1WHOA

Allergen phl p 2
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
94
structure length
94
Chain Sequence
VPKVTFTVEKGSNEKHLAVLVKYEGDTMAEVELREHGSDEWVAMTKGEGGVWTFDSEEPLQGPFNFRFLTEKGMKNVFDDVVPEKYTIGATYAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ALLERGEN PHL P 2
publication title Crystal Structure of Phl P 2, a Major Timothy Grass (Phleum Pratense) Pollen Allergen
rcsb
source organism Phleum pratense
molecule tags Allergen
total genus 18
structure length 94
sequence length 94
ec nomenclature
pdb deposition date 1997-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01357 Pollen_allerg_1 Pollen allergen
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.760 Mainly Beta Sandwich Immunoglobulin-like Expansin, cellulose-binding-like domain 1whoA00
4FG4A 2VXQA 1BMWA 3FT9A 4JCWA 3D30A 3FT1A 1WHPA 2JNZA 4JJOA 4FG2A 2BH0A 1WHOA 4L48A 1N10A 4JS7A 2HCZX 4FFTA 4FERA
chains in the Genus database with same CATH superfamily
1PJ9A 4HIIA 1G9ML 1E5BA 4KZ0A 2BOBA 5CINH 5AUMA 3MFFA 2AJXH 1AQ8A 2DLFH 2RHEA 5E08H 3QCUH 1J88A 2PWHA 3EYFA 2WZPD 4MBRA 3VXQA 4WW2F 1XCWA 4NPYA 1NCWL 5CJXC 1WZMA 2VDQL 2NW2B 3FCTB 2VW7A 1UM5L 3QUXD 4FFYH 5HP5A 4MJ6B 2OMNA 3ARUA 4F7EA 3QUML 1K4CA 1HHKA 5KOVC 1EPFA 5EZLA 1RUKH 1XBDA 4LVNB 3BP6B 3MROA 5C70A 4AMKL 4ZOAA 1B2YA 5C7XL 4Z7UA 2F0CA 1DN0A 3OMNB 1N5AB 1TF4A 4WHDA 4ZW3A 1L7IL 1TCMA 3ES6A 2IGFL 2P46B 4ODXB 5HD8C 2PPDA 1DTUA 4TXVB 2F8IA 1JPSH 1AGFA 4MJJA 4NO0A 2VDNB 4LOUC 2YC1A 2DWEA 4HHGA 4KO9A 4CJ1A 2QVIA 1PDKB 3NJVA 4LESA 1MCKA 3OC5A 4JQIH 4L5FH 4AH2B 5LBSA 4M43L 6PAZA 1ERNA 1W8EA 2X1OA 5A2IH 3B9KD 5DJ2A 2CXGA 3TGXA 1CI5A 5E4OA 3UBFA 4UINH 3TEUA 3ZE1E 5EN3A 4U1MA 4KC3B 2Y3NA 4GW5A 4KX8A 3KBHE 3HG1A 4JJ5B 3EJTA 1Z9OA 4Y5XB 1JF5A 3BX7C 3D39A 4XNBA 2EDDA 2F19H 1XGYL 2A0LC 5HYJB 3VI4B 4LKXA 1EDHA 3G5VB 1YEEL 1XF3B 2Z8RA 1F4HA 4P2QD 1TDQA 4S1RH 3F05A 5ANMA 4NRZB 3VA2C 1KFGA 3WLBB 4Y19A 4JREB 3MV7D 2K8QA 4ORGB 2Z6FA 4A6YL 5C0DB 1GMEA 2A3TA 4Y9CA 3HI5L 1ZE3C 4APQC 3HI6H 2BY1A 4FQ2H 1R0AL 3I6KB 1F97A 4I48B 1KCLA 4M3JA 5TQ2L 5LGHL 2VDQB 3UBXA 1ZVYA 3DWTA 1MZZA 4K94C 3GMLB 4OZGA 4N87A 4GSRA 5D72L 3UTSB 4AENA 4BYHA 3QA3B 4M7JH 5GGUB 2EDHA 2XCMC 1I85A 5KZCB 4P2RA 2VRAA 3REVB 5HI3D 4AYFA 3UGXA 3O0RL 4NZRL 5INDA 1NKRA 1E7UA 4OR1A 4XVTL 2MCAA 4TSBH 4WTQA 5JXEC 4PJDE 4AUYA 3BGFB 4NEHB 4XC3L 2YN3A 2OJZL 4M93B 2PW2A 3OKDB 2B4CL 5FW6A 3WFEL 1HVXA 3QUKB 4B41A 1O9VA 2KDGA 2R0WH 3UZVA 2YZ1A 3NZSA 5J1TC 1BGXL 5DD6A 1UWGL 4DOHE 4L4TA 2DQHL 2XN9A 4YSTA 3T77A 4LQFH 1YPZF 1RZKC 4EMZA 1KB5A 1PZ5B 5DJ8A 5IEKB 4CMHB 2FE0A 4YH6A 4Z7OF 4IBWA 1MOEA 4N0UA 4XX1E 4Q4EA 4XP5L 3EF7A 3RFZB 2V17L 4LVHC 2JJTC 4YLQT 1YN7A 3EXLA 2WSKA 4JFEA 2NXYC 2EO7A 2AEWA 1WTGT 5D2NA 3RZCB 4XX1G 5D55A 5MI0B 4JPVL 4X7TA 1OOAA 4LP5A 4KNQA 1IBBA 1KELH 2RB8A 3UMTA 5I5JA 3MNVB 5D7JB 1TZGH 2HP4A 3OR6A 2OR7A 1O6SA 3BGMB 4JFPB 4QRAA 3LZQA 3NJKA 3N44B 3UOAB 3KGUA 2D9QB 2WN2A 1YYMH 2YRLA 1JZGA 1A6WH 2I5YL 1WCBB 1SZNA 5ECGA 4A6YB 3B6SA 3MNZB 1F3DJ 3KD4A 2W9EL 3FO0H 1FJ1A 3K3QA 4R5XA 5DRWB 4H1LA 1JTTA 4L1HA 1M9SA 2APSA 4P2QE 1JXGA 4QO1A 1QYGL 1MF2H 2H7WA 3DIFB 3QUZC 3K74B 5J8OA 1AG6A 3HMXL 5LWYH 2WXRA 2VISB 3EOBB 3KPLB 2MKLC 5LHDA 1XFPA 3IMSA 1Q9KB 3DRQB 3WDHA 2YD2A 1OGAA 3A4AA 3S34L 1KACB 5FV1L 2YD5A 2DQIH 3IDMA 3OD3A 4PJGE 1OGTA 3WTWA 2VZTA 3BDYL 3MOAH 5HJBA 1D5XA 2VL4A 1EAQA 4QOKD 3P0YL 2F74B 2O5ZH 3FN9A 3H9SA 2ARJB 4YO0B 3OKLA 1CXHA 5BJTA 1Z5HA 1MAML 2F8VA 2WMPB 3OLIA 1M7UA 5B39A 1DVTA 2X4PA 3WENA 1MFDH 1QATA 2VDLH 1YG9A 2L0DA 2DM2A 3BIKA 3IS1X 1S9XA 2QL1A 3H55A 4FFZH 3WKYA 3LHPH 3NEOA 4JRXD 1LEGB 2X9XA 3D0LB 1U3HB 3ATDA 1X7QA 2P26A 5I1CH 4NZJA 3ZX1A 1WFMA 4UTCA 1ZGLA 3WEMA 1CT8B 5EUOF 1RURH 3EJQA 5E1HB 4TQEL 4HPHA 4JFZL 1Z1WA 4JPIA 1S9WB 4MXVF 4A63A 1I1AA 2R4SH 1DE4A 1F4WL 3SDAA 4CVXB 3OPUA 1HU8A 1WWCA 3BSZL 2D7QA 3L3KB 4O51B 4I3GA 1VFAB 4BQBA 3MUJA 4BHUA 5IFHH 2YD6A 3SPGA 3U0TB 3QYCA 2XWBA 1DLFL 2NSQA 1JK9A 5HHQB 1N6QH 1JZJA 1NBCA 2BIQA 3TU6A 4J3SA 3AADB 4KTEL 5C0EB 4MD5A 3JT0A 5AD0A 4L4JA 4LL1A 2BOLA 3MLZL 4AQAA 4YDMA 1TZHB 2ORBH 5I1HL 1BZ9A 3THMH 1I75A 3NA4A 3M6DA 3L3OB 5E2VH 2EIDA 2O6DA 2CHDA 3LNDA 5IHLB 3GHEL 4UZSA 3VI3B 4PUBL 2APBA 3C8HA 3EGSA 1BD2A 5EZOL 5KYWB 4NJAL 3ZHLA 2ZP8A 4RH4A 4PS8A 4Z7VB 3OKMA 4GXVL 4P2YA 3VRIA 5IGXL 2D03H 4NO2B 4JDVA 3O4LB 1IGYB 1XGPA 3EJUA 4FTVE 2VYRE 4NN7B 5CBAA 2WW8A 2BHUA 4JZOB 1NDGA 4OSUL 5F88B 1H15B 5I30H 1C1EH 3RDTB 1F90H 2WXOA 1CFVH 2V9RA 2VDKL 3B9DA 3V0VB 2Y7LA 4OGZA 4ZUWA 5DUBA 3TVMB 4HVBA 1FE8L 5AVVB 2GAZB 2W81C 4KH2A 3R06B 3CDGB 5ENWB 2Z8SA 2ID5A 3FDWA 1HFUA 4ZOEA 4OTXH 3ZVVA 2C26A 4W4OC 2J55A 4QOKE 4HIHB 1G1CA 5BVJB 4EKJA 4BFIB 3B5HA 3MRMA 3RRQA 1SJEB 1T1YB 4GRWH 1KNOA 5L9DL 2OTPA 1IAOA 4KAQH 5B1AB 1AY1H 3LNFA 4NGHH 2O5YL 2APXA 3WUWA 1KEMH 3GDCA 3NFNA 1CF1A 4JRXE 3KPTA 3L3IB 1CO1A 1WA2X 5HYJD 3PGFL 4RGMC 3VGAC 1BVZA 2E27L 4LO9A 2VM3A 1DVFA 3NK4A 4OLXH 5JA9A 1NFIA 1S5IL 3CN4A 4LSQH 3MBWB 1DQKA 4PBVC 3OKOA 4ES9A 2FUTA 5TTRA 3H53A 3WJLA 3GF8A 4FNPA 1LILA 1Q9LA 4E0RA 2EADA 5IFJB 3RBGA 1I1YB 1TQVA 5T5FH 5HDLA 4R7NB 2E9BA 4HWUA 4Y4KC 3BD3A 3BLKA 1I9IL 