0XH 4MVBC 3BP5B 3BE1L 5LAXB 1K4CA 2OXHA 2VT0A 3CLEH 2XWDA 4BKSC 4LLWB 4ANUA 4L1LA 2BNQD 1MCBA 3FQ4A 2DKMA 5GGRY 3WEBA 1PY4A 2HT4D 3EYOA 5JW4M 1QW8A 3CXHJ 3NABL 3PXJA 2UVFA 3QJXA 2LU5A 3EO1A 3OG4B 3SJVD 4YPGA 1YQVL 3ZLQC 5A1AA 2LVEA 4LLMB 3PJNA 2J4WL 1AZVA 2YGVA 2VDQB 3RX7A 1XL4A 3N0AA 1U92A 1SBSH 3L1GA 2R4SH 3IDJA 1UGKA 1A02N 3U7AA 4M4RA 4OI7A 1D5XA 1DJSA 3FB5B 5AAPA 3SGEI 2BZCA 3FT2B 1HXKA 1Z6JT 2WN2A 4V33A 5LBGA 4R4BA 4A7QA 2YPVL 2YQ3A 4P5KA 4XB8A 5LBVA 4DK3A 1T6VN 4FLOA 4TLUA 4E36A 4LOEA 5HHPB 5EBWB 1KCLA 4D0CA 1HL5A 4MB5A 2HT4C 3IK2A 2NT1A 1WDAA 3IFPB 5DUBA 1IBHA 2QQQA 1ZVNA 2DICA 4G7VH 2HLFD 2E6QA 3FL7A 2BVUA 3L3IB 2XBDA 3QRGL 4F1ZA 4NO3A 1HAWA 3UROR 2VO8A 2ICEC 4LAJH 4GRWE 1S7WA 2Z31D 4GKSB 4JM4H 1BQHG 3JWDL 3ARYA 4PJCA 3OXRB 4AVJA 3RWHA 2B1OA 4GQQA 4KJPD 3O9WD 5C07E 3E1ZA 3KPRE 3VXSD 2CRYA 3QDMD 5ADOH 5AOLA 4MNGE 1C5CH 1BAGA 2ROXA 5B1JC 5KBKA 3GSUB 1INDH 2P44B 3RBGA 2AS5M 5ANMB 1NEUA 4GFXA 3IE4A 4MAZA 1GGIL 3RJDA 1SMOA 2OK0H 5JZ7D 4N6QA 4NRYA 1FYTB 1K72A 5E5MB 5I1IH 2B1HL 3V6OA 2WIIB 3GM8A 4OKVB 4MMXB 3N85L 3VXQA 4M03A 4LZKA 4CA4A 3K2KA 3QWRD 3AGWA 5EPMA 3X2QB 4E42A 2N7BA 2R29L 5DWPA 4X99B 1M71B 2BSCA 3E7JA 1Q9OB 2HLFC 3T65A 4NC1C 4Y9FA 1UZ6F 3GMNB 4G71B 3MRMB 3MRIA 2NUTB 2Z31C 5DTFA 4HLJA 3LIZL 4GG8A 2XPGA 2J25A 3ZIYA 5JPMC 1MAKA 2HCZX 2ZCZA 3O9WC 3DMMA 3BPNC 1NC2A 2BSEA 2DTSA 3SDCD 3STBA 1B2WL 1P7BA 1IFGA 5E8DH 3RGBA 4MSWA 4EZKA 1BLNA 1FFNA 4DP9X 3VGGA 5IUSA 3NJHA 5H94A 4ZG1A 5JZ7C 2FT6A 4ESKA 4OLEA 2HKFH 4ZUUB 4AYBA 1F4XH 3CH1B 3LRSA 3VI3F 4E5XB 1EFXA 2Y5TA 4LBEB 3NAAL 1ZEAL 2R8SH 4HFUL 3ZYOA 2E4FA 2ATKB 5I6NA 3KGUA 5D1QA 3QDAA 4R7NB 3W9EA 3MLSL 2ZNXA 3NIDF 1EAPA 1NM4A 5IVXE 4HJJL 3AM8C 3FOMB 2MNJB 3SDCC 1VHPA 1V7NH 4K7FA 1PZ2A 4OTXL 2IWGA 3B2VH 2HVJA 2K6WA 3RL2B 1TETH 2MQ3A 2ZOTA 1KGCE 4Z7AA 3OKKB 1U6AH 4LSSH 4BFKA 9CGTA 2QV4A 2K6YA 2R27A 2CDEB 3FQYA 3QYCA 4P2CG 5EBLA 1UQSA 2A4ZA 1A1NB 4G8GD 4L3CA 4AI7A 3GC3A 3DOHA 3EYQD 3L1OH 3ZMRA 4AC4A 4D7BA 1JZ2A 3BIBX 1QFWL 4NENB 3WIIH 1NCWH 4GUCA 2AMUA 3GMMB 4WK2B 5DD0H 1XWVA 1XXFC 2C9RA 3P2DA 3PWJA 2PXYB 3TM6A 5HPMA 2D3LA 1PEWA 4WU7B 1HCFX 3D50A 1JK9A 4ORGA 4IYKA 4DGYL 3KG5A 4P9HC 5DQDH 2QBWA 4YHKL 3MRHA 3F12A 1S5IL 4P46D 1INEH 4R26L 3GRWA 4LLAA 4HUWB 5HHOA 4Z7UF 2EJ1A 3QC6X 1TPXB 2P8MA 4XWOD 4R9HA 1MWAA 3QHZH 1S9VB 1TQTA 3C8HA 1L6ZA 4OIIL 4U05A 4KZDL 3BSGA 3C6SA 3UP1A 1FL3A 5INCB 3GBNL 3VRLE 3BH4A 5E2TH 3EYQC 3L7FB 3Q44A 2ESVA 4HDIA 4EJ1C 2EO9A 1TQCC 4KKRA 3Q5TA 4L8DA 1LVEA 3TBVA 4PJGE 2O5YH 3N06B 4OH2A 1EHXA 4IMKC 1L5GB 1XH3B 4FZEL 1IBZA 1KB3A 2X7LA 3FUKA 3B6SA 3AWEA 4OCYH 3HLAB 3DRTB 4Q9CA 4N5ED 5T5FH 3H3BC 3Q3GB 4P5RA 1S9YA 1PBYA 1FSKB 1JVOA 2UWEE 3BT0A 4UQ2A 2ZOWA 4XWOC 1KJ3L 5EO1B 5K39A 2AZAA 3VXMB 3AGVA 2OMUB 4JDVB 5D6CA 1GAFH 4OLWL 4MCZB 3NPSC 4JFDD 2F15A 4FNQA 2XJKA 3IM1A 5DVLA 3C5XA 3IETA 3KPQA 5IHBA 1TNMA 4MNHA 1MDAA 1AKJA 3QUYB 3VFVB 5L8LB 5MHSE 3O3BB 1P5UC 3PPEA 2ZWYA 5C0JB 3LOWA 3DBXB 3JZ7A 3VA2C 5DJDA 1PL3A 3AT8A 3OB0K 1X5FA 1J86A 1NFDE 3VI4E 3KDMB 3AZUA 5AL0A 2COQA 5IB1B 3OKEA 1YNLL 1YPZB 2LAAA 4N5EC 5B7EA 4FLSA 4CSSA 1JZ3A 2EVJA 4P2RA 3IMRA 2CHZA 2F74B 2ZG2A 3GBEA 1TJIH 1UD4A 2W0KA 3Q9QA 1J1PL 1JPFB 1OAYH 