1WHPA

Allergen phl p 2
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
94
structure length
94
Chain Sequence
b'VPKVTFTVEKGSNEKHLAVLVKYEGDTMAEVELREHGSDEWVAMTKGEGGVWTFDSEEPLQGPFNFRFLTEKGMKNVFDDVVPEKYTIGATYAP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ALLERGEN PHL P 2
molecule tags Allergen
source organism Phleum pratense
publication title Crystal Structure of Phl P 2, a Major Timothy Grass (Phleum Pratense) Pollen Allergen
rcsb
total genus 16
structure length 94
sequence length 94
ec nomenclature
pdb deposition date 1997-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01357 Pollen_allerg_1 Pollen allergen
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.760 Mainly Beta Sandwich Immunoglobulin-like Expansin, cellulose-binding-like domain 1whpA00
1BMWA 2JNZA 2VXQA 3FT9A 4FG2A 4JCWA 4JS7A 4FFTA 1WHOA 2BH0A 3D30A 4FERA 4FG4A 2HCZX 3FT1A 4JJOA 4L48A 1N10A 1WHPA
chains in the Genus database with same CATH superfamily
1DQTA 4IRZH 4X99B 4KKAC 4J2QA 3QIWA 4TRPH 3W81A 1AQMA 4B41A 4JPKL 3DV4A 4NHUA 4G8GA 4CRPA 3H0TB 5D7JB 4DAGH 1C5BL 1OWRM 4DVRH 1DO6A 3PNRB 5DJ6A 2Q5BA 2Y06L 1F2QA 1L9QA 4ZPTA 4L3CA 2V7HB 3E2HC 4IBSA 2EE0A 3AU0A 3V2AR 4IW4C 2X28A 2IQAB 3C60B 4M6MH 3M46A 4NM8H 4TVSa 5CINH 1WGVA 1EHAA 3WN5A 5SV3A 2ODIA 3L8QA 3QRBA 3I6LD 1PZUB 4NI3A 4DZ8B 3IDNB 4V1DB 3VI4A 3WNMA 1DJIA 2XZCH 5D7HA 2Z4QB 4BK4A 3UJIL 1ZXKA 1OSYA 4WEEA 3SGDI 3ZSTA 2NY1B 3DDFA 5BJTB 4MNQD 3FQ4A 2Q3XA 5C0CA 3QSKB 2CKBB 3HG1B 5HBBA 2WLNA 1WS8A 3GSRA 4N8VG 1ILUA 1NCBH 2HA1A 2H41A 4KZEL 3WEXB 4HQQL 2HZHA 1MOEA 4XVOA 2ICES 2XFXB 5TDPB 4U6HB 3WTUA 1LEGA 3WDIA 4JRYE 5DFVC 4GMTL 4UV7L 3UPCA 5FA4B 3CSYA 2EVHA 1P5VA 1IQDA 1EQWA 5TF1L 1JPGB 1FZJA 5D1XD 3NIDF 3KWUA 2DI7A 2VGLM 4HKBA 1YN7B 4YEEA 4ZQTA 1VGEH 2ITEA 5FYKU 1QNZL 2BINA 3T08A 5CD5C 1QEXA 4KJWC 4V1DD 3X11B 1N5AB 4WFFD 1R24B 4I0PA 3IPEA 4U2YA 1UVQA 2E7HA 2MNJB 4N6QA 2DOCA 1TCMA 1E8ZA 4QXTA 3VI3A 2K4WA 4BBWA 5EF3A 3EYOB 2EJ1A 4HHWA 2CE6A 4C4KO 2EZ0C 2AVGA 3G5XB 1SOQA 4W4NA 1DZ0A 1WV7T 3G9AB 3VFNA 2UWEE 1YN6A 4PRHA 4R97C 4GG8B 4HKXB 3NCWA 3KPTA 4G80A 1J5HA 4JO4H 1PKOA 5I0VA 3TBSA 3RTQB 3GGWB 3HAEB 2OM5A 1E4WH 3M8OH 3QJUB 4MMXB 3TA3C 4KNQA 1TJGL 4ZSOE 1MCCA 1CE6B 3HHRB 2IDQA 3S3DB 4WWNA 4OTXL 4OF0A 2E8YA 3VFPB 2B5IB 4U1SA 5CFAA 3D4GA 4K15A 1P4LA 1MCEA 3MCLH 1M56B 3PHSA 1A21A 2JF1A 1Q1JL 3M17B 3UJIH 2WMPA 3GI8H 2GUYA 4YIQA 2BHFA 2W65A 3OB0K 5F8QC 3GXIA 2I7OA 3E1F1 2WQ8A 5FLUA 1YNKH 3OMNB 2EO1A 4K5PA 1RL1A 2CJSA 5IMOB 3E0GA 3A22A 1M6OA 1EAPA 1MHEA 3EYVB 2IPKB 3JTTA 5D1ZB 3QIUD 3R06B 3FQXB 3CGTA 5KVGL 3UXFA 3ZDZB 5T1LB 3RIFF 5IJDC 5D1ZC 5LUMA 5T33L 5I1HH 3NCFB 4Y2DC 4AZ8B 4E68A 3EFFA 3LNEA 3QDJA 2FWOA 3I75B 3IU3B 5F72S 2Y2YA 3OKLA 2OMZB 4IIQB 2YEVB 3WBDA 1AIFA 3O3EA 2R51A 5T3XE 3EJYD 2DM7A 4NZTH 2XA8H 1EZSA 1FG9C 1B0RA 1WTLA 1E28A 3V10A 3RPIA 4H88L 1I9RH 3QH3A 4KPHH 3ESMA 5DRNB 5I6XC 5F0MB 3IDUA 3G9VA 3VJ6A 3PRZA 4L9LA 3EJRA 1H9DA 1S3KL 4LZKA 2I25N 4LXFA 4X5QA 3POCA 2X1PA 4P2QD 4AV4A 3CPLB 4KX7A 3I6GB 1KIQA 4MMYB 2OSWA 2BVPB 4P0DA 1JYXA 3L45A 2BERA 5MEQB 2YGVA 1OY3B 2MOQA 2E9GA 3MTXA 4QIRA 1F58L 2YEQA 1I8IB 5CNHA 1R4XA 3DPBB 5CZXD 4ATWA 1WICA 2VM4A 3PL6A 3BE1H 1SDDA 3MR9B 2PW1B 3VM7A 1OSZA 4ADJA 2VZUA 4B9GA 4PJGE 4N2BA 4XB8A 4MJ5B 1EIBA 5E2JA 1F3DH 3NN8B 4AC2A 2ZXWB 1O6SB 2B1AH 3QORD 1BAFH 1MCQA 1Q9WB 1EHNA 4PS3A 4R7VA 1SMDA 3CFQA 4K9EC 3SGDH 3AZUA 4JJHA 4XO3A 3WHE1 3C6EA 3C75A 2VE6A 3L2MA 4PRNB 5A6MA 3DDGA 3QORA 5J11C 1CLOH 5LGKA 3GMMB 4FNUA 5DRXB 4F7MA 1FH5H 4A6YA 5K9KA 2VIRA 4F7CA 4NRZA 1C08B 3N1PC 3AT8A 1Q38A 1NMAL 4GRMB 1S7XB 5C0BD 5BS0E 4LLUA 2X2YA 3FN0H 2BXZA 3FT4B 3NGBC 4I3SH 5FUCC 5I6OA 1L7IL 4N9GA 5KS9A 4HYTB 3ETTA 2Q0ZX 5GGUA 2W0FA 1DQML 1KIPB 1SNRA 3KH3A 1WISA 1E3XA 2ADGA 3ZDZF 2XI9A 3Q1SL 2DQCH 5IFHH 2XNAA 1ZT1A 3N41F 4MDIA 3BUQA 4LCVA 5DURB 5I8OL 1RLBA 4J1UB 4X5WB 4XP1H 3VXMB 3WN5C 3JWNH 3TYGH 1HOCA 2IFFL 1TMCB 2Z6FA 4S0SD 3KXFB 5I8KH 3QDJE 3QUYC 3B8YA 3GHBL 4ZOCA 4W4OA 5KJ4A 3N04A 4OIIH 3U0TB 1W8NA 2HWZH 4KUCD 5L4JA 4GLRH 3ZUCA 1RIUL 5HGBA 1MHHB 1NCWL 3BT2H 4HUMB 3B9KC 2YXFA 1N3NA 4IJ3B 1DSFL 4KJYA 4H20H 3O6FA 1JS4A 4LLAA 5EPMB 3EO9H 3STLB 4HIJB 4Q89A 3QR1A 3V6BR 3HHSB 1BQHG 4P04A 1QEWB 3K3QA 1NSNL 1GZQA 4FLHA 5EOTB 4JPVL 5ETUA 1QI4A 3TT1L 2DIBA 4AJYV 3B2XA 3AUWB 4MDJA 4NZRL 4PV1C 1NGWB 4GRLB 1GC1H 4F1SA 3RJDA 2DLIA 2LHAA 4NX0A 5ECGA 1NINA 2CGZA 5EZJB 2ZWSA 3PDGA 4K5OA 1G9NL 2MEJB 1WT5A 1XCTA 5IJBC 2EINB 4TPRL 3CVIH 3BO8A 4Q0XL 2WD0A 2PCPB 3NT0A 3D85D 32C2B 4LLVB 2VN7A 1HILB 5FCUL 1W72H 3K8KA 4ZNCD 2YD7A 2HAZA 3IETA 4YO0B 2RBLA 2R0LH 5BUGA 4A7SA 2P8PB 5KYXB 1HNGA 1GKOA 5DD1H 4DVBB 1AD0A 4L8SB 1P7QD 2XZCL 4LDLB 3PQYB 1BQUA 2QSVA 3EJZD 4M56A 5FOBA 4E42A 1NOLA 5CEZE 3FQ2A 3VI3E 4WJG3 4Z5RB 5I5IA 1OO2A 4OLXL 4LESA 3GMQB 5BOPA 4ZMQA 1VERA 4MMXA 5IHBA 1QABA 1A9VA 3DVGA 4E41D 3FO2A 2X0UA 4F1ZA 4DN3H 5MHSE 2E7LA 2X09A 4LCCB 4OI9A 2PO6B 2PCFB 4R2GC 3ENEA 2WQWA 3NCEB 2NR6A 3A47A 3EJSA 1J8SA 3FU5A 3CDGB 4G6KL 2UZPA 2DQGL 4EN3B 2CO7B 2GSIB 1OAUL 2DQUL 3WIFB 4M5SA 1F58H 3LJ3A 4YPJA 4XPFL 4EN3C 1J5OH 1WC7A 3VMPA 4GAGL 4JMNA 5C0CE 4PVBA 