3GSNA 2HVBA 3KG5A 2YQGA 4H88H 4HAKA 2IV9A 4KJQD 3DX1A 1DQDH 4PP1D 3UTSD 4YQXL 4LBEA 4QF1B 5BRZB 4Y5VA 4JY6A 1VZHA 2NY4B 4IJ3C 1SMOA 4Z18A 3HC4L 2VCOA 5KZCD 3QQDA 5I28A 4ZMLA 4TUKL 1NWPA 3H3BC 2CDGA 3GZOA 5IB2A 4UQIM 4X5PA 4OI8A 1N26A 2HX9A 4TQPA 5IG7B 2AXGB 1GJIA 1VLXA 4XP4L 3SY0B 4L23A 3ZHDA 3U2SA 2R9HD 3GSRB 1KBPA 3L45A 4H2AA 2E7LC 2AHIA 2PYFA 5F96L 4DFHA 2GTWA 2VDKB 3BT2H 2P28B 4MXWL 3P9LA 2IOMA 3PHSA 1TFPA 2NZ9D 4IBZA 4M1GH 4CKQA 4MCMA 5EF0A 2I85A 3NIGF 1ONQB 1T04A 3EFOA 4O02L 5ERWA 3VE0B 3TS8A 2WXGA 5BZXA 4PJEB 3OHMB 3NCYP 4HUVB 3QI9C 5B1CA 1SFDA 5TE6H 3CHPA 4MQXD 8PAZA 3KWWA 3HPJB 3T65A 2AQ2A 4YLCA 2BRRH 4OQTH 1E5YA 1QUPA 3RZCD 1EHLH 3UTZA 4RISL 2WLMA 4FI8A 4KO7A 3S8WA 2IDCA 1EJOL 3P77A 2UZIH 4HUWB 3QXDA 4S0SD 5IY5B 4GQQA 1P4LB 5D7JD 1HIMH 2KUTA 1QFPA 3SDCC 5DD3L 3OXSA 5HDQL 1AIFB 1B4TA 2WLNA 3IRCA 1GGIH 3KWUA 1SHXA 1CE6B 4YDVB 1NGWA 1FFPA 2WQAA 4M02A 4G5ZL 5IROA 4CN1A 4XHJD 4I1RA 3VFMA 3JV0A 3JWNC 4S2SB 3IRPX 5FO7B 2IGTA 2FHFA 1NC2B 4RWYL 5I0VA 4LSRH 4X9GA 5HYJE 3VI4E 1PTZA 2FEDC 4OCMC 1KGJA 1RK1A 3NCMA 1CYXA 4QHNB 3UJTH 2ZXEB 4HIPA 4BDVA 1MIEH 4AM0Q 1YNLH 1I7TA 2Y1ZA 2VABA 1GZHC 1NIFA 4RMBA 1W72L 4TLKA 3GXDA 1F4XL 2LLNA 3VFPA 1O6TA 3X11B 2IADB 3MRLA 1DL7L 5KAQG 3X3GL 3X1EA 4N24A 4MX7A 2XTSA 1C5DA 3ATFA 3ABGA 1W0WA 5C09A 2QADC 1GZQA 1HNFA 3NPZB 2YD4A 5LLIC 1I9EA 2VQ1B 2BSDA 4YDZA 4FL4B 1RZQA 3AT0A 4JFQB 1X5YA 4DKDC 2HVKA 1MWAL 3RIFK 3UTSE 3X14A 4H0HB 4G7RB 4X4ME 3CFIC 2CGRH 3RWEB 2FWOA 4X5XA 5GGRA 3UTOA 1XGTA 3VSVA 5L7XH 3SGEI 4LKCB 2CO2A 1OVZA 3MODH 4N85A 4W81A 1AD9A 5AAWC 5EOCH 1MEXH 1JWSA 3ZIMA 4XNDA 4FYQA 1QG3A 2VR4A 2HTKD 4JFYA 4RMSA 2R2HA 4DGWC 4ZOCA 4GNKB 3KGSA 3CCHA 5KS9A 1T20B 4F7CB 1OO2A 1YEHL 5C2BL 5B1JC 5KEZA 1UACH 4TL5A 4MNQA 1U3HD 4Y2LA 4C58B 3L5XL 4U3XA 4Y8DC 4AEFA 1WT5A 1FL3B 4HEME 4PSPA 4BFNA 4TL4A 3F7QA 3HZVA 1EAPB 2WK2A 4JE4B 4X83A 3KW8A 1IU1A 1I8MB 3FH5A 1TQWA 2DQUL 2QKIB 4GAYA 4JFXB 3MYZA 4QHMA 1O5DT 4P2OB 3A4DA 4MZ2A 3G08A 4LEXH 1RZ8B 3S35X 2XPGA 1C8PA 1FZKB 3FQ1A 1B3IA 4LIQL 5J6HA 2NDFA 2VE6B 4IDLA 4OCRL 1K2DA 3JWDC 3W0WA 4LEBA 2R0ZH 4KXZH 1SMDA 5BZWA 3DTXB 3D4GA 5I6MA 4F1SA 2B59B 5EU6B 3JVFC 1AR1B 3AB0C 1TLKA 3PL6A 5IIEA 1LQBC 2DV6A 1R24B 1CE1H 3ME0B 5EULV 1EA9C 3WJJC 1PKQA 4QTHA 3WJMA 1NMBH 32C2B 4FXLA 5DA0B 5I6LA 5IMMB 1EXHA 1A21A 3HN8A 1IGTA 3MV8A 4OD3L 2FBRA 5H35B 1XX9C 3QAZC 4Z8FL 2N4IA 1NLBL 5CJ8A 3RWHA 2C7UA 4BKSC 4XPHH 3WL9B 2YKKA 1ODUA 1T0MA 3RUGB 3VM7A 1OAYH 1OLLA 3VGEA 3MA9H 4IOSA 2ATPB 1T2QL 3O4LD 3ESOA 2QDVA 2WQRA 1IM9A 1ITCA 1HHGB 1MWAB 3OMAB 1GAFL 3H4FA 5FUOL 1J10A 1GYAA 4X42A 5JA8B 1RIVH 3RDTD 1U33A 4D8PA 1IVTA 3ECQA 1QFWL 1EMTH 3TVMD 5IJKC 2D73A 1GCYA 1YO4A 2DQFB 5FOBA 1MCHA 4D0BA 4HMCA 3IFLH 2BNRB 5INCA 4EN3B 1I8KA 2I26N 4AKQA 3V0GA 3IEAA 3BXNB 1UB5A 1TQCC 3QDGB 1FNSL 1QNZH 4LHUB 3BKJL 4CBPA 5IWLC 1QSFB 3QZWB 2NY5L 3ULSA 4FGMA 3V52H 4JQXA 4G3YL 1WGOA 4PRHB 4QRPA 4UIMB 3K71A 3BAEH 1LK2B 4N8VA 4EZKA 3WIHH 4B27A 4GKSA 3I74A 1BQUA 2M83A 1OIOA 4A67A 2GUOB 3PWPA 5CP7A 4NN5B 1Q9OB 1U30A 4I1PA 2WQUA 5I71C 3DSFH 1GS8A 1UA3A 3INUL 2RIKA 5CN2A 5K9QI 5B21A 2CMRL 4MAUL 3X12A 4NC0B 5JZ7C 2MOQA 4NWUH 3OPZH 2WB7A 4X6BA 4BZ1L 1FG9C 1RZJH 4JO8A 1URIA 3TO2B 3V0JA 1XQ4A 1FVEB 3FCUB 3IMTA 2F53B 3OHXB 3LDBB 5L2KA 2AXFA 3R4RA 5E94B 4QWWC 4YL9A 1FRGL 3FTYA 1N19A 1A6UH 1MJ7H 1S5HB 4M4RA 1SN0A 4WTZG 3T8XB 4J23A 3WSQH 1AQKH 1NM4A 3GSUB 4NZTH 4KOCA 5LVEA 5HI3C 4NNXA 4XP9L 1IKFL 2P49B 4HUXB 4D0CB 1GPOL 5BRZD 3L7EA 2V37A 1CXFA 2NY4D 5CWSB 3VGBA 1J1XH 2G3MA 2B16A 3IVKA 2HLAA 4Q58C 4XB7A 4YSSA 2XSKA 4YHIA 1W0VA 1WJ3A 1UKSA 3LVTA 1GGCL 1AZCA 1JWMB 2GK2A 4IOIA 3S96B 1SHMA 2XQBL 3QIBA 1IC1A 1JVKA 1EHKB 8FABB 1WWAX 4NWTL 4R3SA 1SJXA 4KI5D 1F1AA 1UASA 5E00A 4UM9B 2ODIA 1HWWA 2PO6A 4PGDA 1RZFL 5EZJB 1EBAA 4KFMA 3UO8B 2ZG1A 2ICEB 3VI3E 2CJTA 4BFGA 4R4ND 4FG0A 2P8MB 3CMOL 4X5LA 3UJIL 5ADOL 3AQDA 3VNYA 5T3ZD 5FW7A 3ARZA 1CL7L 3C09B 3HE6B 4Z7VE 3V6ZB 2WLLA 2Q8BH 1MREL 4EKXA 1KJ3H 3PABB 4WRLA 1SBBA 2WNWA 2ZSWA 2EE6A 3O4LE 2FHBA 1ZSDB 4DVBA 1NIAA 5C9JB 5IZ7A 3HG2A 4NHCL 1XXFC 4TPRH 1HTYA 5E2TL 3F04A 2GTQA 1ZEAH 3ZTCC 5EB9A 1UYWL 4GRMA 4PLNC 5T5NF 1A47A 2D7TH 4FHKA 5IEHA 1KGIA 7PCYA 3QFGA 3ENEA 4JBSA 3QFDB 2Q86B 1WFUA 5GS0L 3LJ3A 1IBYA 4WWKB 5KG9A 1MHCB 5CEXA 5D1XA 4QEGA 5TDNB 1UB6B 2HVJB 1OY3B 2DWYA 3DBXA 4U1SB 5MP6H 1FC2D 2FECI 4PJXB 1OEZW 4FQLL 1BVNP 5JR1H 3NIDF 1FNAA 3WS6A 4ABVA 1JHLH 4NQEA 4QTFA 4BJLA 1KWKA 4HCRH 3D69A 3HMWL 2FLRT 35C8H 1EHNA 4Z7NF 5L0QC 1LE5B 4AJWA 5C3LD 4FG6C 3DO7A 1F00I 1QNIA 1NC2D 2EYTB 2ED8A 4AG4H 2A73B 4LRIC 5FYKH 2P5PA 4HBCH 1NGXB 3AUWB 5DQJB 3AUVA 2IALA 1NFDB 3HNVL 1ITBB 1H6TA 2Z7YA 2AEQL 3PWUB 4HU2A 4ZK8A 4F7PA 1MHPL 3QH3A 1OM3H 3MR9B 3RWDA 2OMUA 4XP6L 2OJEA 4OIAA 2VLKA 4DO4A 1BEYL 4MA8L 3RHWF 1BXAA 3ORJA 3SKJH 2X7LA 1XV8A 3N04A 2EIJB 3RGBA 2NY0B 3PAUA 1J5OH 1ZA3B 5BRZE 3MXWL 4AGLA 2J8UB 1L9OA 1J9SA 3LH8A 3SPIA 1LO0H 3RVTD 5EEXA 1KXVA 2A99A 4CBZA 4OCWL 2VDPH 4U1NA 2CDEA 3IK2A 3QQXA 4XMZA 2P8PB 4K5MA 1T4KA 4XN4A 1EAOA 1JPGB 3I6GA 4KI5E 1DVQA 4UAOC 2VLJA 1T6VN 3D25A 4ODBD 2CHNA 3BFQG 5IV2B 2R15A 5GQBA 3T4AB 4XXWA 5JDJA 4X6FB 1TLMA 