1WHPA

Allergen phl p 2
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
94
structure length
94
Chain Sequence
VPKVTFTVEKGSNEKHLAVLVKYEGDTMAEVELREHGSDEWVAMTKGEGGVWTFDSEEPLQGPFNFRFLTEKGMKNVFDDVVPEKYTIGATYAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Phl P 2, a Major Timothy Grass (Phleum Pratense) Pollen Allergen
rcsb
source organism Phleum pratense
molecule tags Allergen
molecule keywords ALLERGEN PHL P 2
total genus 16
structure length 94
sequence length 94
ec nomenclature
pdb deposition date 1997-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01357 Pollen_allerg_1 Pollen allergen
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.760 Mainly Beta Sandwich Immunoglobulin-like Expansin, cellulose-binding-like domain 1whpA00
1WHPA 1BMWA 4JS7A 1WHOA 2HCZX 3FT1A 3D30A 4FG4A 4JJOA 4FG2A 4FFTA 3FT9A 4FERA 4JCWA 4L48A 1N10A 2JNZA 2VXQA 2BH0A
chains in the Genus database with same CATH superfamily
4TTDD 4B9GA 1BQKA 3TV3L 2IMMA 3FKUS 5DJAB 3ARBD 5FUOL 2XQ0A 5ADPH 3ILEA 3HIZA 2DAVA 2BZCA 4ZAKB 1U91B 2BC4B 2ZUWA 4AOFA 5T3ZE 3FQ4A 1LK3H 5LG6A 1HCFX 5ID0B 3GEWB 3PJNA 1EFXA 1CGUA 1DSWA 1NCAL 3FQWB 4AC4A 1ZT7B 3MCYA 4QF1B 4BQCA 4C83B 2C4FT 2OMYA 1EAPA 1OT4A 4HBQA 3MJ9H 4IU3B 1HEHC 5KS9A 5B4MC 1YJDH 3SDDB 4X8XA 2VC2B 4LCWD 4OQ1A 4PTTB 5E8EB 4BWUA 3AUVA 4J39A 4R7DB 3TFKC 3AU1A 2UZYB 3CH1B 1IEAA 5KUMA 3OSKA 3EJUA 3L4VA 2QFPA 4NQVA 2JTDA 1ZIBA 2X4TA 4X7FC 4AJVA 2CDFA 3FU8A 2M1KA 1QYGL 3OR7B 4ZS6C 2Y2TA 4FQXC 3T65B 1W0YT 5ADOH 4PJBA 1S9YA 1K4DA 1LNUA 1MUJA 3IJHA 3TIDA 3W0WB 1C1EL 5KBNC 1H3PH 1DVFC 4ZFZA 4WEUD 1G7PB 4FYSA 3MRFB 1FIGH 1TITA 1PKQA 1WCBA 4H8UA 4JRLA 4F37F 2YAFA 4NNYB 1A6VH 1K8DB 4JDVB 5F7EL 5EDXA 3ZY7A 3ULVC 1F41A 1QX1A 1I3UA 3HG2A 3RUGF 4EDXB 3GMOA 2QR0B 4P5TA 3TO2B 5T1MA 4X4XA 5HYIA 4LU5L 4GFXA 2E6PA 4XODA 4MD5A 3V0FA 3VFWA 4AYGA 3AM8C 4GRLB 4F58L 3IAPA 3DV6A 4LDEB 5JYLA 3LJ3A 3REVA 3TVMA 3RVTD 1PS3A 5HHOB 4I18C 2PP7A 2YAOA 3EYFA 4KK8C 3NH7H 1UG9A 1HHJB 4TLKA 4OVUA 4W6YB 2XV2A 4WTXA 2PPCA 4M1GH 1DJZA 5AVVB 5FM4A 3QEUB 1YEKH 4QXUL 1FVEB 5B38G 3RDJA 2JJSC 5IG7A 4TVPE 3D0VB 4GMTL 1NCDH 2N7AA 4PP1D 3X11B 3QXAB 1KGCD 3N42F 1Q72L 2OMWB 4TUOB 3K6SA 3GRWA 3V7AG 3T0XA 5HJGA 1ZGLA 3UZQB 3II3A 1IVLA 3ZIYA 4NKOA 4QJ3B 5FW8A 2D7TL 4LSVL 4O51A 1EHAA 3WKMH 3QEGL 3VW3L 3C8HA 5AVYB 4RQQB 4YHLL 5BMFL 1DDHB 1A4BA 5BPPA 1IBHA 1YMMB 2IPUK 3VWKB 3RYMA 4RGNB 3VFUA 3OF6A 4LLYA 1Z0NA 5ITBL 5EZJB 3D33A 3D1MC 3QJTB 2VZ1A 3GBNL 3GSXB 5A7EA 1LL1A 1L9OA 5F0JB 4L1SA 5T5NG 1FSKB 3G5VA 3HPLB 2Q3AA 4YDKH 2GY7B 4P2OA 1WA1X 4U33A 3OZ9L 5DGQA 3VQMA 4BCYA 3VTAA 4LOUD 2N1TE 4P5SA 5CSGA 5G4MA 4BFIB 4CILA 1KXVA 2A83B 3EO9L 1GOHA 4L4TD 2Y3AA 3PFUA 4R4ND 3HE6B 2XV0A 4L4VB 4F24A 1ZEAL 1RUQL 4PRNA 1OKEA 1MIEH 4NKOB 1JK9B 2K8QA 4HDIA 4NSKA 4Z3JA 1HE7A 2GABA 5HPOA 1KLGA 5D2LA 4OBSA 2WBJC 2RIKA 4N2HA 2R8SL 4PS7A 3ML8A 4KJQC 2D0HA 3RGVA 3L4TA 4MA3A 4O2CB 2EVFA 5DD6A 1Q0EA 2VLMD 4TKWA 4QY8A 1IKFL 3PGCA 2UX7A 2GT9B 3JUYA 4Q6IC 2NNRA 1WEJH 2Y25A 5A6LA 4A7UA 1P5UC 1JFQL 1OCCB 5MEOA 4N0FB 3MV9D 3WY1A 8FABA 3HCVB 3SPGA 1EAPB 4D9RE 2DJ4A 5E7FA 1BVZA 2V2TA 1EANA 1GIGH 1OE1A 2QVKA 4EIUA 3BGMA 2HPTA 3GMRA 2EO7A 3CG8A 3AWGA 4PJBF 5ECJE 4ZPVA 4P57B 3FCTA 4YFDB 3QXDA 1LDPL 5C0NC 4ZPTA 3LX9A 5GRUL 4Y4KC 1MN4A 5AG9A 3FQNA 4WO4B 3ZRFC 1RUAH 1BFOB 1U6AH 4GRMA 2FTAA 4ZBJA 4LF3B 3LZPA 2E6QA 1S9YB 3EW3B 2OZNA 3D4GA 3HE6D 3KYKL 1GYWA 1E90A 1WAEA 1EQWA 1I8UA 2LOEA 4JFEA 4PJ6A 1SXZA 5ISZB 1ES0B 1L5GB 2DQIH 2NYKA 4PBXA 4TVPD 1T0PB 3P11L 4OZIE 3FUDA 3NTCL 2BSTB 3KYKH 1E28A 4RGOH 5SWZE 4XPTH 3NESA 3HKZA 3QDGE 4Y9GA 4KX7A 1CL7I 4PJ7A 2WYIA 3EUUA 3MV9E 1ETB1 1A6ZA 4FOMA 1QTPA 2ZT9C 3PS6A 4MCYA 5EU3A 1KGUA 3F2LA 1GJUA 3F85A 4NO3A 3X3GL 3V4VL 5EO9A 4CVXB 1E4WH 2Z4TA 2WTOA 4WFGE 1LDPH 3V10A 4HS3B 3GC3A 4X5PA 4OZIA 4FI7A 2E7LA 4C4KT 4WTQA 1R34A 3IE9A 4U05A 3ATDA 2J8HA 4KQ4H 4HWNA 5KOMC 3SE6A 3ZDZF 5DLML 3ARSA 3IGKA 4XNXL 1KJ2A 1CGYA 4OLZH 1JE6A 5HDBF 4H2AA 1NL0L 4JPVL 3JV6A 2H2SD 3BZFA 3LXUX 4MAYC 1FFRA 2A2QT 4YR6B 5ISZD 3CDYA 4YHML 2ROYA 5J12C 4BZYA 3UO1L 3C5JB 5IEKB 5JUEL 3IGUA 4QUOA 1X5XA 2W59A 5I66A 1X6LA 5GRVK 4HIJB 3U36A 3BH8A 3DMMC 1EUUA 3ATAA 4JAMA 4HOZA 3L48A 4P2QA 2ZSVB 3V4UL 3ZE0B 2BY1A 3LQAL 5INDB 4YOKA 3OL2A 3K2UH 1C7TA 4JFHD 2WNWA 3T0BA 2APSA 2ICEC 2B9BA 1ASQA 4PUBH 4PWIA 2DD8H 3HFMH 4GRWH 4KKCD 1U3HD 4PJGB 5D1ZB 2HH0L 4UTBA 3GKWH 2KDGA 3GXMA 4ZPVB 1LEGA 3QNZA 2D31B 3TCXA 3W0WD 4YL4A 2R23A 1PL3A 1ZIAA 3LTVA 4P4KC 3AMKA 1I85C 2GVYA 3GHBH 4OFPA 2KZKA 3TYFA 4BM7A 5L8LB 4DP7X 1FNGB 5JQ6H 4Y8AA 2WZAA 4QAWA 2ZAGA 2OJZH 1QRND 5IK3B 5F3HA 5EOTA 2Z9TA 3Q2CA 4APXB 3UCQA 4JM0A 5DYOB 1UJ3A 1MLBA 2NY7H 5I2IB 2PYEA 4ODWA 4O02B 3CFKB 3K5RA 3AQYA 3UAAA 1U3YA 4LBEA 4MHHI 5LWYL 1SXSA 1FZOB 5JIQA 3UAJC 1ZS8A 1XH3B 2VO5A 3N44F 3BP5B 3OB0K 2FWUA 1DO5A 1G9ML 3GXDA 3P2TA 3SB3A 4PBWD 1YEIL 4WK0B 4L8BA 3QR2A 1QLRB 3C2AH 4H1LB 4D8OA 2PTVA 3MODH 1AZCA 2XN9D 4PWHA 3NZ8B 5C0EB 3BUDA 3L9RB 3P73A 4M43L 1KCKA 2G75A 4XN1A 5E2UL 3T71A 2YKLL 5ANHA 3T2NL 3IU3A 3PXLA 3QQXA 3MACH 1RSFA 3ET9F 1YEGH 2Y06H 4OGXL 3HA0A 4ZPTB 4ICWA 3ZPDA 1ZY9A 5DHXB 