4KWUA 1IKOP 4UTAA 2VDRL 5CILL 5IQLA 4LSTH 4WI3A 3L5WB 2OJEB 1MAMH 2WBXA 1NBCA 4FFTA 2KZKA 1SXCA 3CNKA 3MUGB 4JRLA 1PD1A 3EW3B 2ZCKL 1DVTA 3VFWB 4KKQA 5I1EH 1J18A 1AHWA 3KYOB 5D7LE 3OKEA 2DQTH 4YS4A 2H8PA 4P2AA 4GP5B 4QXVA 5I75C 3FZUC 3K80A 2Z31B 3VXME 3BWAA 5FWRA 3SODB 4Q74A 2V9QA 1NGZA 4PRPB 4XAKE 1RULL 4MNGB 3LRGA 1XAUA 2IVFC 2YD5A 5SWSE 1H6UA 2BSSB 3TFBA 1WCBB 1BZ8A 1NFIB 3LQZA 1TEGA 3T71A 4N2LA 2FAUA 4ODUA 5BS0B 4KC3B 2ZYIA 5DVKA 1TZ8A 4JFUA 4Q8BA 4FQHB 4B97A 1UOLA 1TJHH 2Q3AA 2R2HA 2XWTB 3I9GL 1N8ZA 4M6ML 2ZKHH 3UBXI 5T1DH 3MBEB 5C1MB 1KTCA 1LLAA 1XIWD 3PWVA 1SGKA 5C0IB 4F20A 3GBML 4XXCA 1BG9A 2FECL 3HC4H 5EBMB 4QXUH 4L8CA 1UFGA 2OMUB 1NDGA 3C6SB 4PGEB 5E8NB 5IFAH 1HWHB 3N9GL 1ORQB 3QG7H 2B39A 3BC9A 3ME0A 4LP4A 3TBTB 5ABDE 2ADFH 3N85L 2FVNA 5CGBA 4PVLA 4JCMA 3EGDB 2DBLL 1JGUL 2J88H 3I2CL 3U6XA 3KPOB 1J05A 3NN8A 4H20L 4TRPL 5IFJB 5DZPA 2ERJB 3C6LC 4LQ1A 1NUNB 4WHYG 2ZOKB 2AABH 3FU6A 5DR5L 3RGVD 2VRAA 3ZT6A 1H6FA 2OSLB 4IOIA 4LARH 2N1TE 1IC1A 3NZ8B 3SCMD 4M4RA 1B4JL 3ARPA 4CMHC 1JNJA 3WEMA 1GGBL 4MAYD 4OF3A 5A2JH 3T3MB 4QHMB 3D34A 2FIKB 3P3SA 4LIQH 3H42L 4BSVA 4JDTL 4P9ML 1RPKA 4Y16C 2WQRA 5DK3A 1IGJA 4IMLB 4UT7L 3VMOA 1A65A 4UILL 3UDWA 1GZPA 1V3JA 1PNDA 5AW0B 2XJLA 4K9EH 1DQQA 1E2WA 1PCSA 3QWRA 1ZWIA 4MDIB 3FQNB 5CEXA 3TZVD 3GMNA 5DJZA 3LNDA 4WKZB 4ZUUB 4BYHA 3GK8L 4LL4A 5E24E 1ECYA 3RL2A 3W2DL 5JHDD 3HNTH 3Q44A 3U0TA 4LPWA 1VIWA 2OLDA 1KBKA 3RVXC 3N1GC 5G5DB 1K8IB 2ZXDA 5DJ0B 3CCHB 2J6EH 5ANME 3VACA 2QSTA 3KEHA 5BO1H 2GJ6B 4URKA 2OXHB 1X9UA 1U92A 3KPQB 4PRBA 4JPIA 4Y4HC 1KBGH 2KLRA 1NL0H 2KDYA 2Y7MA 1MZYA 3UH8A 1NWOA 1R47A 3BPLC 2CGRH 5EC1B 4JLRB 1BZ9B 3JXAA 2FYYB 1TENA 1E9OA 3RWJA 2WLKA 2FYVA 2W9DH 3UO1H 1C12B 3T0EA 3R1GH 1B4JH 4LLQB 4O02H 1MFDH 2Z9TA 1D5ZA 3SCMA 4GAYA 4AGLA 3BVXA 1PBYA 2G60H 3OG6B 4QOKD 3BO8B 5I1JH 1WA1X 3HRZB 1TU2B 3MRNA 1SOXA 4KBPA 1A14L 3B7RL 2IFFH 5TK2A 5E1IA 3W9EA 1SXNA 1QHQA 4ODSL 4PFEA 4ZO7A 4BSWA 5FYJL 4MB5A 4ZMYA 2RQEA 1I7RA 2GJZB 2E9WA 4YUEL 3IPBA 4Y19B 1A8JH 1IGCH 1QHPA 1BQHA 3FS9A 4LVNC 4AE0A 4L29B 7PAZA 5AVUB 1CG9B 4P2RD 3CFKB 3FBKA 1S3KH 2E7MA 4J39A 1DSFH 1BXAA 4AH2A 4BJLA 5L2JB 1R5WB 2B9AA 1SYSA 3B9KA 4K23H 1T22A 2D7PA 2GTZB 1KXVA 3UYOD 2G0LA 3RWDB 1NM4A 1RERA 2X89A 2Y7NA 2VO8A 1JD9A 1NSNH 3X11A 3DGGB 5JR1L 4JM2D 1KCSL 5INDA 1KPVA 1DJHA 1F3JB 1VGKA 2XN9E 1WZ1H 1ZANL 4PRIE 3T5WA 3QP3A 2Q9OA 3HTLX 1EFXD 5E9AA 4HU2A 4UV4H 1HE7A 2F58L 2XU9A 4G1EA 1THCA 1TQVA 3FB8B 1QI3A 2PP7A 2R69A 5K9JH 1NBVL 4Y19D 4LU5H 3V4PA 1OAQH 3X3FH 4P06A 2DRUA 2IGFH 2H3NB 1G9HA 3DX6A 4WI8A 2E4FA 1T1YA 9CGTA 5JNYB 1OAYH 4TV3A 3PJSB 1JGVH 4P46A 5KN5A 4GKLA 5B8CB 3FTXA 2EC9U 5BZWB 2WXMA 1FVCA 4JCWA 3GNMH 5D72L 4E0RA 3GLAA 4NPYA 1UXSA 5GPRA 3HI1A 4AEHL 5SX4I 4FI7A 1OVZA 4QOKE 4JGUA 1LO5B 5JOFA 1AKJB 2NUTB 5DZNA 1BQKA 1KN2H 1XSIA 2Z65C 2ZCZA 3TO4A 3K6NA 5FGSA 2W9EL 4R0LC 5LDUA 4YHYC 3UAFA 2HFFB 1GSKA 3HFMH 3NVQA 2ESVD 3ROOB 3IN2A 5E6IC 1JVLA 1KB3A 2E7LC 2CIKA 1CCZA 3OPUA 4XGZB 3SQBB 3UJTL 4AQ8A 5HP5A 2LLGA 2NYYD 1NAMA 3MNDA 3SYQA 2G5UA 2F53E 1G7PA 2VQUA 4L9DA 2CK2A 3G5YB 5EU6A 1QTYT 4HLZG 3V5KB 3WO4C 1BM3L 4R9HA 1DBMH 4HSAC 3FO0H 5E0QA 2XV2A 2YMOA 3A4FA 4NQEE 4HUVA 3T3MF 4WY7L 3JV4B 3QUYB 4UOZA 1SJVA 4G8GB 5E6UB 3ZZSA 2OL3A 4J3TA 2Z92B 4YDKH 3QO0A 2HRPL 4FLOA 1TMQA 4QWWC 2OSXA 3BGMA 3LIUA 1PMYA 2FSDA 5DEJA 3FHEA 4I77H 3TZVB 5J6HB 4HHAA 3JV6B 2CR0A 1VFUA 4IRZA 2E6PA 3QJOA 2A5UA 2Y7OA 4LSDA 3U30C 1AACA 3I3EA 1T20B 3BHBA 4K9JA 5J0BA 3NFSL 4XWGH 2RGSA 3U1PA 4L8BA 3CU7A 2DWEA 2B9BA 5E6YA 4R4FL 2ROYA 3UTTE 1OZUA 1U2CA 4KKBD 3FTZA 3RZCB 1L9RA 4Y1AB 1GYAA 1F1GA 3HBPA 5GS2H 4JHWL 2EDJA 1JSYA 1AQKH 2WBJD 4KPHL 3TURA 5I16A 4I5BA 4CA4A 3FUMA 4D9LH 4NQSA 1E8XA 2I07A 3I74A 5AAWC 2Q8AH 1UB6A 3C08H 3HMXA 5I1IL 3LKPB 1O5PA 4HIQA 3ATEA 2F54D 2A74A 2ICWI 4ADIA 4J12A 1QVOA 3IWUA 1ZK9A 4NQXB 2OZ4H 2BSBA 1P5VB 3OJ2C 5AD0A 5L4FA 2DQJH 5IHUH 2SODB 3QG7L 4LLYB 2R69L 2FHFA 4ABWA 4AVIA 2VITA 5JPMC 4E9WA 2X9XA 1JPSL 1RMFH 1TNNA 1VENA 1YCSA 2HKFH 2ZXQA 4TVPH 5TE6L 3T1FA 2JCCE 2XPZA 3ATDA 5DJ0A 1MHPH 3QFJB 4P9HC 4BH7B 4MKMA 3EADA 4AEFA 3G6DH 4QHKI 1FYTD 1LHZA 1ETJA 4B9KC 3RFZB 4LT7A 3IFLL 3PUCA 3U36B 2WSDA 4JFWA 2CNZA 4IRJD 3ZJAA 4X4XB 4ZO6A 5GGUB 5L4IA 1G1OA 3MA9L 4JMXA 4K8RH 4PB9L 4JO5A 4RGMC 1C1EH 2MPAL 3ARZA 4TPRH 2VZSA 3QS3A 5KYYB 4GG8A 1ZT1B 3G04A 2WLHA 4GSDL 4NFCA 2ARJB 5F71A 4E5XA 4RMBA 5I71B 5F6IB 2GCYA 4ATTA 4IGBD 2VLJA 3S5LB 1OF0A 1Q9LA 3FU8A 1ONQB 2R0WL 4GO8A 5C6PB 2JB6A 1QLFA 4ZMWA 5B38G 1HQRA 2FUTA 4ODWA 3U83A 3W57A 3LSOA 2DIEA 3J2PA 4L0ZA 1RUAL 5F2FA 3DV6B 1TVBB 2Z91A 4JHBA 5IMKA 4JZJB 1FBIH 4L1HA 4AJ0A 3MUZ1 1S7WA 3KBPA 2YARA 3K4AA 4PI0A 4A2GA 3EZJB 4R7LA 4MJ2A 5IHHA 1XO8A 1JGDA 1C5CH 4F7TA 3O6FB 4NCDA 4M6NL 3CPUA 3CH1A 4NQVB 2R7EA 4Y19A 2WIIA 3HG1D 4A68A 3HHSA 1X7QA 2FBJH 3DSNB 4M61A 4W9CC 5GRXG 3RP1A 2F18A 1MFMA 4JZOA 3M1CA 4NDMB 5T8IA 4AENB 2OP4L 2KT6A 1OCCB 4GQZA 3FFCB 1LWRA 4BUQA 3VFOA 4OCSL 4XVJL 2FB4H 4ZYKA 5DSCB 5EUOB 3B9AA 1FFNB 5DXWA 1NUGA 4PEEA 5L8LB 1JGIA 2N56A 1DANT 3UADA 5JMRA 3ZDYF 1JXFA 1QFHA 2OTWB 3PV6A 5A6IA 2NY5H 1U3HA 3HHMA 4NUGH 1UASA 2WYHA 3MMEB 