1FVCA 2FGWL 4WO0A 1MJUH 3QRGL 3RVXD 1ICTA 4K7PH 5IR1A 2KLSA 3OKEA 3ZHNA 2Q2LA 2UY7B 3VXSB 5A2BA 5AKTA 5T3ZE 6FABL 5D6DA 3L3DB 3D48R 3QORC 3ZQXA 4PYGA 4MMZB 4P2OD 3EGXB 1YVLA 5F7YC 5TE7L 4AQEA 5J3HD 5SWSA 3PWJA 5L88L 2PCYA 2DQCH 3FUIA 2IPKB 4DGYL 4G82A 4PJEE 4PGCA 5IQ9A 2H3NA 2VITB 2NY3B 3A24A 4KMTH 4Q74A 3NSCA 3JWOL 1GSKA 4B0MM 1AHWC 1NPUA 3CSGA 1A14L 1G6RA 2GFBB 5EFIB 4L9LA 2DQJH 4A39A 2WPGA 4GT0A 2IWEA 4N22A 4YSCA 5KW9H 1AR1D 5EU6D 2F58L 5BV7C 1W15A 4Y4FB 3PG2A 2ATKA 1H9VA 4MAYA 2EDOA 1UOLA 4FNQA 1P2CA 2VDRB 3LPFA 4U1KA 3LNEA 3Q9PA 5BZDB 4J3XA 4BSWA 3B2UD 2R56L 4TVPH 1ZPLA 1KY6A 4X7SH 5DUPH 3E1ZA 4YBLC 2YK1H 5E99H 3IGLA 5AZEL 2LLLA 3MLSH 3OXRB 2FT7A 3ROLB 4EXKA 5C6WH 5DVMA 5TFSH 3ISYA 4M8VA 4D7BA 4G42A 2YPVL 3CTTA 2YSSB 2UWEB 3G5ZA 4FQHB 4ZG1A 1QSEB 4FZEH 4AGOA 1ML0A 5E5MB 1MN4A 5EBGA 1DEEB 3JZYA 5B3JE 2C3WA 3ZY7A 1ORSA 5DMIH 3X1FA 3BD5A 3TBYA 3MLPA 5I73C 1ZHLA 3FNKA 4HAGA 5T1LB 4WTXA 3P11H 2AJSL 4ZS6C 1HKLL 1LO3L 1VEOA 3IJYB 3ISRA 3O8XA 3QFJA 3QJTB 4U6YA 3LZRA 1CGSH 3AXHA 4R0LA 4UT9H 5EN2A 1BOYA 3I3BA 4U0RB 1P4BL 4EN3D 2BNRD 4M62L 5DCCA 2EH7H 3MDJA 2V7HA 1Q0YL 2XBZA 4PGEB 2ZOLB 4YX2H 3QDGD 4LHUD 1QSFD 2HJFB 3NRFA 3N41F 3RVUD 2CDFB 3FUDA 5IVZB 3W56A 1MFBL 3NH7H 1T0NA 1IAKB 1BXUA 4PRHD 4L8CB 4CL7A 3UP6A 3LHAA 4HF5H 3VNZA 2VRQA 3VXUA 4EQ2A 1G9MC 5CEZL 2M1KA 3CXFA 2QPFA 3MNWB 5T1KB 2YMTA 4YE4L 3IJEB 4UQBA 1ZWIB 3PAVA 2GITB 3GI9H 3DMMC 4U3CA 1M7IB 2K7PA 3LIZL 2X4RA 1JE6A 3BSHA 1D9KC 3POCA 4LASL 1FL5B 3VUAA 4HZLB 2F53D 3ZK0A 4LPXA 2B1HL 5DK2B 4I87A 1ORQB 3STLB 4W9HC 5IMLB 3HRZC 1BZ7B 3NCEB 4UV7L 1Y18A 4GAAA 1AZUA 3GSWA 5IB3A 3LX9A 4BE5A 4DIXA 5EU7C 1TEYA 1RJYA 1KMGA 2DQGH 3BAJA 3IU4L 4POUB 4LLVB 25C8L 1N3NA 3H8NA 2QZ5A 2ZKXA 1SY6L 1UGNA 3OX8A 2WWMC 3FOLB 4EI0A 1HHHA 1RPKA 3HNSH 2FJGB 3B9EA 3MLRH 5EU6E 1OALA 2WNGA 4JFSA 5GZND 5C08A 2XTLA 3SCMB 4WY7H 3MRJB 4DTGL 4P4RA 3W38A 3C9NB 4UM9D 3HAEB 3RI5K 2YIHA 1KPRA 5JIQA 3ELQA 2GC7C 3PCYA 3LEVL 1NTDA 3NESA 2Y1YA 4G43B 3T8MA 5FYJH 3ARBB 1DCLA 1JGDA 3SKNB 4AZ8B 2VUYA 2WCGA 3I9PA 3OKYA 3FCSA 3M1CA 2B3IA 3RUGE 1JG9A 1TITA 4ZMPA 3HE6D 1KC5H 5AG9A 1QEXA 1MY7A 1PCXA 2YGOA 3C5ZA 3SE8L 1N68A 2UVFA 1CFQB 1FVDB 4PY8I 5ITFA 1RMFL 1JDDA 2XPYA 3AWEA 4I2XB 1JPEA 3K72A 3EH5B 4PRAA 3R7QA 4UU9A 1QLFA 4JL2A 5JPMA 2D31B 2VDOL 2BNRE 2YPLA 3QJFB 5D7EA 3DX9A 2ZP0T 3FUHA 4F33B 2JI1A 3PAYA 4WWKD 4ZQKB 5FGBA 3QJVB 4N86A 2EKJA 2VMFA 1F11B 3QDGE 4WU7A 5HYIA 1H19A 3HBPA 2IANA 1QSFE 2OMZA 1AQDB 3D9AL 4RGOH 5MEPA 5DRNA 1HCFX 2GBAA 3JTTB 3GJFK 4PRHE 1S7TB 4OM0L 3CSPA 4LHUG 3S2AA 1KTDB 3QZWG 2PPAA 1LD9A 5E56A 3Q1EA 1TYEB 3MRRA 4WV1C 2JJWA 3NSXA 2V2WA 4UQ2A 4KUZL 4FQIL 1SEQL 3ARDB 1Q8MA 3HC3L 2PPFA 1U8NB 3S35L 2Q8AH 4S1QH 4UM8B 2JJSC 4PRIB 5ITBH 2IPTH 3J07A 4YHLH 5AW7B 3KJ4C 1B4RA 5IK3A 5CMAA 3LNGA 5CN3A 4DKEL 4WI6A 3QCTL 3HFMH 5JUEH 3GI8L 1TNNA 2F53E 3L4VA 4HH9A 3CDZA 3PJSB 4U6TA 2RR3A 2YGQA 3P4NB 4GSDH 5FUZL 2ZAHA 3DDFA 1DQJA 2B4CC 2FL5B 4JM2C 2NR6D 2YO3A 4TOYH 3AAZA 3IAQA 3P54A 3GQFA 3VGDA 4AEEA 1DDHB 1B90A 5D7IA 2NY0D 1JNNL 4W70A 4MWFB 1U93A 1BEXA 1UXSB 2WIMA 3NG5A 4U3SA 4WEMB 4XVJH 5AW9B 1HSBB 3NCBB 3VSTA 1N64H 4PJFA 1N5YH 1PY4A 2BINA 4IS6B 2GABA 2KLTA 2FO8A 4A7GF 3GXFA 3NN8A 3MO1B 3BPOC 2UZXA 2BC4A 3MRCA 1V5JA 3P0VL 5AWNH 5LUMA 1VCAA 4HGWA 1GGTA 2OSLA 3LZFL 1MIML 4QDGA 3HS0B 3U4BH 2P3YA 3IF1B 1UD5A 3N3EA 1AZBA 1QAWA 1OB1B 1OAJA 3LN5A 5MERB 1AKPA 3VXSD 1EXUB 2DH2A 3IDNB 4GXFA 4ODWB 3UAJC 1I1FA 3R8BB 3BLPX 1A4JB 1G5GA 1KPVA 3BUTA 4W9FC 3QIUB 5CFAA 1SVBA 4FABL 4ZX6A 1CGTA 4X0NA 2B15A 2JF1A 5IOPB 2H26A 3HFFA 3V4VH 4NNYA 2J5LC 3V5DB 2G4EA 2JIXB 2WLZA 3MLYH 4MAZA 1XF1A 2NY3D 3NCJH 5L4JA 4NUQA 3CXDH 4WW2B 4OV5A 4ODUB 3O3BA 2VO8A 2UYLA 1FIEA 3J2PA 4UT6A 2JQZA 1HL9A 1I7UB 1XL4A 1U8LB 2H1PH 3ERXA 4JB9H 3T8VA 3BH4A 4FRWA 4DAGL 1DBML 3QR1A 1U8CA 2BP0A 5EZPA 4Y4FD 4QHKJ 4Z1PA 4S1DD 3VD2A 3K5SA 4XVOA 4PJXE 2YD1A 5AYUL 4E9VA 3KBFA 3IS0X 1ACZA 5SWZB 1FFNB 1JZ3A 2YJLA 4DQOL 2K9FB 2BO0A 4KTYA 1J18A 1DFBL 4K3EL 4BM7A 3QARA 1BFOB 1OSEA 1QSED 5F0PB 2EDKA 3U0WH 3OWRA 3NMEA 1SHWA 4N2IA 2IQAA 5HYQA 4QXTB 3LS5L 3VFSB 4XCEB 4L8SA 3GC3A 3TVMC 1NFDE 4ELKB 2H45A 1CBJA 3QUYB 5T1LD 1LXMA 4URKA 1FWXA 5I0WA 5BVPL 1HQ4B 1KTLA 2RJMA 2CCWA 1MW2A 3LKQB 4KJPC 2VLMD 2BFVL 3LKSA 1RJCA 1WFTA 3HB3B 3CG8A 3GMOB 5L8KB 4IGBA 4PR5A 3FMGL 5F44A 3UC0L 4LB8A 2J8UE 1P9MA 1MVUA 3CXHJ 4Q56A 2V9TA 1NJ9B 3RIKA 2WQVA 5EOQL 3V4PA 3ZBMA 3QJQB 3VG0L 4JM0A 4G1MA 3H1ZA 5H8DA 4QHUA 3B43A 3W39B 1MCLA 4X99B 1A7BA 2DL9A 2Y7QA 4GRWF 3DC0A 2C9XA 2YQ3A 4G1EA 4PVLA 5T1KD 2ZCLH 1AS8A 3Q6FB 3MJ9A 1S7UA 4LAJH 3T2LA 1UENA 3O3DB 1KIRB 2YOCA 3HZYB 2ZWYA 3MRQA 1RUPL 3LXAA 3PNWB 4PWIA 1Y1UA 3JVGA 4IRSA 2IFFL 2KLRA 1XD1A 1KJVB 1U6AL 4K3JH 3VXSE 12E8L 2FEEL 4JGUA 5I0YA 4LGPB 5K5YA 4NUJB 1H5BB 4PB0H 2J6EH 3DJ9A 5EO9A 3UGUA 4M1DH 5CCKL 2HZHA 4ONHB 1A7OH 2FATL 3FFCB 3GMPA 3WO4B 3EDFA 1BQ5A 4KJYB 3GJFH 1NOFA 3C5XA 1VADB 2CBPA 2FJFA 4K3HA 5GRXG 4YUEH 3V6OC 2H4EA 4UT7L 1Z0NA 3IB4A 5EF2A 1PX3A 4MJ5A 4NKQB 2NTFB 4ZUSB 2CO3A 2CRMA 3TH3T 1T80A 3EOAB 2GEQA 5A16B 4M6MH 3II1A 1YMHA 4NHUA 1RZ7L 3UCQA 3CZUB 4G8EA 4P0DA 3FONB 3SCMD 1U2HA 3GXIA 