4PG2A 4HWBH 2CBQA 5D2LB 3F7YB 1WBXB 4H8VA 5CJOH 4BE5A 4Z0BH 3QQDB 2Z4TA 4P23A 2EECA 1KEMH 2C3VA 2K9FB 3PWLB 3TO4A 3X3FH 3LKSB 4AJVA 2M83A 2ITDA 1I9EA 4X2UA 2H1PH 4U3SA 3UG4A 5F7HA 3PL6B 1SVCP 1CS6A 1EO7A 4ILDA 2FQFA 4BWUA 2OZ4L 4C54A 3E9TA 1Z5HA 4Y19B 2J43A 4ZX3A 5DZPA 4PJHF 1NAKH 5AFAA 4O5LL 5JOEA 4FXGA 1AQMA 2COVD 1JTPA 1K5WA 4E9RA 3NCBB 1IX2A 1UGNA 1U58A 1BD2D 2ZJSH 4HXAL 2C3HA 2L7EA 3K8KA 4ZRGA 4M56A 5EOCJ 4MDIB 1BQSA 2MOGA 3ROLB 4BK5A 4MS6A 1PLAA 1D9KB 3BGAA 3CH8A 1HDMB 1S3KL 3OC5A 3MV8E 3SDDD 4NQXB 3EH3B 2F8VA 4GT7A 4L2LA 1X7QA 1UM5L 5ESAA 3LN4A 4CU8A 3ZR5A 1DVTA 3QXTA 5GS0L 2ZWLT 4AYEC 1FVCA 3BT2L 4NLHA 4G72B 5JIDA 2DWSA 2YEVB 2J21A 1MW1A 2ISDA 1WIOA 1VGKB 5C07A 5I1HL 3KPRA 2BVQB 2EVHA 4HLZH 1QMUA 4WI9A 4MNGA 2X1OA 5DD3H 3T08A 3RWGB 1Z9PA 4ZO6A 4Q14A 4JY5L 3KCPB 1DVXA 1HL4A 2QLVB 5AAMA 2FQDA 2Q2EB 1UKQA 3T4YA 3D18B 1ORSB 4MCYA 5DVKA 1IT9L 3LHPL 3RX9A 2XZCH 1HWWA 1TCRB 1NDGB 3BUPA 5D7SL 3PGCA 4Z3GA 1YJDH 2BNUA 3GTVA 3QBTB 1NSNH 1MCEA 2P5EB 1S2EA 4S10A 5GRXG 2B7DT 4UT9H 4EVNB 4K8RL 5DJYB 2ID5A 3MNMA 2FTAA 2YC1B 3L5JA 3OKNB 2XBTA 4R4FL 1ZLUH 2HB0A 4L3EB 1MRDL 1MCLA 4MAUL 5LXVA 3N1QC 2WVVA 3AG4B 1MHCA 2VXQA 1RURL 4M93B 4NGHH 3FSWA 1BVNP 5AB9A 5DZLA 1F6AB 2UZIL 4TSBL 3FB7B 1GJIA 2CXKA 1NBVH 2IQAA 2BVEA 4PY7B 5BNXD 3ZE1E 1DEEA 5I0YA 3QUMB 4ALAL 4HBQA 3IGAB 2FCBA 4KUZH 3ULUD 3LAFA 3OLEA 4F20A 4PW3A 2HG5A 2MOVA 3QHFL 3ZGIA 5J6GA 3D0VB 3SY6A 2J57A 2JVUA 5IOPB 1T3FB 3O2WL 4GQ9H 4R6UA 5IROD 3CMGA 3B3IB 3GZOA 5IVXA 2CA4A 5IVNA 4QIRA 1NWOA 3DSFH 2YAEA 3FCGA 5FYJH 2CMRH 3HG1E 4NP9A 3N40P 4PU2A 3DGGB 5DCCA 1SNRA 2H26A 3QW9A 4LCWD 2WINA 2Q10A 2ZUYA 5D7JD 2WD0A 1MKFA 3GEWB 1J10A 3II3A 2NR6A 2Z7ZA 3MRKB 3EZ8A 4LVNC 4X42A 1KZYA 3VFUA 5C0AD 4BFNA 1QO3B 3S3SA 3ULUC 3FCTB 4GBXB 5F9JA 4R5XA 4L3FA 4F2MB 2F54D 3US1A 4JGMA 3A0OA 5EU6D 4AM0B 5D7HA 2WO4A 4JDZA 5TQ2L 5IROC 4FQIL 5JO5A 4QD2E 1G9MH 4S1QH 4ODUB 1S7SB 4JFYA 3HN5A 1NCIA 5FFLA 1L7IL 5L8KB 3P2BA 4OFDA 1K85A 2N3JA 5K9OB 5D7JC 3ZE0B 4S0TD 1NCAL 1C08A 2H0PA 3MNWB 2ZYSA 5EA0H 3TV8A 1IC0A 1XL6A 4J3XA 3ZSTA 2EEDA 3RZCA 2C34A 1H0DB 3KGRA 5DMKB 4KUCD 1FNAA 4YLQT 3VG0H 1AGEB 2PW1A 4Z7OF 5AOMA 3TWCL 3ARTA 5IBUG 1T5WA 5D2LF 1N68A 5E08H 2LQRA 3JWNH 3K80A 2FATL 3OAUH 5TE7H 4AQ8C 4YXLL 4ABVA 4LDCA 3E80A 4LB8A 1EXUA 1HKLL 3QRBA 5C0EA 2ICWA 4B60A 2ZXAA 5AVZB 2VDLL 1NCCH 5KBPA 5ESVB 1CBJA 2EE3A 1N5AA 4KMQA 5AZEL 4LARH 5JHDE 3ARBB 4ZBJA 4UAOC 1KEGL 3IFLH 4M1GH 1Z9NA 2UWEA 2VLKE 5B3JE 5IHWA 3SCMB 1FQ9C 3ABMB 5EORH 4KROB 1VADA 2AJZA 1JZIA 5GJSH 3TIDA 3OGCB 1WUZA 3OAWA 4LHUG 5B4MD 5FW6A 5JQ6L 1BECA 4EF3A 3EYSH 2IALB 4FP8H 4LSUH 2PWGA 2KQNA 1G7LB 5DMIL 1Y1UA 2OSWA 3Q2LA 3CZFB 4O58H 1K4DB 1X5ZA 4BFJA 1MH5A 4WHYH 4Z78B 2EILB 2ADIA 2GJ6B 2NY0B 3MU3A 5DO2D 1UUSA 3VI4A 1NFDA 2Y7SA 2FQGA 4QDGA 4BFIB 2E7CA 1TLMA 3MBEA 4GINA 4JE4B 3T0VA 4PJBB 1DVFD 4OJFH 1YZZA 4YNYB 3HZYA 4OJAA 4XNZC 3R7RA 3WE6B 3HFML 2APFA 1CDBA 4X6BA 2OYKA 4JO1H 1ES0B 3IB4A 3DROA 4N8PA 4A2FA 1FAKT 1BVOA 1WGVA 2LFEA 3HB3D 3KYNB 5B4MC 5DGQA 3L7EB 4DERA 3HTLX 3MRDA 3UAAA 2C1PA 5CD3A 4GP4B 1FBIL 3ML8A 3K1DA 5CS7A 4YHIA 2NQ3A 2Y23A 4FULA 1S7VB 4NQVB 3MLRL 2VE6A 5E9AA 2CO6A 2W9EL 8PAZA 2AXHA 4YSTA 