4FZEL 3SDXE 5EF0A 4H8WC 3HRZC 4FNPA 2ESVA 4X50A 4DVBA 4X6DA 5F7BA 4Q6YA 5GGVH 3EH1A 4NO2B 4Y7MA 2DLFL 2VLKD 2XIBA 3HMXL 4G9FE 4LPYA 4HJSA 3GSOB 1PD6A 3TU6A 1F4XH 2H6PB 3FPXA 3SPVB 1CU4H 3QJFB 3JUYA 4QRPA 5J1TC 3SN6N 1LGVA 2EXSA 2XWDA 3HS0C 3PWNB 4IDJL 2VXVL 2XLLA 3NSYA 3MJ8A 3EBHA 4WEBL 2V9RA 2EH8L 4UT6A 3GGWA 5DMIL 2HJKB 5A43C 1BYOA 1WEJL 1CICC 1XCQA 3KYKH 1SLXA 4NC1C 2GC7C 4K23L 3IDIB 3CMOH 4RAUA 5MERA 1JZIA 3HMWH 3KGTA 1KCRH 1RZQA 2F5AL 4PWJA 1F56A 4E36A 2DKSA 2ZXEB 1MFBL 2P46B 3CX5J 4PBWD 4EMZA 1LDPL 3ALWA 5GGVY 4HUWB 1LJMA 1L4IA 1RFDH 3L2NA 3BRGC 4M9PA 2XWRA 3BQVA 2HLEB 4PRDB 1YUHB 4DKTA 4D9RE 1DR9A 3MJ9A 1ZLVH 1GOFA 3EJJX 3RGHA 2L7QA 4GI6A 1FCCA 1G7MB 5SWQB 5TQ2L 3DRQA 2A0LC 1DJXA 4H25A 2H1PH 2WB7A 4G42A 2QTVA 1JYVA 1HHIA 3FK3A 3WMPA 2KQNA 2VR5A 3ZKSD 4L4TB 5D7SL 2K6WA 5CR8A 1G6RA 2B3RA 2PR4L 4I85A 3L4ZA 3K2UH 35C8H 3L1GA 2OTPA 1CTMA 4QRAA 3T2OA 4KKRA 2ZSVB 4OV5B 3QH3B 4XMKL 4GXUM 5DRNA 1NLDL 2DQEH 1QACA 4LDOB 4PJFF 4ZW3A 2PXYC 3HE7A 1JG9A 4PJ7A 4U31A 4Q14A 2X53A 2BP8A 4DK3A 4NYLA 1PG7W 5ERWA 2BY0A 3ZT5A 4LSRL 2DYPA 4JFED 2BSRB 2H6OA 4PG9B 4YHIA 1BBDH 1JCKA 5I16B 2WXIA 1B4LA 4OLZH 1F6LL 1M2VB 3CFDA 5CSGA 5IT2L 3U6RB 2KPNA 4IBVA 4HLEA 2G0KA 2JQMA 3S5ZA 1Z1WA 4FQ2H 2C3VA 3FUHA 4LEEA 1TO4A 3BDYH 1T1WA 1KXQE 1ZXQA 3D18A 2HSIA 2O5YH 3U4BL 3IS1X 1UWFA 1ZSHA 3QUXD 3KJ6H 3F85A 1U8MB 2V5MA 2WZ5A 3LEVL 4F92B 3S8FB 4N5ED 5FECA 2EIEA 1ES0B 1LP9E 3TLRA 2P49B 3TJEH 1M57B 2B4CC 2WK2A 3ML8A 5KSAD 1QSED 5I1KH 5E5LA 1LEIA 1OE2A 3FCTB 1F8TH 1NCOA 4M5YL 2ZSWA 2YKKA 5LDSA 1N0XL 1IE5A 1FJ1B 2G2RB 4W9KC 1HYSC 1EXUB 2P5ED 2CBQA 1BQLL 2HRHA 4XP9L 2QPSA 2VLJB 4JQVA 3OZ9H 4MD0A 4JG1L 1AZVA 5H8DA 3UTPE 5B7FA 2YUWA 3I9PA 2KYIA 3SKJL 4ZOEA 2JKNA 3OM3B 5FYJH 4ELMB 5AAWA 2VXTH 5HHXH 1FAIH 1YY9D 2TRHA 1ZA6A 4IBLT 2D4FA 4PS8A 1F4XL 1Y7VA 2AJUH 4PJIE 2XTSA 3EGSB 1S7QA 3CZUB 4Z78A 4A7QA 4XP1L 2F8XC 4FQQA 3D85B 4OT1H 3SY6A 3INUL 4CDGC 5JLZB 1KJVB 5C0ND 4PJ8B 3I9AA 4NZDA 2RIKA 2GSIA 2F1BA 1EHLH 2A6IB 2CMRH 2NY3D 1PGRB 2AJVL 2W9EH 1JIBA 3FB5A 5K1VA 3AFLA 5D96B 2VL4A 5AKRA 2OJEA 2FYYA 3IJEB 3HMWL 3NQIA 4HUNB 4MQXD 1X6LA 2MQ3A 1V7ML 4N24A 2VERA 2I85A 1NMCC 4A2DA 2DQIL 1GZQB 1JGLL 1GGTA 2XWJB 2VLKB 3GFUA 4FI8A 2GABA 4N22A 3K8LA 1YEJH 5TE7L 1EHXA 2W9LA 3D2TA 2EIJB 4JRXE 4KOCA 4G6FB 4Y2DA 3FO1B 4LHUG 1A6TB 4OZIE 2G4EA 4E9VA 5LGJB 3BH8A 3O3AA 3FU7B 4GFXA 1MZZA 3SDDA 2HN7A 2QADC 2N01B 1C16B 5D5MF 3UAJD 1FAKT 2M26A 32C2A 2D8KA 2DLGA 4X5XB 3SO5A 4XMLL 2H6PA 3U9PL 4HOZA 4RRPM 2ICCA 1XF5B 4EF3A 5A7BA 3VXMD 1Q0YH 5KVDH 1JHKH 1NCIA 3HIZA 2NDFA 1SYSB 3B9KB 3BUIA 3TPUB 1NA8A 2HPOA 3FW6A 5E1GA 3P4OB 1A3RL 1A14H 5IJKC 4LVOB 3CN4A 3UTZB 3GZQA 1MCWM 4F15B 5I71C 3KD4A 4JHWH 3RNQA 4ONGH 3KVPA 2VXQL 3VB8A 3Q6GL 4AG4L 1ORQA 3HNVL 4UQ3B 5C0CD 4UDUB 4LRNH 4PREB 4RQQA 2WNKA 5T1KA 1UWGH 2H32A 5GZOD 4KVCL 1M05A 1QA9B 3IE9A 3UC0H 1B6DA 3QPXH 4R5VA 5B38A 4TQIA 4LFHG 1BD2B 4U4IA 3MRCB 3TXAA 4PP2B 3B83A 2NXZC 1J1PH 1FLRL 1I7TA 2VOTA 3L9RA 4XTRD 1NIBA 1NCJA 2F7PA 1T1YB 3X14A 2NY5L 2AGJH 5DTFB 1W0WA 1CUOA 1R9FA 4RMWA 1T2QL 4FMVA 2O6FA 2WO4A 2Y3NA 1BFVH 1IMHC 2IXQA 3ARGD 4D3CL 2J6EA 1IB5A 2GI7A 3RG1C 3H9SB 4GAGH 2OPCA 5CD3A 1KJ2H 3G08B 1VCAA 4GEJA 1TT6A 3DUUA 1JZ6A 3D09A 1ZSDB 3HPLB 4E9TA 4NQCD 1IJNA 4KVPA 2WP3T 4OZIA 4IRJA 4NT6B 3OJDB 3VXRD 4KX9A 1ZT7B 4OD3L 5E7BA 4JRXA 1PZSA 1MJ7L 4MYWB 4YSDA 4F37F 4UAOB 2CDGB 5E2TL 3DIFA 1I1CA 4KXZI 1A4JA 1M7UA 2W07B 4MFHA 3U9PH 4CBPA 4F3FA 2WTRA 3VXPA 1ULVA 2ZG1A 1QOKA 4LSUL 4QY8A 4XPBH 2AKRA 2B1HL 1DJSA 1NLBL 4M6AA 4ACTA 4F58H 4JNXA 1DQJA 3EF4A 3EYUH 1ID5I 4GS7C 4XCNB 5IB4B 2R15A 5IREA 2YLKA 1IFHL 1PJWA 2X4OB 4UM9B 2G3XA 3H7BB 5AG9A 2P24A 2DJSA 2O1AA 3KGSA 3VX1A 5C0AE 2HFTA 4Z7VB 1FO0A 2QMJA 1BVNT 1VRSA 3DK2A 4PLKC 4MMXC 3TA3B 3D2UB 3S5YA 3WAJA 1XB3A 4P3CL 1X5XA 3QO0B 4JY5H 5EN2B 3VXOA 4A67A 2AJUL 5TDNB 2J8OA 2NY4B 4D7BA 5C09E 2D03H 3IDXL 4TVUA 3JV6A 4M7KL 5I9QC 4ZUWA 1E5YA 2H0EA 4LSTL 1S78D 3C5JA 5I6XB 3FT2B 2Y24A 5KVFL 5KBDA 3T8XB 1X4YA 3BZEB 3AY4A 1A6UL 3EGDA 2AJVH 3IMRA 3F05A 3EOTH 4GRWB 4M3JA 5EULV 1E4XL 5EOQL 3L3IA 1VGEL 1XF4A 3GDBA 5EFIA 5AW2B 4FOMA 3MRQB 4PJCE 4OD2B 1J9SA 3MUUA 4Y1AA 3WNOA 1QUPA 1DQVA 1O9VA 2D7MA 4TN9A 5DK2B 5FV2A 3PXHA 2AABL 1MCOL 2VLRA 3IXTB 1MCWW 3N0PB 5EU4A 5AG8A 4XOBA 5C0GA 1E2ZA 1R3KA 1KOAA 2CXGA 1FJ1A 5DEGB 3CK0H 3VGFA 3MPCA 3EOAB 2N0KA 1SEQH 5IQ9A 2CCLA 1ASQA 4OAWB 3QORC 1JI2A 4L29A 2HFEA 4KV5F 2XXMB 1WBYA 5GGSA 3TVMD 1URIA 3CFUA 3LNGA 1JI1A 5J6SA 1F90L 3AS2A 3VG9B 4NUPA 3F83A 1EGJL 1AXTL 5IJVA 1O75A 3MRLA 4J3WA 3FYIB 1ZK5A 5T5FA 3KZ8A 4C58B 5CLXA 4Z18A 1CF8L 2YPKB 2P5PA 1NBZB 4IMKA 4KQ4L 1JK9B 2PETA 1MY5A 3KM2A 1ETZB 5C07B 3W9DB 5CCKH 3P02A 3FOMB 4WUUD 3ZHNA 1KLFA 1KCRL 2ZKMX 3IAQA 3ILPB 3PAZA 1RZGB 3QYNA 1N2RA 5EN3A 1CICB 2C4FU 2WM0A 3BSGA 3UBGA 4AGMA 5KYYA 4UZSA 3AUVA 2EACA 2Z0UA 5DC4B 3FT3A 3RTQC 3EOTL 4PJ7E 1JWMA 1YPZA 4UT9H 1YNLL 1ZTXH 3VW3L 3H3PH 2K3TA 4JPKH 1E4HA 3P11L 3QDJD 3OAZK 4Z77B 3QHZH 3PWPB 1ODAA 3LSOB 5IWLA 1DLHB 4DAGL 2R0KH 1I3RB 1NCDL 1GS7A 1WHPA 3MJ7B 1L6PA 3JSSA 4FRWA 5I8CA 1IAKA 2CALA 2JLPA 2VXSH 5DYFA 4JVPA 1CE1H 4PG2C 4YSQA 5MENA 1AGDB 