3NZ8B 4LT7A 3VWJC 1KWGA 2ZYHA 1B4JL 3SYPA 3H9ZA 3VD4A 2CH8A 3FQUB 5EBLB 3TEWA 1JHTA 2OTWA 3A21A 3ARBD 3G6AB 1KLFA 4U3HA 3ZR6A 2K6YA 3LPPA 1YPZB 2UWEE 4U6XA 4C4KO 3ULUL 1QSEE 4Y9EA 2IWKA 5AVUB 4G83A 4Z7OB 3L2NA 3B37A 2Q76A 5I75C 2BNQD 2KKQA 3RWGA 3UZQB 2XY2A 1U2CA 4H8WH 4W6XB 3T0EA 3HE7B 1R5WB 1KV3A 3CU7A 3O6FC 3O81A 4JN1L 1HZKA 2A77H 1J87A 2KL6A 4WI4A 4X7CC 3ZL4L 3NTCL 2JK5A 4PJ8A 3Q3GA 3QVAA 4X5QA 1GHFH 3EO9L 3L4ZA 2VLME 3QPQC 3ALXA 2X89A 3QDMB 4XNQB 1NL0H 1E43A 4XO4A 4O4YH 1Z9NA 4L1BA 5J13B 4KVNL 5CEZD 3N50A 2FTAA 3JYBA 4MQTB 2NUTA 1M2VB 1NIEA 1YN6B 2VTFA 2ZKMX 5EBWA 2OJ1A 2OMWA 5TF0A 3AS0A 3TPUB 3VFNA 4ZX5A 2E8YA 5AVYB 4BFJA 1Z3GL 2VNCA 3BWUF 3H7BB 1MQ8A 2B5IC 5I82A 1EUTA 1FZOB 4NAJA 1C8QA 2WZPA 2WWOA 4OW6A 3ARDD 2HJKA 4WU5A 4L1TA 4JZJB 3PV6B 4OD1H 4PRID 2VN6A 3KBPA 3NA9L 4R6UA 5F6IB 3UTQA 1F3JA 3QUXA 2O6CA 3AABA 1Y6MR 1NIBA 2HWZH 5ECJE 1YQ2A 5KYYB 2ETWA 3IJHB 1OGPA 3GBNH 4Z7WF 5IMKB 1T7VA 5ICYA 4OZ4B 5I1DB 5D2LF 3T3PF 3M8OL 1T1XA 5C0CB 1MNUL 4NT6A 1IE5A 3GFUA 4XN5A 3EDEA 5IKCB 3MJ8A 1IGCL 1OT4A 5CCGE 2Q0ZX 3RJOA 4MGXA 3BPNB 3T0WA 4TLSA 2GIXA 1GS7A 5EPMA 3LEYH 4EE2A 2VN7A 3B2VL 4TSAH 4JKPH 4Z78B 4OF6A 3MPCA 3TBSB 1RSYA 1I8UA 3OQ3B 4BFEA 2W8CA 2WBXA 4WFHD 5B1BB 3KPNA 1VCBC 1IFHH 3KE0A 3BHBA 4HX1A 1AVAA 3GKWL 4J1UA 5EUOB 4ZX4A 1P7KA 3LMJL 2V2XB 3QG7H 4DSYA 5EEVA 3NJGA 4MDIA 5GRWA 3EG9B 3HAEG 1PEZA 5HYEA 4MJIB 4UMGA 5D96C 2ADIA 5KSVA 4P59L 1BFTA 2XBTA 4JFFA 2FYYA 2OCCB 3HC0A 3I9GL 3QIUD 4GSXA 1M05A 4X7DC 3NSYA 3F7RA 1AXSA 5A3ID 5I74C 2Q9OA 3N1FC 1WP6A 4I2XE 2BJML 1OF2B 4AJYV 3WO3B 1DR9A 1UHVA 2JIXD 4N9GB 4XXCA 5GGSY 1KCWA 1L6XA 3UH8A 4JQVA 5E9AA 2NY2B 2Z3FA 3FB8B 4FKHA 3MRHA 1BIIA 3MV7A 1SUJA 2Z7UA 1TEGA 4FLRA 5EU5A 3HJEA 4Q6IA 2DMKA 4Q89A 4DHLA 1TFHA 5CEZE 5J57B 3ZYOA 5BUGA 4IHBA 3OGCB 1GZPA 2J72A 3OLGA 4XMLH 4PJGA 5SWZD 5TDPA 4NRYA 1UWYA 1GYVA 4AMWA 4A7QA 1XMEB 1RIUL 2E7HA 5DHVA 4EDXA 1IVLA 3N42F 1OP5K 5HHVH 2GVYA 2H32A 4MB5A 3IPEA 2B39A 2Q7NA 5F1IA 2CPCA 2DD8H 1DZBA 2PF6A 4PRIE 3EBAA 2P4AB 1CMOA 1WZKA 2Q7AA 4WCYL 2WUBL 4YBQC 1QKZL 5FV2A 5GS1C 1ZHBB 2GG1A 3QUYD 3U1SL 3V7AE 4H5SB 4N2CA 4EN3C 5JIPA 1CBVH 5CP3H 1NGQL 2CUHA 4QXGH 4AQ1B 3QZLA 4P49A 2X38A 4QNPF 3V7AG 3IGUA 1COBA 4YNYA 1ADWA 4ZPTA 4JPSA 3RVUC 3SQOH 4AIEA 1NCDH 2V7NB 3HB3D 3UC2A 1IGJA 4I3SH 4UBDD 2IH1B 3DJZA 5IFAH 4QY8A 2LU5A 3KCPB 3MNDA 2Z93B 4AC4A 1R3LA 2RH0A 4M5SA 4DKFL 4OUUA 4ZMAT 1KYOJ 2OI9B 1B6UA 2WQXA 4E68A 3QRLA 2J8OA 1R3IH 1B0RB 3VA6A 4Q7DA 4WFHE 3TZVB 3O9WC 5F70A 1E67A 3LXCA 4M7LL 1QSZA 3VU1A 5FAAA 1QR1A 1O9WA 3OHXC 1IKNA 1TTGA 3K6NA 3CFBA 4YHML 1ES0B 1FFOB 4IRZA 4IEFB 1JZ8A 3CVHH 5F1SA 4ZDHA 4PJ9C 5HDRA 3ZT7A 1WZAA 5AAMA 4A68A 5DJ0A 4NBXB 3L08A 4OZHF 2AAVA 1T89C 1MXDA 3BVUA 5SWQB 5HHXL 3WFDH 3NAAL 1P6AB 3VO0A 5CN1A 4B9GA 3FFCD 1ADQA 1P0SE 2X0VA 3BYYA 3EJZD 3FN0H 1TEFA 5J6GB 1UADC 3DX6A 3OAUL 4ZD3L 2A4CA 4XXDB 4ALAL 3CSBA 3MJ7A 4KK9D 3GD1C 1UWEH 1HSAA 5JIDA 3SPCA 2WVSA 3GO1L 2NYKA 1C08B 2G30A 2VR9A 3HZKB 1IBHA 4MMXA 3HR6A 1ZV2A 2X40A 2ZWLT 3AU1A 1WAEA 2ICEC 3C08L 2OXGB 1DUZA 1URZA 4XH2A 2HKHL 1FLRH 1HWGB 4RFEB 3UYPB 1R4XA 3QB7C 5SWZE 4A2FA 5EC2A 3EYSL 3I85A 5ILTL 3TM6A 2FH6A 1ZJAA 3S37X 1YEDA 2VXSL 4QOKA 1FO0H 1ZHNA 3LIUA 4KXZI 1JZFA 3F8UB 2WQ8A 2AEPL 3E6FB 2H9GB 3N91A 2XQ0A 3NIGB 5TGBB 2GT9B 2Q2EB 4OZFB 4GUQA 1QVOA 4N5ED 1R3JA 5TQ0L 5DHDA 3RIFF 4LK4A 2HFGL 3PGCA 4AVKA 3FQWA 1IC5H 3HE7D 1NCBH 4JRXA 2DLTA 3BZFA 4FQJL 2FBOJ 4QRRB 2CM5A 5CILL 1DQTA 4KKRA 3MREB 4ECNA 3WBDA 5F9JB 3QDMD 3ZSSA 3U25A 5T1DH 4LCCA 1XB8A 2HN7A 1DQQA 1W2KT 3PHAA 2QSVA 1U41A 4F7MA 3MMEB 2AS5M 3GINA 1XR9B 3CHXA 3QQNA 4U6HA 3L9YA 3FT2A 2H8PB 5DO2C 4AL8L 4ANXA 5IHWA 4JPQA 3ZKMC 3HEIB 4TN9A 3RKDD 1TJIH 4F58H 4ETQB 1A3LL 2JTDA 4BH8B 1PD0A 1AMYA 2FX8L 3CK0H 1PD1A 2QVTA 2V4LA 3KNBB 1JPTL 2YAOA 4D2NA 3B8SA 2BWDA 4BCXA 4MSWB 1FNLA 3JTSB 1XBRA 3WTVA 4M7ZB 4MVBD 4XAKE 2XYCA 2NW2A 3FCTA 2HRLA 2ZUYA 3PWNB 1MLBB 3RU8H 1JMXA 4PWJA 4IIQC 4H0LC 4B9PA 1NPNA 4AEIH 2AERT 2CLVA 1SJHA 2IOIA 1QBAA 4R84A 4IHOA 5FW8A 4P9ML 1AE6H 3F7VB 1YEFL 3ZU8A 4GJTB 2N3JA 3BP6A 1CFNB 3FFCE 5C0CD 2H2SD 2ARWA 1IKOP 2V3FA 4M56A 2Q7YB 4UV4H 5AOLA 2CKBA 2X87A 2DQDL 5K59E 1JOIA 2J4WH 4H8PA 1OP5H 5EMYA 3UABA 3CSYA 4BKLB 4Y9GA 5DJDB 2BHZA 1NFAA 3QIWB 5DVNA 4AWJC 3DYPA 1E7VA 4ODXA 5DJCB 4DO5A 4ZAKB 2OSXA 5KVMC 3OG6B 4MD4B 3FN3A 1M6UA 1OTTD 3MACL 1PDKA 3EAKA 1BVKB 4M5YL 2OR9L 4UTAA 4AH2A 4MCNA 4DVRH 5GS0C 2R2BB 4X6DF 4AE0A 2WBWB 1X7TA 5JXAL 4MJID 1YPZE 1EO8H 4AKOA 1HJBC 1DBAL 4Z7OE 3FT4B 3QEGL 4N20A 2VDMH 1WAPA 1ED3B 2VL5B 4G80B 1NSNH 4JJ5A 5JW4M 1SGKA 1VIWA 4Y5XA 2GHZA 1DUYA 2IQ9H 3IJSB 5F3BB 5HGAA 1KENL 1SXCA 3HTLX 1UXWA 2FX7L 2ZD0A 5HYJA 3ZKXC 1PNCA 3G5VA 1XF3A 3QDME 3RWIA 4K23L 3WLBA 2NY2D 4NRZA 2AZAA 5E1IA 4OGYH 2HUHA 3KEDA 5K93A 2XRAL 1A1MA 1GY2A 4PMFA 4W9CC 2AZUA 5HJGA 3RTQC 2I07B 3BT0A 5C0DA 2EDTA 4BE6A 1SLUA 3I6KA 4MHHI 1RFDH 4L0ZA 2OL3A 5I16B 3GMLA 4A2GA 4XR8C 5JPNC 4HOZA 5K39B 1SDYA 3GK8L 2GJ6B 3UTSA 1G7MA 2CUAA 4X4MA 1TTCA 1SVCP 2VC2H 2BNUB 5D4QA 3NJNA 5IUCA 3VM5A 3C6SB 2NYYC 1X4ZA 2EXTA 3KJ6H 5TK2A 1PBYA 3GBMH 4CU7A 1S78C 3EBGA 1HC1A 2VH5L 1RXLA 4JVPA 