4N8CL 5DK2B 1O5PA 1UD5A 1U8LA 4PBVC 4QOKD 2CBOA 3NAAH 2PO6D 4H26B 2YN5A 1OSZA 2XWTA 1XGYL 3VXTB 1NFDA 1MJ8H 4WFGD 2IFFH 3UTTD 4Q4IA 4HULB 4IEFA 4MXQC 4Y1SA 3NCEB 4NFDA 3UYPB 3H9HA 3HAEA 1U92B 2BIQA 3EYOA 4X7TA 2R4SH 3RIAF 2IAMB 2WNGA 1QQDB 4XPBH 1RZJL 1WJ3A 3TF7C 1JHLH 4IDJL 4I87A 4K8RH 1JPGB 2MKWA 2IOIA 3IM1A 5FA4B 1VFBB 4O5LH 3TA3D 1P4UA 1G87A 1P5VB 1JRHI 3K0YA 5DHVB 5DK0A 3QYMA 2R56L 4OZIF 3IPBA 1E7VA 4LIQL 6FABL 2Y07H 2H7WA 1ZSDA 3TWCH 5B8CB 3OMAB 4UV4H 4Q2ZA 4LB8A 1P6FA 1ZHBB 3BH4A 2E8ZA 1RERA 3ECBA 2XYCA 4R6UA 1ZXQA 5F88A 4NX0A 2I9TB 2HRPH 2BWQA 5I1CH 5CD5C 4MBOA 4YLQT 2WIIA 3Q2WA 2WINA 3MXVL 4U49A 3GI8H 4PR5B 4FQXB 3KHQA 1CLVA 1NGXA 4WU5A 1Z0MA 2FAUA 3TH4T 4I0KA 2JV6A 5D1QB 4G8FB 3BFWA 1HXKA 4P2AA 1G1OA 3E8UL 7FABL 1M6UA 2RH0A 1UA6L 2UXVA 2X09A 3L3IB 1EZSA 3FNKA 3SE8L 1QLRA 3NFSH 4P06A 3QI9C 2AI0L 1A66A 2E7HA 4IMKC 4LRIA 3VFVA 1T1ZB 2K7QA 1PD1A 4OIIL 5E6RB 1TZ8A 5D72L 3RVXD 3QDGD 5LBGA 4JUTA 1UA6H 2D03L 1DL7H 2MMXA 3ZTDC 4OBRA 1NM9A 4GAYA 5EO0A 1ILUA 4W1TA 4R90H 4ABUA 4EN3A 4X50A 3V5HB 1NPNA 2YKKA 5KYUB 4HFWA 4ABWA 1XGPA 2H1PL 2YRZA 4OT1H 4H88H 1SJMA 3NZSA 2XC8A 5C0DA 3K2IA 4OM0H 4ZYKA 2XWTB 2JKIS 2V9UA 1T7XA 1SOKA 1ZT4A 4NO0D 3QORD 4D0CB 3P3YA 2PYFA 3OG6B 1ADQH 1TQTA 1MJJB 4OF3A 5HDQL 4K94L 3HPLA 4PREA 1AI1H 3VFPB 5AL8A 4F27A 3OKMA 2PPDA 1CGSL 1XH0A 1G4RA 3FUFA 2ICWJ 3P73B 1TYEB 2H6PA 5TE6L 4E36A 1HFUA 5DJCB 2JJTC 3HC2A 3B43A 4IBZA 3VVVA 1U30A 3W37A 5IR1B 3X11A 2H8PA 3VI3A 3L3HB 5ETUB 1L7TH 3BISA 5DHVA 3H7BB 5DK0B 3SYOA 1FAIL 5KBDA 3CVCA 3ERXA 3HHSA 5I8CA 1FO0B 1XGRB 4KMTL 3ESUF 4YO0A 4NOFA 1I9IH 3FSVA 5AD0B 1JL8A 3ORJA 1FNLA 3L7FB 4DUVA 1ZS2A 4KJQD 5DFWH 2HWZL 1TTAA 3H3BC 2IJ0C 2O5ZL 3L4XA 4W9KC 3WDHA 4JR9L 1DN2A 4UYQA 1XAUA 4QYOA 4XNYH 4AVJA 1O9WA 3IDUA 4OT1L 3TBSB 1A4JB 3BGFB 3G3LA 2BVPB 4J3OG 3MLVH 5HHNA 5LQBH 1U8MB 4ZMWA 2YO3A 3U7YL 1PLAA 3GB7B 3ZE1B 5T33H 3E0GA 2C7UA 3Q8EA 3Q2LA 4NO2B 4GP5B 4JGMA 4I3RH 5C0RL 4FZEL 3WIFA 2GBTA 1RZKC 5CU9A 3I9GH 3K1KC 4MX7B 5D55A 2DY2A 4QHUB 4FNSA 1I1CA 2DD8L 4N8VB 1CK0L 2VERA 3SYPA 2YQ3A 1GZHA 2AAVA 4CGUB 2JJWA 4JFVA 5AEAA 3STLA 1WK0A 1ASOA 3V9EA 5GRWA 4YFLI 4YSEA 5MEND 4XTRC 3P4MA 4RWYH 5EU7C 1RZFL 2P7TB 4HKJB 4GPVA 3ILPB 5G4NA 3MOBH 1S9WA 4HGWB 5L4MA 3TBCA 3DTUB 5DJZA 3ASOB 4X5XA 3IWVA 3DVNA 2OK0L 1M6OB 4KJPD 3EDDA 3UXFA 5IQ7H 3KL5A 3SBPA 4HWEL 3UEZA 5CMAA 1VGKA 1T4KB 1NBVL 4JDEA 4NQDB 4DN4L 1F4HA 5FOBB 2DEYX 2WN3A 1DDTA 3O81A 5LNGA 4WO4C 3DARA 5I8KL 5CEXA 3HN8A 1MKFA 5EV7A 5IV2A 4P23A 3FO2A 3MKGA 2NOYA 4QR7A 1J0ZA 4BHUI 1KEGL 1DN0B 4NQQA 1HILB 4LVOC 3DMMA 3WIHH 1I9RL 4DEPB 2Y7LA 2DQEH 1NBYA 2R69H 3LKRA 4ABQA 3ZO0A 1SBSL 3QEQA 2B59B 2WKOF 3ZDYE 2F1EA 3GIVA 1T6BX 2AP2A 4FFZA 4PLKD 2LVEA 4PY8I 1QFUL 4JFOB 1UOVA 2R69A 1IAKA 1T2QL 1T5KA 3WXVH 1X9RA 2FX7H 1H0DB 4FFZH 1IGFL 4XBGB 3LVEA 3O41A 3WFBL 4PRIE 1B0IA 1J0IA 4U6YA 1XGTB 2IWKA 3JT2A 3KYOB 4D9QE 2CR0A 4HWEH 1MCSA 1XF3B 3P9MA 4JO4H 4MDJB 5DUJA 1A1MB 3A6CL 2DW5A 5GGQH 1V7NH 3UJIH 4D7PA 2R4RL 2WAHA 3V6FA 3GNMH 3WKML 4WI2A 2HAZA 4FFVD 3CBJB 2BRRL 4WCYH 3H8NA 4AIXA 1S7XB 3EFDL 1Y6MR 3LS4H 4LCWB 3D7PA 4B27A 5HGDA 2WUCH 1RIHH 3D3VA 3HG3A 4KKCC 5HGBB 3WFZA 5FB8B 4PJ5E 5DVNA 4PS3A 1IGML 1XH1A 5J12B 2BVQB 3SYCA 3S8GB 2HTLC 4YXKL 3QIBC 3G08A 4QXUH 5ESQA 1OAQL 1NBQA 3WKNA 4CW1B 1CE1L 3NCWA 4JM2C 2YRPA 2DLGA 4GAGL 2HTLD 2JJTA 2VT0A 5DJXB 3ZKXB 2C9XA 1YYMH 1FYHB 3PAUA 4FP8L 3GHEH 1LXMA 5EULV 5TPWL 1I53A 5I82A 4MJ6B 2Y36L 2VO8A 5EOCH 1U4EA 3GSOB 1RIVH 4MXQD 1L9PA 1QI5A 1NANI 4KVNL 5D1ZC 1JZFA 4JFED 4DP8X 3GHEL 3X1FA 2A9AA 4LAJH 4FXKB 1VGEH 3LN9A 1A3LL 1GGBL 3V6OE 5I19L 1IB5A 4HK3J 5JXAL 2AEWA 1AANA 1N26A 4R8WL 3Q43A 4EUPA 4MXVE 2FJGA 3B1UA 4I1NB 5MENB 4HPYH 3RWDA 3TEZA 1XZ0B 4E9VA 5JHLH 3SKJH 1CB4A 1I4FB 4ZXBD 3NN8A 5IROD 1RJCA 3RIAK 3VGBA 5DWPA 4QIRA 4W9IC 2OZ4A 1B3JA 3EFDH 4MJJA 2ATKB 4OIAA 4G7QB 2CNZA 2AKRB 5JHLA 2WUCL 1EUTA 5EIIB 3I75B 2HG5B 4LEOA 2Y5EA 2WXHA 1YEEH 2HKHH 5DRZB 1P1ZA 3FRUB 4G8GD 3OB0H 4XGZB 4O4YL 1INEH 1PF3A 2VDQH 3E1ZA 3HG5A 3KH3A 5I5JA 3RVVC 4JHZA 3W57A 2A3TA 4OM0L 5T3XH 1KWGA 1R3KB 4X4ME 4X80H 3OXSA 1HSBA 4IS6B 3KWWA 4OCRL 1S7UB 1XAKA 3D85B 4MNHA 4XMXA 2EDFA 3BT0A 3B2XA 2NRDA 4R26L 4IRJD 3I50H 4FFVC 3C6LD 2NLJB 4P46B 3DTXA 4PCKA 1CLZL 3RI5K 4ZNCD 1MW3A 2CDEB 2I5YH 4AM0Q 1OV8A 5A2KH 1IMHC 3TJEH 2XFXB 4HUVB 1IQDB 4IDLA 3QC5X 3FS9A 4FG6C 1QNIA 4Z7NF 3MV8A 5DQJA 4ELKA 4ZO7A 4KAQL 2ROXA 4AW7A 4Z3TA 4K71B 4Q2ZB 4Z77B 4JRWA 2R1XB 1QSEE 2VLKA 3RWCA 3GM8A 1IM3B 4CGTA 3GS4A 4EBQH 3HFFA 1PFOA 4LLUB 2C3GA 4CJ1A 5I17A 2EEDA 1AKPA 5EBMA 2Z1PA 3SDYH 3NRQA 1RXLA 1HCZA 1U8HB 3SDXF 4W9JC 4PW4A 1TZIA 1DBJH 1BFSA 4P07A 1WZ1L 1RFDH 3LKNB 4J6RH 3Q2NA 3QIUA 1L7IH 2X2UA 5E2WL 1NL0H 2X4UA 2IAMA 5CCJA 4NPJA 4W93A 4D7BA 1VF5C 4DK3A 4AVHA 1G9HA 4QHLA 5I1AA 2EH7H 2GTQA 3U9UA 2DJUA 4N2IA 4NUPA 5AVQB 4YX2L 1FRGL 1XXFC 4MHHG 1X6NA 2BRQA 3ZRSA 3FOMB 3DX0A 3VWJA 3CZJA 3UIYA 1GZQA 5E8OB 3LNHA 1T89A 4RFEA 5J6HA 4L05A 1KC5H 1LEIA 4TV3A 4K3DL 3D0AA 1UC6A 1UM6H 4Y9CA 3A5VA 3HZYA 1GGIL 3LKPB 2X7LA 5G55A 1AGDA 1E2WA 4RFNC 1J9RA 5HHVL 3VRLE 4IOIB 2RGSA 3DJTA 4CW1A 1D7CA 3LKSA 3RL1A 1G94A 2BINA 