4JAMB 1EZVY 1UM5L 2VLLA 3HJ0A 4X7EC 4YXHH 4DT2A 5KAQF 4WFHD 2UYLA 4IDJH 1IKNC 3JTBA 2R56H 4M7JH 5DEZA 3SDDB 5BZXA 4XMWA 3IFNL 3RAJL 5D7SH 1FNGB 4YPGA 1CXHA 3TM6A 3T09A 4LASL 4LPVA 3U46A 1QBAA 1TITA 3FONA 4DGUA 1Q9KB 4UIMB 2XVGA 1XGQA 5F9OH 3LS5L 3PP4L 5JDSA 1NLDH 5IB3A 4G6FD 5FS5A 2D3LA 2NY2B 2XKSA 1S7VA 3DGDA 4JKNA 5IF0A 4P2RB 4PVNA 4ZYKB 2VSMB 2ZYHA 3ATFA 2LVEA 3LY6A 1TTUA 2GK0A 2YOAA 3AQZA 3P77B 1N6UA 3NP3A 5T1MA 4J3XA 2X4UA 2VM3A 1CF8H 1TTRA 3TN0D 4DP2X 3LKRA 3C09B 4LKCA 5AVRB 2IQ9L 4YDJA 4FFVC 3W5MA 3QAZB 4F33B 1J88A 3KAAA 4MXWL 3ISWA 1KPVB 5ICZA 4C83A 3C5XA 1B0GA 1UQSA 4QKXB 1F2XK 1WRFA 5JR1H 3ARDA 5B1CA 3KBHE 4UYPA 3LPWA 4JEGB 3CZFB 3SDCB 2F61A 3QRGH 4KJQC 5E1AB 1FNLA 3P1VA 4RDQG 2MQCA 4H0IA 5KBMA 3SPCA 2G60L 2NYKA 2NY4D 3C5ZD 2FSEA 3QHTC 4G9FA 3SZKC 3N3EA 3T6ZA 1ZS8B 5C0BA 2QPDB 2VDLL 2C1OA 1A7BA 2OCCB 4FG2A 4XMKH 2ESVE 5TD4A 2PTTA 3UFIA 4UU9B 4MCMA 3QNZB 3O4LB 3SGEH 3LZQA 4PY7A 4HH9A 2A9BA 4P59H 4PMEA 3DX7A 1JK8B 1P5UA 4RLDA 3FQUA 3P4NA 3VM5A 3WFBH 1Y6KR 4CMHB 2J7LA 4KO9A 5FYLL 1GGUA 5E5MB 1A4AA 2WXQA 3CDZB 3MRJA 4JFSA 4FJZA 2W81C 5E2VL 3RZWA 3SE9L 4FMFA 3WJLA 4OZIF 1D5RA 1GOGA 5KVEH 1BF5A 4HMDA 1IGIL 1YMMA 2AAAA 1OK0A 3MACH 3TNMA 1GKEA 4F8OA 3N0AA 2CR3A 4I7ZC 3U2SA 3DTDA 4AX3A 1KYOJ 5EEUA 4WAFA 3AY2A 5E9DD 4F7CB 1G7PB 5L2KA 1UA3A 1AR1B 3UPRA 1JGEB 1Z7JA 2CSPA 2MJWA 3AB0C 4Z3EA 1BBJB 3H9SD 5CZKA 3X12B 4DERA 4X4YA 2NX5D 1A8ZA 2IPUK 3QUXB 4Z0XA 5JW4M 4PJDE 5E8PA 4P2QA 2GAZA 5LB1A 2IDTA 4Z7WF 1IIKA 2IH9A 2VNCA 2WLMA 4HWBA 2Y0SA 3MRIA 4KROC 5CM1A 1HAUA 2D2CC 5EG6C 2AEPH 4BFOA 2WLYA 3CHXA 4G6JH 3TJHD 1I7UA 1NCBL 1GC1L 4GRLC 2AHIA 1KB9K 1CTOA 4AQEB 1E5UI 1HIMH 1XF4B 5EO1A 1ASPA 4WVRA 3MV8E 5LAXB 4NYLB 5FM5O 1S8DB 1J87A 4JFOA 2WKGA 3O2DH 1TVBA 3BAIA 4X9FA 1FVDB 1ZIBA 4ZZKA 4KRPB 5IMKB 4N1HB 3HZMB 1HI6B 5KZCB 1VFAA 1BREA 1I3GH 1QATA 1DBKH 1RUMH 5F1IB 4J6RH 4WGVB 5DYOA 1D5XA 5DD1L 3VXTA 2FJSA 4I48A 1WIUA 4LOUD 3V0AC 1CFTA 4JFPA 4YXHL 1XHHA 5FOJA 3PWLA 2CBTA 1F11A 1UUSA 2V9UA 4U1JA 4Y9FA 4XMXA 4ZOBA 5BRQA 3D18B 2CRYA 2WTOA 1NC4B 1OP3K 2F74A 1P53A 5IJVB 2E46A 1T80A 1BECA 3LEXA 1PZDA 4WEUD 3NBNA 4RFEB 4GP4B 3NA9H 4ZFQA 3L7EB 5IV2A 4ONGL 3ULVL 1NDMB 2CBOA 3EFDH 4ZQKB 2DQJL 4WFFE 1BJ1J 2XETA 5I0WA 2Y36L 4QYOB 3MCKB 3MRRB 3NSJA 5CJXC 1VKXB 2ENPA 3DOHA 3GLEA 4TVPL 2R1WB 3QIWB 5HYJA 3FSOA 3UG3A 3P54A 1IBGH 4F2FA 4EI5A 1BVKA 5MP6L 4JO2L 3WG7B 1U21A 3F01A 4DPBX 5HYSA 1Q9OB 5JHMA 1X9QA 2Z64C 4I3GA 3VAEA 5BCAA 1U8NA 1Z9SA 4JCLA 4KTDH 4KZEH 4HQQH 4HSCX 5GS0D 1Q0XH 2AXWA 5TF0A 2AXJA 1HKLH 4P5SA 1BFVL 3MJ8B 3OX8A 3IGLA 3ZE1E 4PG2A 1JV5B 5M7QA 1PSKL 3GSNL 4NP4H 1H3WM 3QA3B 2WSKA 1LD9B 1QLFB 3LIZA 1IL1B 3BFOA 4YHNA 4HCIA 3ULUE 2GEQA 5I82A 4C57C 2C9QA 3TYGL 5F6IC 1MPAL 5BMFH 4KZDH 4R4ND 1T1ZB 1T1XB 3OGOE 4JJ5B 2AV7B 5IB5B 5KVMC 2FK9A 2PUQT 5E03A 1K4CA 3VE0A 1CK0H 3IMWA 4KGJA 4BQ6A 4MVBD 1S7VB 3JT2A 2V8LA 2F53A 1H9VA 3DTUB 2D4DA 1WSST 3DOIA 4PRDA 5DURD 5EBGA 3JQOB 1YA5A 4JFDD 3P3UA 4FFZA 4XT1C 3DV4B 5AVSB 4JW3A 2YAOA 1ZLUK 3TO2A 2XPGB 4OGXH 1QYGH 3PL6C 1GYVA 4O2CB 4YDJB 1DDHB 3NOIA 1DFBL 4MZ2A 1AG0A 4BM7A 5DSCA 5AW8B 1S46A 1O9WA 1KLGA 4YFEA 3VU1A 4HJIA 1LK3H 5DGRA 2BY2A 2EH7H 3KLAA 4N20A 1RZFH 3ZYJA 4M1DL 3WLWC 1FFOB 1NEZB 4YDNA 3QAQA 1UXWA 4ZAKA 3Q0HA 4GKOA 2J2ZB 4ZMAT 5KBKA 2ESVB 1KG0A 4BGLA 4AQ1A 3IVKB 5IROD 1KIRA 1GTNA 4HSQA 3ARYA 3I50H 3NCCB 4Q0XH 1RJYA 2YAQA 5ICYA 4NN7B 4Z76A 3SE4C 5D71L 4OLYH 4WI5A 5D7IE 5BJTA 3UYRL 1F86A 4CC0A 5JQ6L 4MASA 2PTTB 4LCWD 5CS7A 1EZUA 2VJXA 4H1LB 3O9WA 2EECA 3JWOC 3QIBD 3MO1A 4G3YL 1UM4H 1AFVL 4EI6A 2WKLA 4ZXBB 1JK8A 3MXWH 2PYED 5J12B 5FYJD 4NAMA 4OLXH 1PIGA 3U0WH 2X5PA 3FN0L 4HS3A 4I3SL 2BW5A 5FW7A 3DYPA 1ED3B 5C3TA 2HMID 3HZVA 1ZRUA 1RUML 2UXTA 3QB7C 4P2OB 5ITBH 5C08D 2C9XA 3FT9A 1WD9A 1AYRA 2FR4B 1ZVNA 2C3HA 1CB4A 3T6QC 2VE6B 1MIMH 4PRNA 1CDUA 1HCZA 5AW6B 3UYPA 1PVHA 4EUPA 2F53D 4UMGA 3F2LA 4OLWH 3W39A 2GSGB 3HB3B 1CZ8H 2VIRB 4IU2A 4JFZH 3OKDB 1J9QA 3ZY7A 4S11A 2HH0L 1Z3RA 3MV7D 2VR7A 2VDOH 4GAJL 4P2RE 1YEIH 2BFVL 4K71B 4S1SL 3WO4B 4GKZB 1B3JA 5I8KL 4M1CC 2M2DA 3UPRB 1JPTH 3EYOA 5F7KC 1DFBH 2NR6D 3FUKA 3PDDA 4U3CA 4XPFH 3V6OE 3X12A 4IRJB 4F7EA 1N18A 1SHSA 4FG0A 3RL1A 4TULL 5TDOB 5JW3L 4OR1A 1D5MB 3OV6A 3TBCA 4A2LA 4BK8A 1HH6B 4DPRA 2WANA 1V05A 4XCNA 2WVVA 4NN6C 5DZVA 2VQ1A 4I4WA 4FG4A 1HHHA 3BWUC 4NBZB 3WS3A 1SUHA 2E6QA 4M8QA 4GOSA 3U1SH 4OGYH 3HZMA 2JELH 1XGYL 4YZFF 1VCBC 1MLCB 2BVPA 1JNHB 1OL0A 4KTYA 5F1IA 1R5IA 5GZNC 5JLZA 3BEVB 1CE1L 1GVIA 1KFAH 3AWEA 1PZ3A 1WBZA 2Z4QA 3D87B 4WK4B 5FKAB 1PSKH 4C54A 5JDJA 1O0VA 3QE5A 4Z7VE 2R4RH 2BHZA 1CBVL 3QW9A 4Y88A 5HGDB 4I0KA 3B7TA 1PIFA 2XG5A 3B1TA 1WUZA 3BE1L 5I1DA 3BZEA 5DFAA 3GBMH 3H2WA 5KTEL 3EDKA 2X4PA 4AI7A 2VMJA 3F58L 3BISA 4JR9H 4H8WH 4H13C 2F8IA 5IBUG 4X7TB 5GJTH 1FZMA 1KCSH 1M2OA 2CCVA 4JM4L 2P45B 3HB3C 4BQ9A 4R7NA 5C92A 5BUAA 2F0CA 3CLEH 1HQ4A 3RPIB 2DS4A 4FXLA 5TFSL 5CJ5A 3ZVVA 5PCYA 5GGTH 4N0YH 1HHGB 4W9GC 2VZVA 2CO3A 5DD0H 3MAWA 4MCZB 4Z5RA 1RZJH 2V2XA 5CEZL 3FCTA 5KBNC 2VAAA 2JJTA 1ZLUH 2NSQA 5I1KL 3MTRA 3VFTA 2QVFB 1M7IA 1HL8A 3QCVL 3O0LA 4K5MA 2JJSA 1JGVL 4MNQA 1X5AA 1RUKH 1N4XH 1KJ2A 