2WBJD 1KJ2A 2H3XC 2QGCA 3QQ4A 1TT6A 5DO2C 3DHUA 5E8OA 4AJ0A 2CZNA 5D6DA 3A6OA 3H8NA 3EYVA 3BRGC 2Y22A 3KLDA 4ONHB 4CJ1A 1DVFC 1MREL 1QNIA 1NPNA 1CQKA 1YAZA 1YMHB 4WAFA 4XAKE 1J8KA 1AD9B 4XN4A 5CLTA 2KQMA 2LHAA 1JDCA 1KGJA 3WDJA 1AHWC 4YGAB 2C7UB 2WQUA 3HRZA 4XVJL 3FN3A 3D6GA 2D7OA 4RGND 5G2NA 4DHLA 1MCOH 4E68A 2BIOA 3GGWA 4EI6A 3HB3C 4WEMB 1VLXA 2X2IA 4EN3A 5M95B 5MENE 2VC2H 2GTWA 1ZE3H 1ZLSH 3MV8A 35C8H 3GNML 4DKEL 4YPJA 1OK8A 1S7RA 3SDAB 2E75C 5I19H 1OGAE 3UCQA 4FKEA 4JJ5A 4CDHA 3UTSB 4F93B 2OMXA 5IQ9B 2WBJC 3DVFA 1A1OA 4F57H 1H3TA 1M1SA 1NLDH 2PTTB 3H7LA 2GIYA 4L8BA 5B7FA 3WLWD 3BDYH 4H5SB 3NA9H 1Q1PA 1JNNH 5DUPL 4XCFH 3T3MF 2IAAC 1ZGLM 1VZGA 1UXLA 2QQNH 1S7TB 4N90E 1XCXA 1M6UA 2GY7B 3MJ8B 4HWZA 3FHEA 1UZ8A 4RGNC 3TA3D 5FECB 4DVBA 1M53A 3MFFB 3S4SA 1WV7T 2CCLA 2XIIA 1JZ5A 2E86A 3IAGC 3EJZD 4P9HL 4AIOA 1HHGB 4QTFA 2G9HB 3WYRA 4N0RA 4RDQG 1WLHA 4R8WL 2V9QA 1ILUA 2B3IA 4LHUD 2VLMD 4H7VA 1FE8L 4O2FA 4PJ7B 2UZXB 4N2DA 4JRYE 1GZHA 1J9QA 2GFBB 5EN3A 4ZODA 1FFTB 4FQXA 4BGLA 5DGRA 1D2PA 4G6FB 3WLWC 3FTXA 5SWQB 4HS3A 1H3PL 5K9JL 3ZIMA 1GYWA 4YFEA 2X89D 3SBQA 3AWFA 2R39A 2EXWD 1ZXQA 4NJAL 5FYKH 1EA9C 1OB1B 3IFOB 3MROA 3FH8A 4OQTL 5I0WA 3G6AB 1OOAA 2FJUB 4O4YL 1XCTA 5C71A 2OW6A 5JXAL 2V2TB 2RIKA 1AKPA 3TA3C 1IKNA 5FYKU 2P8LA 3F6LA 3G5YA 2R2HB 4I2XE 4XMVA 1TJHH 1JHLH 3DXAD 3PGFL 3QFJD 4RFOL 1JOIA 3OKLB 4C56D 4PM1A 3TVMB 2X4UB 4X6DF 2F5BL 1UEYA 2ZYHA 1KJMA 4LQFH 1KCBA 2LAGB 2P1YA 1CLOL 3QJZA 4G9DB 2XX1A 4M4RB 3BKMH 5DUMH 3OJDA 1A3LL 5HYJD 3SPIA 2AK1L 4AH2A 5C2BL 1TTRA 3ZHLA 3HS0A 4P5KB 2GJJA 2EXWC 5SX4H 4BSVB 4PJXE 4G7RB 3U7WH 3UX9B 2JXMB 4KO9A 3HG1A 3EGXA 4LLVA 5K9KA 2X9YA 3GBMH 2G30A 3EUDA 3GSWA 4OCSH 4JMXA 5F9OL 1PY0A 2P48B 3TCXA 4NI6A 1MLCA 4KQ0A 5DUBB 4X7TB 3STZB 2MFNA 4N2KA 4ZOCA 4GO9A 4MMZC 5D7IF 3BKJH 5E8NA 3RHWF 2NTSP 3QEUB 3NJLA 4HEPA 2IGFL 1NLBL 4J6RH 4PJCB 1WYJA 1A6WH 5CMAB 3MXVH 1URLA 3THMH 3GB7B 1UVQA 3OHXA 1T2JA 1IL1A 2V5YA 3BVNA 3QUKA 1YG9A 3GKWH 2Q2LA 3T6ZA 3GFUA 4S0SD 4IBYA 5JA9A 1AMXA 1MFEL 3UJIL 4XPBL 1AZNA 5I17A 3LH2L 4F24A 4D2NA 2HZHA 3BDBA 3CFEB 1U2HA 3TC9A 4KXBA 3VXQB 1M1XA 3B3BA 3QHTC 5ACZA 3P4OB 5C0IA 2J8UE 4E42B 5CINH 3C09C 4PJBF 4P8QA 3T4AA 3C9NB 3GT6A 4DCQB 3KPMB 4M5YL 1A1MA 5HDBB 2Y1AA 3GXMA 4FTVB 4M5ZH 4I5BA 2W95A 4O2CB 2V2XB 4WFED 1NGPL 3MRIB 4ZUTA 4P48A 3F65A 5DTFB 2YPKB 4KQ3L 2AXJA 4ZO7A 1JFQL 5FGRA 1GMEA 3RFZC 2W0FA 1HNGA 1NC2B 2Q86A 1T04A 1JE6A 1XEDA 4OCNC 5DJZA 1KXQE 3U0TA 4NKOB 5FWQA 1CFNB 1CTMA 2OL3L 2R23A 4GKOA 2H3NB 4U1NB 3MN8A 5JHDA 4TUOA 3VXRE 5KUKA 4HA1A 3H85A 2VLKA 3GSRB 1G7PA 4KVPA 1BQKA 2ICWI 1RZKH 2IAND 1X5HA 2ZTBA 5G4OA 1MAMH 2NY1B 1YEGH 3MNZB 5CZVL 4FZ8L 5D1QB 2QHRH 2VDNB 5KJ7E 1FVEB 1DQJA 4MAYA 5T3ZH 3GPSA 1GL4B 2H6UA 1OAQL 2DBLL 4HIJB 4KTDH 4XPHL 2OCFD 4FADA 3S6CA 4HGWA 1ND0B 4IK6A 4YSDA 1U8LA 2ZCHH 3NCMA 5BPPA 4LNVA 2BX5A 4ABWA 1NMCC 4DQOH 4CUCA 1X9QA 3WUZA 3LRGA 1QEWA 2OPCA 2GT9B 3T6VA 2NY7H 3VH8B 4Q6YA 1T80A 4PMFA 3V0VA 4JQVA 1IGCL 3DX8B 4TNWF 2HJKB 4N4YB 4N1CA 4J3VA 1XFPA 1QQDA 1AO7E 2KL6A 1DBKH 1NPJA 2R2BA 3MLTB 4LU5L 5EBLB 4NSKB 5I9QB 4HJTA 2EDQA 2FWLB 2H2SD 3D85D 4HZLA 3KLSA 1K2DB 1XGUA 4NWUL 1N0XL 4N8VB 4MA1B 1GRWA 1NGXB 2RCSL 