1WHOA

Allergen phl p 2
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
94
structure length
94
Chain Sequence
VPKVTFTVEKGSNEKHLAVLVKYEGDTMAEVELREHGSDEWVAMTKGEGGVWTFDSEEPLQGPFNFRFLTEKGMKNVFDDVVPEKYTIGATYAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Phl P 2, a Major Timothy Grass (Phleum Pratense) Pollen Allergen
rcsb
source organism Phleum pratense
molecule tags Allergen
molecule keywords ALLERGEN PHL P 2
total genus 18
structure length 94
sequence length 94
ec nomenclature
pdb deposition date 1997-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01357 Pollen_allerg_1 Pollen allergen
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.760 Mainly Beta Sandwich Immunoglobulin-like Expansin, cellulose-binding-like domain 1whoA00
3D30A 1N10A 1WHPA 3FT1A 1BMWA 2HCZX 4FG4A 2VXQA 3FT9A 4FG2A 4FFTA 2JNZA 4JJOA 4JCWA 2BH0A 4FERA 4L48A 4JS7A 1WHOA
chains in the Genus database with same CATH superfamily
5F9JA 1RJLA 2ARJQ 4NJAH 1WITA 4U31A 1D2PA 4FNLH 4G42B 1FE8L 1HQ4B 2AXGB 3BEVB 1CXFA 2I60H 3CX5K 1PGRB 3DGGB 3IAPA 4N9OB 3Q8FA 5FO9B 4AOFA 4C59B 2APSA 3QDMD 4XP6H 2PABA 2NY3D 1F13A 3S48A 3M17B 2J6EL 1DVTA 4J3OC 5I6LA 1KXQA 1CG9B 1GA2A 3G3LA 2BS71 4OD1H 1KJ2A 1ZTXH 2ICEC 1FV1B 2ZF9A 4TNWF 3DDGA 5A2LH 2Z7WA 2J72A 3DBXB 3ISWA 1BG1A 5E9DB 4LHUA 4PGCA 4XNXL 4ICWA 4IQHA 4GKNB 1QFPA 5EFIB 3VFWB 4GQQA 2AV1B 2QPSA 3S5YA 1G6RB 1NKGA 2WWKO 1CZ8H 1UUNA 1QNZL 1B2YA 2CNZA 3BPCB 2BNQB 3FUJA 4PJXB 1SY6H 4LVOC 1JV2B 2D31A 4WU5A 4Y2OB 3PWVB 1IUZA 4QHNA 3EO0B 1DN0A 8CGTA 1CLOH 1T0OA 3TF4A 5KBDA 3CZSA 1E2VA 1ORSB 4KKBD 2JIXD 5DMIH 4ZW3A 3RUGF 3WFBH 2HVKA 3PPSA 1U8OB 3OR7B 3DX2A 7FABH 3WFDH 4E41E 1Z9NA 3QUXA 3UERA 1C08B 3D0AA 3ARVA 2IGFH 4QHNB 3RPIA 1WFNA 5DQ9B 1HILB 1Q72L 3D69B 1XCQB 4ODUB 2A74B 5GZNC 2ZWSA 2O61B 1MJUH 3LNEA 1IBBA 4FFWC 5B38B 4NZDA 1BM7A 5J3HD 2LLLA 4GRWH 1ES0B 1PG7W 3AW5A 2WLYA 4KZEL 4HCIA 3VAEA 3OZ9H 1A6AA 4HWEH 2BXYA 1NCAH 4X4YB 1JP5A 4FFYH 3MJWA 3NCCB 1JPFA 4H13C 3VFRB 3SKJL 4DN3L 2VITA 4O00A 5C0RL 4G8EA 5DD3H 4YX2H 3LZQA 4AYDC 4ABQA 5B38A 4FXGA 4GYBA 3D6GA 1FAIH 2J55A 3OLDA 2XOTA 4I4WB 3ZYOA 4XPAH 4QHMA 3X1BA 1KY7A 2BOCB 4XH2B 4IKLA 4CMMB 2JKJA 2R51A 4JY5L 4AYID 4HJGA 2R69H 1T20B 1H3TA 1S7VA 4OZFH 4U33A 3SCMC 4BELD 3P0YH 4G9FD 2BFGA 5JOFA 2X0WA 4HALA 4MDJB 2BSEA 1SEQH 1H3XA 3QIBB 4L23A 3L3HA 2WVVA 1CGTA 4W81A 3ZYZA 3AREA 2EZ0C 3ILQD 1UWXK 5F1IB 3OXSA 2WIIB 3AG2B 4JG0H 3U0TB 2EDMA 1P2CB 4GAYA 3LCYA 1CFVL 5BZXA 5GS1B 4NQDD 4ELMF 1B6DA 3PGDB 1MLBB 2A77H 4G59C 2VDPH 4S1SL 4D0DA 2B1HH 3ARBA 1FG2A 2BNRD 2WVVB 2E7DA 4HWUA 4M1CD 3HEIB 1JGIA 2PPCA 3PPEA 4R2GD 2HTKC 4OGAD 2JCCB 1XMEB 3HAEG 1BECA 4LU5L 3ZX1A 3AFLA 1HJBC 3CFNA 3D39E 1IT9L 1E8ZA 5B39B 4XX5A 2VN4A 2Z8SA 1CL7L 4HH9B 5I0WA 5IESL 4HT1H 4ALAH 1JIBA 4IGBC 8FABA 1I8LA 4YX2L 3GSUB 1F4AA 2J5WA 3JV4A 4TUJB 3SDDA 4OF0A 3TPUB 5DK2B 4YE4H 3AADB 3MC0A 4FKKA 2BY2A 3TS8A 4FEMA 3QJOA 1WAEA 1ZEAH 4QRTB 1SN0A 1KJMB 2R69L 2KZ1B 4GJTB 1YAIA 5I17A 1U8MA 1BF5A 1M7DA 1NL0H 3SE9H 2HH0H 2W9DH 4GBXC 4ESKA 1Z9SA 1NLDH 3VXME 2VRQA 1CQKA 4JY6A 4Y7MA 1KYDA 1DVFA 2CDFB 4TF4A 1H6FA 1NQBA 2V7HB 1P4IL 5LNGA 5DD6B 1JHKL 4XOBA 1U8QA 5T3ZE 1Y1DA 4AYEC 1N4XL 1VGKA 4AGPA 3BHBB 2WLKA 4JM2B 4GPVA 3US0A 3H9SE 1SJMA 1SMAA 2VH5L 4X8JB 2ZCKL 2CQVA 5F7UA 3PHAA 2DWDA 1BJ1H 4HS3B 2KH2B 1N6QH 1UD5A 3ZY7A 2QVMA 4A7UA 1CB4A 5AW5B 3FS9A 1AIZA 2YS4A 3G6AB 2NY3B 2W9LA 3LSOB 1XL4A 4CAGA 2COVD 5IKCA 1T03L 5B1AB 1MREH 4X9BA 4EZJA 2NY6B 1I9IL 5D7JC 4LCYA 3UTTB 3BSHA 4N22A 5GRUL 4CKQA 2VDNL 3BUBA 1HXKA 1IKFL 4G72B 4EVNA 2EEXA 2FO1A 4RWYL 3S5LG 2CKBA 2G4GA 2N59A 2WSDA 3EYSH 1HHHA 1L6ZA 4UOZA 4LBAA 4B53A 1JN6B 3BQUA 5DS1A 4OZHF 2Q20A 5E2UH 4LOVA 3CCHA 2EIJB 4EIBA 5FM5M 3TIDB 4EUPH 3ZT5A 3SCMA 1R3IH 3F3HA 2PPEA 2ICWB 4BQ8A 3SQOH 3JXAA 4MCYB 3OR6B 2IGLA 1K85A 1AGDB 1AOHA 5FDWB 3WNMA 43CAA 3FB6B 3RBGA 1HH6A 2X42A 3WCYA 3MA7A 4WW2A 2BVQA 5FWRA 2BIOA 2DQ6A 2H32A 4BA0A 3KD4A 4AGQA 4ZMVA 1DVFB 2CDFA 1Q0XH 3UL4A 2O5ZL 1DE4A 1UYWL 5EU7C 1YYLL 3S35L 4K94H 4XN1A 4YHMH 1AG0A 4OCLC 3BPOB 3M1CA 1CT8A 2XN9E 3NQIA 3MGTA 3RNQA 1F6AA 3ZU8A 1HZKA 1FNEA 3MA9H 4TVPH 4YZFE 3SPHA 3QEQD 1A5FH 1JF1A 3FT0A 1B0WA 1IBZA 1MCBA 1HE7A 5TD4A 1KYAA 4BZ1A 5ADOH 4J3WA 4A7GA 2XPYA 1JNJA 2NXYC 4MD4B 4LDLB 3CFJA 1HTYA 4Q89A 5FCUL 3GM0A 3MDJA 2Q9OA 5K59F 2ZUVA 2CG9X 4J3OD 3RI5K 2WGNB 3F05A 3MYJB 2DYPB 2X6CA 3MCG1 5AVUB 1TEFA 5DMGD 1FZJB 2E8YA 3EHBB 1NBVH 1WQVT 1XR8A 1M1XA 4RFNC 2PETA 2A99A 4N2NA 5JQHC 4Y16A 3HR6A 1ZOXA 1S46A 4LKCB 1NOAA 3QFGA 1QEWA 1AQKH 4IU3B 4JFXA 4J3UA 4P2QB 3KW7A 5D7IE 2VQ1B 2WLIB 2DV6A 4IK6A 1I1CA 3GXUB 2OQJB 3MCLH 2ZSVA 1NFDE 5I6OA 1IEAB 1HEJC 1S78C 1UURA 2NQCA 1ID5I 4PV8A 1JPTH 1M2VB 1BGXH 5INCA 3UGEA 1ZJBA 2VO5A 1NCTA 2AGJL 2E27H 3O6MH 3IDIB 3HFMH 3QVAA 4XXWC 1N70A 1HHIA 3LH9A 1GZHA 4YPGB 1KJVB 2QQLL 3L9YA 1VKXB 4JFDE 2DL2A 4PLJC 3S3DB 3ALWA 4UINL 2Y24A 3VXSD 5IQ7L 3UBFA 2QEJA 3OKDA 5C3LD 3T2QA 1S3RA 4HUKB 5HJDA 4DP7X 3DHUA 3CGTA 1DANT 4Q9RL 2BSED 1GZPA 4HHGA 2DWSA 2E6JA 3GWJA 5E8DL 2ZKMX 3FB5B 1E8WA 3IT8D 5HSFA 2J1YA 4Z7AA 2X4QB 5AOLA 1ZHKA 2RACA 2W07B 4ZFZB 2V17H 3K3QA 