3FCBA 1YYLL 2BNRB 3ZTDC 5IQMA 1EEQA 2FHBA 3OR7A 2VDRB 4NRYB 1CE6A 1SVBA 1IM3A 5C7XL 2XPYA 3CK0L 4Z8FL 2F68X 1T5KA 3ZE1F 3ZX1A 2P26A 1ZCRA 4RMQA 3TF4A 2PXYA 3HE7C 8PAZA 1RVFL 4NZUL 3SY0B 2YKLH 1CR9L 3SZ6A 1BZEA 1BXVA 4FQQB 2WHVA 3MOQA 1CICA 1RAMA 4HW6A 4JO1H 4EXPX 4OD1L 1RZIB 5T3ZD 4UQCA 1UJTA 3AU1B 5DUML 3K81A 3EYVA 1CDIA 4Y2OB 3NQKA 3JUZA 4YHOH 2YPLA 4H8WL 4N2HA 1M7XA 1IBGL 1RUQH 1YYCA 2BY3A 2K9FB 2NNXA 4YZWA 2VUYA 4WF7A 2QTEA 4O2CA 3DIDA 4PJ9C 3QFDA 4P5TD 4NERA 3TP4A 1X9RA 1AQ8A 3FCUB 4A2EA 5ALBH 4NO5B 1EUTA 2DN7A 5EB9A 3RWEB 2B7DT 4B9IA 3VXMA 3TESA 2VLKE 2WTRB 3FONB 5D7LA 5EEVA 1NAMH 5JIIA 4HJEA 3PQYA 3MNVB 2QDVA 3AXLB 5F0JB 2N3JA 5DUJA 4YE4L 2VJ0A 1I1YA 1N4XL 5IHUL 2CLVA 5FUOH 1KEGH 4XP5L 3HW7A 3NRQA 1ZVHA 3MLPA 3PABA 2EDFA 5DMGC 1GPOL 4TVPE 3INUH 4WNQB 3CUPA 1Q0YL 5KVDL 1YC8A 4FFYH 4LGSB 1WZAA 1BD2E 4B95C 2VN3A 3KWVA 3DVNB 3RZCD 3KPOA 1HL5A 4ETQA 3KPPA 4XX1E 4ENED 2MTPA 3CBRA 1OPOA 2QZQA 4XPHH 4IJ3C 4MDJB 2OSYA 4L5FE 2XHNA 4N8CH 3MLRL 2AJXH 5EU3A 1I1FA 1NBQA 3ZZ1A 4RBPK 2PMZA 3AGVA 5IY5B 4XRCB 2CAKA 1NPJA 3MLWH 2X40A 1W9XA 1AH1A 1SXZA 3NFPA 1ZT4B 3RDJA 1I7ZA 1TFHA 4O2FA 5HHNB 3SDXF 1I7TB 1INEH 1FPTH 3DSFH 3HE6B 2E27H 1B88A 4QHUA 1H0DA 3V0WL 3VA6A 1BOYA 1ILSA 1DANU 2I60L 4YR6A 4RZCA 1JCVA 4L8SA 1RURL 4PGDA 3FB7B 2EDEA 2R0ZL 5IIEB 2E6JA 1C1EL 1ZWIB 2VR8A 3T8MA 1GL4B 5FO2A 5DO2D 2CUIA 3NDYE 5KUKA 4JRXB 5C0AD 1L9OA 2P8MB 1JBJA 5D7EA 1V27A 4K3JL 4GW4B 5KBPA 2JKSA 3P2TA 5HVFB 1DFXA 3BGAA 5L4MA 3N91A 4FA8A 1P2CA 3KJ4B 3C5ZA 2O72A 2QQNH 3IT8D 1L9TA 1N6VA 3LTVA 4X4KA 3V9FA 2YPKA 3FTVA 4PM1A 1IC7L 3HZKA 1Z9MA 4XXWA 1MREH 1KNOA 1UD6A 4XNYL 2OMVB 2YEZA 1I1RA 4ZS6C 5HGDA 3MCYA 2ZXAA 4L3EA 4MJJA 3RVXD 5C3IA 4V2CB 3LZNA 4XX5A 1FGNL 1S5HB 3MRIB 5AAPA 1R19A 4TQHA 1UOKA 4KK6D 2PABA 3L3JB 1SXBA 4IM8A 3F7VB 5KS9F 4QJ3B 1CBJA 4PJHE 4I0CC 4IDLA 4HUXA 5FW8A 1HL4A 1NGYB 2D03L 4KI1A 4MAUL 1AGEB 4O9HH 4LL9A 1XGTA 1IGML 1MEXH 1CDGA 3BKJL 3CHOA 5J57B 1JNNL 2IG2L 2JFCA 3ILQD 4MYPA 4OFQA 4JK0D 3MBWB 1KTRL 1J0HA 4CSPA 3K6SB 5DD5H 2R1XA 2YSSA 4MTMA 2CLRB 6PAZA 1WDAA 1YAIA 5EU5A 3ISYA 4OJYA 2A9NL 3WEBA 1UT1A 3ERXA 3LZRA 1I9JL 1KTBA 5JTWA 3EGXA 4CN6A 2CKBH 2IWGA 3DI2B 1E67A 3LYRA 4KXAA 1CFTB 1MLBB 4L18A 3OAYH 4KITB 2IWFA 3DX4A 2HJFB 4JVUA 4FAAB 4U0RB 3T4AB 3C8KB 5K9JL 2K6YA 2GTZA 3WV0A 3QNYA 5IQ9B 4OQTL 2OMNA 2R29H 4O00A 5DVPA 4A39A 3GPEA 4OFPA 5BQDA 1M3JA 3GSNB 1NDGB 4CVUA 1MQ8A 1LYQA 4FXKC 2EDTA 2ZX5A 5FYLE 4AQAB 3KYMB 2J25A 4PJGA 3O6MH 4LHUA 4N2GA 1T4KB 2D31B 2EKSB 4DW2L 1XIWC 3FZUD 4FYQA 1MREL 5F6HI 3FB8A 3CVHA 2A6JB 1UA7A 1WITA 5EA0H 5KBLA 3Q05A 1T0MA 1G6RL 3LH2H 1R3JA 2IJ0C 2XWCA 1DUZA 2A9DA 3PGFH 2P8LA 3V0GA 3UABA 3ZHLA 2X6BA 4NRXA 5DJXB 1Q9OA 4KQ4H 2VC2L 2NY2C 3KM1A 3RU8H 4XBGA 3TWCL 2JIXA 5I73B 3VTAA 3GUTB 3WIAA 1NM9A 3OB8A 4EIGB 4Z7AA 3NCMA 4ZTPH 2E56A 3RWJB 5J1SC 5FGRA 4XE0A 1DJWA 1ZS8A 5I0DA 5H37G 1C12A 2IG2H 5AKSA 1A5FL 2VH5L 3ARBA 1A1MB 3N5AA 1XF3A 4FFVD 3V95A 1IAOB 3O11B 1DBML 1VEPA 1D6EB 2HTKC 3IS0X 1IM9B 1AZBA 5DZJA 3RY5A 3HPJB 1YYLH 2NY4C 1U9KA 4UV4L 3IU4L 3BRFA 1E4XI 4IRJC 4YHLH 3MV9B 5TE4H 1PFOA 1K4DB 3O4OB 2FO4B 3GBNL 4U6XB 2VN5A 3G5YA 4OCYL 5CN2A 4L4TD 1ZLSH 3V5KA 4KAQL 1IVTA 4M00A 5GS2D 4YHYB 3WTSA 2BJML 1CQKA 2GJPA 4FHJA 5LCVL 3MDJA 3MREA 5F1KC 1A1OB 4JZJC 3PS6A 1G7LB 4BFRA 3CZKA 3H4HA 3BVNA 1KCUH 1CZ8L 5I24A 3ESUF 1BLNB 2I5YH 1WZLA 2R4RL 2BIOA 3E38A 4LLDB 2Q8AL 1X5ZA 4FQ2L 1NGXA 4JY5L 4K94H 3DBSA 3OKNA 3E9TA 4M3KB 1V5JA 4EE2A 1FLTX 4YHKL 5CIPB 1CDHA 2R4SH 1SHMA 3QCTL 4G83A 1JPST 2OI9C 3EYSH 4KDWA 5ICYB 1QQDA 5DMGD 2CO4A 5T5NG 1FVDA 3QYCA 3MX0B 1JHLL 1WA2X 3IBEA 5FWQA 1OAUH 2DQUH 3E3QE 4MA1C 5GGVL 1EO8H 1K2DA 1RZFL 1I8MB 2EIDA 2IMMA 4K7PL 3BN3B 3LH8A 3BWUF 2FNWA 3AAZA 3WGUB 4XNAA 5KOVC 2NY2D 5T5FL 2YAMA 1L9NA 2QVMA 4IS6A 2WQVA 3QFJE 3LRSB 2A7BA 3ZL4H 1BZQK 2R2CA 3TJHC 4TUKL 1BZDA 4ALAL 2APVA 3BAEL 3VXSE 1T22B 1N59A 4GW4A 5AYUL 3RILA 2QPEB 3WJJA 3ECQA 1E30A 3ROOA 2X4QB 1ZS2A 3CQQA 4WKZA 4ZUUA 3G6JA 3DGGA 4JFVA 2QADB 4JS7A 5CJBA 3SQBA 3W39B 4FNTA 4LSPL 3F62A 1BIIA 3OPZH 3HEIB 1OQOA 4MA8L 5F3FA 4KO6A 1LMKA 3KR3H 3TBYB 4P05A 4R4FH 3H6AA 3L2LA 5KTEH 3WY3A 2C7UB 1RJCA 2CBPA 2XTJC 5D4HA 3RQ3A 1M53A 1MW3A 4G2AA 1EO5A 1OTSC 4TNWF 2GI0A 4U1KB 5EDXA 4ZMXA 1FC2D 4HAFA 2MQ0A 3WJMA 4NFDA 3WHE0 1XCWA 3P4LA 1U8IA 1DVUA 4C4BA 1BWWA 2JNZA 3PJSA 4L2YA 2Y1AA 4Z0XB 3QUGA 3GWJA 1BZ9A 5DWPA 3TH2T 3A6CH 3QNFA 4P2OC 4PJIF 5D96C 3U7YL 4KMTL 1W91A 1NGYA 3WU1A 3OX8B 5TQ0L 4L1BA 1ZEAH 3HG4A 1JV5A 4WHCA 4PJDB 3K6SA 3POHA 1QLEH 3MJGX 1Z5YD 4PH8A 4XC1L 2IGLA 5E6ZA 3TEXA 3J27A 1OF2A 1SJHA 4P5KB 4FABL 4G8IA 5IZ7A 4S1QL 4Y5VC 2WIIB 1HIML 2P9RA 1KB5B 3LNFA 3KDPB 4G8GE 3WFBL 4WTZA 4NQEB 3O41B 5INCB 1AXSA 3UAJA 3DMMB 4GH7B 5AYQA 3I6KA 2IBZY 2Q76A 3C5ZC 5DD6A 3BPCB 4ZO8A 4HETA 1BQHB 1SXSA 1TQTA 3NPZB 4NZUH 2ZKXA 3CFKA 3TO4D 4N5EC 4L3FA 4E9QA 1I8LC 1D7DA 1R5WA 4UM8A 1U95A 3PG2A 4OFDA 4GQ9L 4F2EA 3ARFB 3VMNA 4JE4B 3VXSA 1QFUH 2Z92A 4Y16B 3IJHB 1FZKA 1U6AL 2DY2A 2IH3A 4GW5A 3UCRA 4P8QA 3CVHB 1FNSL 1QBLH 3QFJA 5IB2B 1EHKB 2UZYA 1S7SB 2A6KA 2F7OA 3ABLB 4HFUH 4OLVH 3BP4A 1HHGA 4KY1L 1OGPA 1DJGA 4ZMLA 5D2LA 4AQZA 