3TT1H 3QO1B 1JK9B 3EDFA 4MCNA 1KB5H 5AWNL 3QSKB 4BSJA 2ZE0A 5AW8B 4C83A 3JYCA 3F12B 4JCLA 4KRMB 1DQKA 1P69B 4DGIH 1ZY9A 5F7EL 3TLRA 4EQ3A 2A3TA 2DBJA 3VRJB 3ABKB 1D5IL 3LPGA 1ZLWH 2KZBA 2G3MA 1Z9LA 1JGUL 3MTXA 2FBOJ 4FKHA 2E5EA 2DWEB 5DI8B 3S2AA 3M8OL 2I5YH 1M3JA 3C6LB 1JXFA 1OD9A 4KX9A 3UGXA 1F4YL 2VJ8A 4NJ9L 4O9HH 3CDGB 4Y9CA 3AS0A 3IDNB 3QB7C 5D70L 5J13C 2Z91A 4D9LH 2H2SC 1T0PB 1BOGB 3FSOA 3LPWA 2NY2D 2F53E 2MH4A 4LSRH 1ASOA 3E1F1 4KKQA 3D07A 5E2VH 2Y5EA 3LZFL 4JFHD 5MENA 4L8DB 2AQNA 4IHOB 4PRID 3W5MA 4AQ1A 3MRBA 3QAZB 5C0CD 1OGAA 4I1PA 3OJVC 3WLBA 4TXVB 4QHLB 3B6SB 3TBYB 2V2WA 1CBVH 5EOTB 3TWYA 3P4NA 5TQ0L 3BGFB 4AK2A 2J5WA 5LJYH 1S9YB 1TCMA 3I6GA 4ZMNA 2A83A 1PZ3A 3L5HA 5I1AB 2UUDH 1M9WA 3R06A 4FTDA 4NQCE 5D6CB 4ELKA 2A9ML 2V9UA 4WI7A 2C5DC 3A22A 2O30A 3W56A 1HSBA 2ATPB 1O6VA 2VN4A 3KXFD 4HP5A 2B9BA 4G1MA 3KPQB 4M3KB 4H0HB 3ULUL 1R3LA 1U8PA 1L0YA 4Y0GA 2NY2C 1LDSA 4PTTB 4CMMA 4OLZL 4HFWA 1YNTB 4U2ZA 4WTZA 3TASA 1RK0A 1L6XA 4KAQH 2ITCA 4RMSA 5IQOA 3CLFL 5GJTH 1MI5D 4JO4H 1NKRA 2CLRB 2XWXA 2K8MA 5DJDB 1OP5K 5IESL 2DQFA 3FU9A 4G8FB 4HOWA 3QXDA 1DDHB 1MVUA 3IGLA 4LHQB 2FHFA 3OSVA 4OZHE 3U46B 3IU4L 1W15A 3EJUA 4JRYA 2AJ3B 4I77L 3PNWA 5I6MA 1XCQB 1TTAA 2WXHA 1L9RA 4OAWB 1E6OL 5E03A 4MNQD 4AYDC 2F7QA 2J71A 5JW4N 4XP6H 1T5KA 1QZ1A 2VR8A 1F4WL 4GB9A 4UTBL 5F7NC 2F68X 3K71A 2JNZA 5AOIA 1NCOA 2NDGA 3P0VL 5D96C 3B7RL 4JFSA 2XC8A 3RIFF 3FU5A 1EH9A 2NCMA 4I2XA 2VL5A 4LVOB 5HHNB 2Z92A 4UOW1 1RH8A 3DK0A 4NZFA 4K5OA 2W9DH 4M8RA 2WWKO 3I74A 4CGUB 2WXLA 1TEFA 3WJLA 5JQIB 3V6FA 3C60C 3S8FB 1J05B 2H0FA 3MACL 5LGJA 3B37A 2BIMA 3KM1A 4WWPA 1S9WB 1UOWA 5IHHA 5FLUA 2BLFA 3BPLC 4M7ZB 1BD2E 4XVTH 2ADJA 4OFIA 5KOVC 1ZMYA 2BP8B 4OGQC 3ORJA 4ATWA 4PJXA 4AEEA 3BVTA 4LCCB 4UV4H 4HVBA 1OAUL 2WVSA 4U1GB 5LCVL 1AGDB 4AGOA 5CHNA 4M02A 1U8JA 1VIWA 3U25A 2VR5A 5IK3B 2WB7A 4OCRH 3V79C 1NGWA 2A74C 4LVHB 2WBKA 3JTTA 4RNRB 1N5YH 1S7XA 4UB0H 4MJ2A 5KVDL 1P9MC 1NAMH 1OAXH 2A6KB 3W39A 1MW3A 3O9WA 5HHVL 4EE2A 3L4TA 5AVTB 3FJTA 3HNVL 1XT5A 3NFSH 4K3EH 3MV7D 3BWUF 3L3DA 2FBJL 3UOAB 1TTUA 5B39G 5KYWB 2PO6B 4JQXA 3QUXD 3QI9C 5C0DA 4ODSL 1HILB 1I3VA 1WIPA 3KYOA 3T4YB 1AP2B 4J27A 1JUFA 2QADB 1QR1A 3CHSA 3ECUA 5JHMA 2J8UA 4G6ML 5JHLA 1RERA 2BNUB 3FT0A 1DQML 3ZTDC 3WKNA 4RGOH 3CFCL 2EKSA 4PJ8B 5GGQH 3BMWA 2VDKH 1YA5A 1E3FA 5GRUL 6PAZA 4GOSA 4EUPG 3CPLB 4ZFGH 4QKTA 4GAJL 2E9JA 3FQUA 3GTNA 2JQMA 3E8UL 4A7UA 1WZ1L 5FA3B 4GSXA 5TE4L 3AM8A 4GRMA 1T22A 5FO9B 4FYRA 4HU8A 3H7BA 4UU9B 3DX6A 2BVTA 2QT6A 4IBLT 1KXQA 4I88A 2UYLB 4NNYA 2NX5E 1MHCB 3AW5A 3OLDA 3KPPB 3QUXC 2BIHA 5AVQB 3WOVA 3DX4A 1NC4B 1PVHA 3UYOD 1MLBB 4AENB 2QGEA 4IKNA 3FYEB 4NZRL 2P5WB 3VXRA 2YSSB 1XO8A 5DD6A 4X4XA 5DEFA 4E41E 2AJYL 4A2HA 3QDGB 3BUYA 1KB9K 4RISL 2Q8AH 2AEOA 1AQKL 3BEWA 4KNSA 4DVRH 4JFXA 2CO7A 1YNKL 3O6LL 4QXGL 1VPOL 2Q6WA 2FX7H 4NRXB 1F13A 5IM7A 3PAVA 3PDDA 1FHNA 3QARA 3DETD 4KVNL 3L4UA 1JZEA 4JPSA 4RSYA 4JAMA 3MOBH 1EZLA 1WAEA 2R0ZL 3EXLA 3T6WA 1RULL 3N1PC 3NYKA 1CYGA 4K5PA 1R3IH 2UV3A 5B3SB 1JZFA 3RWIA 1X5LA 5B1KA 1BVLB 2XY1A 3UPCA 1UWEH 2BC4A 5F2FA 3DDFA 1AO7A 1A6PA 1U3JA 3TS8A 3WJJC 4ZNCD 2CH8A 1IGYA 1LK2B 1WWBX 1NEZB 3VFUB 1EK3A 1MG3C 3EO9L 