1SDDA 5E6RB 1Z9LA 2YSTA 1E8WA 1X3DA 3QQ4B 3AVEA 1MLCB 1FIGL 4DEPC 2PR4L 4N2DA 3W1ZA 4RDQF 3OKDA 3FSAA 1SF3A 4H7VA 5J6SA 4F2FA 3BVTA 5FKAB 4KNTA 2NNXA 4HEMA 3KW7A 3GPEA 4HLEA 2ZXGA 1T2JA 4X4KA 5EWIH 2P47B 2NNCA 1X5IA 2P43B 4NKIH 5C0CE 4Y1TA 3KHOA 3WIIH 1V55B 5CJQH 3TYFB 4DJMA 3WN5A 1TXKA 1S7VA 1PY0A 2Y06H 4M29A 4AC2A 3UCRA 1BYPA 2HT2C 3BPLC 1K3IA 3KPMA 4LLUB 3FCBA 1RIHH 1G84A 3Q8EA 2Z91B 1FPTL 3L2LA 1IARB 2AABH 2QV4A 2V0AA 4FQCL 3TZVD 3F62A 3EIFA 2MNWA 1U8MA 4CC4C 4FXGC 3D2UA 3JWOC 5EO0A 4PD4K 5EUOE 1V7MH 1UZGA 5LBSL 2VXTL 5D7JA 2CJ3A 3AM8C 3CLEH 2MSPA 3FT9A 3QISA 4MJIE 4DGIH 1F02I 5K33A 3IMRA 3K0WA 5KVEH 2ZKHH 1KT2B 4XBPB 4YWGL 4A55A 1XZWA 1WCBA 4LSTH 3PF2A 5DQDL 3TIEA 2OAAA 2XWCA 3L3HA 4ZUUB 3MNZA 3GM0A 3M1OA 1XB3A 3WXVL 2DQMA 4PI0A 5DRWA 8CGTA 4HAFA 4P57B 3EFDL 3OQRA 3C75A 2KZWA 5CCJA 4KQ4L 2G60H 1OL0A 1S7WB 2AEOA 3DV4A 3DIFA 3SCMC 4D3CH 4ZO7A 1UTDA 5AUMB 5AVTB 1A8JH 3EOBA 1BMWA 2BHFA 3KPLA 1X4XA 1ROCA 1Q9KA 3DRQA 4JG9A 5E2WL 43CAB 2IJ0C 3VXQB 3BKYL 3BFOA 4NPYB 4BBWA 3DTDA 1UFUA 4JG1H 1D5RA 1EGJA 5HHNB 4KK5D 4Y2DB 2WXIA 4KZDH 2R0KL 1KZYA 4GKNB 4U1GB 4YO0A 2ARJA 3VYPA 5LQBH 5E8DL 4PJAF 1RPQA 3DPBB 1PAZA 4ANKA 4XCCL 4FQXB 3WEXB 2WMPA 1MVYA 4HK3J 1A5FH 4N2NA 4JM4H 4XP1H 1UUNA 2J1XA 1RUAH 3MROB 1AC0A 4MNHB 3DX8B 5DWUL 5I2IB 2Z4QB 1G9NL 3TT1L 1NBZA 2D0HA 2FIKB 5LXVA 4QRRD 3D0LA 2ZXDA 4G7YL 5ANHA 3QNXB 5E70A 4DN4L 2HFEB 3ES6B 4K15A 1FP5A 3K4DA 3OZ9H 4NDMB 2ZWZA 1CT8A 5BUPA 1BF8A 3GIZH 2A6JA 4BCYA 5FS5A 1FNFA 4NO0B 1IAIH 1T7ZA 2W60A 4ODHL 4WTZA 5F9WC 2YC1B 2DWEB 3A4FA 3D5OF 4JY5H 4F15B 2HCZX 3IAGC 1KB5L 4APXA 3BJLA 3BZ4B 3L3KA 2IWFA 3WKML 4O51A 3ZKQD 3FYEB 1VFAA 5LG1A 4Z7NB 1NCGA 3QE5A 5DJ2B 1QPXA 4M7KH 5I6OA 2FZ3A 2CCVA 4P5RA 4YR6A 3ASWA 3U0TA 3VFGL 4Y88A 1W8OA 1DBKL 2E6QA 2XKNB 3NJJA 1IL1A 2XY1A 1NCHA 4GW5B 1NMAH 2UXFA 1MPAL 2CG9X 2CK0H 5B3SB 4NFBA 3D39B 2P24B 3Q48A 5LB1A 4KKAC 4NRXB 4P46C 4FP8H 1PFOA 5I18L 4LKXB 4E9SA 3EDDA 1E4WH 2VXUL 3EHBB 3L3OA 1KEGL 1XTMA 1KGYE 2P44B 4Y19B 2K6ZA 4WIQA 4JHWL 3KR3H 1XMWA 3JUYA 1H8SA 5KYWA 3PXHA 2G3ZA 2A9NH 4KY1H 3CFCH 3MZTA 4XCFH 4Z7VA 2AI0L 4YDKH 3SOTA 2DL2A 1A7PH 1NCJA 4NLHA 3MV9B 3T1FA 3DOSA 5E24E 3O4LA 4Q2ZA 1IGYA 2ZYRA 3GRGA 2VN3A 3QULB 4AGQA 2CBTA 3SY6A 3QIWD 4DH2A 3EBHA 4JZOA 5ESVB 1T66C 2DH3A 1BQHB 1H15A 3NPSC 2PTUA 4KRLB 5EORL 5C6TH 3RDTA 3H2WA 4ZAKD 2K45A 2J5WA 2I32A 1U8KB 5ACZA 2DYSB 4FYRA 4AYFB 3WEBA 2N01B 2Z8WC 3TJEL 3R06A 3CDGA 2ZCKH 5ENWA 2YQ2A 3K2KA 5DK0A 4HIHA 1WD8A 2ED9A 3RILA 3S4SB 5FGSA 4Y4HD 5JHMA 1A65A 5MHSD 4BFIA 3WXWL 3NIGE 4ZFGH 3ARGC 5TPWL 1IIIA 1BAGA 4MKMA 5HI5D 1WE5A 3UZVB 1SJMA 1K8DB 5KVGE 1V7NH 4JR9H 4LDCA 4CSPA 2VM4A 4FLSA 4GT7A 1U4EA 5DD6B 3GBLA 3T77B 5CD5C 1PG7W 5I19H 1L0YA 3A67H 3E6HB 4OZFG 4QRRE 1BAFH 3ZDYF 5DJ8B 2V5RA 2HT4C 1IFGA 3IGAB 4KRPB 2XOTA 4NM8H 1JYXA 4M1CD 1W6LA 4PJ5B 4FE9A 2J1YA 3SQBB 4B53A 3MBWA 3T0VA 4F2EA 3TJPA 3ETTA 4ZTPH 1OKEA 4ABUA 3VYOA 1EHAA 1K5NA 3V6BR 5DJ6B 3DKHA 3GPSA 1TENA 3LXBA 1E4XI 4R7NA 1O0VA 2EH8H 1KF9B 3OR6B 1MDTA 5D9SA 1O6SB 2DW5A 3F7KA 4NZDA 2GJ6D 4Q8BA 3GHPA 4QF1A 4BA0A 5AL8A 4M9PA 5DR5H 4YC2C 1BV8A 4NAMA 3B6SB 3GYRA 4U2ZA 4DP5X 3ULVF 1ID2A 2ZX9A 4F9LC 3TEYA 1FJ1B 1QO3A 2AXGA 3D06A 5H94B 1PLCA 4BD4A 2G0KA 3HB3C 1A22B 4QO1B 4RAVA 3N0PB 4J2XA 3N2JA 1TMCB 2UY6B 1NGPH 5CU5A 4EBQL 1OGAB 1KPUA 1ET7A 4IBLT 3N41B 4AQ8C 1URLA 5DC9B 7FABH 2WBJB 4IRJC 1ONQA 4XN2A 5I1EH 3FSZA 3F85A 3PP4L 5K9QG 3AWFA 3NACH 3QNYB 1N12A 2X3CA 3S37L 4PJEA 3JTBA 4HUVA 1RUML 4CADB 3ARSA 5BJTB 2P7TB 2SEBA 3O3AA 1A3RH 5K9JH 2MFNA 4XCYB 1KCSH 4R90H 4A7VA 4OH2A 3Q2LA 4OD2B 1ZE3H 4JUTA 4HUWA 2AGJL 1S9XB 1J9CT 1P4LA 5MHSE 2X3AA 3FQNB 1AIFA 3CZJA 5ETUB 1ZLUK 3CVBA 4ODSH 2MTPA 4YPGA 3WO4C 1BJ1H 2VUOA 3SZKC 5JW4R 2VO5A 2OK0L 4FKKA 2EDQA 4S2SA 4JPIB 4KK9C 1I1AB 5FO7A 4P2CG 4HKXB 3SDAB 1TT6A 5H37A 3UERA 4NIKB 1LO5A 4DUXA 4ICXA 4QHNA 2HYMA 4Z9KB 5L6YH 3EOTH 1SXZA 5DVLA 3APFA 1JK9B 3ZL1A 1E30A 3LS4L 1M6OB 4MKTA 4KTDH 2HMID 2DTMH 3DJSA 4BK5C 2WAQA 4MD5B 4N2FA 3VXPA 5AD0B 1ZLWK 3A4EA 2BW4A 4JFQA 4OB5L 1RZKH 4Y2DD 4TNWK 5FYJU 3GSNL 1A7QH 4JX0A 2GJ6E 1BZ9B 3RWEA 5E6YA 5H2BB 4R5TA 2CALA 3PDGA 3SYAA 1PG7X 1A66A 4FQ1L 2O61B 5DUML 5FK9A 3H42L 3HE7C 3ULAB 4FQXD 5A7EA 1J8SA 2Y3AA 4GYBA 3QHTC 3TWCH 3EGSB 1BD2B 4N2KA 3OKMB 2FQDA 3WMSA 5E4EC 5FHBL 4HJUA 4IKLA 1JGVL 5HYFA 1TSRA 5EC1A 3GSOB 1NDGB 3MC0A 4UTBH 2W0FB 5CJ5A 2PN5A 3GZPA 4ZUWB 2QKIA 4NO0D 5DUBB 4ESKA 3SDDC 4P2OA 5F1KC 5DZPA 1FZKA 1D5MA 2XQYG 5B38A 2WLIA 3RX8A 4I3RL 1LE9A 4HU8A 2K3HA 5ICXB 3VD0A 3FUNA 3E8VA 4KJWD 9PCYA 1UH2A 1KNOB 3DK0A 3D07A 4BA8A 1IAOB 5KBNC 3DTXA 5CEYB 3WUWB 4NP4L 2B59A 1B2WH 3MRPB 5DLML 5EU6A 3D39D 4JVUA 4DKTA 5T3XH 1Y1DA 2BS9A 1UD4A 4FJZA 2ZXWB 1Z0MA 1UM6H 1U8HB 3ARTA 1Q0XH 3GSVA 1QBBA 1FV1B 32C2A 3CPUA 3EHBD 1NFIB 4R2GC 5IW3A 1CF8L 3OKOB 4Y19D 3WNPA 5H35A 2ZUWA 5BQ7B 3WTSA 4F9PC 1DN2A 4E0RB 1LDPH 3WL9A 3RUGA 3ILQD 4K7PX 2G4GA 5I30L 4XRCB 2ATPA 4A04A 3MV9D 2JELL 2DKSA 3C6EA 2DKMA 1HQRB 3ULUC 3TNNA 5CHNA 1N0XL 5CLWA 5I66B 5FYLL 1O7DC 5J5EA 3HPLB 3O6KL 4JY6B 3H2PA 3CVCA 4APQA 4IBUA 3MA7A 3U7WH 2AW2A 1T83C 4ODVH 2DQFA 4QR7A 1JS4A 4H2CA 4JMXA 2EXYD 