4P3WA 1JUFB 2FTAA 3QULB 3VXQA 1PG7L 2HLFC 2NPLX 3KJ6L 1UA6L 5AW3B 1QFPA 4ZX3A 3OR6A 3OLIA 2DMBA 4KQ3H 4XBGB 1KG0B 2H3KA 1EZVX 3U7YH 4GQQA 1LDPH 4Z76B 2GCYB 3D07A 3ZYOA 3ARBC 5C0DB 3MV8B 5DRZB 4NI6A 3S3JA 4L0PB 4Y5YB 4FQXC 3UTTB 4JO2H 1PKQA 4HULB 1AMXA 5FYKL 5K59F 2A9CA 2GKIA 4HPYH 1NAML 3S8WA 1MNUH 1BFTA 1AY1L 5BV7H 2ZX9A 2JK5A 4O02A 1QRNA 4WUUE 4OF7A 3FMGL 2BWDA 3CN1A 5F1NB 4OFYA 2WQSA 2UY6A 2VDPB 4IK7A 4N6RB 4XBPA 4D0CA 5DO8A 5J9PB 3NZUA 2QZ5A 2WXOA 5JO5B 3MV9A 2VXTL 3BKMH 4XOCA 5HHXL 3ZXAC 4MD5A 2OX5B 4ZFGH 4G1MB 5GS0H 3V52L 2VW7A 1VACA 4HGKC 2AEQH 2BY1A 1P5UC 1QFWL 2RH0A 2C7FA 1A47A 1XIWA 2GSGA 4U7SA 4FX5A 4OSUH 1CGWA 3MLUH 2RD0A 1WO2A 4JHAH 3P30H 4Q6KA 2NY6C 4AMKL 4LEBA 2E0PA 2F53B 4ODSH 2QJDA 3S98A 3K1KC 4R26H 2Z8VC 4HUUB 1OCWL 4IHOB 4A7VA 1AZNA 4KY1H 1U33A 3S37H 4NNYA 4NO5A 5EHFA 5TPWL 3S35X 2HMIC 3BDBA 1FYTA 2KKQA 3V0WH 1QUNB 4P5MB 3KPNA 4QOKB 3L4CA 2O5ZH 2IALB 1RIVH 5IKCA 5ICUA 3DK0A 1RURH 4A7TA 5IVXE 3FRPA 4LCWB 4PJFB 1NEZA 4PG9A 2AXFB 1MH5B 2OMXB 3GMPB 4F8TA 4Z7NF 2R2EB 4MQSB 1TQCC 2BP0B 3V0DA 5C0EB 4NUJB 2DKUA 3WIIH 3IVKA 4PUBH 2E75C 2NY3C 5BV7B 1YO4A 3CFDB 4KMQA 1NL0L 1FH5L 2WUBH 3RGVC 3WEXA 2OAAA 3NIFB 1YEGH 2WSPA 4F5CE 2A38A 3OXRB 2C9RA 4P4RA 2CWRA 2CO6A 2YR3A 4JKPL 5AOKA 1W6LA 2EADA 1IQDB 4FL4B 5DI8A 5ADOL 4GG6B 1ZHLA 2GB2A 4LNVA 4OZHF 2PCXA 3LD8C 5D2LF 3SKNA 4TQ8A 3WENA 2Y5TA 2Q3ZA 3TH4T 3QO1A 1T21A 3DJRA 1N59B 1N0XH 1TXKA 4WJKB 3WCYA 5HVHB 5LGHL 4Y5XA 3P0YH 4W81A 1CDCA 1MDAA 4KDTA 4B9PA 3MXWL 35C8L 1LNUB 5FECB 5I8EB 5F9JB 3QEUA 4QTIL 4YDMA 3V79C 2XV3A 4HJJH 4XC3L 2ZKYA 4ZMPA 4A7UA 4HLZH 5DVNA 5KUMA 3B7UX 1KXHA 4PJGF 1HZHH 3B9VA 4GO6B 2F5BL 2I27N 1D7FA 2V5TA 3FCGA 2ADIB 3BQUD 1CO1A 1RK0B 1GC1C 4AXWB 4U1NB 3CZJA 1FNSH 1ADWA 1QBLL 2YRZA 4B50A 4JHVA 1JZ2A 4XNMA 2PYEB 3SYAA 4P07A 4YXKL 2CNYA 1Q1PA 3PAUA 5DHXB 2XACC 1JXDA 2O5NA 4N28A 2TAAA 3PWPE 4P23C 4WWKA 3C60A 3JZYA 3K2UL 2WY3B 5I1LB 4Z78B 3AGWA 4PJBE 1DLFL 2QLYA 4PJ7B 3O6FC 5GZOC 3QDGA 3ZL4L 1BQ5A 1QSFA 2DM3A 1GR7A 1HQRB 4UB0L 2KUTA 4XVTL 5ERWB 2ZX6A 2CR6A 2PXYB 4F8QA 5L7XH 5HHVH 2FLRT 1QSFD 4OQTH 3U2JA 1L7TH 5IMOA 4K3HA 1S7WB 3B3BA 5C0AB 3VXUB 4ANKA 5D9SA 3TH3T 1AZRA 1KC5L 3DMMA 4B27A 4JHUA 1P4UA 1GCYA 4WNJA 5C07E 1CDYA 3ZRFC 4LPTA 4BFKA 5T3XL 1F6AB 2WWNA 3BAYA 3QUXC 1ADQA 1R3IL 3U79A 1SVZA 1VZGA 4Y5YC 2FWOB 2X2JA 3I75A 3PE9A 3MODL 2DQCL 3GNML 5D72H 2OBGA 3NSDA 4H2AA 3BSHA 2BIPA 4RDQF 4XNQA 4C56D 4WW1B 5HXMA 1RU9H 3VFUA 3DRQB 1MNNA 1XH1A 3IJHA 4WK0B 3HOGA 3GTTA 1ZLWH 1KWKA 1U8MA 2GTQA 2LV4A 4YMPA 2LVCA 3RFZC 3WSQH 4BKSC 3NAAH 3BFQG 3MLUL 4DK5A 2UVFA 5ISZE 3P30L 5D2LB 4O5LH 5ACLA 1G7HB 3FUNA 4S1RH 1Z3GL 2B1OA 4NM8L 1ZEAL 3H9SE 3G5VB 1N9PA 4F93B 5L9DL 3HS0B 1EDYA 1KTJA 3EJQA 4X9GA 4BDVB 4MQXC 1TQWA 4ZX6A 3SQOH 3TPUA 1A9EB 1A2YA 3D0VA 1DHKA 5CJXA 5LWYH 2BC4B 4BZ1L 3HAEA 2VAAB 4JM2F 3T77A 5CZVH 1FLRH 3ARDD 3GSNA 5CP7B 1FUNA 5L8KB 5AVQB 2JV6A 3RVWC 1E2VA 5C0NC 4HCGA 4QUOA 4F7KA 1NKRA 2D31A 2E3VA 4BUGA 1AKPA 3L5HA 1AHMA 1TZHA 2BZ7A 4HD5A 3VH8A 5B38B 4RWYH 3BP7B 2MCAA 1IM3B 1BD2A 2YBRA 3ZQ9A 3LAFA 3ZRSA 2E74C 1XTMA 2R23B 5AOZA 4YDIH 2GW5A 5DQDH 3CVCA 5D4IA 5L6YH 1GGIL 2N1KA 4FMKA 1Z32X 2W95A 4F57H 5CLYA 3FB5B 4XO8A 4Y16D 4DQAA 3SPIA 1HS6A 1KSRA 1Q94B 1HK6A 3PQYE 4WUKL 2VWEC 5K1NA 2E9IA 1IC5H 3D8MA 3OAUL 2W0FB 2VLKA 1BJ1H 3RVVC 4GS7B 3LH2L 1AIFB 2ADGB 3O3EB 1FV1A 4HKXA 2X3CA 2EDDA 3E8UH 2J8UB 1CXEA 1B0RB 3H0TA 3WS6A 1LE5A 1KULA 1YMHA 1XZ0A 2QKIB 3FU0A 6FABH 2AV1A 3ES6A 3EDEA 4RGNB 4Z7OF 3QQ9D 5KVFE 4I1PA 1NGQH 1LO4H 4JQIA 4BINA 1HWWA 2EABA 2AXFA 1E9PB 4TUOB 1L9PA 5D2NA 1OZTG 1XFPA 4Y4KB 2AK4D 3A24A 2MFNA 4PRPD 4U7KA 4NKMA 4LPCA 3RKDD 1KY6A 4RMTA 3ECWA 5EOQH 2J1KA 3TV8A 3OWRA 4AGOA 4BHUI 1CDBA 5TDNA 1HINH 1OAJA 3F3HA 4ZAKC 4JDZA 3T0EC 3ULVE 2CKBA 3HG1A 2BZCA 5GS3A 1TTCA 4P9MH 3ZPDA 4HIHA 2EIKB 4YC2B 4D9RD 3EIFA 1ZLSL 1MCKA 1UJ3C 4HWBL 5JW5A 2JWYA 2R29A 4NZTL 3BCDA 1NCAH 4WZ9A 1U8PB 4ZMZA 4JDVA 5I8EA 1AR1D 4NC0B 4GUCA 4HFWB 4KI5F 1L5GB 4XHJD 1HNFA 5EU7E 5I9QB 1T5XA 4NQCA 4MNQE 4FTVA 4JY4B 5IESH 3CV5A 3T0DA 4HJUA 3IETB 4GQ9H 3F58H 4ODXA 2UXGA 4YO0A 2H45A 3ZGHA 5KYXA 4RVBA 3C87A 1E9QA 3N6YA 4LF3B 4AYMC 5C0GB 5TJWK 1CGSL 5DEGA 2FJGB 4GRMA 3RY4A 1OB1A 3VI3B 2J6EL 2CU9A 5SX5H 5GS0C 2X42A 2OL3L 2P1YA 3FSVA 3QRGL 4U1NA 4DP1X 4CL7A 1AE6L 1E7VA 4IS6B 5D1XE 3JWOL 1AS6A 2BSCA 4X4ZA 4AYFB 4N2IA 3T6XA 1EXUA 3N42F 1ZHKA 4DGYH 1E8WA 4HEME 3ZU8A 1JMXA 3VFSB 3QUMA 1VHPA 1DBJL 2Z0BA 1KCWA 2ADYA 2C9VA 4R3SA 4ZFZB 1BQRA 2QT6A 3HI6H 3DO4A 1CGUA 2RA1A 3L3GB 1EDHA 3MNZB 3KYNB 4HJ0D 5T3ZH 5IWLC 5G4NA 1J8RA 1BIIB 3KVQA 3ALXA 4U3SA 3TNNA 3UBXG 3IDGA 5FYKH 4HP5A 2GC4C 4NJAH 5H4YA 3KPRD 4ENEC 4X7SL 2AZAA 2IADB 1ZLDA 1M6UA 1JRHL 5C0JA 4ZXBC 5BW7A 1KLFB 4DK6A 4Z9KB 4Y5XC 3PXLA 3H42H 3SDCD 4Z7VA 1RZGA 1HTYA 2ED9A 2VABB 3C2AH 3DX9A 3ISRA 1TLMA 4PP2A 1O5DT 4PJ8A 1GJWA 2WN3A 4WI4A 1KACB 4BFIB 4PYGA 4FZ8L 1TJGH 4IOFC 4QHPA 1IUZA 2A6IA 1IU1A 3ILDA 4X8XA 1ADQL 2GBTA 3ROLA 3IFNH 3RAJH 4LRIA 2ITDB 4P3CH 5HI4C 3VD1A 5T1KD 1U4FA 3OPZL 1JP5A 4HBQA 1WWCA 5GZNA 3LIZH 1BV8A 2NUPA 4XO4A 2NQDA 1NC2B 1ET7A 1YEFH 1QD0A 1JE6A 4X7CC 3D7PA 5T1JA 3MFFA 