5C0AE 5B8CA 4WUKL 4OLYL 2YARA 3VFMB 1F3JA 3RWJB 1X5KA 2H6PB 4JDZB 3BYTA 5JO5B 2BXZA 2J6EA 2WWMD 2B77A 5E51A 1KTBA 1QNZL 1HH6B 3MZTA 5I30L 2C4XA 1WD8A 2NRDA 3FW6A 5CBEA 5JMOC 5EO9B 1DE4A 5HVWA 1JPSL 4GT0A 4PCSA 4MJID 5I0VA 4XN1A 3SKNA 5J06A 2XZQL 4LSQH 2XVGA 3QEGL 5HHXL 3RZCB 4OJCA 1LEKA 3O2DL 1N64H 1HYSD 1EHNA 1HINH 2PW1B 4U6TA 3VWKD 1H9VA 4OBRA 5HDRA 1YJDC 2F53A 3IFNH 4YDJA 5HI3D 4A6YL 2C9UA 4WHYG 2IOIA 3CSTA 1H19A 3JXAA 3KGSA 3TL5A 4PD4K 4H4NA 4NN7C 3ZDYB 1MJ7L 3INUL 4OVVA 1EXUB 2IAMB 4XVUD 5D5ME 1CB4A 2WWMC 4JFWA 4PRPD 2NZ9C 3N44B 5ITFA 2AKRB 1W0VA 3TBTA 5FYJD 3KZ8A 4YXKL 3ARVA 4FXLA 3VACA 2YLKA 3NZUA 3HMXA 3KLHD 2YKLH 4HETA 2VZOA 2IPUK 4HQQH 4NQCA 3UO1L 2AJZB 4G1EA 3FUIA 5IQ7L 1N0LA 5A2KH 2DWXA 4ELME 1TIUA 1OSZA 5JUEH 5KOMC 2FLBT 2ICWJ 1HYSC 3K6SB 3VWKC 2NY4D 2G5BA 1KMGA 2OS7A 1GHFL 5F97E 3BXNB 5HI3C 3US0A 1SY6H 4HX1A 4Y1AB 4O02L 5EOQH 3HZKA 3QG6B 3FCSA 4JKLA 4XVUC 1MH5B 3ARSA 2X4QB 3S96B 2BCKB 4Y5VC 1U36A 4WGWB 4OZHA 4AGMA 3SKOB 3AG3B 4GRWF 3COOA 3KLHC 2EDDA 4R5TA 2JTYA 5A2LH 1E27A 1IGIL 1KTLB 4PRHD 4F80A 4ZQKB 1G7MA 1G84A 3IS1X 4K3DL 2W1NA 5SWSD 1MCWM 2DLIA 4XC1H 1EMTH 2OMYB 4WW2B 2CLZB 2C1PB 2NY4C 4G8AC 4YHIB 1VCAA 1UZGA 3CSYB 2QZQA 1LWJA 1A3QA 2GSMB 1MZZA 5IB4A 3QNYA 3VDCA 5CFAA 4NPKA 3D4YA 4MHHI 3QQ4B 3I50L 2FK9A 2IIJA 4GP5B 1S5HB 3ZXAC 1P2CA 2DQEL 3MRRB 1G9MC 1ZVSB 3CLEL 1ZT7B 1R9FA 4YGVB 4XPFH 1GS8A 2HXAA 5CEZL 4Z9KB 5CEXB 2V17L 4PB0L 4HCRH 3V0HA 3ZO0A 4K9EH 3S36H 2VNCA 3HRZB 1BD2A 5F7UA 5AOZA 4QXUH 4G9FB 3C87A 3HBGA 4YSPA 3OBAA 5HPOA 2IPKA 4OZFH 4EN3B 2OTWA 1TJGL 4HAKA 2YA2A 1G7JA 5TDOA 4XX1E 4AEIL 4UYPA 1SBSL 3V5HB 1GGUA 3SGEH 1XMWA 1JDAA 1ORQA 3X17A 4AVHA 3KBHE 3JWNC 3PAZA 1THCA 1MQKL 2RQ8A 4B9GA 4EI5A 5IB2B 1JV5B 3QDJB 4TQEL 2KBGA 3ZE2E 5DQ9B 1A6TA 1G87A 3JTBA 4XBMA 3VFPA 4ODWA 3L3KA 4Q4IA 4YSUA 3ARED 5FWRA 1DBJL 1KDIA 4AXWA 5F7DB 2PP9A 1PD6A 1R34A 1VFBB 1UWGL 2A99A 4RQQB 3S5YA 3N42F 5CSBA 5IVXF 3WS6C 4EKXA 1ZSDB 3QEQE 4HWZB 1AR1B 5FKPB 4HWNA 2QGDA 3CK0H 3G6DH 4IK7A 4MA7L 4U7SA 3RIAF 4UT6A 3EBIA 4JM4L 1DVQA 2VQUA 2D7NA 3SSGA 2LTQB 1BXAA 4N0FA 3NJFA 3V6ZA 4TSAH 2HFFB 1TUPA 2O1AA 3L81A 2YZ1A 4JRXE 5DVOA 5C6TH 2C4FU 5HY9A 1INDL 1MFAL 2Y2WA 4O00A 5C09E 2JKRM 3LEVH 4FQXB 3WO4B 1A7OH 2Z64C 2Y72A 4MASA 2YAQA 2OMZA 2OK0L 5KBNC 5EZJB 5I1IL 1W72A 1DQLH 3AREC 3AY2A 2FL5A 4M6NH 3UFIA 4D0DA 2IXQB 1QA9A 2R2EB 4JQIA 3NIFE 1WH0A 2XRAH 4X98B 5EUKB 2XI9A 1M42A 1ZLVK 5KEZA 4NO2A 4P5TD 2J6WA 1XCTB 3PFQA 2NX5A 3VXPA 4MGXA 2R69A 1BA9A 1VEPA 1MY7A 3RL1B 3C2SA 1ETA1 2DH3A 3DXAE 1Q1JL 2J88L 4TNVK 1EGJA 1OF2B 2CWRA 4E41A 4YQXL 4AE0A 3ZE1B 2NT0A 1KJMB 5B1CA 4ERSL 4NZ8A 3VRLF 2GBUA 3BW9A 1R0AL 4NUJA 2FYYB 5GGSB 3SBWC 4GW1B 3OJDB 4M62H 4XBEL 4B9PA 3ARXA 3S8WA 4AH2B 3S37X 4HSQA 4RWYL 2OJ1A 2ZX6A 5AW0B 1JHTB 2HKFL 3ARGD 5I1GL 1MFUA 4XB3A 4Z7WE 2AEPL 3O3UN 4JG0L 1F4XL 4PJGF 5I1JL 1THAA 1FNSL 5CWSB 1NOFA 12E8H 1QLRA 4P5TC 3N44F 3IJHA 3MLUH 1OANA 4GSDL 5D7JA 3WL9A 5E00A 4BWWA 2X70A 4TUUA 2HFGH 2E4TA 2UWEF 3N5AA 4A7VA 1IGFL 1AY1L 1CGWA 4HKBA 5SWZD 3VA6A 3WG7B 1YN7B 3TYGH 1SJEB 5C0AA 1WO2A 1HIMH 1YEFH 3FF8A 1DCLA 3WEMA 2WQRA 5ELIA 3U4EB 4IIQC 4AQ8A 3BVNB 4WW1A 1TETL 4L1TA 3L95B 1SN5A 1ILSA 3FHAA 