3R1GL 4FOMA 3MBEC 4F7TB 5ISZD 3VD5A 5GRYA 1LK3H 2VAJA 4RQQA 4AK2A 4QRPB 1ZE3H 5TTRA 2YPLA 2VDLH 2NT1A 5DQJA 1J18A 4AQZA 4D9LH 4PRIB 3V52H 2JF1A 4UQ9A 3NZHH 1GAFL 1FVEA 1NEZG 4GRLC 2LR4A 4S0SD 1TVHA 4CSSA 5EF0A 1E8XA 2IBGA 2LVEA 4HS8H 3ZO0A 2HVKB 4F58H 2Z3FA 4MWFB 2FB4H 3ZE1E 3BUIA 4ZYKB 5EC2B 1Z2KA 3HUJF 1SDYA 3MXVL 1YMMA 5JW3H 5E24E 2YKKA 2O1AA 1DQTA 1M7XA 2FATH 5BV7B 3T4YB 3GO1L 2G60L 5EF1A 1V3LA 1K2DA 1OM9A 3DURB 1J48A 3CSFA 3N04A 4ICXA 4Z76A 3VGDA 1JGLL 4DERA 4QXUH 2EEFA 2EH7L 2X38A 3QWOB 4A38A 1EPFA 1G9NL 1XGUB 2AVGA 3NABH 4HETA 3CDZB 1VZIA 1LK2B 3VX0A 2DQIH 5LXGL 4ZMWA 4B6ZA 4L3CA 2XETA 3CZFB 5ANMB 4QRRA 4FCHA 4JFQA 2CO6B 5DJ6A 5JXEA 4OJCA 1INEH 3BKYH 3H53A 2YXWA 3KDMB 2P24A 4NNPH 5FCSH 4W9LC 5F21B 3ULUL 5GGTH 4GI6A 1NCDL 5F7WC 2LTQB 2WQVA 5B3JE 2EC9T 4NQSB 2WAQA 5HYJE 3L13A 3N85H 1BQRA 5J9PB 1ETA1 1P6FA 5AYTA 2HKHH 1JNHB 3OR7A 2I69A 3TJHD 4XGZA 4RAUB 5DS8A 4I2XB 3QCUH 1MZZA 3PWNB 3M45A 5IBUG 5JHDD 1OF0A 1TJHH 2OSLB 1HILA 4XHJD 1BVNT 1HQRA 3BH8A 4MKMA 4HJSA 2QMJA 2AMGA 3PL6B 2AK4B 5GS0C 2F53A 3NCYP 4JG5A 2BSTB 2FD6H 2W0FA 3KPMA 4N1CA 4OM0H 4U1IB 3MLZH 2MCG1 2CGZA 3QUXD 3WXVL 3MFFB 2XWJB 1Y1UA 4EOWH 5FB8A 1RZJH 1MHHB 3O0RH 4MJIB 1OKEA 3TCLA 3P40A 1A1NA 3MFGB 1VGKB 3ARGC 3KJ4B 2P5ED 4IOIA 5F9DC 2X4NB 3MJ6A 4I89A 4LF3B 2ADGA 4UT9A 4XHQA 2BSTA 3V5HA 2VLJB 4IEFB 3T8VA 1XIWD 1CDJA 1EXGA 1UM6H 2F0CA 5ANMA 2PN5A 2CHNA 2ZCHL 4PREB 4U2ZA 5L4IA 2DLIA 4WHYH 3VFTA 3EYOB 5FECB 4PEEA 1CXKA 4NPKA 3NBNA 4G82A 4JFYA 3ARRA 1JWMB 3KW8A 1QO3B 4X50A 5CMAB 5AL0A 2E9BA 2AQNA 1ZHNB 4FTVD 4QO1A 3MLVL 1PY4A 4ONFH 5J9PA 1MFUA 2JKRM 1KJ2B 4NQVB 5L0QC 1MCIA 5ADOL 4DN4L 4PU2A 5MERA 2CLZB 3JV6B 5DJCA 4CMHC 4X7TB 2WCGA 4C47A 4UT9H 4TV3A 2FIKB 2VLKA 1X9RA 1BX2B 3CZKA 1HSAA 2CJUH 1WZ1H 1LO2H 2R23B 1MHCA 3FONA 3G9AB 3IDXH 3ZE2F 2SODB 5CEZL 5KAQF 4CVUA 3ROOB 3S3SA 4AKQA 2YMOA 3BDXA 1DQIA 3K4DA 4L05A 5G5DB 3T2NL 1TUPA 5MENE 2OLDA 4V2CB 4XH2A 1QR1A 5I1AA 1DO6A 2OMVA 3ABKB 2VLKB 2FIKA 1GJUA 4HJIA 2WSKA 3RL2B 3C5JA 3JTBA 3OKKA 2K4WA 5E5LA 1B0GA 2CA3A 3CFQA 3MHZA 3P9WB 1T5XB 4MCZB 5F0MB 4FFZH 2LOEA 2AJXH 3P4MB 4MJ5B 3I9IA 1F41A 3FT4A 1I1YA 4DGVH 2WVUA 4EDXB 1N2RA 5B1CA 4CN1A 4LSTL 2WY3B 3QQ3B 2XG5A 4NKDA 4OF5A 1EJFA 2VR4A 1ZANH 3KYOA 2C4FU 1O7SA 1J1OH 3AXIA 3WGUB 2BHUA 4C54A 3I3BA 1QLEB 3F83A 2HT2C 3OKLA 4PRHE 3AS2A 5EO1B 4J4PD 3UYRH 3BZ4B 3LIUA 3MVSA 1G7QB 1NCWL 4E5XB 4PJ7B 3ZT6A 5AQ0A 5FLVA 5D7EA 1C5DB 1ZHNA 5DYOB 3THMH 1A6TA 3EJJX 3F7KA 1XGZA 3VXQB 2MH4A 1RCYA 4WNSA 1EJ8A 4L4VA 1RJYB 2OZ4H 5HI4D 1S9KC 4JO8A 3FSWA 4J8RB 4ABWA 4G43A 4Z95H 3GT6A 1UADC 3W0WD 4IU3A 4JFXB 4PYGA 1U8NB 1WLHA 4JY5H 3UTTE 2P8PB 1HDMA 3ZDXF 1T22A 1E4HA 2Z0BA 4P5KB 5IT2L 3VSTA 4OLYH 1TFHA 3FMGH 3KH3A 3QYNA 3N41F 6FABH 4WSJA 4J12A 4ODHH 3CZJA 4WGVB 5E70A 2BH0A 2LU5A 3H9HA 3GI8H 5SWZA 3VQMA 4GW5A 3BAEH 5LHDA 3P73B 3WDJA 5CSGA 1CGSH 1RMFL 3Q0HA 4UCFA 2Y7NA 4NN6C 1ZK5A 1ZLWH 4Q6YA 3SO3C 1E4JA 3FHEA 5E56A 3DRTA 4LSTH 1CGYA 5T3XL 1U93A 3ZR5A 5LGHH 5C0CA 1LLAA 5JO5A 4AYSA 1U2YA 1YUKB 3BLBA 1CFBA 2AK4D 4U6VL 2OZ4L 3MRKA 2H8PB 4FXGC 2IQAA 4IU2A 1MFMA 4PJIF 4OI9A 1ZIBA 3TO4B 3IJEB 4X6BB 2GSGA 4L18A 3E8UL 1XCTA 4ZMPA 3OMZA 1OEZW 1AKJD 3WSQL 4HIIB 1E4XH 3FQWB 2J1ZA 4ODVL 3FU6A 5J5EA 3REWA 3SZKC 5AZUA 1USZA 3GSUA 2DDQH 4ZUWB 5MEQA 2OA9A 3AJ7A 4ZS7H 4C58B 2G4EA 2YRZA 1U91B 3GHEH 1DBJL 2M1KA 4X99A 3SO3B 3CFJB 1INQA 3J07A 3KGUA 3I6KA 4XPBH 1IAII 4WW2F 4OIIH 2PYEB 4WY7H 3S37L 3K6DA 5I1KL 2YWYA 2Y5TA 1AY1H 1YEKH 4OD2A 5TK4A 2ATPB 3BN3B 5TPWH 2WXKA 3BVNB 3O0RL 3C09B 2OMYA 2EO1A 4HSCX 2F8IA 4K3JL 5D7IB 4N6RA 2OXHA 3RVTC 4AQEA 1NGXA 3GZQA 3PY9A 3RWEA 5T5NG 2A6KB 2EEDA 5KVDH 3UTQA 2JKXA 2DI7A 1YZZA 3RDTD 1Q1PA 5KEZA 3MRNB 5KYUA 1UA3A 2F15A 5GHWH 1KLGB 1KT2B 1SY6A 1R3JB 4L5FH 3MV7B 3OPZH 3OGOE 3RWDA 4PTTA 4RSYA 4TTGA 2BDNL 1C16A 2Q3AA 3C2SA 3NGBC 1MJ7H 1ZA3A 3LS5L 3QG7L 2C9SA 1YEGL 1DFBL 1NKRA 4MMXC 4Y2DB 1VCAA 4G70B 2J6EA 3D7PA 2WZ6A 2CM6A 4DKAA 2QV4A 4HUWB 3C6LD 1YEKL 2ICWI 4NQCD 5FYLH 1QVOB 1OP5K 3PDOB 4X2UA 4TYUA 3G5YA 1NINA 5AOIA 1N5AA 1BBJA 4FRWA 1DBJH 3UC0L 3BIKB 3MJ7A 4AQAB 3SDDC 4L4VE 4NDMB 4JL2A 1YN6B 5DC0A 2ZG2A 1QASA 3FN0H 3K0YA 1JK9B 1ZIAA 2VH5H 4PV8B 4R4FL 5DC4B 2D3NA 5C9JA 5AW7B 5KYNA 3C6SA 3FQRA 4FHKA 4FXTA 1Q0XL 2PCFB 1NGZA 2ZP0T 1LXMA 1E2ZA 4DGUA 4GMTH 3FQNB 5EEYA 4PRHA 3OLGA 2Y22A 3LH2L 1N7MH 4NBYB 4POZC 4RETB 1P7KB 2IBZX 3L8QA 1LD9B 3KLKA 2V2XB 2NW2A 2YWZA 4LGRB 3IGUA 4RISH 2OMNA 2JH2A 4UF7C 3DJZA 4HQQL 1IQDB 1G9NH 4JDZA 1VJSA 5E6YA 4QRSB 2XIIA 3F7YB 4ZMZA 3NCEB 4JQVC 4KTGA 1Z6JT 1FLTX 2VERA 4UB0L 3VA6A 3DMMD 3EOAA 3ZSTA 3OM3B 1EAPB 3DIFB 3TA3B 3T0AA 5JMRA 4OV5B 1ZPUA 4AX3A 2XVGA 4ZXBC 3VB8A 3HMXH 3T3MF 4PB9H 4XBGA 3QZWB 5MENA 4MCMA 1MQKH 2X40A 1KCSL 3OLEA 1SLVA 1XGTA 5DJ8A 1GCYA 4LKXB 4X5QA 4QHMB 1SDAB 5F7DA 4KVPA 2Q76A 4FQCL 2VLRA 1MFAL 4L4TB 3UO8B 2VLKE 3UYRL 4B50A 2J73A 3CDYA 4YHOL 4C55A 4ALAC 3W5MA 2P28B 3KPQB 4XVUC 4P4KC 2GT9A 4XWOD 2WQ8A 3JBG7 5F88B 1ZPLA 4M8QA 2F5AL 3HAEA 2V5MA 1F00I 1MDTA 5D96C 5T1MB 1GKEA 3TH3T 3TO4D 3K2IA 4XCNB 5DHMC 2VZUA 4L48A 5JHDE 5JW5A 4G7VH 4R4NC 3JYBA 3D07A 4W4NA 3QA3A 1T3FB 4PHXA 1BMWA 