5IB2B 4J3WA 4P23C 2Y25A 3O2DH 3NJXA 4FEIA 4WAFA 4IW4C 1ZLVK 3BXNA 1HEHC 4FXKC 4LHUA 1S8DA 3QZWA 2GJPA 2R29H 2F2HA 1CLYH 3T6ZA 4YHZH 1OPGL 2NY7L 4YXLH 2HKFL 1LK2A 2GTWB 5DHYB 4HXBH 4GXUM 4X4XB 1JYWA 2GUOA 4B9YA 1Q9OA 2LR4A 1FGVH 2F5AL 4RAUB 5ERWB 5D4HA 5EV7A 5T5NG 4Z23A 1SEBA 4B7LA 1WZ1H 2WJ7A 1UJ3C 1ZS2A 4PJ5D 4W9JC 1KJ2H 5D1ZA 3G6DL 1WS7A 4R96B 3T65B 3UTZB 5JHLH 5E94A 1MJ8H 2BIIA 2OP4L 2XLLA 4OFDA 4R4FH 3ZTNL 3P77B 2ZWNA 4YFEA 1AZRA 3VB9A 3UYRL 3T8XA 4Z7NE 5F7WC 1HI6B 3GSUA 1KY7A 4F92B 4OGXH 4HUXA 4Y5YA 4M8QA 4AYEC 3KGRA 2IGLA 2X2IA 3LY6A 2C8NA 5CWSA 2FYVA 4MRCA 1SPDA 1FFPB 4WEBH 4UOJA 1DJWA 5JNYB 3KXFB 4I18A 3S88H 3D39E 3KLQA 1FUNA 5GZNA 4QXWA 3DX0A 1XH3B 1OOWA 1R47A 3ARXA 8FABA 2RQEA 3U6XA 2CSPA 1YECL 1E90A 4HT1L 4UM9A 3W9EA 1YUKB 5EZJA 4BDVB 2FLBT 1I7TB 3RQ3A 2VABB 2A9AA 2JMRA 4Y19E 1JF6A 3SDXF 4ZQTA 3P9WB 1CDHA 4XMKL 3TYGH 4J28A 1OGAD 3ZYJA 4K3GA 2OI9C 2AJYH 3HE6A 1CLOL 1W0WB 3V6ZA 1X9RA 3S36H 2AJUL 3PABA 2WBJD 4XO3A 3I9IA 1LDSA 4M7LT 1ZSDA 5C9JA 1WV7T 4GRWB 4Q9QL 1TO5A 2HVKB 2PWFA 4LARH 4N8CH 2FWOB 3CHOA 3MUUA 1TO4A 4NOBA 4X5XB 4H20H 2EEFA 5GRVK 1AD9B 4ICWA 3TBBA 1JWSB 2Q86A 1BQHG 3CFKA 4WWKA 5TDNA 1DQLH 2E7MA 4PW4A 3G5XA 1XIWC 2HVJA 2GCYB 2GW5A 4LZKA 4RESB 2A38A 2AXWA 4U1SA 2ADFL 3F6IA 3C6LB 3BO8B 5GRJH 3L3JB 3ZOAA 3HHMA 2F1BA 1SYVA 2ED7A 3W57A 4K71C 2Y5QA 4ZPVB 3S4SG 1FYHB 3HZVB 3MXVL 4LDEB 4BFRA 1IEAA 1LE5A 1FORL 1I1AD 4XMVA 4QHMB 3SDAD 1LK3H 2EYTA 1OSZA 4JO1H 2ZX5A 2XPGB 4P48A 1D2PA 1CICC 4HQQL 4JK0D 2LVEA 1NGXA 5DQJA 4PJ5E 2JCWA 4QUOA 4XMXA 2Y5EA 3PWUA 5F21B 5CBEB 1I3UA 4OCXH 4NUPA 5DD5H 5B4MD 2Y7SA 3TA3C 1MRCH 4MD0A 3MR9A 3S8GB 4FHJA 3O6LH 3TV8A 1LEKA 4K2UL 2CR0A 2QT6A 3VFTB 1UCBL 5IIEB 1QI3A 4OJEH 5KBMA 3QHZH 4OLWL 4IBVA 1TETL 4HUKB 2A74C 2EYRB 4KXDA 4LGSB 1ZA3A 1PKQB 4QTHB 5J0BA 4HP5A 3EBIA 3V9CA 3DI3B 5BS0B 5K1VA 1IGTB 1E5UI 1BJ8A 3N9GH 3PREA 3ZMNA 4PJ7A 5AZ2L 4B95C 3OR7A 2P8PA 1OE3A 2C7UB 1BD2D 1FNEA 4GUPA 4J6RL 1T0MB 1JPGA 4EIGB 1WAAF 3BAKA 4F24A 5IV2A 3T4AA 1IM9B 1AFVH 5EIVA 4X6FA 1MFCL 3BEWB 4YDLB 5CUSL 4TF4A 1INEL 2Y6TE 2IDSA 3Q2VA 3IPFA 4D8PB 1OCWH 5EEUA 1OGAE 3VXSA 4L5FE 3ESVF 2EVFA 4IOFD 4ZNCD 3KVPA 1D3CA 4Z95H 1MCIA 1ZLVH 5FOBB 4MMZA 1FNHA 3JWNH 5INCB 3AT9A 3EGXA 1S7QB 4XNUH 4YN3A 3NABH 2NXZB 2VWEE 3LRSB 4EIBA 3UDWC 1FZMB 4ONOA 5I1AB 4NP9A 4MCYB 3ZTEA 1KGCD 1ZCRA 2VITA 1CB4A 1RERA 4K5OA 3RVVD 3ULSB 4JCMA 3DROB 4JN2B 1GOGA 3MLVL 4OZIA 3SGJA 4N3TA 4S1SL 3SJVB 3K71B 1F6LL 5EFIA 1YEKH 4N8VB 5C3IA 4ALAC 15C8L 1JRHH 4TTDD 3PWPB 5IT2L 4KPHH 3FUKA 1A1NB 3CQFA 3FTZA 4NBZB 4Y4FA 4XWGH 2C9UA 5A43C 3CX5J 3GRWA 3BQVA 1LEIB 3MOBH 1HH9B 3V0WH 1BM3L 4PLOB 5D2LB 2EZ0D 5KVFL 4GG8B 4N8UA 3T3PB 1OAXH 4NQSA 4LVOB 3BQUC 2G5RA 4X7FC 2BP8A 3OXRA 3ROLA 3EJYC 4Q0XL 5L2KB 5D1QB 4YK4B 2EE0A 3IETB 2HG5B 2UWEA 1NAMA 2MHAB 3QIWC 1QSEA 4HLJA 3SBWA 4CGUB 1DEEA 4ZAKC 4DP2X 4HWZA 1X9QA 1K72A 2D4FA 4TRPH 5EA0H 3OC8A 2DQ6A 4NNXB 1SUHA 2L7EA 4NN6B 5T1LA 2YA1A 2CZNA 3L7EB 1G7IA 3NQIA 3WEAA 3IJYA 3LZPA 3QJOA 2K70A 5AOIA 2XIBA 3RY6A 4AOFA 2HLAB 1N18A 4UOZA 4YHOH 2WVUA 1W0VB 3FPXA 3IKCA 4Y4KA 3WLWC 4H8QA 5KYXA 1ZPUA 3QJZA 2VAAB 4JDTH 1JGUH 4M6NH 4PGEA 4P3DB 2ICWI 2QQLH 3AG3B 3IDIA 1MCOH 3Q01A 4OT1L 1XCXA 1NBVH 4EUPA 2HJFA 2PO6B 1TSHA 2CDFA 3GUTA 3KYKL 2ZKWA 4HC1H 4P9HH 2VZOA 1IAKA 4AL8C 1ZVHA 3JWDH 3MBEC 5J11C 2WB1A 3EF4A 1BD2E 4I88A 4DK3A 4CC0A 4HWBH 3IMBA 4ZRGA 5T1KA 1UA7A 2WLLB 1GGBH 2PXYB 1Q4NX 4FADA 2ZSWB 1NMCC 3IJEA 2GITA 5DK3A 5C86A 2WP3T 3A23A 4HK3N 3VWKC 1M7IA 4ZS7H 5D7LA 1PZUB 3KYAA 4I5BB 5FUCE 5IEHB 1GXEA 2F61A 1FL5A 4H26B 1A6UL 4M3HA 2VRKA 5E8OB 2BMKA 1N7MH 1FA4A 4XC1L 5IMLA 5CEXB 2MH4A 2IDFA 5D1XB 4JFDB 1HINH 5AW4B 1BZ7A 4BZ2H 4F2MB 4YEFA 3N42B 4XOBA 2WO2B 2Y7MA 3QI9A 4YDJB 1KGCE 5IHHA 4JO5A 4WO4B 5F9OH 4MCZB 2Z65C 5BOJA 3F3HA 4G8GA 4NQEB 4LCWA 2R1YA 3PXLA 1KCUL 4PH8A 1P5UC 1G6RL 4HJ0C 1ZRUA 5IROD 4G6ML 4MS8C 1BW8A 3FOLA 3KXFD 1K6QH 1YNKL 2FJGA 3T4YA 3DO7B 3STZA 1L4IA 3FTUA 4OLZL 4BGDA 4PG9B 3TH2T 3C9NA 3K0YA 3WUWG 3HAEA 1E6OL 4BFBD 3OB0K 5GJTL 2YJQA 1AXIB 4I7ZC 3NBNA 5FYLD 3OZLA 3IXAB 3V6FB 3CLFH 5E6IB 3ARBA 4PG2A 4AZ8A 2UX7A 1G1KA 1M71B 2GY5A 2OMUB 4H8HA 4QPEA 1GC1L 2OJEB 2VLKB 4JLRA 1JZIA 5AYQA 3CFJB 4IMLA 2BNQA 2X7LB 4LGRB 3LSOB 5DURB 1CFQA 3QAQA 4CU6A 3OF6D 2E6PA 5F72S 4I2XA 1HOCB 4JDZB 1ETB1 1OW0A 5KTEH 1AHMA 1EXGA 1PG7L 1MRFL 4U1NB 3WFCL 2Z64C 3BVXA 2DY2A 4H13C 5IQ7H 4F33A 1CFSB 2V5MA 5DJXA 4GRLB 1F11A 3I6GB 1CDGA 3QJXA 3D25B 3IBOA 2MPVA 4FFVC 4HWEL 2X1XR 3ZT6A 3C6LD 1HXYB 1S9YA 3B5TA 4YSUA 3TP4A 3JTTA 1F1DA 5KYNA 1S7TA 1KTDA 5IR1B 1INDH 5M94B 4JFHD 2K0RA 3ARPA 3O3EB 3FTVA 3HRPA 2BY3A 3ARDA 2IG2H 2QJDA 3HG5A 1F4YH 1U8NA 3PWJB 2Z1KA 5SWSB 5JW3H 4GQ9H 4UM8A 2XVLA 2GIMA 4PRIA 5TH2A 5CZVL 2H3NB 2ZOOA 1W16A 3LZNA 3DVIA 2NYZA 4P05A 4GMSL 2OZ4H 4CILA 4RIRA 3PJSA 2I9TB 3P4NA 1G6RB 4L9LB 1NDMA 4LBAA 4XPBL 2FL5A 1FG2A 3K80A 5AVWB 2OS7A 4K7FB 3C8DA 2R4RL 1I9RH 2ATKB 2O5NA 4G9FB 1DDHA 1MELA 5IHUH 2I60L 4U1KB 4PSRA 1I7RA 2AFNA 1G7HA 1HSBA 2W92A 3QT2A 1J05B 4POZC 3CJJA 5BS0D 1F3RB 4IS6A 2QQKH 4FX5A 3KXFE 2C3VB 4G42B 4L1DA 1KIPB 4NCC1 4X80H 5I1KH 1D5BA 4HFUL 2QPDB 2DEYX 4M6OH 