2QKIB 1PMYA 1BF8A 4PRPE 1J18A 3QPQC 2EJ1A 3CJJA 1J11A 4M4RA 3NIFE 2BNUA 4OLEA 2ZUVA 5FO8B 1RIUH 3VXOA 4L4VE 3WTUA 4QNPF 1NC4B 5CEZE 5JIDA 1IL1B 1CFVH 5EOQH 5BXFB 1I9IL 2J5WA 1FN4B 1RY7B 4Y9EA 2JI2A 4EOWL 4NKMB 2BXYA 4MS8D 5FW6A 4BH7A 1XB8A 1PU0A 2CK0L 4OUOA 3KS0H 4PRPA 1IM9D 2X9ZA 5DZNA 1N5YH 1UT1A 4TULH 1QLFB 3QQ4B 2J3SA 3MV8E 5C07D 3DOSB 2IVFC 4JDTH 3ATFA 1KTLA 4YX2H 2D3VA 5IEKA 3GJFB 3QXVA 5DQDL 4P59H 5D1XB 1IBBA 4OZFB 3GI9L 3KWUA 2P8PA 5MEQB 2FECL 2NY5H 4LT7A 3T0EC 1BHGA 5DMKA 4UF7C 3CH8A 4MDIB 1GJWA 1V55B 1DUZA 3N1GC 1O9VA 1K6QL 5JR1H 3IRZA 4U1JA 3FHQA 4BK5C 3JV5A 5HHPA 2E75C 3B5GA 1C08A 4U1HA 4GSQA 3HS8A 1CS6A 2VC2H 4PJFE 1R3HA 3EO1B 4PYHA 5E2VH 4G80A 4HHAB 4AZ8B 3EHBB 1G6RH 1YPZA 1IEBB 3TV8A 2FHCA 4PRBB 3RUGE 3MLSL 2OMNA 3DETD 5AYUL 3TWYA 2WNKA 5BV7L 4FS0A 2CHXA 3NGBC 4PQXA 4ODTH 2K7PA 5EG6C 1HI6B 1S7QA 4EAEA 4KGJA 4CVXA 1LEGB 3QNZB 4Z3FA 4X6CA 3APFA 3X13A 3BQVA 4W70A 1X5GA 1R5IB 3SDDD 4BWTA 3ESMA 2I07B 5C0AE 1XEUA 1YPZF 1HWWA 2N56A 3BKYL 5C09D 4TSAL 2G3NA 3HMXA 3L3HA 3BRGC 3FTSA 1MFEH 1KBBA 3RJQB 1AZZC 5KVGH 2YUXA 4YEFA 2NY4C 4HUMB 5KVDH 1C16A 5JW4Q 5A16A 4BXVA 2ZWLT 2Y36H 4F9PA 3BPOC 4O02A 1WTLA 3NJVA 1JUFB 2XACC 2HTKD 2AERT 2WVVA 1I7UA 2VQ1A 4Z0XB 3QIUB 5L4IA 3GMPA 1S8DB 1UXMA 4FQLH 2Y9RT 3J7HA 5C08B 5GSRA 3F7VA 3R8BB 4NNXB 4TNEA 4WTWA 5LVEA 2DBJA 5EBMB 1NOLA 4YBQC 1AO7D 3UH8A 3QDGB 4EI6A 3BE1H 2CR3A 2QSCH 1FN4A 4AQEA 2IANA 2OM5A 1F56A 5DWUH 4E5XB 4F7CB 2D31A 3G5YA 3VGHA 5FGCE 5LO7A 4H44C 1UCBL 1RZJH 4N8PA 3CAFA 4W9HC 2XETA 3EFFA 3FUIA 2D9CA 2IH1B 5C09E 2DTML 5IHUL 1BD2D 3AT0A 2ZWNA 2FO8A 1LEIB 4HUNB 1QFWI 5DYFA 4A7VA 3MLUL 1SOSA 4HEPA 2VE6A 3SOBL 4L3AA 4YDVB 1M2OA 4V11A 4PB9L 4XVJL 5AOIA 2B4CL 4MDIA 2MTPA 1S9WB 3I6GA 2EZ0D 3C5JA 5HDWA 3RVWC 3QRGH 3THMH 3PGDB 3B9KB 2GBVA 1FAKT 3TEXA 3P77B 2P5EB 1Q9LB 1GGIH 1CD0A 3CNKA 3FH5A 1FG2B 2Y1AA 4LRIC 3EH1A 4OGXH 2AQRA 4G5AA 1KB3A 5HYJA 1KEGH 4JFDB 3DIFA 3P2DA 1A7QH 1IC1A 3DRQA 5T3ZH 1GTNA 3FB5A 3INUH 4KXBA 1SUHA 3LEYL 1F11B 2O6FA 2W9EL 1MI5A 1E4JA 3ULUD 1U2HA 4JQVC 4OAWA 3MV7B 1HH6A 3QA3A 2ZX7A 3MBED 4UU9A 5C6PB 1HEJC 1E30A 4LLYB 3G5XA 4S1RL 4R2GD 3GQFA 4N1EA 5G5DB 2PWHA 2X44D 1NCGA 4KMQA 4ZFGH 3P54A 1K8IB 3MX0B 5C6TH 1D5ZA 4NWTL 4UQ2B 4RX4D 5E9DA 4U0QB 4PG9B 1SLXA 1IKOP 1S78C 1C12A 1I3GL 1DBKL 1GGUA 1Q8MA 2WCSA 3DSFL 4W9DC 5E99L 2Z7ZA 1UVQA 5LNDA 2P3YA 4F8OA 2K78A 4WWID 1F58L 4GKOA 3QIBB 1DQQA 3VRIA 3GWJA 4LLDA 5FK9B 3WTSA 3U2JA 1TTFA 4PRNB 2DLHA 4XMVA 2IANB 4M1DL 4Q6YA 3QEUA 4K73A 4YBLC 4PCTA 4YK4B 3SO3B 1KXQE 3KLQA 4YN3A 4HUWA 3K2KA 2VLKB 3RWCB 1DBBH 2HG5A 4UZSA 1X44A 1KCSH 4F7MB 2OXGA 1GH7A 4PB0L 4U6HB 4X7SL 1P1ZB 3ARBB 4OLWL 1ID5I 4FYQA 2BFVH 4FXKC 4XPTL 5L2JA 4NLHA 2XWRA 2Q8AH 1LP9E 5DZAA 2GFBA 1XWVA 3MNDA 4M48H 3NA9H 1XR8B 1JVKA 4K3JL 3BLPX 4LCCA 3B2DC 3BSHA 4JRXD 5EU5A 5E6ZA 3ULSA 4QDGA 4AQ8C 3H9SB 4EZKA 2CCLA 2NUTB 4JVPA 5I71B 2CDFB 3QYNA 4GO6B 2W94A 3BN9D 3L4CA 4PGZA 3MOBL 2E7BA 3ZTNL 3OPZH 1BD2E 3FTGA 5I76B 2EDKA 3PIQB 1ZLUH 5F7WC 3DTXB 5FHAH 2CBTA 4IBWA 1F1GA 1KYOK 1T21A 3E80A 3F01A 4NKDA 4H8WL 1Q9KB 4NPKA 1BA9A 3AJ7A 3MRKB 4WVRA 2JVUA 5LDSA 3S4SG 5IVOA 2F5BL 4EIZC 3LPOA 3UPRB 4QNPE 2H0PA 2QR0A 4FFWC 4KC3B 5CZRA 2FT6A 4RMSA 5E2WH 2O6CA 2HKAA 4LHUD 4OD3L 2Z6FA 4ESKA 2HJLB 3B5TA 1AGCA 5IFHL 1ZT7A 4QF1A 1T2JA 4G8EB 4JQXC 2W9LA 4GMSL 1NIEA 2EIZA 2FJFA 4HZ1A 1D9KA 2WXNA 3RRQA 3VFTB 2Q7YB 2AV7B 3RWGA 1YC7A 2CO6B 2MCAA 4KMLB 3J27A 4PS8A 5CINH 4N3TA 2ZSVA 3RWIB 4WSJA 3SO5A 4JW3A 3OGCB 1FZMB 2VZOA 3IDJA 3V7MA 5EDSA 3CH1A 1KIQA 3QWQB 4JKLA 3EDFA 3DBSA 4NDMA 1JZGA 1FLTX 1W72A 1GOGA 5ANMA 1A6UH 3IJSB 1K3IA 2O1AA 3OR7A 4NZ8A 3MYZA 1JWSA 1ZHKA 4LVNC 5EF2A 2ICEA 1K5NA 4FULA 2OULB 1B0RA 3AQZA 4X2UA 4YSOA 4EI0A 3STLB 4YDIL 4AXWA 3SGEI 3FQWA 1R0AL 2HJLA 2ZTBA 4LBAA 4ODWB 3U1SH 1ZVSA 3W2DH 1A3RH 1CZ8L 5HVHB 1OK8A 1UT9A 1JSYA 3BSZL 3KPSE 3LKSB 1AG0A 3F6IA 2R2HA 4Q0XL 2QV4A 3LAFA 2XX0A 5CMAB 4MD5B 5ALCL 5J9PA 5CCGE 4ENED 3LN5A 2Y69B 4GXFA 5F8RC 4W9FC 5GPRA 5FO8A 4ADIA 3CZFB 4QRQB 3KPNA 3DUSA 3O2DA 1H19A 2MPAH 4XO3A 5D93C 3MRBA 3QDHA 4UIKL 5KVFE 1ZK9A 2XBTA 3MUGA 4CU8A 1K72A 1AFVL 3IU3B 2FJHB 3BPLB 4FQCH 3O2DH 5ESVA 5IUSA 3QIWA 4A2GA 2NY2D 1HU8A 4J6IA 4WI8A 1NC2A 5C0EA 1RUQH 1I8KA 1AQDA 1BGXH 2BVEA 2MKLC 3MMEB 2YXMA 5DHYB 1LM8V 2CIIB 4OW6A 2F0CA 5CLTA 4GEJA 2RA1A 2QKIC 4FHBD 4M62H 5INCA 4OZHF 1LP9B 4GAFB 4GUPB 4YQXH 1KENH 2VH5H 2EDJA 4WO0A 4K3EH 1A21A 4KHXL 4E0RB 5BS0B 3ILPA 2NCEA 2E86A 1TZAA 2VGLM 5AQ0A 4F92B 1OW0C 2EE9A 2PO6C 2XPGA 4GSRA 2VDPL 1VB9A 3AY4C 5JPNA 3CFEA 3CVHL 3GK8H 4PLNC 1ZHLA 2QGCA 3EH4B 4FQJH 3HRZC 3V0WL 2OTWB 1DANU 2V2TB 3BXNA 4HS8H 2VLKD 3MRHB 3R0MA 1G0YR 3L4WA 3MGAA 3PUUA 4P99A 2J55A 2AXGB 1TSRA 5IHHA 2I9LB 3HE7C 4CC0A 4HPOH 5K93A 1A7PL 1F2QA 1MCOL 2P43B 2BP0B 1RJYA 4L5FH 2X87A 2A1WH 1NZRA 3FYEB 1KGIA 3T0EB 4PY7A 1FLRL 2DH2A 4JDTL 2YSSB 2L8AA 3BX7C 3MBWB 2OJ1A 3MNWA 2ID5A 4JY5L 1S3KH 5KVEE 5EU6B 4RLDA 3EJRA 4A38A 5DUBA 1T3FB 2VQ4A 2BNQE 5JORA 4PLJD 5LWYH 1R1CA 1AD9B 3O2WL 1YLBB 3N0AA 3S5ZA 3X2QB 1WT5C 5I1LB 1K6QH 4U2ZA 1D9KB 3VFTA 4M8VA 5KVFH 1TVHA 1T1WB 3UTSA 4P5KB 3DVNB 2Y6TE 3VA2C 3WTVA 3ZDXF 4FFZL 