1UZ6F 4A2EA 3T4YA 1TTRA 2VDQH 1S7UA 3CH8A 2GUOA 1RPKA 1JZJA 5EN2B 4O9HL 2EDDA 4H8PA 4ZSOE 1UWEL 5I8KL 5T5FA 5C7XH 3U4BH 1QRNA 1MELA 2G2RB 2X2IA 4WEEA 4LPXA 4IHOA 3IN2A 5HHME 4JHZA 4X5PA 3Q8BA 3D08A 2P8LB 3QA3B 3WMSA 1OAZH 4PJ9A 4AQ1A 5DD0L 3SN6N 3ZL4H 1YNKL 5CCKL 1U3HD 1ZHLA 3C08H 1PBYA 25C8L 3ZTDC 1NIEA 3QUZD 4ZUVB 4A6YL 4BCZA 5JPNA 4P4KA 1HK6A 3L4XA 1MNUL 1ND0B 3VD2A 2BRRH 4RQQB 2BIIA 1E40A 3EADA 5D2NC 1AMYA 4N2IA 2R2CA 5D7SH 4UQ2A 1MFCH 4M8UA 4PGDA 5F8QC 1GAFH 3WG7B 3DX7B 4Q4IA 3PXLA 4RAUA 5DS8B 5CEZE 2KDYA 1FLRL 4WEMB 1NA8A 3I6LE 4O02B 3DSFH 3L3DB 4Y9FA 4X83A 5D6CB 4LOUD 5D7JD 2EIZB 2PPAA 2R4RL 5IUCA 2VW7A 2NX5B 1OZUA 4Y2DD 1KGIA 1DR9A 2IDSA 1THCA 4OAWB 3CVHL 2FAUA 4JFOA 4U05A 1IVTA 2BJML 1TU2A 4L4TE 5L2KD 4PRHD 4GG8A 1PFOA 1TMCB 3HI1B 3VD9A 2JCWA 4LCWE 1NC2A 5DWUL 1OP9A 3KGTA 2MHAB 5I23A 5J7CC 4KDVA 4PP1C 1X6LA 3ECWA 3PNWB 1WH0A 2NY1B 2VTFA 2NLJB 3NRFA 4UM8A 3SJVD 4LVNB 4F9LA 1X5AA 4J5VA 4ELMB 5FR3A 1Z3GL 4ZO7A 4O2CB 3L5JA 4NGHH 4MNHB 1DQQA 1P4BL 3D0LA 4QOKA 5I1DB 2DKMA 2J20A 3DSNB 3DTUB 2VL5B 3NK3A 2Y6SD 2JJTA 3DO3A 4Y9CA 1FL5B 2Z93A 4V1DE 1A4AA 3PJSB 3Q5TA 4K7PY 1G6RL 4MRBA 3SDDD 4D9LL 4DSYA 1ND0A 2DQFA 2VLME 2K45A 1QG3A 3QEHB 2CWRA 3CLEL 3H55A 2ZUUA 3QXUA 4O2CA 5GS2H 2FR4A 3R06B 4YDLB 2DJMA 3O9WB 2FDBP 4TL5A 2X2JA 3NH7L 3JTSA 3TNNB 4OQTL 1KLGA 4FQXB 1EGJA 2EDLA 3B56A 1NMCC 3NUKA 3U0PA 2P7TA 3BHBA 2BLFA 2XN2A 4L8CA 4QRUA 3V4UL 1M3IA 2V9RA 3RDTA 4NPYB 4FQHA 1AR1D 2COQA 2ADFL 5F7MC 1DVUA 1UXMA 3BW9A 3DC0A 3PIQB 5FOBB 4GQRA 4GXUM 5AWNH 5BS0A 5J6GA 1FN4A 2C3GA 4ETQB 1G7MB 4HEMA 1SEBA 2JK5A 2R0LH 4X80H 4HF5L 1G7JB 1QHQA 5FCUH 5TF1L 2IPUK 3VGAB 1OSPH 4L1SA 3MRQB 1YQ2A 4PCKA 5E6IC 5I2IB 2R8SL 3WFCL 2CCVA 1FAKT 4P3DB 5AALA 4L3EE 1ZGLB 1YVLA 5HGGS 4KZDL 1YDPA 2VC2H 4UUJA 3O3EA 3MJ8A 4GUPB 2ESVE 4YXLH 3H56A 1M1XB 2W9EL 4NKOA 4WTWA 3BDYL 1OGAB 3UAFA 4N2BA 1ASPA 4NBZB 3UFIA 4A2MA 1MI5E 3GSRB 3KVPA 4WO4B 1GY2A 4NSKA 2XJLA 3PAVA 4RBPK 4BXSV 1VESA 4JRXE 1WV7T 3MRGA 1T21B 2JMRA 1UZ8A 5HYSG 3GNMH 4HV8A 4YDJA 3KR3H 3T2PA 4BWUA 3IETB 1NOLA 4MMZA 5F3BB 2CKBH 5LBGA 1U93B 5IT2H 4NQQA 5D7IA 1MQ8A 4WIQA 1PMYA 3BAIA 4U3XA 5AL8A 4LCCA 4LSUL 2DRUA 1I8UA 4OIIL 3S37H 1OHZA 5IHHA 5DZLA 3TBTA 2CAKA 2XXCB 2JNZA 4JRYA 4YK4C 1XCTB 4F37K 2HTLD 4DKTA 4JKLA 2NSXA 1VADA 5GGUA 1NCIA 4LGSB 1USQA 3DV4B 4GXVH 4GOSA 5DO8A 2J56A 2GJPA 5IROA 1TJIL 4HEPA 2ZSWA 1NUGA 2J44A 2EIKB 1BXAA 1G7JA 3LKQB 4L8BB 3B7RL 2QQNH 5LLIC 3QO0B 5C0AD 2Y1ZA 4IMKC 3BKCH 1N9PA 2YMTA 3QFJB 5BQDA 3SGEI 4M8QB 3D18A 4GQ9H 4L37A 4RH4A 3EBAA 1MDAA 3VM7A 3MOQA 1IGML 2GY5A 1ONQB 3CSBA 1YJDL 3O3EB 4NZJA 3BDYH 4HT1L 2F19L 4HFUH 4E9YA 3J8F7 5GZOC 4K4KA 1HWGB 4LHUD 1NCBH 3BZ5A 4OGXH 5EZIL 4IKKA 5E5RB 3LB6D 4R2GB 2ZJSL 1TQCC 2UXVA 3HE7A 3KLAA 4KROB 1S8DB 1S7QA 4AV0A 4XCFH 4M1CC 3SQBA 3ZK0A 3QZWA 1NH6A 1MY5A 2XIBA 3UZVB 2BIQA 4YXKL 4XWOC 3TF7C 4XE0A 3GK8H 5AVQB 2NX5D 2CDGB 4HUXA 4HMDA 2Z8VC 5AZEL 4GXVL 4C56A 3I9PA 1BQSA 3IFLH 5JOPD 1G9HA 2FSEB 3PGCA 4Y19E 4P04A 5EC1A 4ELME 4KV5F 4DUVA 4ZG1A 1FCGA 4GMSL 5EBGA 5I0YA 4PMFA 4TSCH 5LCVA 3CFMA 2HFEA 4KVCH 5I1CL 4ODXA 4X4MA 5K9OB 3LDBC 2VR7A 4A7TA 1RZ8B 2H1XA 1GR7A 3WN6A 4PJ8A 2HKFH 5HI4C 3E1ZA 3ZGHA 1HINH 4LEXH 4FZ8L 4Y1TA 1JYWA 5DO2C 2KL6A 3MV8E 4AIZB 1ZHKB 4K7FA 1ZGLP 1YC8A 4GAAA 1R34A 2VO8A 1EZVY 3OGCA 1A3RH 4EQ2A 4FQJH 4YE0A 1PF3A 5HDRA 4AXWA 4JZJC 1ORQB 3NIFE 2E9IA 2I07B 4QHUA 1WFTA 2QVFB 4PRNB 3E6FA 3VMPA 5I76A 2BHZA 2AJ3B 1TETH 1CTNA 4JZOA 3M17A 1BVKB 3R7RA 4AYMC 1MXDA 2R2BA 1CIDA 3QORC 2XTJD 2X53A 5H4YA 1QI3A 4WTXA 1UD4A 1ILSA 1UC6A 3RFZA 4JUTA 3H42H 3BD5A 3V4VA 3RJQB 3O3DA 3FZUD 4NCC1 2MTAA 2ARJA 4NENA 4OGAC 4GW1A 3LV3B 4LLQB 3UTPD 4HBCL 1ET5A 1RZKL 3LRLA 3EH1A 3LH8A 3LZRA 4CSTA 4ZI8A 3ZZLA 2Y72A 1WCBB 1KPVA 3QDJB 1JPST 3EIFA 1JF6A 1YNTF 4RMBA 4M9OA 4KKPA 4GRMA 3GHBL 5ICZB 3OKMA 1C1EH 2YN5A 2YAOA 3D39D 3PHOA 3FT1A 1IBGH 4JFTA 4Y5YC 3SPVB 2WLNA 2NT0A 4D0BA 4O02A 3GYRA 3BVWA 1CDIA 4P0DA 2WN3A 1U8OA 5C6WH 4DO4A 1N6QL 4KK6D 1TQSA 3CC1A 3O41B 4GT0A 4ODSL 2OR9H 2YAPA 4B9JA 4L37B 3OC5A 1UB6A 3GBNL 3S34L 1A4KB 3OXRA 4JKPL 1U9KA 3K81A 1DQJA 4YBQC 4PWFA 1P1ZA 1SYVB 4PGBB 4DVBA 2DI8A 2GUYA 1LE5B 1X7QB 5EA0H 3LYRA 5DXWA 2ZKWA 5F7HA 3FCSB 3FT2A 4HKJA 2FQFA 1QZ1A 1UGNA 3PGFL 3IDMB 1Q1JL 1MI5D 2X2UA 5C0GA 3B9KA 4X6EB 1QBLL 1QO3A 1KGCE 5CMAA 4YO0B 1HCVA 4PWGA 1DSWA 1F3DH 3GUFA 5HY9A 5K33A 4X4YA 2R39A 2AQ2A 4MA1C 3V0GA 3ZL4L 3QYMA 4XXDB 4R4BA 4AENA 1A6ZB 1AR2A 1CBVL 3FQ1A 4PB0H 1Y6KR 3PV7A 5EU4B 1I7RA 3SD5A 1YSOA 2WZ0A 4ZW5A 3HG4A 4OLWH 4F8OA 5FK9B 2IAMB 4JG1H 2GITB 4WEBL 1NLDL 4CMMA 5A6MA 2XDHA 2BVEA 3GSQB 2NOYA 3IRZA 3DTDA 4QRRD 4NWTH 4MD4A 4XNYL 1MAMH 1P7QA 3B8YA 3ZHNA 3IU3A 4M9PA 3BFOA 3SDYH 3AWFA 1S7TB 3GZKA 3T09A 3GMPA 4EDWH 2E4FA 2KC0A 4X0KB 2MPAL 2L7EA 5IFAL 2BW5A 4PS4L 1RJCA 3CVHH 2ATKA 4CMHB 1R5WA 3HUJA 4WWNA 2HT4C 3EJPA 1J9RA 1CFVH 5IBLD 2Y07H 4L9LA 4XMZA 1B6UA 2MOQA 3ISRA 3UC0H 4ODSH 1OAKL 3RDTB 2DBLH 3SPCA 5I5MA 2WANA 1CDCA 4IBUA 3GPSA 2DLFH 4ZYKA 4NWUL 2I60L 4P46B 4DCQA 2ZWNA 5D7HA 3MV7D 2CR3A 4Z7UB 2BERA 1II4E 4JDTL 3RIFF 1X5ZA 4AE1A 4LCIL 5E0FA 4URKA 1AO7A 3VQ2C 3LHPH 4Z7QB 4UMSA 3OKNB 