4AMKH 4DP7X 2ICWA 5FA3A 3RRQA 3K2IA 1HL9A 1S9WA 5ESAA 5JUEH 5FGCB 2YUZA 1W0VB 2R39A 3VDAA 4YSCA 1G7HA 1SJXA 2P5WB 2YRPA 1USQA 2DTSA 1XGTB 1A7OL 4H8QA 1Z5LA 2J5WA 5I17A 3IXTA 4FNRA 4Y4HB 4OIIL 1RZ7H 3I6SA 4Y9BA 2VSDA 5D70L 4Z3FA 2AMGA 3E80A 1LO0L 4G5ZL 4RDBA 4AL8C 4DCQA 3EGXB 1JWSA 1X4XA 2DD8H 5SWSD 3JTSA 2R1YA 4TLTA 3TIDA 3BP5A 2IGFL 1RZPA 4FP8L 1TJIH 5D71H 3LVEA 2ZNWA 1MCSA 2WQUA 2K7PA 1OOAA 2XRAL 4O02L 4K0OA 4Z7QF 4PUBL 4DNLA 1NFAA 1GSMA 1EAQA 2LABA 4F33A 3RHWF 5F7LB 1S9KC 4BKTC 4AYGA 5IB2A 2GBVA 4J4PC 3MR9A 4LDCA 3NJMA 4WFGE 2BVTA 2ZOKA 3VXQB 4QJ5B 4PWGA 4UT6H 4FGMA 1NGXB 4X6DF 4FQLL 4W9FC 4UNUA 4X4MA 2YZ1A 3A4DA 5GGSY 4XAKD 3Q8FA 5LGHH 5CEYB 3WOVA 1WS7A 4BFEA 4OJFH 2VO5A 5EFIB 4D8OA 5D7IA 3IKKA 5HD8C 3T2PA 4Z7OE 1GZHC 2BWQA 4HIEA 4OLZL 4WI2A 3S9DB 3JBG7 3AXHA 4ANWA 4OIBA 3PJNA 3KPSE 5JA9A 1WAAA 1N7MH 2GJRA 4G11A 4E41B 5LNGA 1TZAA 1X44A 1D2PA 1XQ4A 2P8PA 3OMAB 3Q7JA 4YNYA 5ESQA 3O4OC 1WTGT 4ZFOB 4B3EA 5F21B 3CMGA 3IKCB 5BNXD 1JWUA 4JPVH 2W60B 5DUBA 4TLKA 1F4YH 1YY8A 3QJZA 5E6IA 2VAJA 2ZICA 4BZ1H 1CURA 1OAZL 1QRNB 1J8HA 3PJLA 4C8XA 5I8CB 3SBWC 4JM2C 1T3FB 4DN3L 4N6RA 1JMZA 3SYOA 3PNWA 4D0CB 4NT6A 2CPUA 1ET5A 1IAOA 1SQMA 3VXUD 3UZVA 1EX0A 3ECUA 4FXTA 4IJTA 1FFRA 1NQBA 3VRLF 4WW2F 3CQFA 4YDZA 4LFHD 4GKSB 2LLLA 4PJ9A 5EOCL 1P7BA 3L7FA 43C9B 5KSUA 1O6VA 1CFVL 3RIKA 4M8RA 2X41A 1BZ7A 1G9MC 3NJXA 4CC1A 2LU7A 5BVJA 3L3KA 4M5YH 5DRWA 3K7UA 1MHCA 2PWEA 4PJCF 3ZDZE 2NY1C 4F57L 2Y3AA 2GK0B 2XQYA 1I3VA 3A0OA 5D4JA 5DS2A 2JQZA 3S0PA 5DHVB 4DTGH 4IHOA 3VQ2C 4GP8B 3F5WB 2QQQA 4KKPA 4Y4KD 1OLZA 3D2UA 3MUGA 2W0KA 3WJMB 2D7NA 3MREB 1CFSB 3VCLB 1XVSA 1A1OA 3STZB 2XIIA 1IIIA 1AHWB 2ZG2A 2ED6A 4DN4L 5EOTA 1JV2B 3AM8C 5ETUB 3JT0A 4OM0H 4Z77A 2ZUUA 1BLNA 1KELH 1S5IL 5L0QB 1RK7A 1C8QA 3N43B 3VWJA 1PG7X 1URZA 3KH4A 4PWFA 1ITCA 4QHLB 4R7XA 1X3DA 1EFXB 4NWTL 3BQUB 2DQGH 4ZSOB 3S3BB 3L9EA 5FUZL 5TE6H 2DQFB 1VFMA 2B08A 5I2IB 3RTLA 1A7PL 2FJGA 2XWEA 3CC1A 3G5ZB 3LDBB 1EDQA 3B5HA 1OB1B 1BW8A 4IIZA 5GQBA 3QJVB 1ZOXA 4X9BA 5CJQH 3CN2A 4YBQD 4ZDHA 5FB8B 3GS4A 3MACL 2Z8RA 4ONHB 5HDQH 3NA9L 3JWDL 3MRHB 4W70A 3RWGA 2F1EA 1OV8A 2WBJC 1DLFH 2QSCH 2R2HB 2XWTA 5AALA 3VSTA 2MWCA 4PBDA 2OXGA 1C7TA 1AGFA 3AQXA 3GMNB 3LS4L 3VD3A 4MDRA 5EF2A 3NPSC 4GSDH 4K7PH 1MVUA 2DM2A 1TYJA 5CLZA 5KOMC 2XN0A 4O51A 3L17A 4R7DA 1R33A 1WG3A 5EDSA 5IP4A 4N1CA 4TUJA 4LCUB 1GAFL 5CU9A 4JANA 5DHEA 2HRLA 3DGCR 1ZLVK 2X4QA 3K72B 1ZTMA 2HT2D 4K4KA 1ACYL 3HC3L 1J05B 4UOW1 5EORL 5IFJA 2VABA 3HR6A 5CGMA 2V4LA 3QWNA 1HKFA 4ELMF 3M07A 4LSUH 4DO5A 1BD2D 4XO5A 3TCXA 1AJ7H 1A3ZA 5T1DL 4NC2B 1U8NB 1Z9SB 1SJMA 4G72B 4KHTH 1QWUA 3CBKB 2HH0H 5E8PB 1V55B 5JHAA 4PB0H 3MYZA 4EKXA 1FVCB 3D69A 5ITFA 1A64A 4YHOL 1HJBC 1BF2A 1SY6L 4J5VA 4HC1H 2X6AA 5F3BA 3GRWL 4LPXA 3MFFB 1ICTA 4PLOB 3AREB 5C07D 4YBLC 4PY7B 3VQLA 4WNSA 1KCVL 3GSWB 3DX1A 1IC5L 3OAUH 5I23A 3D4CA 2BVQA 2G30A 3NJIA 3DUSA 3DJTA 4QGTA 5J8OA 3D4ZA 3OVUB 4MCYA 1NIEA 5LCVA 1RIUH 2XICA 4P2QE 2D0GA 3B56A 5J6GB 4JJ5A 1FYHB 1J1PL 3CSTA 3DECA 4H2CA 2LTQC 5AW7B 3PAYA 3PGCB 2A83B 4AITA 4AJVA 3FL7A 1WVZA 1OF2B 1E90A 5FGBC 4FZEH 2KPWA 3ET9F 3LQZB 4TUKH 2VT0A 4TSAH 2ORBH 4HCFA 4ODUB 3DETC 1F4AA 4GPVA 3GJFK 4JB9L 3TCTA 2AXHA 2WZ0A 2MH4A 4WDIA 3U1SL 3LOWA 4FQCL 2ICEB 9PCYA 4HA1A 1CFMA 1AQHA 1BGXH 1XGQB 4RWYL 1DE4A 2B4CL 1G9EA 4DKFL 5DD6B 4J3BA 5E94B 3X17A 2AJZB 4N1EA 1L7TL 1XF2A 5L6YL 3EKCA 2WNWA 3FTGB 3FOLB 4H26A 1LE9B 2NNCA 2V2TA 2O61A 2WKOA 2XA8L 3SD5A 4Z7UF 1TSHA 1RJZA 3GC3A 3L3DA 4ZNEA 4M4PA 1E6OH 4P2YA 2B1HH 1K6QH 1UXWB 4F37K 5A3ID 1C9SA 1I7UB 1S9VA 4UINH 4ERSH 1F4WL 1ZV2A 3LKNA 2M83A 2A6KB 5JUEL 4EPSA 3AC0A 5EO1B 4MBOA 5AYTA 4BD4A 3UEQA 4KK5D 1IGTA 4X7FC 2DB8A 3G3LA 4QXUL 4XP6L 4OV6F 3LMJL 1P1ZA 1T2JA 2J71A 4KHXL 3ZKQD 4AZUA 4R2GB 5E1AA 3ARFD 6PCYA 4UAOC 2K7QA 4EVNB 1U8JA 4K2UL 3CHRA 5CWSA 3NIGB 5FYLD 4E9YA 2VN4A 2WXGA 4PWIA 2V7NB 2VDQB 1BEYL 5FPIA 5IR1A 5DUBB 3SE6A 3RUGB 5IMLB 4G6AD 5E4OA 3AB0B 3CFJA 3OKYA 4OUOA 2DJUA 4APXB 4HLJA 4N8PA 1ED3A 1MCRA 2VM9A 1QPKA 4W9ZA 1UOWA 4AQ1C 3PWLB 1NAKL 1J1XL 3TO4B 3EH5B 4EIBA 3Q43A 5GHWH 1GGBH 1NC4A 2JKXA 3FQUB 3P4NB 1U8QB 4PJ9B 3VGAB 1T1XA 2A4CA 2W5PA 2GK2A 1H6TA 1LNUA 2N7BA 4M1DH 4OLUH 1NCDH 5D8JH 4NXKA 3ZDYE 1OAXL 5HDOA 3V4PL 1J5IA 3HI6L 4NZJA 1MAML 1OGAE 4FKKA 5T3ZL 4G1MA 2X2UA 4C59B 4CJ0A 1CT8B 3M45A 4LOUC 4M7JL 3D05A 3QZWA 2VXVH 1S2EA 1NEPA 1E5AA 3VYOA 3INOA 4NSKA 4PV9B 4X7SH 5DVMA 3QVAA 4OLVL 1EEZA 3EJUA 5JPNC 1Q90A 5JOPE 4EOWH 1U92B 2EE9A 1AKJD 3BKYL 1TCRB 1UXLA 3FSZA 1INDL 2UXVA 1B6UA 5HPOA 1D5MA 1FGNH 1KLGB 1E0OB 3FYEB 1J48A 4YSTA 3B2DC 5BO0D 1OTTD 3P0GB 2COVD 1FFPA 1QNIA 1HHHB 1DQIA 2Z91B 4GMSH 4JZJA 2A99A 3KMDA 1MLCA 4N90D 4GAYB 1SYVA 4FI6A 1IEHA 4AIZB 1BQSA 4Z7UB 3O3DB 2CDEB 2ZIDA 2NX5B 3S97C 1U93B 1PZCA 3LEVH 3LV3A 1QHOA 1ZMYA 4C56A 1FDLH 3N55A 5ANMB 4P48A 4YSAA 4OH2A 3B9KD 5HHME 4MZRA 2AV7A 5I1CL 3KWWB 3J7HA 1QRND 3FDWA 4J23A 4ZMVA 4L8DA 3MO1B 3QUZD 3B9DA 4I0PD 2Q6WA 1OGAA 1CI3M 4HJGA 4I48B 4LKXB 5EU6B 1H15B 3BUYA 4PRIB 1AFVH 5EUOA 5DD3H 5DLLA 3T9WA 4KU1A 3O6KL 2NTFB 2DWXA 3BRDA 3KW7A 4HJ1A 2Y5TB 4JG0L 4PTUA 1OP4A 3TZVC 4R7NB 1LM8V 4NCC2 1HHKB 