2X4NA 2AV1B 3CFJB 1NBYB 3F00A 2AHIA 1QWNA 2EC9U 1SXSA 3U9PH 4GPVA 1KTCA 5I26A 4BZ2H 4POZD 5FYKD 5FA4A 4XRCA 3OAYH 3CBKB 4ADGA 3VI4F 1NFDF 4TKWA 3WIIL 4F7MA 2P43B 1V54B 3BWAB 4DKFL 1RZIA 2WXFA 3RWDA 2WWOA 3T4AB 5DD0L 3RY5A 4MQXD 4KTEL 1A1MB 3FU3A 1JTOA 3BCDA 4NX0A 1QKZH 3SE3A 1FPTH 1A4JA 1K8IA 2AK4E 3KLLA 4WFEE 2W80C 1LO0H 1AS8A 3PFUA 4XTRD 4PVBA 3S5LB 2W0FB 4WHTA 1EBAA 5IBTL 2Y4SA 2WC7A 2X2UA 2OJZL 3CCHA 3FN9A 4GNKB 4L18A 4TSCH 3FRPB 1E6JL 2JKTM 4V1DE 1S8DB 3U0TB 4MJ5B 5D5MA 4X6FA 1CXIA 3D33A 4POZC 1EIBA 1BFOA 1CFVH 2XQBL 1J9TA 1HK6A 4NM8H 5J8OA 1I85C 5J12C 4HW6A 2IANE 4NXSA 2E27H 2FZ3B 4WWID 4MQXC 3HG3A 1QR4A 3SQBA 4FG6C 1DVUA 2CR3A 1SUJA 3IDIB 5T3XD 4ELMA 2MTAA 4U1SB 1NCJA 5CILL 2X6BA 4XTRC 4AV5A 1YVLA 1CDIA 5AZ2H 5HD8D 4HGWB 5T1JA 4BSWA 5CXPA 2HFEB 2CUHA 2CCVA 2VM9A 5EWIH 1SFDA 4MA3B 3GSNH 4NO0A 3ALXA 2I60H 4K71B 5JDSA 1UUNA 4KJWC 4LLQA 3VSQA 4NN5B 1LO3H 1IE4A 1HHJB 5I8EA 1JPST 2MRYA 1G0XA 1ODAA 3CUPB 3VQ1C 2K8QA 5LBSH 3TBSA 3IDXH 3ES6A 3GUTB 3EFFA 2GJZA 2EC8A 4H8WH 2PKDA 1N12A 3DBSA 2JCCE 4OSUH 5IIEA 1E8YA 3EW3B 3P0YL 4UF7C 1WCBB 4LVEA 5HD8C 4IRZL 3IDMA 4ODXA 5C9KA 3D48R 2OTUA 4JDTH 5BO1L 3UL4A 4FG0A 4W9CC 4Y5YB 2EDMA 4BH8A 2UXFA 1TJIL 3VGAC 4JFUA 1OAYL 3AQYA 4GSQA 4HWBL 3D2UA 3ZL2A 4QRSB 1V8HA 5CP7A 4TVPD 2GC4C 4NUGH 4RIRB 5CJOL 4AY0A 2KMWA 4FYSA 2A73A 1OVZA 3VVVA 1OCWL 4F33A 5EC1A 4PJ5D 1G7IA 4I87A 4UM8A 1HS6A 2J8HA 2YO3A 3F5WA 3FTGA 5D1ZD 3V2AR 5A7EA 2DM3A 3KYKH 3US9A 4YAQB 4LRNH 4NN6C 4U6HA 4PRIE 3QULA 4IDJH 3V5KA 4KZ0A 4G8EA 4F58H 3JT0A 1NOAA 4WO4A 3DJRA 1E4WL 3EAKA 4P04A 5DZJA 3BWZA 4N3TA 3KWWA 4G5AA 3X1NA 3UG3A 2H9GA 3ZE1F 4GG6E 4HIXH 4LKCB 1YECL 5JR1H 2XTJE 3NK3A 4EO5A 3VD1A 3W11D 1ET7A 3M1CA 3SYOA 1M6OA 1FORH 4JB9L 5GRZA 5AD0A 4W4OC 3TCLA 4G1MB 4PBXA 1Z9SA 3QEQA 4JM2B 1R3LB 4V2CB 5J3HD 3GXFA 4K5MA 5KW9H 1QSEE 5D1ZC 3RGVC 2DLEA 4ZW6A 4XBPA 5AENA 2CRZA 3U4BL 3IVKA 2AJSL 3R4DA 5FXCH 5C0RH 4E0RA 4YXHL 1MI5E 3EYFB 3F83A 3VTAA 1Q9WA 3MGOB 3GLEA 3L5WB 2DD8H 2QKSA 3NDZE 4P57B 4YWGH 5T1LD 4AYID 4QF1B 1NJ9A 3S8GB 4TLSA 3UACA 2W0PA 1T4KA 2F8IA 4JRXA 2EIJB 2HUEA 8FABB 1FNGB 5C09A 3ZTNH 4U3XA 4FQ1L 2JJVA 3S48A 5IVZA 4NRZA 4H0IA 1NGQH 1WFOA 2ZSWA 2X89A 3W11C 3H3KA 3U9UA 5L2KD 3V4VH 2EVGA 2BNQB 2Z4QB 1WC7A 3OF6A 2VDLB 2XZAL 5J3HC 3D9AL 4F2FA 4UT9L 3UC0H 1JRHI 1AC6A 3GKZA 4FA7B 2BDNL 3E9UA 1KT2B 1G7HA 1PGRB 1E3ZA 1PSKH 2XCMC 2YEZB 2Z92B 3DXAA 4MMZA 3SJVB 4L9LC 3V4PH 4J28A 4FD0A 2Q7AA 2ICEB 3CE1A 4NIYE 2QSCH 5AUMB 3PWUA 2B1AH 3UGEA 3RPIB 3V6FB 1GKOA 4OJYA 5HYSG 2CIKA 1ACYH 1E67A 3GMQA 5CIPH 4NGHL 2XA3A 2BMKB 3MMEB 3NSYA 2P24B 1DJZA 1ONQB 1E4XI 4RMUA 1XF3A 5LGHL 4MZ2A 2ADJB 4MRBA 2P28B 1MFBL 3O8XD 5BRZE 2BY0A 4ODTL 4Z7WA 4XWGH 3LNDA 3HOGA 4HMDA 4NYLB 2DH2A 3ALWA 1IFHH 2P5PA 3EJTA 2C3WA 2AQSA 5EIIG 1QPXA 2HLAB 1E43A 5IHUH 3FTWA 4KUZL 4MJ4A 3VMNA 2E74C 2YBGA 4HKJA 3S34H 3DVGB 1PF3A 4QXTB 3MCLL 3U6XA 5B3JF 1XTMA 3NZ8A 1EPFA 1H5BB 4RCAA 3U7YH 3TU6A 5F6IC 3MOQA 4DKAA 2Z31B 1XGRB 5JOPD 3SDYL 3SGJC 1U95A 1XH1A 2VDPH 2WTRA 3UJJH 4G70B 4B0MM 5JPMB 3KPSD 1QTYT 2MSPA 1JZGA 3LPFA 4LP8A 5AVVB 3O9WB 5JXEA 3SY0A 3VXSB 3RFZA 3QDMB 3AC0A 1JJUA 2Q76B 1SN2A 2IWFA 5FYLH 2R7EA 2OR7A 3FXIC 5TDPB 