4HAKA 5M7QA 1W8OA 4OCXH 3JSSA 1YY9D 2R9HC 2WLZA 3QULB 2OL3A 2Y06H 4JRXB 2BVUA 3KYKH 4U49A 3QPQD 3KH4A 3EGSB 5BZWB 1CDBA 3N91A 3RL1A 1A4JA 3L4TA 4U3SA 2WWNA 2FLRT 2UZIH 3L3GA 4OLUL 4HGMA 1KC5L 1VACB 5IVZB 4PS4H 1E6OH 1RUAL 4R7VA 2Z1KA 5ISZA 4R9HA 3NEOA 1X44A 1G84A 4GY4A 3IKCA 5DK2A 5BUPA 3B9DA 5D70H 5T8IA 4RNRB 1MWAH 1R19A 3TJEH 3QIUC 4LL4A 5C07A 5HHXH 1VENA 1MSPA 5BS0B 1IGIH 1GGCL 3MV8B 3UEQA 1QA9B 3HZYB 2WWOA 4UV4L 2FH6A 3CXDL 4M7LL 3MOAL 1XVSA 2DYPD 3ZKSD 2AC0A 3ZSSA 3K74B 4F57H 2YD5A 4G6ML 4HWNA 1S9WB 1KXQE 2OX5B 4TUOB 4HPYL 3LKOB 3BZFA 3TPKA 2J8HA 1EX0A 1AIFB 2Y06L 4RGNB 1W0WB 4Y5XC 2DQEL 1GW6A 4GBXA 5DHEA 5B3NA 2G0KA 3S9DB 3PQYB 2X2YA 4TQ8A 1J11A 2P5WB 5ENWA 5E4OA 2YUXA 1N0LA 2PW1B 4D3CL 1DEEA 1MHEA 1EFXB 5LCVH 3INUL 2NYYD 2ZXAA 1RUPL 3FTSA 4OQ1A 3FUKA 1P5UA 3E8UH 1XX9C 2IH1B 5BVPL 4WHTA 1ETZA 2V3DA 3E80A 3E0GA 3ZIYA 5I1JH 3L3GB 2MKWA 1ZHLB 1RZFH 4HP5A 3IU3B 5A1AA 2R0KL 3L3IB 4TSAH 4QXGL 4M48H 2DL9A 1RZPA 4GG6E 3BT2H 3WIHL 3BDBA 3O6FB 4QJ5B 4PRAA 4X7DC 1LO0L 2Z6FA 2FSDA 3KR3L 5D4JA 1H8OA 1TETL 3TBWB 4D9RE 5C09B 2G60H 3ME0A 4G6AC 3L3JB 5KVEH 4I0CC 1EQWA 1NMBH 5JW3L 1HNGA 1UA6H 2DLTA 2O5XL 4MXQD 3ULUC 4LKCA 5FYJH 4K3JH 2GW5A 3FSOA 3HKZA 4JLRB 1G7PB 4LLYA 1YY9C 2HLFC 2OZ4A 1VPOH 2DMGA 4Q0XL 5JMOC 1I75A 1CLYH 2R1YA 4AQEB 1MRFH 4NXKA 3S3CB 4DKEL 1EO5A 1N19A 2H47C 1NUDA 2X44D 3AQDA 4HSAC 2BZDA 1JI2A 1RIUL 1A7QL 3O6KL 4WFGD 3RZCC 4IJ3C 2WSPA 1UXSB 2WUBH 4K5NA 3WKMH 4P2RB 1G6VK 3IDNB 1F3JB 3UBXB 1TQCB 3MZTA 4N87A 3VRIB 3CLFH 4CSZA 3QXTA 2FGWL 1XIWC 3I85A 2VKWA 1ZLVK 3B7SA 2FBJH 1IFRA 3BP6A 4AUYA 3OVUB 4I4WA 3QJFB 4X6DF 2EUZA 3MV9E 1JAEA 2FHFA 1KIUA 5D4HA 3ARGD 2YD8A 4U3HA 4ERSL 4JAMB 1YNTB 4N2FA 1VFAB 4APQB 2ZOKA 4KWUA 5GGSB 3W0WE 4MJ2A 4CNIB 5C0BE 1E50A 4L0PB 2XWZA 4HZAA 3EO0A 5LXVA 5KUKA 4ZW6A 3JWOC 4LESA 3EYUL 5JUEL 3X11B 2AZUA 1XF5B 4M7JH 3FT2B 5HDBE 1P4LA 2K6YA 2Z7ZA 2ZP8A 5D7JB 1T21A 5DJZB 4Z7WE 4JPWL 1SN2A 2J21A 3NIDB 4BA8A 3B83A 2JIXB 3E3QC 3BVUA 3FAXA 5KBNC 3IXTB 4WLCA 4L8DA 3VFMB 3DBXA 1UASA 2P8PA 4U6HA 2X0UA 1HH9B 2OI9C 4OLYL 3WAKA 4D0BB 3O4LE 2E4TA 1RP8A 3EBIA 1HEZA 1SEBB 4XPBL 3SYCA 2VXTH 1KTKE 4P9MH 5HJBA 3X14B 1PSKL 4BRJA 1GSKA 5IKCB 1KNOA 4K94C 1LNUB 5FV1L 1EGJH 3M6DA 1GZHC 3ATEA 3MLXH 4HVBA 3TYFA 2G2PA 3SDDB 4HG4K 4Y9EA 1SMDA 1WFUA 2LFEA 4HBQA 3OBAA 4JFFE 5I1LA 2AAVA 4NWUH 4KJQC 4JVPA 3B3IA 4PM1A 3S7GA 4CBZA 1R3HB 4Q7DA 4Z8FH 5F1NA 2OJZH 2W60B 1BD2B 2ED9A 4F7PA 1G9EA 2E9GA 2P5EB 4ZX3A 4N1EA 5ITBH 4W9CC 1A6ZA 1BWMA 3QZOA 5CU5A 3T6VA 1EZLA 4YXLL 4PD4J 3VG0H 4YEFA 2B39A 3KPSA 4JPWH 1A3LL 2PCFA 2HKAA 5JYMA 3IFNL 1QUPA 5DRWA 5FGCE 5F9JB 4XPAL 3L5HA 5FV2A 4EE2A 4B7LA 3POHA 2J8OA 3ULVL 1UOLA 3HI5L 4P5RA 1X7QA 2ZAHA 4TVPD 1M9WA 4C56B 3HR5B 4B9GA 3MV7E 2GTQA 3IFOB 3NIFF 3UAEA 5EHFA 4YFLF 2VL4A 2CU9A 1J5OL 1ZV2A 3E38A 4C4UA 1HYSC 1BFVH 4FI8A 4KI5F 5GIRA 3QCTH 4MNGA 5BMFL 2VLLB 3VRJA 3E2HB 2ZF8A 2CUMA 2ZUYA 3IJHB 1OGAE 3VI3F 1XCWA 4R0LC 4N5ED 1VFUA 2R29L 5B8CA 4BH7A 1OSPL 4N1HB 5ABAA 5JQ6L 5I16B 5ITBL 3H7LA 1E30A 1HL8A 1U92A 3LPOA 2CHDA 1LGVA 3V6ZB 4ILDA 1K8DB 3BD3A 5AZ2H 3CFIC 2JSFA 5BVJB 3ATAA 2DM3A 2V0AA 1OW0A 5AFAA 1C8PA 5I71B 2Z9TA 3WJMB 1FWXA 1WC7A 4FNUA 1E42A 4Q4EA 3B5HA 4N25A 3OX8B 3AWEA 1HT6A 4W93A 5L9DL 4AQ8C 2YD3A 3CVIL 2WLJA 4I2XA 2IALB 3ARDA 4WFGE 3RIFK 4JFED 4N2KA 4RGNC 4YL9A 2V7NB 2G5UA 1JZGA 3TYGH 5LGKA 4WWKB 1H5BA 4HJJH 1AQDB 1ACXA 5TH2B 3R8QA 3ZTJG 3WLWD 3AB0B 4E41D 2ITCB 3UIYA 5LAXB 5E5MA 3CMGA 2YLKA 3DX8B 1RZJL 2HH0L 5CJOH 4LEBA 2FUTA 1QFWH 2JB5L 3GS7A 4LLVB 4YOKA 2DPKA 1KSRA 5F9AC 3BWZA 2OBGA 1MCJA 3GSNB 4M61B 3F84A 2BVPB 1QSFA 2XWJA 2FWOB 4GSXA 4NIKB 4E9VA 4KUCF 1QSZA 2DQDL 3A0OA 3FN0L 4NUJA 4QR7A 1OB1A 2IAMA 4ZUWA 2X2HA 4AGMA 1JV2A 3KLHC 2J6EH 3WS6A 2E5EA 4YSPA 3V9CA 5D7KE 3HPLA 1S3KL 1JPFB 5E1AB 1DQJB 4YDNA 3KYKL 1XZ0B 3CCHB 4EO5A 2OTUA 5HDBB 4E0RA 2NR6D 3N0PB 4A2DA 4LPYA 1CYGA 3OKEA 1I3UA 3RWHB 5CN2A 4XCNA 2QVKA 4NI3A 5ACMA 1FFTB 1ZRUA 2QBWA 4JKWA 3CHSA 2NYZA 3WKML 2YD2A 1QX1A 1T89C 4GP5B 3U4EB 3OMAB 2VDNH 4KMTH 1JYXA 4NLAA 3VD1A 1UD3A 4PRDA 2CO7B 3WKPA 2D0GA 4GW1B 2OL3L 5IW6A 5D1ZI 4M1GL 3RZCB 1HXYB 4CW1A 5I28A 4M4RA 4FNRA 3Q6GH 1JFQH 2BS8A 3BCFA 4Z78B 4G6JH 4JGMA 4LCYB 3EYVA 4XCEB 1AQ8A 5DVLA 2IAMC 3WTWA 1KCKA 3WV0A 2DQUL 2LTQC 5GS1A 1BAFL 2W0PA 5JLZB 2ENYA 4WFHE 2EDFA 5IMLA 3MX0A 4Y2OA 2YD9A 1G7MA 4J3VA 4RWHA 1Q9OB 4Z3IA 4JVWA 2XNAA 3NEEA 4GSUA 1T83C 3ZE1F 1FVDA 2BSRB 2HUEA 4HCGA 3CU1A 3JZYA 5JDJA 4NQEA 4P57A 2A6DA 2LW3A 4FQXC 1KB5H 4PJ8C 5ITFB 1IFHH 5EEUA 4H0IA 3UXFA 1T20A 4AIXA 3BUYB 4A67A 1YEEL 4MJJA 3PJSA 2Y25A 3NSYA 5F0PB 5E9DE 1QBLH 4FF9A 1SVZA 2G5BB 4GQZA 1RSYA 2MQGA 2XVLA 4HIHB 4AMWA 1MIMH 2DLGA 2EKSA 2VMJA 1GKOA 4BQ9A 3TBYB 4F5CA 4PBVC 3PQYE 3SJVE 4Y7OC 5T1KB 5DC2A 2NUPB 4NP4L 2OP4L 1D5ZB 2VUKA 1L7IH 4GINA 3SGJA 3K6FA 3LZNA 3WXWH 3FRPG 1IAIL 3KXFD 4GIAA 7PAZA 2WVTA 2F8OA 2PWEA 4U6XA 35C8L 4X7SL 5I1EH 2MOGA 3PE9A 4ANXA 1UWGH 3DOSB 1VPOL 3BESR 5FDYA 4JUSA 3CVDA 1HNYA 4WUKL 3PWJA 5D1QD 4GXUN 1GGBH 1ZE3C 2GABA 2VMCA 2Z31D 1UKSA 2P9RA 3SDXA 4IGBD 5C0FA 1YEDA 1J12A 2AEQL 2FCBA 4HCRL 1L6XA 5SWSA 4OY9A 1A6VL 3V0WL 4JEGB 3MTXA 