3ROOB 5DEJA 2YRLA 2GAZB 2A6IB 4NO5B 1B90A 1BZ8A 5SWZA 3QP3A 2A74C 1KB5A 1UXLA 1U41A 3N40F 1RZGA 2QMJA 3UPAA 2ZKWA 4GAYB 1WGVA 4DKTA 1N9PA 5JOFA 3RGVC 5D9SA 3I75A 2VN5A 4A39A 2NX5A 5LBSH 5AYTA 5DZPA 4AYMC 4UNUA 3S9DB 3IVKB 4HIXH 3SBRA 2EIBA 1F13A 4YDKL 1E3FA 2V5SA 1ERNA 2AGJH 35C8L 2BZ7A 2FLMA 5IKCB 1UOKA 3ZDWA 3UO8B 2C8NA 4QY8B 4HEME 1KNOB 1FQ9C 1YJDL 3TNNB 3A4EA 3DDGA 4YIQB 1OM3L 1CICA 2BHYA 2JKNA 4U31A 1QFWL 2YLKA 5DVMA 1EGJA 3LZRA 5FHBL 1BLNA 4OB5L 2WWMC 3VM7A 4GUCA 4GW5A 1GGYA 3O2WH 3PRZA 1B2WL 4LSQL 3IPFA 3SDCC 2NZ9C 1EGJH 1Q94A 5KW9L 3TJPA 5DQ9A 2B8OT 3JWOL 4D3CH 1JNHB 1RZIA 3U7AA 5ID1A 3UYPA 3AQDA 1X3DA 3VXRE 3WO3B 4DGUA 1F00I 2EXWC 2Y07L 2O72A 2G5BB 4LKCB 1XB3A 4CNIB 1RK7A 1KGXA 1VERA 4M93C 2MQ3A 4WF7A 4K55A 4WTZA 1OB1B 4NNYA 4KY2A 2VDRB 5HY9B 3ZUCA 3EOTH 2B08A 5F7FA 1WS7A 3H3PH 4JM2D 4IIZA 3OJDA 3ZZ1A 1HH9A 5I0DA 2X89A 1U8IB 4WGVB 3Q6GL 5BRQA 3AREA 4G6JH 3CVBA 2J4WL 2B77A 3C12A 2VDML 5J11C 1IX2A 3HR5A 3P02A 2DB8A 2NT0A 4F37K 2WP3T 4EDWH 3QPXH 4IHOA 3CFMA 4XPFL 4DK6A 2C4FU 1UOWA 3FTUA 1NEPA 3CZEA 2J12B 4IBQA 2DYRB 1ZA6A 1RI8A 4NJ9L 4U1NB 2F15A 2N01B 2VAAB 1VHPA 5L2KE 1USQA 2AXJA 4PB0H 4ZAKD 3UZVB 5DMJB 2VR8A 3D0VA 2SEBA 4Y5XA 2VXVL 4P5TC 4IJ3C 4LO9A 1KFGA 1P7QB 3U2IA 4U1LB 5DEZA 4JFYA 4P46A 5MI0C 1SYSA 1YY9D 3T2NH 4JG5A 4WI7A 4FHKA 3NCBB 4ZDHB 4ANVA 3N6YA 1ZLVH 4H26A 5I6KA 2PNDA 2AJXL 4DK5A 1HH6B 4L0PB 2ATKA 4AGLA 4EDXA 1J10A 2KBGA 1EEYA 4KRMB 4KROC 3GZOA 4QXGL 3BUTA 3M7OA 1DBJL 4DJMA 1IAMA 3KBEA 4L8SC 5EH1A 3V5KB 3ES6B 3FAWA 5GGTH 1DYZA 1QFOA 3CE1A 5BNXD 3HC0B 1G7LB 3IT8D 3N06B 3WEXA 1AD9A 3QUYA 5HI4D 1UGNA 1G1CA 5JW5A 5CU5A 4EPSA 3AADB 2AABH 3HBGA 3JV4B 4MQXD 3LZLA 5I66B 1PEZA 1TQVA 1BVNP 4PRPB 4NQUA 3L9YA 3H6AA 3JWNC 3K72B 4MQXC 5I6XB 5CBAA 4U7SA 5FM5O 2FEDC 3VG9B 2IBZX 4R7DA 4PVNA 1IARB 3K5SA 4XHJD 5HYSG 4MSWA 1H5BC 3EOBA 4AQ1B 3Q1EA 4P3CH 1Z66A 1BYNA 2D73A 1P6WA 1UM5L 2QHRL 4X6BB 1W0WB 4N3UA 4GXUM 5IY5B 5AOLA 3C5SA 3NFPA 5A2FA 3IE4A 3JUZA 3VXSA 4KRNA 3K2UL 3AXLA 3QDJA 4NRZA 1MOEA 5J1AB 4ZXBB 1E9PA 1SMAA 3I3DA 3T3MB 1FZKA 4ZUSB 4E68A 4WLCA 4LLWB 4LASH 5DC0A 5LQBL 2CHNA 3TO4C 2FL5B 5E8DL 2O6DA 5K1VA 3BUYB 2HT2C 4WUKL 1LE9B 4POZD 1WZKA 3GPEA 3S4SA 4C4BA 2FO4B 4XBMA 3JZYA 2Y1VA 3KPQB 5E1HB 4OZHE 3QWNA 4TUKL 1D5IL 4KTGA 2P8LB 4L9LB 2JNZA 1YDPB 3QNYA 2P24A 3DXAD 4LP5A 2XWXA 5C2BL 3EYSH 3QB7C 2IQAB 2NW2A 1VPOH 4PJFB 3S5LA 1XH3A 5DHYA 3S36H 4H1LH 4HUXB 5FECA 5F9WB 5GIRA 1I7ZA 1V7MH 4L3EB 5CLYA 2P8MA 2NDGA 1SN2A 2PCFA 4HW6A 3EYSL 4YWGL 1UM5H 2QHRH 3V95A 1JRHL 2CALA 4AMKL 1NCCH 1JGLL 1G9EA 4PJXE 2X38A 4JN1H 3F12A 5KW9H 1SHXA 4ZG1A 3VJ6A 1NLDH 3FSZA 1TUPA 1QVOA 2EIMB 4GQPH 3NIFB 5IM7B 3NTCH 4DN3H 3IBEA 1HXMB 1D5MB 3HPJA 5I16A 4YUEL 4LSDA 3S4SB 1BBJB 1A3LH 2OLDA 4G43A 4NQXA 2BP8A 3U0TA 3RL2A 3Q8BA 4OIBA 1EHXA 3WJJA 3X1NA 3OKNA 2Y24A 2DJMA 2BHUA 2IXQB 5MERB 3MRRA 5F9JB 2LGNA 2WXJA 4MAYA 3H0TB 3ZHLA 3MUGB 4PRBA 1JYXA 5DRNB 5BUAA 1XD1A 4HCRH 1JV2A 4NQDA 5F72S 5AVWB 1LEKA 3CXHJ 1MF2L 1UH2A 1EFQA 3DX9B 4WUUA 4GRWB 4U0RB 4UM9B 1OAKL 4R84A 1F4XL 4XMKL 3FN3A 5D96C 4YHOH 1GVIA 5JOPE 5ANMB 4HJ0D 1HHHA 3BVNB 4AK1A 4MSWB 1BXUA 3AGVA 3KPRD 4G8GA 3FUMA 4HDIB 3LV3B 4B53A 5JXED 4K9EH 1F02I 1O7VA 3BSGA 3LCYA 4K7PH 1O6VA 3GXNA 3L5XH 4PJ8A 3VXRD 2WO3B 4MNQA 3S97C 4E9QA 3B9KD 3ARZA 1A2YA 3F83A 4NSKB 1OSPL 1OAYL 1IUZA 1FO0H 1YVLA 4NNPL 5HGGS 3RTQA 3OHXC 5CEYB 5FXCH 2BZDA 3V8CA 1DCLA 2Q5BA 5L0QB 2BJML 4KXCA 1ITBB 4RDBA 3HC0A 5CO1A 3MRPB 1JZ7A 5T5FH 3W81A 1AXTL 3BPLC 4ES9A 5DR5H 5JDSA 4G8GE 4Z7NE 5CD3B 4G3YL 4OLVH 2KLTA 4FQQA 1LO3L 5KVDL 1K2DA 4LU5H 3ZMRA 1Q1PA 4UOQA 5DC2A 4L1BA 4AYSA 4MCYB 4FLOA 1AYRA 2KZWA 2WZ6A 3C60D 4HJJH 4QD2E 4Y2LA 1DVFB 3SCMD 1D9KD 5DD0H 3O4LB 1ND0B 1MHEA 2MCPH 1NINA 2X9WA 4YPGA 3L1OH 3IXTA 3T2PA 5CZVH 4WFEE 3VI4B 1FZJA 2W07B 3SDXE 4OZFG 1IU1A 3BH9B 3NIDB 3BFOA 2PO6B 3O6FB 1AHKA 3A47A 3WFDL 4GRWE 2VMDA 4G72B 1J8HA 1QSFE 1YMHB 4IMLB 3ARUA 1NGYA 3O9WB 2F5AL 1KIUA 3HMWL 4GRLC 1CICB 4PWGA 2DWEA 4QPEA 5J8OA 4OU3A 3GBNH 2VABA 3LKOB 4O9HH 3ENEA 4I18B 4KI5C 5G5DA 2G4EA 4G6JL 1HHKB 4Z78A 3RKPA 1RUMH 4WFFD 3T0ED 2VMCA 1BWMA 3K81A 5T5FL 5DS8B 1G84A 1CMOA 3B9EA 3EO0A 1J8RA 5E00A 4XXCA 1KFAL 1ZA3B 5JW4N 3HE7D 1Z9LA 3FDWA 4S10A 1JFHA 5FGCB 1NA8A 3QDMB 2DWYA 3OQ3B 3QARA 3RHWF 4JB9H 1SXNA 2BY3A 3PQYD 1AGFB 2WMPB 5IQOA 1GY2A 1RJZA 3CSYB 4WI0A 1T0MB 4K3DH 1WHOA 2HJFB 4UAOC 3T8MA 2AJZA 2H8PB 3B5HA 3VI3B 4AY0A 4AGOA 5D7KD 1YEWA 1WZLA 5AVZB 1M71A 1C7SA 5FGBC 4UUJB 5HGAA 5KN5A 5GRYA 3GLEA 1EMTH 4HX1A 5DJCA 4FFTA 1CBJA 1W6WA 1MAML 1I4FA 1TKWA 4JANA 5F9DC 3VWKC 1QTYT 1GGCH 2X6CA 4U6HA 4CUCA 2I32A 3K1DA 4U6YB 4AW4A 4FLHA 4Z7VB 1N8ZA 1TIUA 3A4DA 3B2UD 1BAFH 3LYRA 2XXCB 1FSKC 4GG6B 2CXKA 2A74B 5HP5A 4X4ZA 4Y8DC 4ANKA 1TJHH 3QWOA 5T1KB 2Z8VC 4G7YH 2VW7A 5MEPB 2QLVB 2VDMB 3KL3A 4MMXC 4PV9B 3U4BH 4GT7A 1HHIA 5GJTL 1T4WA 2NUTA 1E5AA 3AC0A 5T1JA 4PRPD 4AGMA 3R06B 4KGLA 1ECYA 4P2CG 2OCCB 5AAMC 4DPCX 1KB5B 4Y5VB 2WM0A 1AZNA 1J8KA 2A0LC 2F7QA 4WRLA 5CEXB 4I77H 4DVRH 5D1ZA 2QQLL 5DGRA 4YNYA 1HQRA 2FX9L 3CX2A 3DHUA 3RILA 1BEXA 1MUJB 3TIDB 4RA0C 4G6FD 3VXUA 4PJCE 1AS6A 1HDMA 2WWNA 1RZGB 2C1PA 