3O8XC 5JLZB 1E8XA 3OX8A 1YUKB 1VAHA 1JUFB 1ZWIA 2XWRA 4MDRA 5L7XL 4AM0Q 1DZBA 4L8SC 4X6CB 4OD3H 1A8JH 1TYRA 1ZANH 1BEYL 3KPNA 2D7TH 3UMTA 4QAMB 4C4KT 2AVFA 1DBBL 2GCYA 2AK4A 4BFEA 4S1QL 5AAWA 4GI8A 3JV5A 2BFVL 2ZG3A 1J18A 2VXVL 3PYCA 4WEUD 4PS3A 2GK0A 3VFSA 4N22A 2VW4A 3QWOA 5EZIH 3SDCB 4CAGA 1BM3H 1DUZA 4JN2A 4GXUM 1CFTA 2BCMA 2IDCA 2ZUSA 3B2MA 4V1DA 3RUGE 3S35X 4CBZA 3CVHL 4ZMXA 2WTPA 1CXFA 3BIKB 1FZMA 3MUUA 4JKKA 2BRQA 3FT1A 3CZKA 4U6XA 4Z18A 3VG0L 2CSPA 1D6EB 2EDRA 3CDZB 2JK5B 3PDGA 2OYPA 3B8SA 5IV2A 3CSPA 5INDB 1NUDA 2IANA 2YXVA 4HUXA 4XBGA 5AVUB 2YK1H 5EZLB 3MYJA 2WXIA 4HC1L 3CPUA 4ORZC 3SDXE 4WQOA 3INOA 5GGTL 1BG1A 1TZIA 4GXVH 1A0QH 3DVNA 3FSZA 1BAFL 2Z93B 1OE1A 3DI2B 2Q6WB 1NCCL 2W5PA 1FO0H 2O4EA 1UACH 3OWRA 3EJPA 2HJFA 5BZDA 1IC4L 4S1DD 3O0RH 4ZYKA 4N0UE 1J88A 3DVIA 4Y4FA 5JOFA 2Y1YA 4KDTC 1K9TA 5I23A 4WGVB 5GJSL 1HZHL 1FFQA 4G43B 2DS4A 2EE9A 2HH0H 2HP4A 5EEYA 1E65A 2YJLA 2BC4B 4ZMZA 4CN6A 4K94H 4WU5B 3O6ML 2KH2B 4Y88A 4G8GB 5IEKB 4TUJA 1IGYB 1I3RB 2BP0B 4OM1L 1RVFH 3RKDD 3RY6C 5FF6A 5D7KE 2BWIA 2EACA 2QHLA 3BISA 5ABAA 4DF9A 1SZNA 3AAZA 1PPIA 3REVA 3B5TA 4AWJC 1A5FL 2JCCA 3AUWB 1TQCB 2DL2A 1H8SA 3X1EA 1HYRC 3L3JB 2OX5B 2APBA 3OJ2C 4PV8A 3GMRB 5T5NF 1R1CA 2WOYA 3S37L 4P46B 4PRDA 2VAAA 1XGZA 4XAWL 3UDWC 4S1DC 1XHHA 4ONGH 1LMIA 3U82B 2VW6A 3DUSB 3T9WA 1BQHB 5CBEB 2DIAA 2YQ2A 4YDZA 1JPGB 1BP3B 1XGTB 3D0LA 4WK0B 3SKNB 3CGTA 4NWTL 3NPSB 5EG6C 1F90H 1ZTMA 2OULB 1L0QA 2VMJA 1UFUA 4CSPA 3RKDC 1GJUA 4PRBB 1MPAL 2XNAB 4YSRA 1BCIA 4RSVA 1CTNA 4Z77B 5D93C 1P5UB 1U2YA 1UFGA 2X6UA 1PYWB 3HW7A 3K72A 4PRIA 5FW8A 3J2PA 4OD1L 4HKXA 4OZ4A 4W93A 1CLYH 1NANI 5DD1L 2VXUH 4GW4A 4AGNA 4PRPE 4Y4HA 3N9GH 5C9JA 1W0VB 2NXZC 4A2LA 5FYJE 4BFOA 3RNQB 2BJMH 4GG6A 1X5JA 4ZTPH 2WZ0A 1RZJH 3KWUA 1VKXB 1QLEL 5EU7C 2AXFA 3K6FA 1SLUA 3C5ZD 4G1EB 4JFDB 1GMIA 1OW0A 5DEGB 1L9MA 2BFGA 2K3HA 1FVDA 1YYLL 4ZNEE 4PJXF 5E99L 3IRPX 1WA2X 4NT6B 1R3KB 3PQYD 1QSEA 2XV6B 1DJWA 1MUJA 4YHPB 4ANKA 1IILE 1T20A 1JV2A 2B3RA 4WI5A 5E6ID 1MI5A 3NA9L 3PWPE 5IEHB 4PQXA 1D7FA 4X5WA 1UT9A 2VL4A 4OZHB 5JNYB 2B16A 4DZBA 5KSVA 1KNOB 3MV9E 3I02B 2FJFB 4L37B 3C60A 5GSRA 4AMKH 5KYUB 1R5VA 1SXCA 1E27B 1NCBL 4LLUB 3KR3H 1G7MB 1Y0LB 4AKOA 1G6RH 3C5ZC 2F0CA 1KLUB 7PCYA 1SEQL 2D2CC 4NS0A 5E94B 4NO5B 2OL3B 4PS8A 4LSDA 4GI6A 1FL5B 4Q7DA 4N2NA 5KYNA 1TVHA 2IQ9H 2J8UF 2OZNA 3JWNE 1ULVA 5E6IC 2A74A 5AW5B 4HIHB 4K9JA 5F6HJ 5L4IA 4XP5H 1HE8A 2F19H 3MA9L 4JZNA 5FYKL 4OFPA 3SOBL 4R96A 3I6KA 2LU4A 2D73A 3TBWB 3SZKC 4XXWC 5ECJE 4ZUSA 1INQA 1L9OA 3MUZ1 4I13B 1UHVA 3FSVA 1UWYA 3P02A 2X6VA 1CGSL 2VR3A 3HAEH 5T5FA 3GZKA 2X2JA 1P1ZA 1BD2B 5BRZA 4DO6A 1HQRB 5BS0E 1TJHL 2EYSA 2ZUVA 3QI9A 4K5LA 5HJ3A 4I1RA 2DI7A 2EAEA 3PWNA 4X6EA 4F3FB 4Y1SA 1LEIA 1G7JB 2A6JA 2BIPA 3H6JA 1QYGH 2MQGA 3K4DA 3SDDB 3STLA 3UERA 4LEXH 1IAKA 3VYOA 4B50A 4WWKD 4XNDA 1WTGT 3BESR 4J3BA 3IYLW 3BQUD 5EUOE 1NOLA 3WS3A 3OZLA 4CU6A 3NEXA 4OGYL 2IDUA 3VFPB 5GHWH 4GLRI 1FDLH 1MJ8H 2ADFL 1VGEL 2BHFA 2AI0H 2K9UA 1FH2A 3GBML 3I85A 4NAMA 1V27A 4NZTL 1GSMA 5F7LB 5IMKA 3WEXA 5DHVB 4U1LB 1B88A 2XFXA 3OL2A 4URTB 2WOBA 3ABZA 5T3XL 1BOYA 3CC5B 2WLHA 3BKJL 2FRGP 3F2LA 1YUHA 2G4GA 4UCFA 5C0ND 1QSZA 