4X5WB 1Q9KA 4U7KA 3KPTA 2W8CA 1TOXA 5JDSB 3FAWA 1IAOA 1R1CA 1MCEA 1EHNA 2TRYA 4ALAL 4I1PA 4ZOAA 1GHFL 1M2VA 2WK2A 2AK1H 4HSQA 5LQBH 3G5WA 4GG6F 5DRWB 1TR7A 1NGXB 1OGSA 2G2NA 1BYPA 1D9KC 5KVDE 1J8KA 1I85A 1OZTG 1RZQA 2DWXA 2GC4C 3SBWC 2OJEA 1JD9A 3LNDA 5T1MA 5KYYB 2WMPA 1IGJA 4RMTA 1O6TA 3S98A 2XBZA 4H2AA 1JXFA 2EILB 1KIPB 1R24B 2QFRA 1EH9A 1OQXA 1U36A 3S6CA 1IBHA 3OZ9L 2BP0A 1ZXQA 1C12A 5FA4A 1CFSB 1A9VA 4U4IA 3NZ8B 4NO5A 1ETB1 1X5HA 2GPZA 3NACH 2EVFA 3GKWH 3QQDA 3S88L 2ZOTA 5L88H 1IEBB 4R7NB 2K1MA 3N55A 4XTRD 5DEFB 3VWJD 4XNUL 3A47A 1QBMH 5DJAB 2XFXB 3QC6X 4W1TA 4HCRA 3V0DA 2AQTA 4BZ1L 3E8VA 4FQLH 4JO4L 1T2XA 4U6YB 3CPLB 2PO6A 4M5ZH 2AK1L 4XNDA 5F1KC 2IMNA 1PZ2A 2LFGA 1JUFB 2KBGA 3MUGA 5K39A 5HD8D 3O4LA 1TO5A 3DX6B 1FNSH 1C08A 1ACZA 4DP1X 4X6DE 2I24N 3VTMA 4JCMA 4QY8A 2MEJB 1J1OL 2KZWA 5AG8A 4QXUL 1SHSA 3BPLC 3FTWA 1OAZL 3RAJH 2LE9A 1GJIA 3MRLA 2N01B 3FFOA 3M8OL 4S0HA 1F3DJ 2BM3A 5GQBA 3CG8A 4MCYA 4OZFG 4G80B 4YSDA 3B5TA 2CGRH 2CRZA 1O6SA 5JNYB 1MFBL 3ULUD 2JJSA 4OZGE 4UQ3B 2GBVA 3J2PA 2FO8A 4JKNA 1S6NA 2AERT 2PNDA 5B4MC 1OSZA 4Q2ZA 3TCTA 4YBHA 5M94B 2XV0A 4M43H 2BXZA 3GJFH 3NDZE 2PTTB 2XKUA 4Z7WF 1FGVH 1ITCA 5FHAL 4P3DA 3ARPA 4G8GB 3E9TA 3F7YA 4HK3J 1FQ9C 5I8CB 1CFSA 5AVRB 3WXWL 3SE4C 1C9SA 5D2NE 2W92A 3ES6B 5CZRA 3RZCD 1XSIA 1FH5H 1KCBA 3EOAB 4UNTA 2FX7H 2F5AH 1NM4A 3HC2A 3CN1A 3I2CH 2ZE0A 2DWEA 5E8EB 5DJDA 2CCLA 1CXEA 5E6ID 3DGDA 4WFHD 3QUZC 5MI0B 4C4KO 1LDPL 4WDIA 3WN5A 2VABB 3IMRA 1KBVA 1JZ8A 2C4XA 1YEHL 4QPEA 2OR9L 2WP3O 1X7SA 3KYOB 3TWCH 3HI5H 4PTTB 4K9JA 4R5XA 4TN9A 3WY2A 4X98B 2FATL 1PAZA 3DVIA 1MFBH 3MJGX 1ZVNA 4MNQE 2ERJB 4LPVA 1NMBL 2IQ9H 2O5YL 4RCAA 4HYTB 5T5NF 3V6FA 1KWKA 1SDDA 1U6AL 5JOPE 3ZKXC 1HHKA 3T0EB 5KAQG 3UBXI 4I0PB 2G9KA 3DUHA 3HE6A 2ZOLA 3KXFB 2E7BA 2ZSVB 3L4YA 1A7NH 5FUZH 2XBDA 2OTWA 3VFPA 2OI9B 4F2ME 4KTYA 1DANU 3PDGA 3UDWC 3D51A 5HHOD 2HPTA 2UWEE 4YBLC 1BWWA 3VFUA 15C8H 3OSKA 4X6CF 8FABB 1CXIA 2XPZA 4S1DC 3B7TA 2EYRB 5TFSH 1XGTB 5DJ8B 1OAUH 3VUAA 2YRBA 1AO7E 1KMGA 3LNFA 1PEWA 2M26A 3NCWA 5C09D 3QQ9D 2EYSA 3QUYA 1OCWH 4PJIE 1OGAD 4RX4A 1SYSA 3FKUS 5L9DH 3UACA 4LGPB 3GIVA 3ML8A 2Y7OA 4KX7A 2H0PA 4WI2A 2WLIA 3CFDB 5CJBA 3QH3B 3VXTB 3O8XC 4WK4B 4NO2B 4ZD3L 3LZFL 2ATKB 3GDBA 4XBPB 2VNCA 1M7UA 5KN5A 4QRSA 3T3PF 1CMOA 1H5BC 1S7RA 3QUYB 1I1AD 2PLTA 4ZTPH 3D9AL 2DLEA 4U1SB 2OXHB 3RU8L 4K73A 5BNXD 1RIUH 5TDPA 1L7TH 4J2XA 4WKZA 3C5SB 3D25B 2CD0A 1RERA 3DETD 3MNZA 3TC9A 1B0RB 1T04B 2YFOA 3OHMB 1AD0B 4DPAX 5ES4B 2GJRA 1XR9A 3BZEB 3BP5B 2WVSA 3QG7H 3DIDA 3DX1A 1WGOA 3CK0H 1T6VN 2ZIDA 4I1RA 2X4RA 2HRPH 3I50L 2PF6A 4FQ2L 4NKIL 4UV7L 3GRGA 3SB3A 3ASOB 4WTQA 1PNDA 4JFZL 5PAZA 2ZX9A 3VFGL 3OJMB 2F5BH 3SKMA 2FEJA 3SE4A 5EZIH 4JRYB 3MQIA 2F7PA 1U8KA 4TNFA 3KNBB 4K3HA 5C8JA 3GRBA 3PNWA 4JPQA 4M6OH 3TWYA 1A6UH 1Z32X 4XVOA 1KEMH 3KEDA 2G75A 5KBLA 1BYNA 1JGUH 3KHQA 3QJUB 4FL4B 3T0BA 3HBPA 2WHVA 3WN5C 3AXLA 4QTIH 3AQZA 2RD0A 4HFWB 5I9QC 1E4WH 4TQEH 3C8DA 4Y4HB 1KGJA 1L5GA 4AUUA 6PCYA 4C83B 5EWIH 4GMSH 1W80A 4HIEA 1FC2D 1MAKA 3FUHA 3L3DA 3LB6C 5D6CA 1SJVA 3C9NA 5HI3D 3TLRA 3P9LB 5BXFB 2MQCA 1GGTA 2QGDA 1KFGA 3ATFA 3FOMA 1TPXC 4IKIA 1B3JA 3HN8A 4Y4KB 2ISDA 2PCYA 4RSVA 5C0JB 5F1SA 3NPSB 4UDUA 3AG1B 3ESNA 3OAYK 4XNYH 5IMKB 1EGJL 1N8ZA 4YHZH 4WQOA 5B22A 3V2AR 3MLPA 5DJ2A 4NRZA 5DUPL 1XZWA 1MPAL 3W9EA 1BREA 4P4KB 4X6FB 1V7NH 5AVVB 3EJYD 3TZVD 4G8IB 3U7YH 3JWDL 3QNXB 3HCVB 4UM9A 1EAPA 2MFNA 4OV5A 2GC7C 2F5BL 3DIVA 3QWRA 1RSFA 5B39A 1I8IB 3MJ9L 2YXMA 3DXAB 3Q05A 2YQ2A 1CC3A 5EBLB 3ROOA 4HX1B 1Z66A 2CK2A 2FR4B 4YL4A 3QNYA 3KL3A 3MV8A 1KGYE 5E4EC 3BLPX 2XUWA 1M6UA 1BZ8A 2ZWYA 4GEIA 2J8UB 3VD0A 2YSTA 2PUQT 4JMXA 3WNJA 1KCWA 3TN0A 4E9LA 4PRHB 3RL2A 3TCXA 3SO5A 4NEHB 4XC1L 5DDHB 3GHEL 4RLDA 1F5WA 3KWUA 1SVCP 3A6CH 4JLRA 3KBEA 2Q2EB 5DD6A 5AYQA 4YHLL 5H4ZA 1VF5C 3D4ZA 4QD2E 4YWGH 3KCWA 1JWMA 1G7LB 4MCNA 4Y19A 3DJTA 3VXSB 5DRXA 1SJEB 4WI6A 1RK0B 1D9KB 4MX7B 3JWOH 5CGMA 4I48B 1TKWA 1ZA3B 4IRJB 3BZDA 2BIHA 2ZCHH 4G5AA 5ICXB 1FCCA 3RRQA 3ZKMD 4GW5B 1AS6A 1GS7A 1UOKA 2CHZA 2WM0A 2X4OB 5C6PB 1IGJB 3IDGB 3MLUL 2DB8A 5G5DA 5C08E 2FHBA 2VWEC 1D6VH 2ZX7A 4ZX5A 1A1NB 3HC4L 2MJWA 2V2WA 2UY6B 1WPCA 1RUML 3OKYA 4DZBB 3U30B 3MRCB 5I5JA 4ISVA 3SYOA 3QDAA 1GOGA 5C2UB 4A6YA 5F96L 1HE8A 4LQ1A 4R2GC 2CA4A 2Q8AH 4XMTA 2FJSA 5DEJA 4WI5A 3ARWA 4M6AA 4XBEL 1JYVA 2QADB 2AJUH 2HT4D 1AQMA 2AQSA 3UG5A 3GKZA 1NBZB 3V0FA 2J43A 3HG3A 5CXPA 2NW3B 3UTQB 1AR1B 3S2CA 2NY1C 1BEYL 1NIFA 4HZ1A 5I82A 1LP9B 3BP4A 4WWID 3QUXC 4JQIA 4N0CC 3UABA 5IK3B 1U8CB 2IJ0C 1SHWA 3IF1A 4IIZA 1H3VA 3FB8A 5E9DD 4MJIE 2VDKB 3RE0A 1I1AB 3SGDI 4JY4A 1EZVX 4RDQF 4AE0A 1LWJA 4YHLH 3LMJH 4MNQD 4QHKI 5DK3A 2VW4A 4WU7B 1EXUB 1I85C 4GNKB 5D7LD 3WEOA 3WI9A 1XAKA 2PYEA 1R3LB 2R29A 1RK0A 5JLZA 3GRWH 4NB7A 5AYUH 4GAGH 2NQ3A 4K23L 4D9RD 3VFSA 4HUNB 3AITA 1F6AB 4ZFFA 3CZUB 5KWYC 4OLEA 2ENQA 2ICWJ 2HMID 5DHYA 1A64A 4XOCA 5FA3B 1GHFH 3DMMB 3SE8H 1A3ZA 4ELMA 1LE9B 2EQDA 4BUQA 4HIIA 4W9DC 5AVWB 3NN8A 4I18B 1WTLA 5CHNB 4KVNL 5ETUA 3HNTL 1JHLL 2GK2A 2P48B 4YIQB 3MO1A 1XEUA 2VKXA 4HWBH 4I85A 4RISL 2NUTA 5T3ZD 1AGBB 4PJDF 1SOQA 3SEPA 3F5WB 2Q7YA 