3QUZC 1KT2A 3GDBA 4ODUA 3UZEA 3VNYA 2FIKB 1A2YB 1AQKL 2B1AL 4X0KA 1PX8A 4WY7L 4CVZA 5C0IA 4JKWA 2EABA 1H9VA 1U91A 1IVTA 2YWZA 4OJYA 5IZ7A 3O0LA 4NENB 5A1AA 3TT1H 4RGMB 4KZDL 5EPMA 2ZICA 5B1JC 4YSRA 5EZJA 3MNMA 5CD3A 4B3EA 1HOEA 3QUKA 3L6FA 1JXGA 3F7KA 4Z0BH 4WUKH 3RX7A 1ZWIB 3LH9A 3D2TA 5HI5C 4ZFFB 2A9NH 2OMYB 3ASNB 4LSTH 5I1GH 4PJHA 3LH2H 2NR6D 2X3BA 4UV4L 1T5WB 4S1SL 1A14H 4Y4KB 4M1CD 2NXZD 3NEEA 3PXHA 4NLAA 5E8EA 4XBEL 2GIXA 2FEDD 1IC4L 3FU5A 4B9FA 2HJKB 2CKBH 2ITCB 2F54E 4RMQA 5EBWB 5DU7A 4ONGL 3ULVH 4LPTA 2BS9A 1F1DA 2NNAA 3C8KA 3P1VA 4NBXB 3T2LA 2PP9A 4IKNA 3NCCB 2ZSWA 2YGQA 1XIWC 2KMWA 4N2GA 2E46A 3ZK0A 5KYXB 4UZGA 5FYJE 3GSVB 2H2SC 4MAYD 2VUOA 3QAQA 1OE3A 1DN0A 4U1KB 1P84J 3LKOA 1HVXA 2V2WA 3AACA 3QZMA 2X05A 1XIWD 4G9FA 5I9QB 1RHHB 1JXKA 4HT1H 5D2NE 2QPDB 3IKKA 5CEZD 1ET8A 5JW4M 4JG9A 1AAJA 1IAIL 3F3HA 3L81A 4NP4H 2PUQT 3WGVB 2AQ1A 1R5VA 1XF3A 4POZC 1T7WA 3QRBA 4QI3A 2XUWA 3HG1B 4P5TB 1FCGA 5HI5D 2CNYA 4J3WA 4YAQB 4IJ3B 2Z34A 3BAEH 2ZNWA 3AS3A 2NY6B 2CBQA 3BD3A 5F6HI 2HRHA 5K9QI 2D7QA 3HE7A 3IXAA 4MNQD 1AGFA 1AR1D 4K0OA 5IROC 2OFQA 4P4KA 3H9SE 4HJTA 2DWXA 4KTDH 4A67A 3KJ6L 1ZA3A 4YDIH 2BSBA 5ICXB 3QAZB 4PJCA 1RU9L 2BO0A 2VNCA 3ABKB 5HDOA 4CSZA 1AY1H 3NJXA 1QSVA 2GK2A 5FM5M 5D7IA 4AG4H 1UYWH 1YZZA 4J4PD 4CMHC 4IKKA 4KVCL 4OGZA 4HAKA 2VN3A 1KDIA 3SOTA 5C0DB 2Y6SD 3U6RA 1CXHA 3SY6A 2ETWA 2GKIA 4DCQB 3LSOB 1PGRB 4IM8A 1WUZA 2FJSA 5H4YA 4BV1A 5EEWA 5ESAB 5IMLB 1U8MA 2IH3A 2WOBA 2CCVA 1FG9C 4JFTA 1AMYA 2N3JA 4F80A 4H20L 1CBVH 5MEOB 4NPYA 3NOIA 4G1EA 1JGDA 1H15B 1QI3A 4GBXA 1T83C 1MCPH 2W9DL 3KDMB 2F54A 3R19A 4I1PA 5K9KB 4NKIH 2Q87A 1JDCA 4ZXBC 4BFGA 3VXQB 1CD1A 4KK5C 3L1OL 4R7NB 4P3CL 1I9RH 3OSVA 3B1TA 4DP1X 2ATPB 3BQUA 1ICTA 4KKLD 3O6LH 1KCRL 3D2UA 1DUYB 1QVOB 3G6DH 3MLSH 4IOSD 1JV5B 2P48B 3PWVA 4FZ8L 5I1JH 3S5LG 1YQVH 4ONFL 1HYSC 2WVSA 5AVUB 4U4BA 4N24A 5FYKH 3IS1X 4P2QB 3QK0A 5LXGH 3FRPA 5LGHH 5B1BB 2QTEA 2IPUG 3C6LB 5IB3A 2Y1ZA 4JJOA 3NJHA 3QDAA 4HIJA 2NY7L 2H4EA 1A4JA 2YK1H 4FKEA 5F44A 3DBXB 4NM4L 4FZ8H 5I1JL 4TVPH 2K1MA 4IBVA 1HS6A 4CMMA 5KYWA 1KBWA 4NKMA 4IBUA 3GB7A 4XNXH 1AQKH 2B1AH 1ACCA 4OD1H 1NDGA 4P9MH 3QQ9D 2ADJB 1EXHA 5EFIA 2NW3B 3WIHA 2ODIA 3MCG1 5JXEC 2ADFH 3E6FB 4RDQG 2XZCL 2JI1A 3D3VE 4D8PB 5ADPL 3SGDH 4HS3A 3U9UB 4XP1H 1J8HB 5D7IE 1OCOB 2VLRA 4Z7QE 3FUNA 1DFBH 1DSFL 5K9QG 3H55A 1IC7L 2R1WB 1MRCL 1VSCA 1TVBA 4N8UA 2IADA 4Y19E 2V2XB 2O6PA 2APWA 4N9GB 4YO0B 3G9AB 1AQHA 3A67H 3VD0A 3U9PL 5DD3L 1H6TA 3HZKB 1QBMH 4RIRB 3D30A 3ZE0F 1MH5A 2GC7C 2F74A 2WLNA 5BS0A 1A1OA 4DP4X 3PV6A 2WLLB 2UZIH 4WWNA 1HHJA 3WHXA 1S9XA 2J8OA 1L4IA 4OCXH 3H3PL 4YGVA 2EE6A 5ISZA 3D9AL 3GSRB 3MO1B 3FSWA 5D96B 5LGHL 3N50A 1NGPL 5C08D 1MCRA 4JZOB 1RZIB 3HG1A 3K7UA 4U6TA 2O5XL 1N0LA 2H1XA 1JHTB 1ZHNA 3QJHB 1ZVNA 1RZ8B 4YXKH 2EDWA 5EU6D 3ROLB 3U4KA 4MMXA 1OARH 1DJYA 1CDUA 4XX5A 5GRUH 2V5MA 2AQSA 5BUGA 2CO1A 4MGXA 3ARFC 3OKYA 5FYLL 2CDGB 5C07E 4BHUA 2EEBA 5LBSA 5ERWB 2QQLH 3CFTA 1YMME 3PP4L 3QJQB 1PZ3A 1J9TA 2DQHH 1MLCA 1U8NB 2J71A 2VSDA 2LQRA 5B7FA 4LL4A 5KSUA 3GSOA 2NUPB 4YXLH 4UI2A 3QJFA 4X7DC 3GF8A 4BQ6A 2E9IA 4F58H 2BWIA 4WZ9A 3WJMB 35C8H 3VFOA 1BLNB 1RUPL 2C1OB 3OKLA 1N4XH 1G7MB 1R46A 5IHZB 5B3SB 2CGRL 4FLRA 4UV7H 2MEJB 5DZ9A 5ILTL 5AG8A 3P30H 3FO9B 4ZW7A 3I84A 4XXCC 3V8OA 5IB2B 1P7KA 3BGAA 3TXAA 3SODB 4NFCA 4LCWA 2IFGA 2EDQA 1NFIA 4ONGH 1S7SB 2MQGA 1CICC 5BOPA 2XWBA 3ULVL 1M1XB 1V3JA 4WV1A 2LVCA 2V5TA 3TBVB 4C56B 4P9HC 1KYDA 5DJ8A 2EO9A 2XX1A 3BCFA 3KLKA 4PJIB 4WTZG 4ZSOA 3MRMB 2XN1A 3CX5K 3FRUA 3D2UD 3NZUA 2JKRM 3ULVF 4NZUL 4L18A 5TTRA 2O6EA 3R1GL 3N1FC 3D2UB 2J6WA 2XTJD 4OCMC 4IRSB 2HP4A 1FNEA 3O3AB 3RWJB 1H6UA 1TJGL 3DHMA 4OKVA 3VGEA 4Z7WE 2WXIA 3W11C 4P5RA 1CI3M 3PV6B 4KY1L 2P1YA 5ITFA 4UAOB 2ZXDA 3RTQD 4XXDB 3CDZB 3D85A 5D6DC 5FGSA 2O61B 3FCGA 5TH2B 3QFJE 1ZT1B 1K85A 3GMMA 3L2MA 4R96A 1DQIA 1KTKE 1J1OL 1J87A 3VD4A 3EG9A 5TDOB 2QZQA 3AAZA 1D7BA 4F2MB 1FRGH 1W16A 5HGDB 5SWSB 1GTFA 1OALA 4U3HA 5CIPA 4ZXBA 3MR9B 4IGBB 4NQCA 1SDDB 5E70A 4QO1A 3TZVB 5ID0A 4M3JA 3R0NA 4X6FB 5L88L 4I3RL 4P2YA 1E5UI 1T03L 5EN3A 1WFTA 2WGXA 4QHPA 5H2BB 4GBXD 3T6VA 4UTAL 1F6FB 3EYQC 4NAMA 4DW2H 2BSRA 1OP9A 1N67A 2HFGH 4JRYA 4HJSA 5JO5B 2WBJD 4F20A 2NTSP 4MMYA 3N41B 4JPWL 3B7TA 3CUPA 3U4AA 3QT2A 4OFIA 3OWRA 3OTTA 3VVWA 3BD5A 4X6DA 1A6TB 1I8IB 1KDJA 5JW5B 5E8NB 3DX6A 3MREA 1YUHB 1I9JL 5I6PA 1BX2B 1XQ4A 1ONQB 2Q7YA 3RWGB 4G1MB 1ZTXH 1OAYH 3M7FB 4JG0H 2Y5TB 2G0KA 1IJNA 5DFAA 3R18A 2NY5C 1M7DA 4WDIA 3GSQA 4PG2A 4NN5C 4HU8A 3G6JF 5AOJA 5FKAB 4HQQL 4HH9A 4XNUL 4PWEA 3AY4A 2VJXA 2ZOKB 5HBBA 4XNZB 4FQHA 4EI5C 1TLKA 1BQ5A 4N90E 5IB1B 1I1FA 3TBSA 3T6QC 4WWKA 5IMMA 3H53A 3KLDA 4ZOBA 3II1A 4MA3B 4N20A 3GT6A 1XD0A 3EJSA 4WSKA 3QFGA 2WYHA 4JFDD 4R5VA 3NA9L 2ZG2A 4LVHB 2HFGL 4FGMA 3O8XB 3WY2A 4H0LC 3NSCA 3TEUA 1IGFH 4Y19D 2EDOA 1NEZB 2XG5A 4J8QA 2Y5TA 3F7PC 4S0TD 4UTAA 3SGKC 4WWKC 1JF1A 3RE0A 4X7CC 1T6VN 2ENQA 3OM3B 4QXTA 4TULL 3PQYB 4YZFF 2OCFD 5SWZB 3UL4A 1XSKA 4LHJB 4ZX3A 2ZUQB 2XWJB 4QHNA 5DHEA 6TAAA 4WHYG 1BZEA 4Z5RA 2IWEA 4G6KH 4FJ6A 1KENL 2VH5L 4JN2B 3TIEB 1U21A 3MLYL 2P5EA 3HG4A 3TA3B 5C71A 4B9CA 