1ORSB 4U7SA 3WFBL 1IM9D 1WQVT 2FQGA 3O2VL 3HS0A 4JRLA 5FYLE 3VRLF 3IF1A 3TTSA 1ZHLB 1X7SA 4F15C 4XZUB 3RGVC 4ENEC 9CGTA 2XX1A 3O8XB 3QFJB 4R0LB 4JHBA 1SOQA 1EXUA 5EN2B 4CRPA 1AI1H 2EDBA 1PL3A 5DHXB 4JNXA 3GNML 2IBBA 1A4JA 2XC8A 3QIUA 1T5XA 2AJZB 2V7HB 3INOA 3PNRB 4GRWE 4XI5C 3VD5A 5IOPA 1MXGA 2NXZD 3U9PH 3U4EB 3V5DA 1PLAA 4LEOB 2JIXA 1SQ2N 1TPXC 1GIGH 1TVHA 4HH8A 1T0NB 1NAKL 4QXUL 1CLZH 2FX9L 2MCPH 2X12A 4GAJH 3NCXA 4R83A 2NLJB 3SJVD 2IPUG 1I7UA 1KCRH 1U8LA 1BFVL 1RJZB 3E3QE 3L4XA 2BSTB 5DZJA 3PWPD 3EHBC 2A9CA 2XWTB 5DJAA 4PJCF 4NIYE 1PSKL 5ADPH 1AO7B 1OD9A 1TU2A 5LDSA 2QLVB 1OXYA 1U2YA 4V2CB 5D70H 3VB8A 3LD8C 2X4RB 2Y1AA 3RPIB 3GMMB 5I15L 4JFHE 4KQ3L 1MHEB 4W1TA 3WN6A 5L2KD 3F00A 3JSSA 5D1QD 5FDYA 4HEPG 3D8MA 2W0PA 3QEUB 3FU9A 2VXVL 1E8ZA 1I85C 5HSFA 2XWRA 3ARRA 3DVNB 3GSWB 1S3KH 4B97A 5IB3B 2VDPB 4HYTB 4ELKA 3EUUA 3QUYA 3ZGHA 2RGSA 4OVVA 2BZCA 1WYJA 1RJYB 5GRUL 4DUVA 4ODTL 2Y5TB 1HQ4A 2B0SH 3TONA 1TZ8A 3QXTA 3LKQA 1G9NC 1R3KB 4FD0A 2RCSH 4DW2L 2YRBA 1MI5B 3HOGA 1ILUA 1E8XA 3OB0H 3GMOA 4X6DB 5C08B 2BIMA 1P1VA 4CU8A 3DLQR 4F5CE 2ZE0A 2ARJQ 3KZ8A 3CN2A 4KOBA 3EKCA 5C0JB 1PKQE 3CBRA 1CN4A 2PO6D 1TZOA 1C5CL 4PB9L 3T6WA 5C6PB 5BS0E 1X5ZA 3ARFB 3W39A 1GMIA 4X99A 4D9LH 3QO0A 4JRYB 4KRPC 3MLWL 4LNVA 4LSUH 5T33L 1YJDL 2PXYD 3B34A 2XFXA 3ILEA 3NFSL 4MXQC 3MKGA 2BVOB 2J88L 3O3DA 1CGUA 1KIRA 1AYRA 3HZYA 4K9EL 1H3UA 3PNWA 4JL1A 5D2NC 5F7AA 5BV7H 4WENB 3NCCB 1T3FB 3KWTA 4OLYH 1UT1A 1KJVA 4KUCF 3ROOB 1AZVA 2OMVB 4M48L 4PRAB 5EBMB 4HW6A 5E2UH 1QLFB 4NUJA 3VXNB 5JPMB 4ZMYA 4XPFL 3QP3A 1YY9C 1E3XA 1LP9A 4XVSL 2AQ3A 1OAKH 5D1XD 4JFDD 1GRWA 2CE6A 1K8IA 3GHBL 3NEXA 4I4WB 4YHYB 3MUHL 3TV3H 3FXIC 5DD0H 1OTUD 2OMZB 2IANB 3D12B 2FRGP 1PS3A 1VADA 4JCWA 5F7EL 4WO4D 1C5BL 1IBGL 5DRNB 2AMGA 3SE4A 3SJVE 4A2HA 3CX2A 4NQED 1HWHB 2NTFA 4ZUSA 4NUGL 1EVUA 2B1AL 4UT6L 4I0PB 2IDUA 1LL1A 4AJVA 1IAII 3C5SB 4O00A 3PWPE 4F3FA 2V2WB 3W11D 4UQ2B 1AGEA 4W9KC 1A3QA 4AYSA 4N8VG 2YOAA 3G5YB 1OQOA 1NDTA 5D2LE 4A37A 3T3PE 4E36A 4U6VL 5KJRL 4O9HL 2HLFD 4JO2H 4HZ1A 1KN2L 1XGRA 3LQAL 4TNVF 2JTYA 3G6AA 3KM2A 1OHZA 1G7JB 5E6ID 3M1BB 5BXFB 5L2KE 3ABZA 5D1QE 5DT1H 4CKVX 5E03A 1YPZA 4ELMF 2F7IA 4FLHA 1E4XL 1Y6NR 1E9PB 1DQJB 3M86A 3E1F1 5F0LB 1G9MH 1FH5L 4RFOL 2VB5A 4LSSL 5DURD 1BREA 1RVFL 4AV4A 5D7IB 1F8TL 1UWFA 1R5WA 5D6CA 4ZTOL 1U93B 1L6ZA 2XWJB 4YHNA 3SE3A 3WNLA 3DHJA 1MFAL 1NCWH 5I8OL 4X8JB 2VDQH 5D5MF 1P69B 1IGML 3DUSB 3ETSA 3S3PA 1OAQL 4F20A 1RZIA 4U1IA 1BOGA 1UM5H 5CIPH 3VX0A 3ZW3A 2BC4B 3CBKB 4GRLD 2JFCA 1KGWA 3CWGA 4LHJB 3QUMH 3QJHA 3Q2CA 1CFBA 3ASNB 2F8OA 1M2VA 2V3DA 2WXLA 5IB5B 4EI6B 1ZD6A 1PYWA 3TPUA 3F7YB 1I1AC 3V4PL 4I0KA 3SDAC 3LN5B 1NCUA 2OFQA 1T5WB 1C7SA 3UFIA 4AMKH 3H7BA 1PLBA 3UIZA 2EO1A 1FZOA 3R4DA 1I1FB 1V05A 5C7XH 4XE0A 5C3TA 3O45B 4Y16C 2AXHA 4JO3H 4BSVB 5SWSD 1L7IH 5E5UB 2IGFH 3B2MA 2AV7B 2H26B 4JJHA 1NQBA 2ZT9C 4BK8A 4M00A 4PJIF 5K9OA 4EI5B 4AGNA 4BWUA 4RA3A 1YYLL 1D5IL 4ANUA 4ZZKA 2UYLB 2ZXAA 3IJHA 1L9PA 5I8EB 4OZ4A 3Q5OA 5D1XE 4JFDE 4M43H 4XVJL 3RVWD 4F2ME 5C0CA 5KVDL 2VMDA 1U8CB 4M5ZL 2JVUA 5DDHA 4G9FD 2WZ0A 5AKVA 1T6WA 3R1GL 1ULVA 4NQEE 5AG8A 1M2OA 4IBQA 2VSKB 1QRNA 5GZOD 3L7FB 3DGGB 3BYTA 3D18B 4Z78A 1UEMA 5ABDE 1UVQA 3MHZA 4KHXL 3T2PA 1XGYH 3US0A 4PVNA 1YEEH 4PAZA 3TNMA 4K3DL 2IXQB 4QNPE 3VH8A 5EUOA 1JK8A 4WWPA 2V2XA 4A6YH 4NJ9H 2B1OA 2DPKA 1QTPA 3HI5H 2NSXA 3V2AR 1PX8A 1ROWA 2GIYA 4LPYA 3CIAA 1R0AH 1SLWA 1CGXA 3QFJD 5TQ2H 4EIUA 5LGHH 2ICES 2VLKE 1A02N 5LNEA 3Q2WA 3FSOA 3DUHA 5D72H 5JIKA 1WUNT 1OCZB 4FNLL 2PTTB 5IJDC 4WLCA 1GKEA 1U91A 4N9GA 3IJ7A 5KANI 1QFUL 3V4PB 3DETD 4TTDC 3APCA 3O0RH 4HIQA 4NZRH 5E6ZA 3TASA 1XXDC 5HI4D 3GBEA 4U1HB 4XC3H 2OJZH 5EEYA 1DVFC 4NZUL 1CI3M 2B4CH 1LO4L 2Y6SC 5IB1B 3OGCA 1YC8A 4IKJA 5DTFB 3SGDH 1INQA 3WFEH 1A6VL 1AO7D 1TCRB 2D3JA 1Z9PA 3DBSA 5GGQL 4I9WD 5K69A 4M4PA 1EFQA 1BGXH 1UWGH 2HH0L 3ULVL 2IBGA 4AUUA 2DQHH 4ZFZA 4RMRA 1VFMA 4L37B 5IHBA 4KNSA 2BW5A 5TD4A 1TJHL 3G3LA 4Y5VC 5SWSE 2BRQA 4XP5H 4XNYL 2AITA 2V17H 1KXHA 1D9KA 1TZIB 1RULL 1E9QB 2JB5L 2XJKA 1YDPA 2FJFB 3LQZA 1YHPA 4H5SA 3FB6A 4JPVH 1BBJB 3FU8A 4OY9A 3D51A 2JWYA 5E8NB 2MCMA 1OP3K 5GGVL 2PYEA 3N43F 4PV8B 1MCSA 1X6LA 5DS1A 5DYFA 2W9DL 3OMZA 4OJYA 4KRMB 2PCFA 1YMHB 1MI5D 1RUQL 4WK4B 4X9HA 3OKKB 5DQ9B 1SYSA 4JMNA 2VJ8A 5C08D 5FM5O 2IH1A 4G9FE 4AXWB 4YHKL 3BUBA 3NCWA 4UQAA 1YYCA 4PTUB 4KROC 3S5LA 3JYCA 5CGBA 2WKLA 5TF1L 2I5YH 2EECA 1YEIL 1S7SB 2HRGA 3L17A 4BZYA 1JHTB 2OTWB 3ARFD 3RZWA 2W9EH 4JRYD 1B0RA 3TZVA 3ZDYB 1B0WA 3V4VB 3VFWB 1FFQA 1BYNA 2WO3B 1QYGH 3BE1L 2Q76B 4MHHG 2AV1B 1C7TA 3HMXH 4IDJL 1EHXA 5J12B 4PJ7F 3T0EB 2B14A 5JMOC 4NENB 2NY1B 1ES0A 1MWOA 4R8WL 3S34H 1G4MA 3QFJE 4PJ8B 5EF3A 2L3BA 1KYFA 3QEHB 5DUJA 1E5ZA 2J57A 1IFRA 4PFEA 5EOCJ 1AJ7L 3ARQA 3BDYH 3V10A 1VGKA 5CLYA 1QWNA 5SWQA 3WS3B 3P0YH 5IVXA 2W95A 2C3HA 2E0PA 2B20A 2IAND 4OF7A 3ZE0F 2NUTB 3P69A 1QLEL 3MN8A 4CAGA 4Y89A 1MAMH 5L4FA 1U42A 4WQOA 2D9CA 4XXDA 1KBGL 2HRPL 4LL9A 5I1JL 4YXHL 4Y1SA 4I0PD 1C08A 4LCVA 2YAFA 3EGDB 4WJ5B 3ZKNC 3WIFA 5E95B 3ZMEA 1MCRA 1G7QB 4OZIF 2HJKB 1AO7E 3N0AA 4WU5B 3EDJA 5I1GL 4DZ8A 3UYPA 4I9WE 4XPTH 4JG0L 