4R90L 4D8PB 1JPGB 2F74B 3IJ8A 3TO2A 2C3WA 4AUJA 2CIIB 4A39A 4OLWL 3IDJA 5HPMB 4KXBA 1PX3A 3EJZD 2K3TA 4KOCA 3MI6A 2EIZA 2IANE 2YJLA 4WJKB 4P46A 4WW1A 4WTZA 1AXTH 4H5SA 4RZCA 4DCQB 2CJTA 4DO5A 1KN4L 1PD0A 2CUIA 3FRPA 4U1HA 3OPUA 3ZKNC 4EI0A 3NSFA 4FQIL 1QW9A 4G6JL 1OD7A 1LDPH 2GJZA 4KH2A 4B7IA 1RMFH 4PJ5E 4R83A 1AXSB 1FIGL 3FNKA 2JVUA 1XHHA 4FG0A 1T0MB 3ARFD 3VJ6A 4ZK8A 4X9FA 5DUBA 3TGXA 1QHPA 1V7ML 3SE6A 1UJ3C 1M6OA 1NAMB 2V9UA 2J4WH 4X5LA 4RZCB 1ZHBB 4HWZA 5FHBL 3VI4F 1UA7A 2KDGA 1I8KB 4JFVA 4TUUA 3WNIA 2HYMA 4B60A 4DIXA 3QUKB 5DMKA 4DW2H 4QRFA 4IHBA 5ELIA 4GW4B 5I1CH 2CXGA 3OGCB 1XL6A 4JRYE 3KPOB 3POCA 5K5YA 4Q9RH 2H32H 4KFMA 3OKOB 4OCMC 1YY8B 4PJHB 5F7KC 5DVMA 5AVZB 3AREC 2RGSA 4JMNA 1H6UA 4NUMA 3BP5A 3FSAA 2P49B 3NSJA 5C0DB 3TL5A 1Y6MR 4PB0L 4JN1H 4Y4HC 1DQVA 1NFDB 4LVHC 1PVHA 4LLDB 2H0EA 3ARUA 5LN8A 3MMEA 2F8VA 2XJKA 2EDHA 3ARBC 1ESOA 5D93C 4F92B 1QPKA 5EOCH 1CURA 3PGCB 4TM9A 4QWWD 5EC1B 3SKMB 5IJCC 5FPIA 4D94A 4FQQB 1GY1A 1A8ZA 2BHFA 3FOLB 3V0AC 4KO5A 4ZFGL 1KTCA 5BJTB 5IFJB 1RU9H 2XHNA 4JJ5B 3M1BB 1TU2B 2ITDA 4FNSA 4FKHA 3RA7H 3FB7B 3I02A 3QIUA 2DQJH 3VXUA 3CIQA 3S3JA 2V37A 3IN0A 3HNSL 4L3EA 2EVHA 4XMUA 1P5UB 4GUQA 1T04A 1F1AA 1W8EA 4WFED 3HZKB 1VA9A 1NEPA 4NFBA 3L08A 2H41A 4PRPA 3AM8C 4CC0A 4XXWA 5DJZA 3GHPA 5BJTA 2QPUA 3H3KA 2ICEB 3IJYB 1C1EL 4HEME 1BVKA 4UQ2B 1E5CA 5JZ7D 2A38A 2F54D 3AU0A 2EDJA 2H3NB 5I19H 3T04D 1CN4A 3DPDA 4MS6A 1KN2L 2IADA 3ELAT 4PGEB 3QIBC 1CD1A 4JRLA 1AE6L 3UDWA 4ZAKC 1WT5A 4W6WB 5GS2D 3Q8EA 1KB3A 3NTCL 3VI3B 3R7QA 4N2CA 1HSBB 3T0EC 3LEYL 1F4XH 2IDFA 2WIMA 2NXZB 3E6HA 1HKLH 1HZHH 2J57A 4ZW8A 1FP5A 3TVMD 2FEDC 4DF9A 4QHLB 1G0YR 1ZTMA 4Z5RB 3SGJC 1O7DE 2EADA 2X4SA 1OAQH 4O2EA 3TYFB 1X5XA 4OTXL 3KBFA 3OAUL 2NDFA 3D39B 5D1XA 4FABH 3B2UC 4EI5A 4V1DA 1WBYB 4ZXBA 4X6CA 2JQAA 1QNZH 4OZIB 3IRPX 5BZWA 4KTDL 3NOIA 2ID5A 4GKOA 4QAWA 5B7EA 3UTSA 4NKMB 1KBGH 2UZXB 2X4QA 5F7EH 4DGYH 1H9VA 4KI5C 5I1GH 5A40E 4RZKA 3WIFA 3ZTNL 3BXNA 4OM0L 5E5UB 2YKLL 4G2AA 4JJOA 5F7NC 2PR4L 4FG6C 4LBEB 1JXJA 4N9GB 5MEPB 3DUSA 4Y1AA 1U8IA 4JHUA 5GXBB 3H7BA 4X4XB 3GLDA 4L4TA 4HJ1A 1A3RL 1ZT7B 2FRGP 5CSZB 2AAAA 5AW2B 2IAAC 1CDGA 3OMNB 4E0RB 3AXLB 3MLVH 4PJHF 4PW3A 4ZOCA 3BXNB 5DCCA 3VA2C 4WFFD 3GBML 2C3XA 1KZQA 1YEIH 1TEYA 4LDCA 2NX5E 4OUOA 2D03L 5E4EB 5EOTA 5IEKA 2BRRL 1FSKC 5HXMA 4PRBA 2WQAA 4OCRH 3UH8A 2XPGB 4LB8A 5CP7B 2YQBA 2CGRL 2D2OA 5ALCL 3AQXA 2XQBL 1A6UL 3GJFK 1SOSA 4CADA 2W9EH 2WXPA 3T8MA 1EFXA 4TNWK 6PAZA 1F8TL 3LOWA 3O3DB 3JQOB 1JSYA 1E2WA 1M1SA 2X4SB 2QTEA 4ATWA 1X4YA 4KVNH 5F7BA 2WINB 1W8NA 3GUTA 2YPVH 1SLWA 4KZEH 3CFEA 2PTUA 5IJVA 4QF1B 3NYKA 4CU8A 4HZLA 4KKAD 4GG6B 5I26A 2VDQL 1DQLH 2O6FA 4AQOA 1UXWB 2HRGA 3EFDH 4Y1AD 3DMMC 1NANI 3JV0A 1OANA 2E74C 3NIGF 2ICES 3KGRA 4ZAKD 2HRHA 3H0TB 5IG7B 1UQSB 3RY4A 3BRFA 1CVRA 1L9MA 3KBHE 5EIIG 4WWKA 2IH9A 3NSCA 3T0ED 3AG4B 1OAJA 4W70A 1DQQB 3M1OA 5ABZA 2HUHA 1VZHA 1S2EA 2P3YA 2B20A 3LJ3A 1WAAF 5FYJE 3PGDA 4D0DB 5C3IA 3Q6GL 4JY6B 4UQAA 2BZ7A 1J8HA 4LO9A 5A3ID 4HKJB 3APDA 1ADWA 2Z1PA 3PWPA 5KSUB 3C5ZA 2X9XA 4B9ZA 2VJ8A 1J8RA 2LHAA 1LWHA 4G7QB 3AAZB 2HP4A 4M7KL 2WKGA 1OAYL 3OF6D 5EU6D 2VLRE 1HYRC 4KROD 1E28A 1HHIB 3NH7H 5D1XC 2YMXH 5DT1L 1K3ZA 2VDOL 4W9FC 3EFDL 1MFDL 1K5NB 4OFKA 1PLBA 2Q86B 4KTDH 2DQHL 4CDGC 3LEVL 1D5MB 4G7SB 1D5XA 3GJEA 5IBLC 2ESVD 3DOSA 3QGVA 5DSCB 1MFEH 2B3RA 1TJXA 1MRDH 1UA6L 2CKBB 1OGTB 3BAEL 4QRPD 5B1JA 5IQ7H 4JPVL 3II2A 3VRLE 4GKZA 2VT0A 3G5XB 3L3KB 4G7YH 3UBXG 1JZ5A 3EYOA 3H2WA 4AI7A 3RDJA 3MSPA 2P5WD 3NP3A 1PZ3A 1CGWA 2I9LA 1TF4A 3NJFA 3U9UA 2NPLX 1UD2A 3P0VL 3GSNH 4NNYA 2W91A 4KRNA 3CLWA 1E27A 1LD9A 3C8KB 5HYQA 1ZDQA 5F3HB 1BAWA 2OFQA 1QA9A 3HZYA 5D2LF 2SEBA 2WC7A 5T1KD 1I8KA 2AQPA 4PRIA 5EBMA 1FYTD 1LP9A 3BP4B 4HISA 5IM7A 2WO4A 3PAZA 5GS0L 4XT1C 1MH5A 1A7QH 1J0KA 2CO4A 3QNZB 4JDVB 3TASA 1UM5L 2VJ0A 3CBRA 3TVMB 4XOEA 3ZDZE 2EE6A 2VZVA 3C5ZB 5LDUA 4RRPM 4Z8FL 2R0ZL 2CO3A 5FC9A 2OTPA 4KRPC 1F45A 1QPXA 3K4AA 3TEUA 3SDCA 1IARB 1OD9A 4NT6B 2FJGA 4Z7VB 1L0XA 5GGRB 5EOQH 2UY7A 2X4UB 1E4XL 1UOWA 4ODVH 5DEGB 4A6YB 3GTVA 3AUWB 5DD0H 1GC1H 3KXFE 2VLMD 2EVJA 2JB6A 3LRSA 3ZTEA 4K7PL 4LMQE 2AHIA 4CN4A 5A2FA 4XZUB 1KB9K 3V4VL 4NRXB 4P23A 1MRDL 1IC1A 3QEUB 3RKDD 4UZUA 4EKXA 3O3BA 2ICWA 2MOVA 1T1YA 5GJTH 1EJ6A 1P4LB 2UXGA 2XV6B 4GS7C 4C4KT 1CICD 2K7PA 4OFIA 1XZ0A 4ZOEA 2CO6A 2K4AA 5K9KA 3O4LB 4KHXH 5CKAA 4WW2B 2R69A 1I1RA 2JB6B 3LRSB 4KKAC 2UZYB 1EV2E 1G7LA 3DI3B 3TO2B 5AOMA 1U6AH 3GO1H 1NEUA 2WBXA 2FJFB 2NY6D 1JE6A 1T7WA 3CE1A 4Y88A 3UTTA 4AY0A 2R0ZH 1EBAA 1W9XA 2DM7A 5FGSA 4G1EB 1GGBL 2Q1EA 3K1DA 5EO0B 1M2OA 5D71L 4JFEB 4W9GC 4XRCA 2ALWA 5KS9B 1EAQA 1VFAA 2P80A 3X1NA 3NAAH 3QAZC 4KKLD 5D72H 4PR5A 3HG5A 4PJBE 1HS6A 1QFHA 5GRZA 4BH8A 2ZXEB 1LP9E 5MHSD 2GFBB 2CM5A 2DWDB 1G6RA 4DTGL 3HLAB 4PRIE 5DK0B 1S7SB 3PS6A 5DVPA 2XZQL 3GSQA 1J0JA 3CUPA 5DGQA 1EFQA 1XIWB 1O5PA 4CKVX 2L7UA 3MRDB 3C2AH 3MCKB 1HSBA 4RGMC 5C0AE 4I18C 5FB8B 2VAAA 2EDBA 3PHQB 3HZMA 1U21A 3ABGA 3QI9A 4OFYD 3WJLA 3TBCA 5FFLA 2KZBA 3FULA 5HYSA 5IFHL 1BG9A 2UUDH 2XQ0A 2H1PL 5TDOA 5CEXA 2C1PB 5GS0D 2Z91A 5CFAA 4RRPA 5CU9A 3WLBB 1EANA 4BBWA 2AJUL 