5IJCC 2COQA 3WEBA 2CHZA 1QPKA 4J3OC 3LDBB 5LGJA 1WVZA 3HFML 1M56B 2YEZA 3VQLA 3OJ2C 3QQDA 2YFOA 3WTXA 2WUBH 2BLFA 3GD1C 3KPLB 4ELMF 1YEIH 2ALWA 3QIBD 2GW5A 5INCB 1X7QB 4U7KA 4WGKA 1JD9A 4U1IB 3LOWA 4XMWA 4OUUA 5JUEH 3GLDA 4QJ5B 4HJGB 5GS0D 2ICCA 1JNHA 2HRPL 1QFWM 4Q74A 1S7TB 1Z6JT 5DUML 5JHMA 1YMMD 2EUVA 4FP8H 1ES0A 1L5GA 3O45B 1FGVL 1TTBA 3WFHA 1EAJA 5F9JA 5EO1B 1JTOA 4HG4J 3HAEH 3MCKB 2H26A 2PWGA 1PG7W 1FHGA 3QCVL 3G6DL 4PFEA 3WUWG 4BWWA 2H0JA 4F7PA 4XO9A 4I9WD 1UZ6F 3BC9A 1KTJA 4Z6AT 3JBG7 3L1GA 5C0AB 1PIGA 1N59B 1R3IH 4FTVE 1G5GA 4KUCF 4XRCB 4YHIB 1FVCA 2BOBA 2XPYA 4L2LA 1PJ9A 2VLLA 4GSDL 4HPYL 3TV3H 4DTGL 5LDUA 2FR4A 2X4SB 3EF4A 1SDYA 1USZA 2D7OA 4H8QA 4H13C 5A16B 2Z91A 3Q13A 2ZYIA 1FO0A 5D2NC 4HUWB 2IG2L 1LO3H 1NBZB 3QRGL 3JTBA 1K8DA 4JDVA 4LCCB 4U6XA 3R7RA 1P7HL 4JFHE 2WGNB 1YN6A 1D6VH 5LGKA 3AS2A 2BPBA 3VTMA 4GKLA 1NFAA 1T0MA 3BWAB 5J13C 2FEEL 3KGRA 1SOQA 1AJ7L 3WE1A 5DJ0B 3FCSA 1UD8A 2VMEA 2P5WD 4HZLA 4P3WA 2VDRL 3MRLA 2AF2A 1HI6A 1S7QB 3DGDA 5BRZB 2P5PA 4NKDB 3I6KB 5GS1B 5J1TC 3EGSA 4OI7A 2I24N 3FYIB 4NUMA 1Z5LA 3OC8A 4YE0A 1Z2KA 1R3IL 3WS6C 1YQ2A 4AM0A 4P4KD 1HL9A 2MOVA 4Z7UE 1D7DA 1ZDSA 1QMUA 2L7UA 4DOHB 3UP6A 2WXKA 1XGUB 3JVGA 1XTLA 5E4AA 2HVJB 4NC2B 3O3EB 1M3JA 1X7SA 5D7JD 1G6VK 3WUWA 3OPZL 3UPRA 3VFOB 4S1RH 4H8HA 2AK4A 4DETA 2OMTB 2ZCLL 9PCYA 3KPOB 4OZFA 2ZAIA 2XN9B 4UT7H 2HKHL 3LEXA 1KJ3L 1TTCA 3BW9A 3O4LE 1ED3B 1OCWH 2XZQL 1NUFA 4FCAA 5EA0L 2DTSA 1WIPA 3G6JE 3EIFA 4DZBA 5GSRB 2OI9B 3FB6A 2YZ1A 5MENA 2AS5M 4P46C 3POHA 2MTAA 5A2BA 1N5AB 2IEPA 3NIDE 5BZDB 2P80A 2FSEB 1CCZA 2WIMA 2DMBA 3G9VA 5B1KA 4PRAA 2FIKA 1WG3A 1P53A 1BOYA 4RMTA 5SWSD 3KPSA 4QTHB 5IB4B 3UGEA 2I5YL 2OYPA 4LKCA 4GUOA 1IC4H 5I1DA 2R51A 1AMXA 1UH4A 4WWPA 5CP3A 2BVOB 4M6NH 4OY9A 5EO0B 4F7EB 2IADB 1R24A 3ZQ9A 4K4KA 1YNTF 3F6JA 3UACA 3BYTA 5CN1A 4KKZA 2V9RA 5JIMA 4IRZA 1CT8A 4XVTL 1MH5B 1DBKH 5E99H 4L8CB 1JPFB 4PTTA 1OGSA 2QPSA 1SY6L 3VU2A 4YHLH 3RTQC 4PV9A 5D2NA 5F3FA 5IW1A 1NEUA 1RK0B 1U3HA 3LN4A 4BYHA 4H8WC 4JFWA 4NP4L 2HFTA 2HXAA 2YPKB 1FYTE 2WUBL 4PRAB 1OPGL 1L0XA 4KI5F 5FPIA 3VD7A 4HK0A 3Q01A 3B3IA 3V5DA 5HI3C 3X17A 1N0LB 4ISVB 4F7CA 4U1SB 4TNFA 4RFNB 3QQ3A 4ZSOB 4DGVL 3OKDB 1U8CB 2NY1B 3VMNA 1RMFL 4P48A 4J3BA 1TSHA 2HUHA 1T1XA 2VN4A 3PCYA 2ZPKL 4NBYB 3SIKA 2ZOLA 4APQB 4PJ5A 1KULA 2QSTA 2AABL 1J0JA 4ETYA 5IBUB 4S1SH 1ORSB 5C0CD 2V37A 4OH2A 3V6ZA 3F7LA 2FX7L 2FH6A 5I1LA 5I15L 5FO2A 4IRJB 4DKEH 3CZKA 2Z31C 2AVGA 2XN9A 3DX9A 1K9TA 3DVFA 4LLQB 4WUUB 5EB9A 1QHQA 3QHFL 3GJFK 2CLRA 4MJ5A 1WAAF 2B1HH 2NW2B 3HNVH 4K9JA 2MFNA 3H0TA 3QIBA 4J3VA 1SYVB 3HAEG 3CFDA 3B37A 3SQOH 4Z7UB 1FIGL 5FKAA 3REWB 4G9DA 1AHWC 4M7ZB 1MWAB 5EU3B 4JPKL 1L7TL 4Q9BA 3H4HA 5CCKL 3MODL 5EU6A 1M6OA 5IMMB 4PS4H 3WXWH 1T22B 1RZKH 3I6SA 4GBXC 3TONA 1XX9C 4NRZB 4KKBD 1IQWL 4J27A 5C9JB 3OAUH 3QCUH 1UD3A 4ERSH 2CRIA 3HLAA 3OKNB 2VXTL 2W8CA 1OF0A 3P69A 3MAWA 1NAKH 3QSKB 1MEXH 4YR6A 2A6IA 1HL4A 1SOXA 4BH7B 4L4TE 3ZL4L 1ET5A 1SY6A 2JTYA 3WLBB 2HN7B 1IAIH 2PF6A 1TZIB 4OGAC 1ZS8B 1TVHB 5HVWA 3HNSH 4JFPA 5D1QD 4DP2X 3U2SB 2ZWSA 1Q90A 4Y2DA 1O7DC 4Z3IA 1HINH 3P3TA 1KTLB 3DX7A 5L2KA 1J5DA 4FZEH 3F7YB 5LBVA 3SCMC 5I74C 3DJRA 4HCIA 4NQEA 4WW2F 5KYNA 5SWSA 3BRFA 2IAAC 3FQUB 4Z7IA 3KVQA 5DI8A 1T22A 4XPBL 3AAZB 2NY4B 1GHFL 4JFFD 1PEWA 4UMGA 2NSXA 2G30A 3U48A 5I8KH 4CADB 3VFSA 4DP6X 1RIUL 4OZGB 4KK9C 1CLOH 2APVA 2VOTA 3MJ9A 4XC1H 2A9ML 4EZLA 3WFHB 2CRMA 2RFXA 4HIIB 4UYPA 1B4JL 3BD4A 4G7VL 1WIUA 4KK9D 1UZGA 5FGRA 3LEVH 4IU2A 4X8JA 4XXWA 2NY0B 4G2AA 5T5NF 1ZVYA 1DEEA 2PCYA 2L7EA 5B38B 5KYWB 3WCYA 1XXDC 2ITDB 4AJWA 2C34A 3PP4H 4PJEF 4LLQA 3VSUA 3KH4A 4IKLA 4P59L 5HGBA 1QPXA 2X42A 1NSNL 4HGMA 4PVLA 1EMTL 1IAOA 3I9IA 2NY5L 4QHNB 1QRNE 3C5SB 1BX2A 1L9TA 3PGFL 3QW9A 1CFSB 5CXPA 2JSFA 2P42B 1JNLH 2J8UB 1JN6B 2QSCL 5BO1L 4Y2OB 1CXLA 3EJYC 3CFBB 1J5HA 2GK0B 5KAQF 1MCBA 4PP1C 3QIUD 1XMEB 3F05A 3VXSE 5DMIL 1MREH 4PPTA 1E4HA 4LK4A 5IVZB 5C07A 2ZP0T 4DAGL 3OKDA 2HG0A 2K9FB 2PKDA 3MV9A 4WWKB 4Y1TA 5I1KH 1BMGA 2WSPA 1AOZA 3TLRA 2DQ6A 3RU8H 4IOIA 1QWUA 3OAZK 3BESR 3DHJA 4LSPL 4F7KA 4YQXL 4YXLL 2YMOA 2ZXEB 3UAJD 3UZVA 4AEEA 4BZ1A 4Y4HC 4TPRL 1A6VL 3C8DA 4CC4C 2UVFA 2EEAA 4G11A 5CSZB 5E0FA 2IQ9L 1FO0L 4HVBA 2DMHA 2LV4A 1A47A 1J7VR 1U6AL 4G9DB 4A04A 2X0WA 5KSBB 4XI5C 5J06A 4ZMTA 1U8PA 2A9CA 4JQIL 4L4VA 1NCDL 4R7LA 1FNHA 5KJ7E 3AG3B 3P30L 2DWTA 1WTGT 1TEYA 1UADC 5T3XL 4LCWE 1BSIA 2X4OB 2XVGA 4DP5X 1A65A 4N2BA 1OY3B 5I75C 2N0KA 4Q97A 4Y4FB 3G04A 5LLIC 4DO5A 4ZO6A 2R83A 1S5HA 1GPOL 4XVTH 1CFQB 5AAMA 4PSPA 3TO4D 4GS7B 5FEBA 5JNYA 4DGWC 1DVUA 2DN7A 3R1GH 1AD0A 4UQEA 3RNQA 1JZEA 1MJ8L 1OB0A 2GJ6A 5C0BD 3MYJA 1S7SA 1CFTB 3JVGC 4JO3H 4M5ZL 2UXFA 3WIFB 2FEEI 3EZJB 4BQ8A 4O9HL 5KG9B 3CFNA 5FCUH 3ARFA 5E1QA 2E7CA 1EIBA 4LDLB 3PDOA 3QFJA 4PSRA 4YLBA 1EJOL 1SEQL 3X14B 3SKJL 3PL6A 1N59A 2V7NA 3U30B 3BP7A 3ARBC 5IF0B 3M1BB 3KYMB 1CFSA 2DQDL 4D9LL 3NJGA 1ETJA 1HQ4A 2R59A 4F8TA 2YUWA 3GYRA 4Y4KD 2J1ZA 1MLBB 5FO9B 3DXAB 2NYYC 1FORH 3Q0HA 4R26H 4L8CA 2YD8A 5KSUB 1XSOA 2R1WA 2R1YB 5CINL 3L7FA 1PQZB 1BZDA 2Q8AL 4TLUA 4LLMA 5D6CA 1KPRB 1NUNB 3C6EA 3WJLA 4K5OA 2Z7YA 3MYJB 