2VR6A 5EF1A 1R17A 4TQEH 1F3JB 5JORA 2BS71 3FU7A 3O0LA 4JFZH 3TJHD 4UQEA 1F4WH 4DGUA 2DDQL 2LAAA 1NCIA 1CD8A 1JZHA 3BSZH 2H9GA 1LNUB 3E6FA 3NQKA 3P9MB 5HJDA 5TGBA 2WZ6A 3QDJB 4JUSA 5EG6C 5L2JB 2BIHA 3NDZE 3ZRFC 4OZFA 5JOEA 3ECBA 4LMQE 3FAXA 4TNWF 3S9DB 5EU4A 3LPWA 2XYBA 4WFFD 1MHHB 5A7BA 1UXLA 3GS4A 4KV5F 3ZHFA 1JZEA 4XN8A 4QRRA 4LQ1A 3N1MC 3WOVA 3NDYE 3UG5A 5EPMB 3LRGA 2XKUA 2WIIB 3MREA 4ZW6A 4K5NA 4KTEH 5F9JA 1XEDA 3WHXB 3DARA 1MI5E 3MLZH 4TUOA 1H3XA 4LU5L 3KPNB 4X6DE 3MMEA 5C08E 5I1HH 1WT5C 1XR9A 2QGEA 2YEVB 3TEXA 4UIKL 1DYZA 2GJZB 3BHBB 1QOKA 2G9KA 5LCVA 4X4YA 3BN9D 1I3RB 3GHEH 3J7HA 4P3CL 2ZUXA 4PUBH 1WDAA 2WYTA 3F7PC 4N8PA 4JRYE 5EZOH 1OM9A 4OBSA 4NJAH 1J48A 4ETQA 1CXIA 5CGYD 4GXVH 2ADIB 5IGXH 3QDHA 5AVRB 1W0YT 2ZUQC 4WI0A 3T0XA 3H4HA 4JFFB 4YDIL 2K7QA 4A7UA 3O41A 2CJSA 3TO4B 4MSWA 3JTSA 4Y9BA 5ACLA 4F8OA 4OSUH 3A6CL 4C8XA 2W0KA 1XSKA 4ZFQA 4IRZL 2CD0A 2VDKH 1MCPL 3PUCA 5GGTA 3SPVA 3PWNA 1MLBA 4N9OB 5F7FA 4UILH 1M7XA 4EI5D 2CLRB 1FE8H 2NPLX 3APDA 2C9PA 3BUQA 3PL6C 4NQTA 3MRHB 1HE7A 3F7VA 3MV7B 4JFUA 5IESL 2M2DA 4Q6IB 5J9PA 4I77L 2AVFA 1S3RA 4OJAA 1XF2B 4NQUA 3NGBC 1HHIB 4J3BA 2IANE 1ADQL 2PKDA 2XWZA 1BZQK 1GZPB 2GY7B 3AQXA 3G7TA 5FYJD 5L9DH 1P6FA 4BWWA 1MG3C 4RMQA 2O5YH 2OYLA 4EDXB 5DHVB 5GGSA 2EIBA 1XF5B 5JMRA 3K8LA 5DJCA 3IN2A 3BKCL 2AJ3A 2DLHA 2R69A 4MD4A 3PGFH 2VMCA 5AVQB 3ALWA 3RNQB 2NZIA 2D3VA 5DYOA 2E27H 3EYQC 5F1IB 4WNJA 5A2AA 4TQHA 3HZ3A 3KL5A 4RAHA 5GRYA 1S5IH 4Z7AA 2UV3A 1BVKA 4RDQG 1DJXA 1OP3H 3WE6B 1CDJA 1T0PB 3L4UA 5FM8A 1QABA 3P40A 2R2BA 4Y4HA 3K91A 4XMWA 3X1GA 1WUZA 3BESR 2NXZC 2XFGB 1G1YA 3CHQA 3FT4A 4YNYB 2QVMA 1ED3A 1I9IH 1MFEL 2VL5A 3RGHA 4G80A 1IGJB 3D30A 4WFFE 5HDBF 4HJIA 4QRUB 4YQXH 5D7IE 2NDGA 1E2ZA 2IVFC 5F3BA 3HC4H 5FEBA 1R3LB 4TUKH 1UG9A 4YMPA 3WCYA 3DRTB 2CBMA 2JNZA 4X5RA 3OJDB 3IFOB 4OAWB 1KULA 4LEEA 3LKPB 4XP4H 1FSKB 2I07A 2VR8A 2VR5A 1CUOA 4UDUB 1XF4B 1N6VA 1QR1B 3ARYA 3LB6C 4JPWL 4YK4C 3CFBB 4OLEA 3D2TA 5I16A 4W9IC 5F96H 2OULB 2H0PA 4MXWH 1L7TL 4HS6B 4OQ1A 5K39A 2JKRM 5CKAA 4HPYL 2OW7A 1HKFA 5DJ0B 5JDSA 3KPSA 3VACA 3VXMB 3HC2A 3C6SA 4O02H 1GCFA 2NQDA 5LN8A 1FNGB 1EEYB 3SOBL 2BH0A 2X6CA 3QQ4A 3VQMA 5CGMA 3OAWA 4RISH 3QIBC 1EJOH 1HSAB 1UJTA 4OKVB 4XBEL 1KBWA 2PO6C 2JE8A 2V2TA 2HJLB 1N4XL 5DJZA 5DD3H 3PRZA 4NCDA 1J9QA 4PP2B 5FYJE 2XQYA 2OXHB 5HDQH 3WNOA 1DUZB 2FNBA 3TYFA 4G8AC 4XH2B 3K6SB 2CKBL 1RI8A 4RGNB 2EEBA 4K8RL 3TCTA 1KJMB 4G5ZH 2QSCL 2Z91A 3QK0A 1RAMA 4RWYH 4XAWL 1OAUL 2CK2A 2VERN 2UXTA 2WXMA 2VDNL 1ZTMA 4PJDF 2JH2A 1JNJA 1R3JB 4NM4L 3PGCB 3HHRB 2ZOWA 1W72H 3T0ED 1GS6X 3FQWB 4LDOB 1QP1A 2NY1D 4GIOA 4UTAL 1F4XH 2YKLL 4UQ9A 5FF6B 3U30C 4A7TA 1DL7H 3X3GH 4JGNA 3EJPA 4PJ8D 5HDOA 2XDHA 4XNZC 2X89D 1DANU 4L29A 3SO3B 4MB4A 1KT2A 4LCCB 4XBPA 2HN7B 4DKAA 5BCAA 1FAIL 3MV11 1IQWL 1MWAH 3ILPB 1E28B 4ZUUA 4BFFA 5B8CB 2CM6A 3MOQA 4KKBD 4AW4A 3NRPA 3FT2B 2ZJSL 4P57A 3U36A 3QYMA 3W11C 1S7WA 3Q5TA 2VXQA 4JZNA 5TK4A 3ULVD 2NNAA 2YBRA 4ZSOB 2QSTA 1YEHH 2FIRT 4HLZH 43CAA 5C2BH 1OE1A 2VUKA 1Z6JT 3DURA 3L5XH 3BRDA 3AREC 4N25A 3SDXB 2OL3L 4CVZA 2C3XA 3J8F7 2ENPA 5HHNA 1ZTXL 4TV3A 4Y2DA 4PEEA 5GGRY 2P8LB 3PHOA 2DQUH 3O2WL 4GKNA 2ERJB 3IRZA 3VJ6A 4GO8A 1BZOA 2CLVB 1SJHB 3NSJA 4P5TC 1A7NL 4XVUC 4IHOB 3DPBA 3QDJD 1GTFA 2WQSA 2DJ4A 3HN5A 4FQXA 3T1WA 1JRHI 3P30L 3WEXA 5KVDE 4LIQH 2BSCA 1PJWA 4MNHA 2A6KB 3QS3A 5C8JB 1HYRC 2Y22A 4GBXC 4NERA 4OCRH 3DX8A 5I2IA 2Z4QA 4OM1L 1CZ8L 2ZXBA 1RJLA 2CKBB 1HHJA 4XN1A 2FIKA 3BAIA 2YPKA 3FTSA 3CSYB 3Q2NA 5J1SC 3IGFA 3GBDA 1BYOA 2OM5A 2HFEA 3HG4A 3QNXA 2D2CC 4HK0A 4NDMA 4UOW0 4XXWC 3WGVB 3LN4A 4LCIL 3TFBA 4H0IA 2YMXL 3F01A 1S2EA 3CVHB 3KDMB 3VG9B 5FA3B 5FA4B 3P73B 2OQJA 3CZLA 4OD3H 5D6DC 3BZ4A 5DMGC 5E8PB 3T2NL 5IHZA 4Z8FH 1X9LA 1NLBH 2XTJC 4OGAD 5HHOB 4TLUA 4J5VA 2DM3A 3C60D 1ET5A 3ZDYE 4F80A 3QWOB 3L1GA 2DLGA 1T2QH 2XKNA 5F1NB 5IREA 2EEAA 3E0GA 4JFFD 1KTJA 2ICWB 1OV8A 3BRFA 3B1UA 1GAFH 5FUOH 3TO4D 3AACA 3T0EE 2FO1A 3WMQA 1M9WA 1XH2A 3CH8A 1DUYB 2P24A 5HGAB 4NRXA 5FXCH 1UXWB 4E9YA 3I84A 1QFWH 4FXTA 2BZDA 1KB9K 3V8CA 4G71B 3WAKA 3RWIB 3DVGA 2IV8A 5CZXD 4F8NA 3Q1SL 4XPGL 1T22A 4XZ4A 3VX1A 2GSIB 3G6JA 4MAYC 4GMTL 1A1MB 5IBUB 1FNSH 2GI7A 3BKJH 5E1AB 2FT6A 2JCCF 1MY5A 1FO0B 2GTZB 2XPZA 4NFDA 4G3YH 2QHRL 2OL3B 3HUJF 2KBGA 3MV9A 1LP9F 1GC1C 3DHMA 1LWJA 2BXZA 3QULA 3O4OC 3ULVE 2EYSA 1Q1JL 2HTLC 1G7MB 2DQEL 2X4NB 4PRNA 5ESVA 1BQHA 1MCWM 4ADGA 3QC6X 3WY1A 4CVWA 4ABQA 3INUH 1KFAL 1U8KA 1E6JL 2CMRH 4MAUH 2R27A 2DB8A 3GXMA 1SDDB 4Z0XB 4XBMA 3O8XC 4BZ1H 3KLAB 1EGJL 2QQNL 5DZOA 1NCCL 2WCPA 4S0TD 3S4SA 3FZUC 2C7FA 3RBSA 1FRGH 5MENB 4UUJA 1CR9L 3QDJE 4ONFL 4ZJ9A 3I2CL 4GAGL 3SPJA 5SX4H 1K8DA 2F54B 1FAKT 1IKFH 2C5DC 4XP9H 1QMUA 5F8QC 5A2KH 2ZXQA 3MGOA 1GPOH 3WN5B 1S7VB 3E6HA 3FO2A 2JB6B 5E5RB 3IGAA 1T1WA 3KPMB 5LO7A 1YNTF 4C83B 2DBJA 1QTYT 1U4FA 1GGCH 4PJ5A 2ZYIA 3NZHL 3SQBA 1RHFA 2XQBH 3QUHA 2KYIA 4NWTH 1U8MB 3D2UB 4U1LB 1RZFH 4FFYA 5DJ6A 5I76B 2IDTA 5I0XA 4KKLC 5EO0B 2LU3A 3LCYA 4ONGL 1HYSC 4E9XA 2AJVL 2BK8A 2AQRA 1ZDQA 4XN9A 5EIIA 5ADOH 3UJIH 3CMOH 1QEWB 1EFXB 1OARL 2ENSA 1CL7H 5PAZA 1MREH 5DFVD 4J4PC 1A6AA 4KK6D 3VXMD 4JFFE 4PLKD <