2EECA 3HB3B 4ODXB 2CALA 3B9KB 1C7TA 2CO2A 3WTSA 2ED8A 1MRFL 1RUKH 3GSNL 4LLYB 4DKEH 4F8LA 2V7HA 4X8XA 4O5LL 4DAGL 1D9KD 4X7FC 5C92A 1L7TL 3JV5A 1JHKH 5DQ9A 2V5RA 3WO4C 3V0WH 5I0VA 5LB1A 1R3LA 5C08B 3U82B 3CZEA 4LEOB 1M05B 1WUZA 5LGJA 2FBRA 4E2OA 3V0IA 2AGJH 2E27L 3O6ML 2P46B 1FGNL 2ARWA 4JRXD 3FT9A 1OGPA 5TE4L 2XFGB 4GIPD 5ID0B 5IWLC 1K4DB 1J8HE 3DOHA 1IT9H 1JZFA 4EIUA 5GGSY 1YC7A 3IWVA 4UQDA 5C1MB 3TBSA 1T80A 5L6YL 4XVSH 3T3PB 4Z3FA 1J88A 3VSUA 4BGLA 2R29H 4B95C 3K5SA 3QIWD 1LK3L 2V33A 3ZRFC 4PJCF 1L9RA 1G1OA 3AM8A 3UMTA 4ONFL 4NOBA 2ICEA 4OCYL 5FF6B 2F61A 3T0VA 5C70A 3W2DH 3QHZL 4IBQA 4JFDB 2MWCA 4UQIM 5FYKU 3R19A 4XBMA 5AVSB 1CK0H 1JMZA 3HMXA 4N5UA 5D5MF 2CRYA 1WWWX 2O72A 1P9MA 3BE1H 3U0PB 5EBWB 1PLAA 4ANKA 3QDGD 5KSUA 2WIIA 2Z4TA 3BEWB 4MNQB 3GSWB 1UFUA 2OCFD 2YN3A 4R8WL 3ZKQD 3I6GB 1S9YA 3RURA 4YLCA 4BFRA 4ZZKA 3GMRA 2YKLH 4XOAA 2VCOA 4ZO6A 4U1LA 1HQ4A 2MPAH 1DSYA 2VLJE 1YYLH 4PWKA 4M02A 1A14H 5C7XL 1MCNA 1MWAA 1DQML 2A9NL 5J1AB 3KPRD 1OXYA 4LNVA 2QLYA 3RNQB 1MVUA 2XTSA 4Q6KA 4JN2A 4IDJH 2GJ6A 1QLFA 4E9SA 1KN2H 1RIVH 2WNWA 2NZ9C 4JQIH 4A7QA 1I9IH 4ZS6D 3VFVA 2AJVL 1GOFA 3X13B 1DZ0A 2K78A 4M7LT 4NZTH 3WBDA 2DJUA 4KNUA 4C4BA 5IVNA 1VZGA 3WKYA 5DU7A 1CK0L 1UT9A 2PCPB 3KPQA 3WFHB 2YO3A 1JNNH 3LKPA 4NPJA 3S88H 1UCTA 2H3XC 4S1DD 5F7DB 4EN3A 3HW7A 1LEIA 1UJTA 1F4WH 4XVTL 1MNUH 3GHBH 1EO8L 5KBMA 1L6PA 1GXEA 1NGYA 3DHMA 3X13A 3K2KA 1TZHA 2X88A 1KCSH 4NNPL 1UCBL 3G08A 4E9XA 5IMMA 4CC4A 3CZLA 1AAJA 3UTSE 5GZOD 3SE9L 1EA9C 1GTNA 1OO2A 1PDKA 2QSCH 2NY4D 1WS8A 4NUJB 4M7ZC 3L3OC 4I5BA 1LEIB 4YXKH 1DVYA 4HHAA 5CLZA 5ANME 4HMEA 5IW3A 1QRNB 5HD8C 5CUSH 2OXGB 3NCJH 4AW4A 3FDWA 2VJXA 4ONGL 1J5OH 5JOFB 1TCRB 4IRSD 1EBPA 3QK0A 3ALXA 2GUOB 2Y36L 3WD5L 1M71A 2XYCA 4NX0A 3RA7L 1RD6A 4AT6B 5AD0B 3KLHD 2CPUA 2FJHB 4LARH 3PDDA 5C0AB 4ZMAT 5J11C 4JO3L 2AV1A 2RCSL 1VFOA 2NY2B 3V6BR 3U9PL 4WKXA 1JZIA 4N0RA 2E0PA 2WP3T 4J27A 4J6RL 5I19L 2DYRB 3CXHK 2IADB 2DLHA 3BMWA 3EH2A 4PGEA 2OYPA 4D7BA 5F88A 3QWNA 4EEEA 3SJVB 4MCZA 1NM9A 1AD0A 1BSIA 1UEYA 2A4ZA 4Z0XB 1ET8A 2FBJL 1F4XL 4M62H 2YXVA 4UT6A 3JWNG 3WDHA 5BQ7A 3DKHA 3GS4A 2PCXA 3CLFL 1OK8A 4YAQB 3CU7A 5JW5B 4Z7WB 5I1KH 1L7IL 2BPBA 1NCWH 4NT6A 5DZJA 5IF0A 4NN5B 1W72A 5DMJB 1TLMA 3FONB 3L1GA 5TQ0H 4F2MB 1BX2A 5IVXF 1VKXA 2QADC 5E8NB 3TIEA 1INDH 1PZAA 3U25A 3IRCA 1Y18B 5HDLA 1ODUA 3LQZB 4KJPC 4TQHA 4QRRE 3ZDYE 2E3VA 4CGTA 2VXSL 3VH8A 2DQEH 3U2SA 1RJYA 1AHKA 1A2YB 2P5WA 1JDDA 2CLVB 5ENWB 3U36A 1JZHA 1X5KA 1JN6A 3BQUB 5FKPA 4F7EB 1MNNA 4Q9QL 5J0BA 3B2MA 4PWIA 4EN2A 4YC2C 4FHBD 2Y23A 2XFXA 2YZ8A 4H8WC 4MMXA 1N68A 2V2WB 4HLJA 1UTDA 1LEKA 5JHLH 4IRZA 2XXFA 4CSPA 5SX4I 2QSVA 3CTTA 1E0OB 3HPJA 1ED3A 4NUPA 4EN3B 1FPTL 4ZO9A 4K7PX 3BO8A 1UUSA 1PLCA 5EULV 3U2JA 2WOYA 3TOPA 1QQDA 4XP6L 5MI0C 2B8OT 3FPYA 2EUXA 2ZKYA 32C2B 5HJGA 1HCZA 5INDA 4PJGA 2X1QA 4P5TD 4PS8A 1T5KA 4LHQB 4NQEB 4P57B 4DT2A 1TKWB 3B37A 2VISB 2VXSH 3HCVA 3IB4A 2B3IA 4G9DA 4J1UA 4LSUH 3EYFB 3DV6B 3BQUC 2GB2A 2XWTA 1FZKA 1NBYA 3FFCD 4PCTA 1E4WL 5I1AB 1AZVA 3DO7A 2FIRT 1J8HD 4LPTA 2AEPL 4G8GE 2OMTA 1VIWA 3MLSH 4G6FB 1K5NA 1QSED 2LAGB 2GSGB 3CJJA 5F7EL 4KKCD 4XVSL 3H9SD 5G2NA 1HXYA 1OARL 1SPDA 1FBIH 4QGYA 4PJ5A 4OKVB 1H3PL 2DN7A 2N1TE 2WYIA 3OAYH 1I82A 5PCYA 2F6AA 1HOCB 3D85D 3ES6A 1I4FB 3GMLB 3X1EA 4GUOA 2IANA 2CLVA 2NXYD 2J8UA 3F6IA 2BNUA 1Q9OA 3D4YA 1UQSA 4N2OA 2H2SC 4QY8B 2W60A 3ZTNH 4BWTA 1ID2A 4HGKC 2WO2B 1JHTA 1ZS8A 4NKIH 5GSVA 2VMFA 4X4KA 4LKXA 1DSFH 2A5UA 2N7AA 2UX6A 3C5XA 3DOIA 2QHLA 4TQIA 1UACH 1MLCA 2YEZB 3CN4A 4K07A 2BNQE 3QCUL 4PJXE 3G6JE 3P2TA 5DRZA 4UOW0 3HS0A 2FTAA 1ONQA 1MXGA 3N9GH 5ICYB 3O8XB 2O93L 5D2NB 3OQ3B 2A6KA 2M8XA 3TBBA 2C9VA 3IPBA 3PREA 3VM5A 3WIHH 4MAYA 1I53A 1BQHB 2YBRA 4FLOA 1S7WA 4IRSB 2D73A 5E9NA 4TUKH 5F6IC 1JV5B 5KVGH 3QG6A 5EUOA 1RZGA 3SYAA 3NJVA 3ESMA 2GK0A 3F6LA 4XPFL 4PW9A 4UQBA 1FDLL 4G5ZH 1E3ZA 5A7EA 2BVPA 3DXAD 1MHHA 3QI9C 4MJIA 4YDMA 4E5XA 3D5OF 3JWDC 5HI3C 2YGPA 1S5HB 2Y3NA 1YO4A 4IHOB 3RWGB 4LEXL 4KO6A 1EMTH 5DMGC 2WZPA 4TNVK 1SEQL 3A4AA 4XVTH 3KWVA 1JTTA 5I1IL 4OZ4A 2YAQA 3D85A 4G1MB 3V4UH 1PSKH 1E67A 4P99A 4NN7C 3KYAA 4WO4A 4D0CB 2J6WA 4X5WA 4PJ5D 3P4MA 4U1LB 2UX7A 4PJFE 2XLLA 4R7LA 1O6VA 3VWJA 3JWDH 1H8NA 5J56B 2YFNA 5HYSB 1ZT4A 5E00B 2MQ0A 1R17A 5GJSH 2HVBA 3AACA 3PFUA 1D6EB 5EMYA 3UEZA 5D7LE 4JPIA 3LN5A 4YSTA 5IJKC 1KPRA 4ONGH 2HG5A 1IM9D 3MZGB 4HPHA 1ZLSH 1MHPL 1FZKB 1NBYB 5DLMH 5FM8A 4YDKL 1Q9LA 1V10A 3NFNB 4LSRH 1ZSHA 4F8QA 3T2NH 3UAJA 3O9WC 4QHLA 4Z5RA 3PUCA 1KIPA 4M3JA 4E68A 2XN0A 3FOLA 5A16B 3RDTC 1SUHA 5JQIB 1CL7H 1I9EA 1ZD6A 1ODAA 1L9PA 4BFOA 1CWVA 1WCQA 4HJ0D 1NCOA 4MA8H 5K9JL 4Z7QF 1N0XL 4KDWA 2X05A 4MXVF 5C0EA 2F54A 2F54E 4UAOB 2DI9A 4M6NH 2NXZC 4B27A 2CIKA 1ILUA 4F15C 2YLHA 4NO2A 1B88A 1FE8H 1HHGB 1P4UA 1GGUA 3BKJH 1CI5A 1K8IA 3BUPA 3IM1A 3UROR 4UAHA 2XZCH 5TE7H 3ILDA 1L9NA 4M3KB 4PRPD 1BJ1J 1AGFB 1KN4H 2XIDA 4HMCA 2E8ZA 1NUNB 5B39G 3BGAA 2VXVL 2XG5B 4NKDB 4R5VA 3BAWA 1BD2A 4H26B 3C6SB 4AJWA 2AJXL 5EEVA 1BXVA 1Q38A 4PBDA 4ZSOB 5FO7B 3U1SL 1Z9PA 5CN1A 1J9TA 4OFPA 3FSZA 1A6WL 1NL0L 2MRYA 2ZXBA 3MAWA 5DJ0A 3H9SA 3QXWA 4Q58C 3ZXAC 1UD8A 