1DBAH 4TVUA 3GUFA 2ZE0A 1VRSA 3SDAC 4PJHB 4C58B 5F7MC 1EX0A 1RZ7H 1UWGH 1HNYA 2H3NA 4LL1A 4YSDA 4AKQA 2OK0H 3M8OH 1X5IA 2XN0A 1XF1A 3FN0H 1KN2H 1V27A 2UWEF 2FSEA 5BOJA 1W8EA 4E9XA 1RZPA 1JTTA 3P0VH 3ZW3A 1L9RA 3V4PB 2DLFL 4ZFZB 1R75A 4PJDF 3UG4A 1P7KB 3GBLA 4WAFA 3FHAA 5ABAA 5GZOA 5GS1A 3DIFB 1KN2L 5KBLA 1H3XA 2BSCA 3FSAA 3MRLB 5T1LD 3TBVA 2GHZA 5DFVC 5F1NB 1FNSL 1WAAE 2XQYK 1X5ZA 1Z5HA 3T3PF 3ZYZA 1F2XK 5C6TL 1JN6A 4PJ8B 2EADA 1EXUA 4S1DC 4JCLA 5FR3A 2WZPD 3VFNB 3VO0A 3VCLB 1CD8A 4MD0B 4MQTB 2EINB 4MDJA 2YIHA 2Q10A 2CM5A 4OF5A 4NQED 5D7KE 1WFNA 3HVNA 4EZJA 3O3EA 3CFCL 4DKDC 2OTUA 3SGEH 2YOAA 4Y2DC 3NIGB 2B3RA 3L95B 5JPMB 1BWWA 4GAJL 3L16A 3SPVB 1G6RA 4UQAA 5I0WA 1BQLH 4BCXA 3LHAA 1BBDH 2KDYA 4R3SB 4DERA 4L2YA 4IS6A 3OB8A 3C5XA 2AJ3B 3C5ZA 4S2SB 1A22B 5DJYA 2EDTA 3P4LA 1MCEA 3EOAA 2CUAA 3O2DL 5HVHC 1CGXA 4OD2A 2GUOB 3VM5A 3VCLA 2X6BA 5IB3B 5K9JH 1G9NC 3ECQA 3E6HA 5DZLA 2P49B 2ENPA 5EEVA 4Y9BA 1FWXA 2VXVH 4Y5YB 1H8SA 3BVTA 4M61A 4RDQF 1EEQA 2YBGA 4Q58C 1BVOA 1Z7JA 2MWCA 2E9WA 2CD0A 1ZJAA 3CUPB 4H5SB 3BCDA 3QDME 2B1OA 4Y2NA 3ZUNC 4K94C 4JFPB 3U2SA 2OR9L 3V0EA 4PH8A 5K39B 4BBWA 1BF5A 43CAA 5T3XD 3N0PB 4PV8B 4NDMB 4G6AC 5DQDH 3A6BL 4HIEB 1T0NA 5GRJL 4D8PA 5IESL 4QRPB 4JGNA 3IETB 5F6IB 4FTVB 4KTEH 1DFBL 1DSFH 1ETA1 1A02N 3FUKA 5JDJA 4HLZH 3EOAB 5DHDA 1NCWH 5E7BA 3ULUF 4XAWL 5E95B 4TRPH 4FXGA 5T33L 1A7QL 4DSYA 3UROR 4J2XA 4MJIA 2AV1A 2VQTA 3V6OC 4FQLL 3CIQA 2UY6A 3PGCB 1E5YA 5IJBC 1ORQB 4GXUN 2VRQA 4HKBA 3F62A 3GIVB 2AQQA 4J3OH 3NP4A 1YNKH 2XJLA 2A4ZA 3GTTA 4U1HB 2C9UA 3QH3A 1PY0A 2GTZA 5HYQB 43CAB 1LO2L 4Z8FH 5DMIH 5L4FA 4OQTA 3A22A 3CLWA 2IIJA 3K2MC 1MPAH 5SV4A 1T0NB 4BSWB 2ZKMX 4IRJA 3ETSA 3L1EA 3GXPA 2D0GA 3GTNA 4TSAH 4WU5B 3HN3A 4KKAD 1KN4L 3ZHFA 5LHDA 3ULUH 1N7ML 4K8RD 5IHUH 5C6WH 4QLRA 2F18A 4XHQA 3MREB 2PN5A 2FWOB 1N6VA 3ZTCC 3V6FB 4PY8J 1A4KB 1HYRC 4MVBD 4W6XB 3W5MA 4JQIH 2E27H 3NCYS 2WXFA 4WCYL 3KPRB 4PVBA 2Z31A 1JXFA 1CXKA 2K3HA 3VH8B 2E6JA 1KFAH 3DROB 4PGEA 2B9AA 1PDKA 3C08L 3QORA 4ZK8A 5ICYB 2FNWA 4TS6A 4G9FE 4LE8A 4NGHH 2BP5M 1QTSA 1MDTA 4PJDE 1PLCA 1Q38A 1NUDA 4D0CA 4ZTPL 5FS5A 1EEYB 3CMGA 1PJWA 1YSOA 2YXVA 4FXKA 4FLSA 4YE4L 4PJ5D 2E56A 1PW3A 4XP5L 1A4AA 5IQNA 3HS0B 3MLUH 1JZIA 2HMIC 4I3SL 4M7JH 4PRHA 4G70B 5F1SA 3QUZA 3VSVA 4W9LC 2YC1A 3GBDA 4PCSA 1OP4A 4FQPA 1THAA 4L8DA 5D71L 2BVUA 4Z7WF 3TP4A 5FYJU 2FUTA 4FLQA 1UXSA 2OCJA 2CDGA 2DM2A 4GIOA 1U95A 4MA7L 4Q6IA 4AM0B 3OKKB 5FCUL 2E27L 1UACH 2ESVD 3CHRA 4O2FB 4WGWB 5GJTH 2EH7L 4J2QA 4A7QA 2J7LA 4P5MB 2W60A 1U42A 2FQDA 3DJ9A 4NENA 1BVLA 1KCVH 4ZUWA 3QA3B 3OKOA 4M5TA 5ACZB 1E27A 2HUEA 4YJZL 1AIZA 1SDAB 1AACA 4GYBA 4TTGA 1ZJBA 1GL4B 5IIEB 4KNSA 1IL1A 3B6SA 5GHWL 2P52A 3AREC 2IBGA 2PR4H 3S37L 2N1KA 2H2PC 3D69A 1BCIA 1MQKL 4XP4L 1ZTMA 3QXWA 5DD1L 3GMMB 3N42B 4JFQB 3HJEA 4B7IA 4F3FA 3DDFA 2VUYA 1B4RA 3LPPA 4GKSB 1PX4A 5KYXA 1F3JA 2OSLA 1R5WA 5IJKA 2EP6A 2CKBA 3TNNA 4PLKC 3B8YA 4RFEB 5J6HB 4XWOD 4FTDA 5FUZH 3OC5A 3HNVL 4XN7A 5DTFA 5C3IA 4Y16B 2V33A 1IQDA 4MZIA 4KKRA 1F3RB 1K4CA 2F8IA 4IRSA 3BVVA 4KV5F 4OR1A 3SPCA 4Y4HB 4PJBE 4TOYH 1XGRA 2NNXA 1TJHL 2IFFL 1CG9B 4JO5A 2OQJB 3SZ6A 1BZQK 4ZTOH 3L3DB 2YZ8A 3RWEA 1JMXA 1RPUA 1G1YA 1J05B 1SJVA 2K4AA 4B41A 4YDLB 1ANUA 5EORH 2HJFA 1DQLL 2X4TB 5HI4C 3ARTA 1F4YL 3SDCA 3TX4A 2XTSA 3HZMA 4ZMVA 3GMLA 4IIQA 3LZNA 4X4MA 3MA9L 5GXBB 5KBPA 3KXFB 1QSED 4GW4A 3FTZA 5IT2H 2N59A 5FA3B 1TQCB 3GGWA 4UILH 4QHMB 3VXNA 4A2FA 5T3XE 1FGNL 4R7NA 4Z95L 4CN1A 2V2XA 4UOW1 4BFFA 2FX8H 4JKPL 4KROB 4N8VA 3OKKA 4YXHL 4XCFL 1U8PB 3HNTH 1XSIA 3BWUF 5CJ5A 2QTVA 1E3ZA 4NZDA 5CP3H 3N41F 4AQZA 1CDJA 4RBPK 3MCLH 1OTUC 4KY1H 1KN4H 3ULUL 3TVMC 4JO4L 4NC0B 4Y19A 4TUKH 1MI5D 4WQOA 3BO8B 2XG5B 3CVHH 1RHFA 3WNPA 1PDKB 3QORB 4F8LA 1T0OA 3VD3A 5BZZA 5B39G 2OL3L 1FL5B 2IAND 5I6XC 5I6LA 3LZOA 4EI6B 3GK8L 1A6WH 3B6SB 3B34A 2NY3B 3UCRA 1NFDF 4PRHD 4NQSB 1SYVA 2ZQKA 4MYWB 1H8NA 1RJZB 4Z7QB 2JK5B 3OG4B 1I3RA 4RMUA 5E9DD 1SXBA 3NA4A 1EZVX 2XLLA 1EJOH 1F4WH 3P9WB 2VDOL 2OSWA 1N68A 4YH6A 3UTSD 1OHQA 5EIIA 4QGYA 3FHEA 1KTRL 5HY9A 3ALPA 5CLZA 3TO4B 3ECBB 3E38A 1JGVH 5HHXH 4JE4B 4Q6IB 1SJHA 1PYWA 3WDJA 3ZXAC 3BQUB 4FG6D 5K9OA 3MRNB 1YMMA 4HBCH 1M7UA 4N86A 2VC2L 3UO1H 5EUKB 5I6MA 3ULUE 1I8MB 3HZKA 3S48A 5F96H 3MLRH 4B9IA 1QI4A 2OSYA 5EZIL 1DBAL 3RAJL 3GMRB 4GXVL 5DS8A 3ASWA 3O41B 3W2DL 3QS3A 1UT2A 4YGAB 1AOHA 3BMVA 4XPGL 5C3LD 1BXAA 5DEGA 2MOQA 2X1QA 5FCSH 4QXVA 4HEPG 2VXSH 4PTUB 2Z92A 3QULB 1A3RL 4JKKA 5EZPA 1JHKH 2X2YA 3ARDA 3EGDB 3T77A 2W91A 1NIDA 1C5BL 4S2SA 2PCPA 1A6UL 1Q0YL 1Z9OA 5C2BH 2VDOH 1J9CT 5JPNC 1PLBA 2VDOB 3VFSB 5BS0E 1UKQA 3ARFD 4FMKA 4GFTB 3GSNH 3QIWC 5F89A 1NGQH 2FGWH 4BUGA 4WEMB 1ZVSB 1AVAA 1Q0YH 4WEEA 3BKCL 3MV01 3JWNG 4HH9B 5D7JC 4HXBL 4LPVA 4LSUL 4U1IA 5B7MA 5JPMC 4XZUB 2RALA 2VZ3A 3HG1E 3V4UH 5TGBB 5DZJA 5IVXF 3OKEA 5D8JH 4ZS7L 3JYCA 2O61A 1J9SA 1B6UA 1T83A 3BO8A 1E6JH 3ARGB 3VAEA 3VD1A 4KDTA 3RAJH 1JZHA 5C0GA 1PBYA 1TJIH 5GIRB 3DURA 3QE5A 3HZMB 3BIBX 3Q6FB 4PJFA 1VACB 3CC5B 4OLXL 3MACL 4BSJA 1UCBH 1ZLSL 2YR3A 3LS4L 3GGWB 4RZCA 5F9OL 3C60C 4WO4A 5TE7L 1GJIA 5AW7B 1JPSL 3ETBF 2EVIA 4TN9A 5JHDA 3V4VH 3OHXB 