1BIHA 2VW4A 4ODXB 3N1FC 2QGEA 4MJ6B 1KPRB 1UD8A 3VWKB 3BWSA 3PDOA 4CADB 2HVJA 4QHNB 5JA8B 4X6DB 2YXVA 5B3JE 1B2WH 3KLAB 3GI9L 1SRDA 2GY5A 2X70B 4U49A 4MCZA 2A73A 3QG6A 4KH2A 4L23A 2L0DA 2N7SA 3CX5K 1F42A 1A0QL 4CU6A 3RFRA 5HVGB 2TSBA 2R1WA 1P4IH 4WW2A 4MSWB 4PSPA 5EUKB 5I1AB 4ZTOH 1SZNA 5C8JA 3ARXA 1YNTB 1DVFD 2Y4SA 4ZX4A 1PY0A 2ENJA 1RK0A 3KNBA 5HYSB 2H47C 3BVVA 2RQ8A 3LKQA 1KJ2B 1Q1JH 2XYCA 4GIPD 2B20A 1B0WA 3NABL 4N0CD 4P46B 4WCYH 5KN5B 4H1LG 5EMYA 2X6CA 4R0LB 3TT3H 3RWCB 4KJPC 4H1LA 4M7LH 1OGTA 2IAMD 4NM4H 2DQIH 5E08L 4PS4H 4I77L 4MA1B 3JWNE 3R8BB 3DJ9A 3NFNA 2ZWLT 4K3GA 2Y5EA 3TEUA 1FG2A 3OHXC 5ICXB 4E9SA 5C0JB 5DZLA 2J57A 5G55A 4J6IA 3OB0H 1YEHH 3MRGB 3ZDXE 5EBWA 2A6DB 2AQ1A 3B7YA 3QQ4B 5GIRA 3QDGB 5C09A 4HPHA 4L4VB 1ETB1 2ENYA 5B39B 4P2OA 3L9YA 2I9LA 5TFSH 2OW7A 4KKLC 3V0HA 1DN0B 1H8LA 4BFFA 1DYZA 4ZT1A 3H9ZA 1A4KA 1HHJB 2YRBA 3R7RA 5C0AA 1T89A 2E47A 5J3HD 2F19H 4Y2OA 4LP8A 4K7FB 4TM9A 1R34A 3O2DL 4BH7A 1UZ6E 5K9OB 4NHUB 2YK1H 3CN3A 1NEUA 4NNPL 1NC2A 2XX0A 3RI5K 3GINA 2AEQL 4JFDB 5FK9B 3LEYL 1HHIB 3GM0A 3M6DA 3DXAD 2EXTA 3TBWA 1R3IH 2EEFA 1X7TA 2Y6SC 4X7TA 3WXVH 2APFA 4CUCA 1RJZB 4CNIA 1K72A 2KLSA 1KGJA 2Y72A 4CN4A 3WLBA 4YDLB 4Z3HA 2YQ3A 2BRRH 3CFCL 3LKNB 2HKHL 3N43F 2IPTL 4YE0A 4CC4A 2QV2A 3N40P 2WN2A 4JM0A 4XNUH 3NEEA 3QPXL 4QHKJ 4N8VB 1CTNA 1T20A 4MJHA 4LGPB 4MAYB 1JNNH 3T3ME 1I1YB 1OKEA 4BFJA 3Q5YA 3VGGA 5HD8D 5C0CB 4HU8A 2XBDA 3TONA 4EVNA 4X83A 2DWEB 4JHZA 4UNIA 4NKMB 4Q4IA 1R5IB 1PZBA 4M7LL 2A9NH 4NM4L 4PRAA 5A2LH 2R7EB 4F27A 4F9PC 1MCPL 2B59A 4O4YH 4JRXD 3ML9A 1I53A 2BCKB 1PEZA 4G8FB 3BEWB 2RFXB 3CC5B 3H9YA 5LBGA 3E6FA 1J0ZA 4ETQB 1ZGLP 2YGNA 2PP8A 3C6LB 3GMOA 5HHQA 1WZ1L 1ZANH 2BVOA 1N0LB 2MOGA 2YO3A 4ZD3L 1MAKA 2WLIA 1Q0XL 2XQBL 5ABAA 4CDHA 4AT6A 2YPLD 2GQHA 4U6TA 5ID0B 3SJVE 3CX2A 5AYUH 4G8GD 4N5UA 3O3UN 2NLJA 4LO9A 4AK1A 2YBRB 1EEUA 1ZT4A 3S2CA 3O6ML 1RZ8B 2JI2A 3B43A 1CFBA 2JB5L 5IQ7H 4D9LL 1HN1A 3S4SG 1U91A 1PLCA 4TNWK 3WMQA 3AU1A 4NBXB 4LVEA 4K3JH 3MBEC 1ACXA 1KGCE 4EUPB 3ARSA 2AEOA 1UXMA 3OKKA 5BS0D 1R3HB 2PKDA 3RA7L 3NK3A 3T65A 2CK0L 4HK3N 3UGXA 3ZE2B 1M71B 5IIEA 5FUOL 5I28A 4UILH 3FF7A 4GT7A 5ILTL 4OLEA 4P9HL 1MI5B 1BLIA 1YEEH 4MMZA 3QCUH 5DQ9A 4MNGE 1QFWI 3OQ3B 3HR5B 2XKNB 4BIKA 1O6TA 5I76B 4YWGH 4NENA 4PRPE 5C3LD 3CXHJ 2NXYB 4B96A 1PY9A 1T04A 2JJWA 1Q9LB 4PJ8D 2AV1B 3ES6B 3L7FB 2UUDK 43C9A 4WTQA 3IFLH 5FM5M 1A6PA 1ORSA 3ARTA 3GJFB 4AIZA 2QSCL 5CGTA 4ICWA 2ARJQ 5BVJB 3BIBX 4G9DA 1TZGH 3V7MA 3BOVA 4NZFA 1V10A 4Y4KA 3R06A 5MP6H 1AOZA 1I85A 1INEL 1M2VA 3DSFL 4G6ML 3OF6A 4UTBL 3VNZA 1ML0A 3U7AA 5C0FB 5EBLB 4TYUA 4Z7VF 5DJCA 5HYSG 1G9MH 3HVNA 3K4ZA 2Q7YA 4AE1A 4WEBH 1G7QB 1DQDH 3EDJA 1YEKH 3LZLA 3B7SA 3CZGA 2C3XA 2ZCHL 1U8HA 4HUXB 3LRLA 1BHGA 3HE7D 4LAQH 1T5WB 3WFEH 1CVRA 4HVBA 1YHPA 1CLOL 2VUKA 4AGNA 3FO1A 4DKFH 3DLQR 1IM9D 5CJOL 4M6NH 1R24A 4I0PB 3D5OF 2BO0A 1JZFA 1MI5E 4H4NA 4HFWA 3O3AB 3EOYG 5E4EC 2J8UE 1T5XB 4NQCB 5JW4R 1P6AB 3KJ4C 3O3BA 2UY7A 4NNXA 3W82A 5HGHB 2A73B 3APFA 3QG6B 4G5AA 4Y4FC 1H0DB 1U3HB 2ATPA 5CZRA 5I15H 4QRQB 4KKAD 3MRHA 3RWGB 2QVIA 3K0YA 4AM0A 2LOEA 3Q1SH 3KPSA 4YN3A 1JF1B 2IBGA 3L9BA 2AJYL 1EVTC 3VD2A 5DGQA 4X2UA 1DSYA 3RNQB 1WWWX 4BUHA 1M7IB 3WGVB 4MA3B 4X4ME 2K45A 2WWOA 4U1SB 5IBLC 3EUDA 1KXQA 3VFSA 1RIHL 2H32B 4HD9A 4JANB 2MCPH 4AMXA 3ABMB 2H7WA 3WFDH 5FF6B 5C71A 5FYJE 3EGSA 3MRGA 2L7JA 1HE8A 3KPPB 4KV5E 4WO0A 5FEBA 5CILH 3G6DL 4ZS7H 3QDHA 2BVEA 4GSQA 4RESB 2J72A 3UTQB 2GIYA 2BRQA 1XGUA 3AACA 3GMLB 4P4KC 4MHHG 3C9NA 4F2ME 2P7TB 4DVRL 2ATKA 5FO7A 1ZPUA 4AUUA 4WU5B 5D6DC 2IPKA 5D1ZA 4AV5A 3BIKB 4L4JA 3M1BA 1CL7I 3GI9H 4LLUB 2R83A 2A4ZA 3QISA 4HKZA 4XHQA 3ZO0A 2CHZA 3DUUB 5GZND 5CBAA 1ROWA 3KXFE 2FBRA 5DQJB 4HMCA 3GRGA 2HT2C 2YFNA 3LB6C 3WEAA 4RZCB 1KTDB 1XF3B 1TJMA 2YMTA 3PF2A 4N2AA 3NJKA 2XNAB 3GXTA 2BDNH 2L8AA 1RXLA 3CBJB 4JVWA 5BPPA 3Q8CA 2FRGP 3QXAA 5ISZB 3PIQB 1MN4A 2IQ9H 2CM5A 4NBYB 1KENL 3VXPB 1GS6X 2BH0A 4G43B 3A6CL 3FO9B 4DKEH 1J5CA 1QPXA 3HG3A 3ARWA 3FKUS 2YJLA 1A25A 1O7VA 5D1XC 1JXKA 1TOXA 2FBOJ 4N8VA 2ALWA 3O8XB 5B1AB 3SJVD 4HALA 1FL5B 2WQAA 4X5XA 5EA0L 3S36X 4B5EA 3REWB 1NCGA 4A55A 1C8PA 4KTGA 1NKOA 2Z3FA 2TSAA 3DI3B 2Q20A 5DFTA 1S7QB 2YOCA 3HS9A 4JUSA 2WZPA 3LHAA 4M29A 4DUVA 4AV0A 3VI4B 2LU3A 2ZOOA 1JPFB 2FL5A 2AQRA 1T7WA 5GGTL 4N8UA 3VXOB 4NJAL 5DHDA 5IB5A 2VTFA 4KKBC 1NGPH 3KPLB 3QDAA 4NZRH 2NT1A 3IWVA 3MZGB 3VXUE 2R0KL 3EBGA 4X80H 1VEMA 4GAFB 1KWGA 4PJGB 4N87A 1OSZB 2B8OT 1CGVA 2ZAHA 2Z7ZA 4OF6A 1HZKA 3UP1A 3QUYD 2AI0L 4PJBB 1CFNA 1YEJL 3VWJD 2ZUWA 2N4IA 3EYQC 3G6AB 4LSRH 5H35B 3BKCL 4OCXL 2EEXA 1OXYA 1W8OA 5FO8B 3V4VL 1PAZA 3VXRE 4XI5D 5EIIA 4HEMA 3QI9D 2ZCLL 5DDHB 2PYEE 2EYSB 1QSVA 4WTZG 2WLJA 2P4AB 4QRPE 5GRUH 2CLRA 3CZNA 4WU7A 3QXDB 2OR7A 4GXVH 2YD6A 4Q58C 4NPKA 4OJFL 3COOA 5IESL 5D7LD 1WFNA 4XCFH 4XBEH 3NPSB 5DJAB 4EUPH 1AO7E 3GMQA 4X6DE 4L3ED 2QFPA 3U1QA 4NO3B 4F9LC 3S88H 2A9AA 3LX9A 2C9UA 1MFVA 4XN9A 2COQA 1L3NA 1JDDA 3W1ZA 4FNSA 4JDEB 3Q06A 1MRFH 4RCAA 2EUWA 1WHOA 1B4TA 2O4EA 2F5AH 3RWFA 4KQ0A 4QT5B 5D1ZI 4G6KH 5AL0A 4TSBH 4F3FB 3I02B 1MNUL 1CC3A 4HDIA 2O6CA 4RX4A 3QNXB 4EI5C 4UQ3A 1AC0A 5K9QI