4IIQB 4PG9B 2H2SD 4QTHB 4OLZH 4G6FD 4IJTA 1ADQA 4JJ5A 3DGGA 2X09A 3CLEH 3GTNA 3FSVA 3LV3A 4LLQA 1DDHB 2XYBA 4Z78A 4OD1L 5HDWA 4KX8A 4Q9QH 3CN2A 4W6YB 1F6FB 4OR1A 4ES9A 1N8ZB 4JM2F 1BBJB 1HWHB 3Q2VA 3K8LA 1T5WA 1T6WA 1A7PL 2I9TB 4DN4H 3NA4A 3NCMA 4KQ0A 1LO3L 4TUJA 4WY7L 5KG9B 4HDIB 3CH1B 1OLZA 1YNLH 2NNRA 5CZVH 5HVGB 5TE7L 1NC4A 1WFOA 3QPXH 1QACA 3KEHA 4H7VA 3OKDB 3IJHA 2Y0SA 1TQBB 2WQSA 1CPUA 4UU9A 2XWRA 1W72B 3V52L 4OJEH 2GCYB 4GKSA 1BD2E 3ARQA 3UC2A 1JGDA 4MHHG 4NQXA 2XZZA 5F9OH 3K91A 3VD7A 4I87A 4IGBB 2BNQD 4BK4A 5KYWA 1YJDC 3DUSB 3IMUA 3OB8A 1Z3RA 2OR7A 1EDYA 3RIAF 5LO7A 3DI2B 4K2UH 4K23H 5E95B 1MF2H 4YVUA 2WZAA 4DP9X 5CCJA 4W6XB 1JPEA 5CBEA 2HB0A 5E6ZA 1PYWB 3R4DA 1SHMA 3DX7A 4JX0A 5DLLA 3SDAD 3MOBH 3LRHA 4HPOL 3G6JA 4X8CA 5GZOA 1DFBH 4F1ZA 4B0MB 1KUMA 3FQTA 4OZIA 3VWKC 2FZ3B 4P46D 5H37H 2A9MH 3NCYS 2GITA 1SQMA 3OPZL 3CSYB 3ETTA 3QZLA 1C16B 3MKGA 1V55B 3DVGA 2CBTA 3EYQD 4MXWL 4AV4A 3RX5A 3HHSA 4R4ND 4HUVB 5EN3A 3WS6C 1WZKA 3QDHA 2BNUB 1B0RA 3DO4A 4ZFOL 2H5UA 4FDWA 1MWAL 3IS0X 5IROC 1PEZA 1GJWA 4HJJL 5CD3A 5IQ9B 1NFAA 2J8UE 2ADYA 2MCAA 3JT0A 4J23A 4XN5A 5I6MA 5BO1H 4HOXA 3N85L 1N67A 2A0LD 1NGWB 3OAWA 4JHAH 4KPHL 5I6KA 4PJFA 1THAA 4EBQL 3H6AA 3SOTA 4YVNA 1ACYH 2PO6B 3BVNA 1L9OA 2M2DA 2UUDK 3N1PC 1KELH 4FFVC 5FGCB 3RVWC 4XHJC 3RTQC 1SF5A 4KXAA 2BOBA 2VSMB 2XWTB 1G94A 1CFQA 2HN7A 3KDMA 3H0TA 2QPDB 3JV4B 4FCAA 1QSFD 4JFQB 4Y4FC 4ZO8A 4DKFL 5I30L 2JJSC 1KCUL 4TRPH 5C71A 4G7RB 4RA0C 3K71A 4E41A 1YEGH 1U2CA 2YA1A 5ACLA 5FYKD 3GXNA 1OAKH 3NFPB 2XX1A 4BKSC 3EBHA 1CVSC 1RZKC 5C0ND 5TDNB 4M93B 3T3PE 2LAAA 2VN3A 3LZLA 3LQAL 5E6UB 3V0VA 3RKDC 5DURD 1P5VB 2G3ZA 3IJ7A 1ETZB 5E2WH 2IG2H 2EYSB 5SX5H 3QJHB 4OLVL 1NDTA 4PJAA 2DM2A 5GGRA 3X12B 3LZOA 2QV2A 4HS6A 5DRZB 4LPUA 2NNFA 4F33A 5IIEA 3HMWL 5CJ5A 2EZ0D 3NQKA 1RAMA 2J88H 4GAJH 3STZB 4FABL 2JJWA 2ZZUT 4OF7A 3V4VH 3LKOA 5D2LB 1BFSA 2VMDA 1V05A 5E6IB 2R2HA 3P1VA 4GFTB 3EGXB 1YDPB 5D1QE 5C0CE 3WIIH 1X5MA 1KXTB 4AGNA 5LN4A 3BKJL 3O6FD 3PWPB 2FX7L 3P4NB 4CBPA 4FQXA 4MKTA 3D25A 1N0LB 3H2QA 3N1GC 1R9FA 3QFDB 1CFTA 3ZR6A 2Q8BL 4TTDD 5JR1L 1MFDH 3A22A 5TPWL 1G1KA 2A6JA 1K6QL 4HUCA 2H7WA 3EJYC 1J1XH 3IU4L 3MRRB 5FFOA 3TZVC 4E42A 1U42A 5FYJD 1FN4B 3UZQA 5KTEL 4XPHL 4G8GA 4R7XA 4FADA 3QDJD 1WSST 3RWFA 3D3VB 3EFFA 4LAQH 3U6XA 3MRFB 3EYFA 4KKZA 4OCWH 5EORH 1L4IA 5EF3A 4BKTC 4ZUSA 4P9HL 3WY1A 3O81A 2JJUA 3MV11 3O6FA 1T0PB 2VXUH 2D9QB 4HLZG 4OF3A 4YN3A 4DQOL 5EIIA 5ERWB 1JGLH 3BQVA 1QLEH 1R0AL 3R06A 2D7PA 1DLFL 4QTFA 2R1WA 4Z9KB 5DZNA 4POUB 2X70A 1P5UC 3GS0A 3O0LA 4JM2D 2F74A 2I9LB 3QWRD 4WCYH 5DUJA 5GGVH 3CFBB 4GW4A 3V7MA 3KWWA 4JHWH 2A9AA 3NIFB 4EOWL 1NCUA 5LGYA 1WZAA 3BGMA 4WK0B 3TJPA 2DTML 4DQAA 5CJXA 3QFJA 2Z91B 2P80D 35C8H 1NIAA 3TEXA 3D0LB 4QOKB 3AMLA 5JXAL 3B34A 1XR8B 3HE6B 1CU4L 2BNRE 2YOCA 3LRGA 4E41B 3UTPE 5L4MA 3W38A 1MLCB 2KUTA 3D1MC 3TNMA 3V7AG 1I7TA 3FTGA 1DL7L 4LLMB 2Q7NA 5D8JL 2H45A 4K9EL 3QEGL 4AYBA 1W15A 5IB2A 2C9XA 1LM8V 3WTUA 1TJGH 5E8OA 1TJMA 1FRGL 4P46C 3S4SB 2AANA 4GMTL 3QQ4A 4UI2A 3K2MC 4RDQG 2BP0B 3E2HC 4XP9L 4HOZA 3DHPA 1MCHA 4KQ3L 4G8IA 4K55A 3G6JF 1R24A 4OD3L 1M4KA 1CT8B 3VFNB 1NFKA 1HZLA 1AZUA 2XKNA 2D03H 1IZKA 3FO1B 2IV9A 4PJ9B 1YYCA 1R5VA 5FHBH 4IU2B 3DNKA 3KAAA 2D7TH 3GZOA 1KJ3L 3OLIA 5LBVA 2X9YA 3O3AA 2C3VB 3CDGB 3NG5A 4GRLB 3D18B 4XP1L 3SGEH 4LP4A 3FT3B 2XWXA 4KK8C 5DQDH 5CCKH 2HJLA 3VFSB 5A2IH 2ZOKB 4NQSA 5J6HB 4GFXA 5I74B 3F2LA 2Y4SA 3LNIA 4PAZA 4PB9L 2WXIA 4QNPF 5ACZA 2QT6A 1XH2A 4I3RL 5H8DA 1L5GB 1DL7H 5SWSE 4WV1A 3LPFA 3HOGA 3RNKB 4PGZA 3REVB 3KWXA 4WNJA 3SDXE 2Y1AA 3VMNA 4DESA 2WMPB 3IWUA 4IOFD 1KFAL 1PLGL 1X9QA 3LTVA 3RTLA 1TTCA 5C0IB 3C8HA 3RBSA 1SHXA 4M48L 1D7DA 4E36A 3CH1A 4JZJB 3IDNA 1A9EB 1E6JL 2X4UA 1KEGL 3QT2A 3MTRA 3DVGB 4L1DA 5DURB 2WO3B 2Z92B 4NUQA 3IGFA 2YXFA 4KQ4L 3SDAA 4L5FE 1S7UB 1FL3B 2IQ9L 2O5YH 3EHBD 2ATAA 3SKUD 2P5PA 1KGCD 5IOPA 4YDJB 3T3MB 1Z0MA 4XBGB 2NTFA 4KNTA 2VWEE 4ISVB 1ZLWK 1KTDA 1A0QL 2IWFA 3UTSB 4TLSA 1BJMA 1CDUA 2R7EA 2Z0UA 4PIBA 5D5MB 3FQNA 4MAZA 3T0DA 1AE6H 4NXSA 3P3RA 4QKXB 3WEBA 3MUZ1 4AXWB 5CS7A 5DVOA 5CP3H 1L0PA 4P3WA 4R0LA 3WEMA 2FLMA 2ZNWA 4HIJA 3QNYB 4Y1AB 3KDPB 1VERA 2PCPA 4OQTH 2IIJA 4M00A 1F90L 3WFHA 3O6LH 3A4DA 4GSDH 1LMKA 4UU9B 3JVGC 3TNNA 3H8NA 3QUYC 2XC8A 3G5YB 5T1DL 1DLHB 3U48A 3B6SB 1FGNH 4W9HC 4UBDD 2VE6A 3IDYB 3GIVB 1RURL 1YECL 4X5RA 4C8XA 3A6BL 3S36L 3MJ9H 5G4NA 4TTDC 3D2UA 1XGPB 3C5ZD 4UTBA 4G83A 3PP3K 3PABB 3H9SB 2DQMA 1UH4A 1OCCB 4IRZH 2QSCL 3HBZA 3ZYJA 1LQBC 2OTWB 1LTXA 3EJSA 4V1DB 1KNOB 4ZXBB 3T9WA 3ZZSA 5K9OA 4PRID 5IVOA 3ULVD 2MQ3A 2DQTH 2MIZA 3BYYA 4Y5YA 5EZLA 3PHQA 3GB7A 3MRMB 3HI1A 3RB7A 5D55A 5L88L 5AOKA 1AZZC 5C0FB 5I1IH 2BP8A 1OSYA 1X4ZA 4I77L 1UD6A 4EPSA 2HZHA 2V9QA 3EGDA 4YNYB 3RZWA 4AM0B 3ZDZF 5BVPH 5TF1H 5GGTL 4BFJA 4TL4A 2PXYB 1U3ZA 2NTFB 3QIUB 4UTBH 2CR0A 5E6IA 3EGXA 3JWOL 4QRPA 3FMGL 4JKPH 4ADIA 4WZ9A 1A7OL 4NHCL 1UG9A 3VGEA 5D5MA 1AI1H 1KY6A 3UJJH 4YHIA 3U1QA 2EIEA 2JI3A 5DO2D 3MNMA 3N0AA 2ZXDA 4JB9L 4LSPH 4XCFL 3UPCA 2MNWA 5DFVC 3KLSA 1M57B 2WTRA 3JT2A 1FFOB 3V5HB 1I8MB 4IMLB 2BSCA 4AVKA 3VXMD 1P5VA 1VFBA 2NY2C 5FAAA 4AYFB