2JLLA 5F0LB 4CJ0A 1MRDL 2AK4B 3QWRA 1L3WA 5GJSH 3FUEA 3MQIA 3FB7A 4X0KB 3JTTB 2CJUH 4PHXA 3T1FB 4IIQC 2O5XH 3KEHA 4G7SB 3U0TB 1FI8C 2X4RB 1F0LA 3U25A 4PGBA 1I8LC 5JZ7C 4NUGH 2Y4SA 1UQSA 4MWFB 4EQ3A 5IQ7L 3UC0L 3LH8A 5B1CA 3ZDZB 1HL8A 1WC7A 4MAUL 1G7MA 1RIVL 2OMZB 2NXYD 2XVLA 5KWYC 5DA4A 5K39A 5IBUG 1JIBA 2HMID 4HIXL 2YD6A 4PJGA 1N70A 5JIKA 4TNWF 5E4EB 2X4PA 1QR4A 1A7NL 4P4KB 1NLBL 4UIMB 3VWJD 4JM2F 3BZ4A 3CQQA 2KQMA 3O6FC 1BXVA 4N0UA 1TEGA 5D70H 2XVBA 1R3KA 3BHBB 1NIAA 3NJLA 2GI0A 4XNMA 4D0BA 1A7OH 3WO4B 4TRPL 3VWJB 3P4MB 4D9QD 4P57A 3TC9A 4PJIA 3WKPA 1OE2A 4ZTEA 2WLHA 4GNKB 2DS4A 4O2EB 3OKOB 1PZUB 2A77H 2FD6H 3K74B 1RP8A 2AXFB 2BW5A 3IMTA 2VERN 2DQMA 2X40A 4XMPH 4QRRE 4BELD 1PG7L 3MLZL 5DDHB 3LRSA 1RHHA 4GO9A 2NY3D 4M4RB 2A7BA 1QACA 3E3QE 1L6ZA 1BQRA 5C0FB 3DX2A 2DJSA 1IEAB 3BUYA 1R4XA 2VLJD 3ESPA 3K4DA 4BKLA 2FATL 3PXJA 4PW3A 4F3FB 2WTRA 4QRAA 4L1LA 2F54D 3Q9QA 3PAYA 4QRTA 1N10A 3WFCH 3FTGB 3ZBMA 2VM9A 3MJ6A 1KEML 2YXFA 3DIDA 3VRIB 3P3UA 3OMIB 3GRWH 4J7RA 4M6OL 4RA3A 4F8NA 4X6CF 4F2ME 4BH8A 5IFJA 1NGYB 3O9WA 3INOA 4ZMOA 4JK0D 1VADB 2FBRA 4H0HB 4N90D 3ARGD 5CIPH 4NS0A 1WWAX 4ZUUA 2DLIA 3B7UX 1QP1A 4I0CC 3FU7A 3BVWA 4DKEL 4EI5D 3HS0C 4OZ4B 1HEZB 3KD4A 3MZGB 4DO4A 5KJRL 1E67A 4CL7A 3LH2L 5KTEH 4GLRI 4LSRH 4EBQL 1DJHA 1RUPH 3N91A 4MAZA 4Y5VC 1OZUA 1SRDA 4P5TD 4X4XB 4HSCX 5AVXB 4AUYA 4RMBA 2EDBA 3DVGA 3GSWA 2WO2B 3MROB 2V5YA 1D5RA 3QUZB 1EA9C 5A2IH 4PJ9C 3IFPA 3ZR6A 2SEBB 3LRGA 1I9EA 1VKXB 4L9DA 4PJAB 4WO4D 5D1XE 5IJDC 1TFHA 2XWZA 1LP9F 1CDIA 1AFVH 3VXME 1UACL 5FYKD 1NJ9B 1P0SE 2AEPH 3W9EB 4ABVA 2XRAH 1VFOA 5AOMA 3VXQA 3GLAA 4RGMC 3VQ1C 4GT0A 4UZUA 5ECGA 5FGBA 5IESH 1L7IL 3BWSA 3L4UA 4XOBA 2EDLA 1UQSB 2QBWA 3AREB 1ZLWH 3RPBA 3UZQA 3SKMA 4JPIB 2KC0A 3QUHA 5LNEA 3MLVL 4O02L 5BS0D 3RA7H 4AVIA 1JDDA 5D1QA 1KXTB 1QHOA 3CZNA 4G42B 4HJGA 4H25A 5DJ0A 3UDWA 2R9HC 2V7HB 4HXAL 5DVLA 3SE4A 3TBWB 2H2PD 2J56A 1KBKA 3HI5H 2YA2A 4B6ZA 3HG1D 2A83A 4V2BA 4DWHA 1E9OB 1HSAB 2BNRE 3QDMA 3MBEA 1K2DB 1A0QH 1M2VA 4N2FA 3CN2A 3CSYA 1TF4A 2AEIT 4K7PY 4LMQI 2AKRA 3WY4A 2IC2A 4ZUVB 1U93A 3O4OC 4OCWL 3TN0B 4URKA 1CN4A 3Q3GA 3RWFA 5I1EL 5L2KB 5E08H 1NC2B 2XTJE 4CRPA 1DQKA 3IU4L 3ME0A 1W72L 1XR9B 1XCQA 4KTEL 3NFSL 1TTRA 1ODAA 3KPLA 4CU7A 2XT1B 1XCWA 2EYTB 3I02A 2CRYA 3Q05A 3ZKND 2GIYA 3WN6A 5IOKA 1J1XL 2DMCA 5DT1H 4LQFH 4LCYB 1KY7A 3EADA 2JCCF 4IU3A 2WP3O 2G2RA 4F33B 3BAJA 3LS5L 1TVBB 4ODSH 4LVEA 4OZGA 4F91B 3TBWA 2CA4A 2WSKA 5GGTL 1QA9B 3BP6A 2V9TA 3QVAA 4FABH 1KJMB 1PZAA 2AC0A 4IU2B 4X8JB 1AE6H 1S78D 3MBEB 2VLJA 2WTRB 1TQCC 2ZXWB 4IEFB 2GT9A 4X6DF 2KZ1B 3U82B 2PCPB 4J3XA 3E2HB 1WLHA 4I8DA 1WIOA 4KKQA 4ZMXA 2B5IC 1UUSA 1M7IB 3OHMB 3GZQA 3O6LL 4RSYA 3R8QA 1W0WA 5ES4B 1NCIA 2ZCKL 2ZSWB 3DX3A 3VACA 1TOXA 2PTTA 5L9DL 3V4VB 1KV7A 5LCVH 3F7QA 3D3VB 4DGYL 4FX5A 3GKWL 2ITFA 4Y2OA 3W1ZA 3RZWA 5BVJA 1EFXB 2EDEA 2R29L 1U8OA 4XO4A 1KJ2H 4DKFH 1MVUA 3D5OF 4RGOL 5I5MA 1J5OH 4FFWD 5B4MD 3W39B 4C57C 4E41E 2GY5A 4JCMA 2A6DA 1NEZG 4AL8H 1A6TA 1I8IA 2QEJA 3EFOA 4OKVB 3PE9A 3U4EB 2X1PA 2CR6A 4XWGL 4M3KB 1XVSA 2QVIA 4AZUA 1NOFA 5CWSB 4DN3L 4G1MA 1GMEA 4G42A 3MLXH 1SVBA 5AW8B 1JCKA 3HW7A 3MSPA 1GC1H 1HHHB 1CYXA 3IGAB 3LNGA 5DRNA 1WV7T 2JKWA 4AT6A 1DQTA 6FABH 1H3TA 5KANG 2HH0H 2XBZA 3RKDC 2HRLA 1XEDA 1A7NH 2YUZA 4P9ML 1IILE 5E2UH 4YWGH 3QJZA 1MVFA 2XA3A 4PGBB 3CLFH 3V4PL 3C6LC 2N0MA 1OAKH 1WBXA 4GP8B 3OAYK 4H8VA 4JPSA 2DQJH 3ULAB 1HN1A 3ARXA 3PHQB 1MPAL 1E4KC 1L9NA 4JRXA 1BG9A 4L1DA 2R2CA 2X3CA 3W5NA 5IJVB 2AJSL 3U6XS 5EUKA 5LXGL 3MRJA 5FOBA 1DVQA 2RMNA 2YGVA 3VYNA 2CLRB 2YUVA 2NXYC 1FYTB 4Q6KA 1DSYA 3GO1L 5HHOA 1O75A 2YSTA 3L5XL 5HD8D 2JH2A 1DQJB 1EZVY 5T1DL 3VG0L 4LVOB 3BH8B 4H8WH 1FYTD 5BUPA 3F8UB 1AKJD 1KYUA 1D5BA 1DL7L 1SPDA 4JJ5B 4L9LA 5I0YA 4W9GC 4M8QB 4F15B 1LILA 4R5TA 4KK6C 5D7JB 2NZ1A 5TFSH 3P3SA 4JFXA 5BJTB 5J3HD 2CO3A 4GRLD 2D3LA 3TZVA 1KXHA 3C2SA 4LLDB 4X6EA 5FK9A 4ZUWB 1YECH 2UWEE 3DX1A 2LHAA 4JL1A 4J3TA 1RLBA 1VZGA 3Q3GB 3GMNA 2R0WL 2ZYSA 4PJBB 5AZEH 3RWFB 3W0WA 4QO1B 2R2HB 2X53A 2A6KA 4L5FE 1SF5A 1MCDA 4KVNH 4RNRB 4AYDC 5IHBA 3IPEA 4HISA 2V8LA 1JTPA 4ZFGL 2UYLB 2OMZA 3RPIA 2BMKA 2J6EH 3HB3B 4JRFA 4FFYL 5BMFH 4HHAA 4E42A 4YIQA 4RRPG 3T3PE 3TT1L 4KZDH 5B1JA 1H3GA 3HNTL 5ID1B 2ATAA 4LSVH 2MRYA 3FMGL 1KIRA 3MFGB 4P49A 2FD6L 5D5MF 4GKSA 3WEMA 3MCLL 5LN8A 3ARFB 1X4YA 3T1WA 1HZHH 1CGWA 4XOCA 2OSLB 3CBRA 4ZOAA 5DJ6A 3X14A 1BF2A 1P4LA 2CHWA 2WWKT 4JHWH 5FKPA 4ATTA 4JO1H 2WBWB 3QDJD 2KUTA 3TTSA 4XB3A 3AS1A 1K5NB 3D4CA 1F4YH 2WKGA 5KSBA 2F2HA 2TRHA 2I60H 5GGVH 4UUJA 5HGAB 2RHEA 5SWSE 5KN5B 2X12A 1I1AA 5E6IB 3Q48A 1DQDH 2FYVA 4ISVA 4C55A 1PY4A 3FB7B 3T1FA 2VR7A 3S98A 1FJ1B 3BRDA 3D0LB 5EIQA 1CXIA 4KNTA 3WS6A 2ZG3A 1Y0LA 4E9TA 4JO3L 4N87A 1BFVL 1MJJA 4MAUH 4TXVB 4LSSL 2PW1A 3S6CA 2I9TA 1YYML 3NFNA 1OT2A 3HCVA 2YAPA 4CVUA 4J3SA 2Y2WA 4EUPB 1AGCB 1HHIB 1QQDA 4I89A 1KCSL 4XNBA 4HD9A 2NMSA 4GLRH 4WW1B 5L88H 4OKDA 1IGTB 4I0PB 1FFNA 3ATBA 3D08A 3GIZL 3LRLA 4QTIL 2LAAA 2J8UA 5I6OA 1UD6A 4JFQA 3A0OA 2ARWA 2YSSA 1CDBA 4QCIA 3PAVA 3KLHD 4XO8A 1CFBA 2AJYH 2Y23A 4L8DB 5HHMD 1Q1JH 3PABB 3ZDXE 2BSSA 3NIFF 1JPGA 4HWBH 5D2LB