3CZJA 3X12B 1YEKH 4HYTB 4OD2B 3CD4A 3OXSA 5IKCA 4J6RL 2C9VA 3VD9A 5E6ZA 4KXZI 3Q7JA 1R33A 3HG0A 2APVA 4MJ6B 4WWKC 2D7QA 1R19A 4HJGB 3GKWL 3AMLA 2EYRA 1DBAH 3BQUC 4DPAX 5IB3B 4U6YA 1EBPA 1W6LA 2DY2A 2Z3FA 3OKDA 2YJQA 2QDWA 1JXDA 2O5XL 2NXYD 1T21A 4I4WB 4BV1A 1FHGA 3GLAA 4D0DB 4AEHH 1TENA 4ZMOA 4GRLA 4JDEA 3CQFA 1EZUA 1G0DA 3FQNB 2VJ0A 1J12A 2C3GA 3BN3B 3G5VA 4QGYA 4PGCA 3RUGA 2BVPB 5KN5A 2VISB 1JN6B 2VLJE 4HK3N 1CD1A 2ERJC 1WA1X 5C0NC 2OP4H 4PEEA 2ICCA 1MIMH 2LU3A 3R1GH 4FMVA 4AGQA 2CD0A 3BX7C 5JW4R 4NAJA 1ZK9A 1XSKA 4LVNB 1T7YA 4LPUA 4GIPD 1YY8A 1CWVA 5CCGE 3AQZA 1ZGLB 3G08B 1Q9KB 3HKFA 5GZOA 2JELH 4FYQA 1ZK5A 1P53A 1UG9A 3SDXA 4BXSV 2EUXA 3ZKXC 1HH9A 3U4KA 3VWJC 3F84A 2NXYC 2D0FA 2YMTA 4PY8I 3WFBH 1A4BA 3QUGA 4TVPL 5HYIA 2XV3A 3N1GC 2AERT 3ISWA 3PJSB 3SEPA 1ZHLA 2X10A 1UB6A 5I16A 4N0UA 3T09A 4TPRH 2FD6L 4LCWB 4PS7A 1MAML 3BRDA 5D7JB 3WL9B 4PUBL 1GY1A 2X70B 1AIFA 4NZUL 2XY2A 3P9WB 5JPNB 1KBVA 1QSVA 3ASOB 4WI0A 2JIXD 3T77B 3UMNA 3FBQA 2WMPB 4FQHB 4AV4A 2QR0A 5TFSH 5J4MA 4HKBB 5D1XD 4HUUA 1QTPA 4DUWA 5MP6L 5C0AB 3HZVB 5T1KD 1E9PB 2WYTA 2HWZL 3E3QC 1E2ZA 2JI1A 1OLZA 4RBPH 2F54B 1Z9MA 5DK2B 3VYPA 2XACC 3PHQB 3GHBH 4R90L 5EU6B 2B20A 3BH8A 1MEXH 3FOLB 2DTML 5A2JH 5GS3A 4Z6AT 2DMKA 4S1SL 5ISZD 3M7FB 5FA4B 3HG5A 3DI3B 3UBGA 4NFDA 4UAOB 4IRSA 2VQ4A 2OBGA 1WTLA 1KB9J 5LG1A 1RZIB 3RWDB 3UG5A 3U2SA 1JGIA 2EXTA 4KNTA 2Y6TE 3QJVB 1CFBA 4ZS7H 5HGBA 4DUXA 5KVEL 2XHNA 3QIBD 2VLLA 4XC3L 1J1OL 2IOOA 1CF1A 1K8IB 1DANU 2NNFA 2Z7WA 3HRPA 4KZEL 3TPKA 5D1XC 3ZQXA 1F1DA 2P47B 2XFGB 4DT2A 4EDWH 2IGTA 2Q7YA 4FF9A 3X13A 4XP9H 3G6JB 4JFPB 1OV8A 1B0GB 4Y89A 2YAFA 5I8KL 4EEEA 3BVXA 4HJUA 2DYPA 5ESQB 4PMEA 3GHPA 1FGNH 5L2JA 1KGYE 4AMWA 1KJ2H 4DAGL 4X6FB 5T1DH 3VRIB 4DFIA 1GZPB 4PRPA 4IS6A 4QOKE 3UZVB 4N1EA 3VFWA 4EDXA 4WI8A 3SKJL 1YEIL 4D9LL 3ARFA 3BAIA 4XNZB 3EH1A 4YFLF 1SF5A 4N20A 4U6VH 1FV1B 3QQ9D 4CC4A 1SPDA 5AVRB 5KVFL 4E9XA 5FGCB 1BJMA 2MHAB 4HGKC 2ZKMX 4TUKL 4ZD3L 2BSSA 3NCYS 3D69A 1J9CT 2GSIB 1U41A 4CNIA 4ZNEA 2ENYA 4ZT1A 4ACTA 1R46A 5E2JA 4X9FA 3GS4A 4EMZA 1QI5A 1IZKA 3KLAB 3GMOB 2EDLA 4GQZA 3V52H 2DWDB 3CZGA 3GSOB 1XGPB 3DA0A 1AI1L 1SRDA 3PWPA 5EHFA 3V7MA 4AW4A 4EIGB 1IIKA 3CU1A 1LEGA 3F58L 3F7VA 3VCLB 1WITA 2BIIA 4EI0A 4MTMA 1DFBH 1CFSA 3MV9A 3S35L 3NOIA 4XOAA 5I1KH 1W0WA 1IQDB 1DVFB 3HG4A 4OLXH 4POUB 2G5RA 2IC2A 1I9IL 4XVOA 4H88L 2P52A 4WSKA 4ZFFA 3QYNA 5EEVA 2R0LH 2WCPA 5F9AC 1YEEH 2FUTA 3IMWA 3QQ9C 4R3SB 3JQOB 1AHWB 1Z3GL 4YC2C 3PS6A 2GY5A 4OCMC 3RDTD 3SE4A 2ITEA 3CFBA 3ES6B 3GJFH 3EFFB 4IOIB 3NH7H 1UZ6E 3KH3A 3BSZH 3HB3B 2Y7MA 2VM3A 3F7RA 3KE0A 4LKXA 1JS4A 4L1HA 5ICYA 1I75A 1MCHA 5C3LD 2BHYA 3PHOB 1ZVHA 4DTGH 3RB5A 3P0GB 3OZ9H 3ZRCC 1B4RA 3LRMA 1EQWA 3FAXA 2WBJB 1RMFL 2WPGA 4L8CB 2D31A 2ED8A 1N10A 1JGDB 2FLMA 1U8MA 2NSXA 5CCKL 1WFIA 3CDFA 3ILEA 4HJIA 1ZHBB 5CP7B 4JPKH 1OL0A 1CU4L 3QZPA 3RX5A 1OHZA 2I27N 2DEWX 2LV4A 3PV6B 3APDA 1RPQA 1GH7A 2A6DA 3MLYL 4XP4H 1C12A 3WKMH 4PLKD 3RDTC 3MODL 2BIQA 4PJ9C 3EOTL 2ENSA 4QRPD 3L13A 4RGNB 5BS0A 4IBWA 4UNVA 3KW8A 5GRJH 2DQTL 3PIQA 1KIUA 1QVOB 3ARDA 4X0KB 4HPYH 5HDQL 4KXCA 2L7UA 4F7CA 3D3VD 4HKZA 5T3ZE 4EQ2A 4G8EB 3LH9A 5DURD 1A22B 2YD2A 3UZQB 1PG7X 2WLMA