1WHVA

Solution structure of the rna binding domain from hypothetical protein bab23382
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
100
structure length
100
Chain Sequence
GSSGSSGGPDLQPKRDHVLHVTFPKEWKTSDLYQLFSAFGNIQISWIDDTSAFVSLSQPEQVQIAVNTSKYAESYRIQTYAEYVGKKQKGKQVKSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords poly(A)-specific ribonuclease
publication title Solution structure of the RNA binding domain from hypothetical protein BAB23382
rcsb
source organism Mus musculus
molecule tags Hydrolase
total genus 12
structure length 100
sequence length 100
ec nomenclature ec 3.1.13.4: Poly(A)-specific ribonuclease.
pdb deposition date 2004-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08675 RNA_bind RNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1whvA00
2XSFA 1YTYA 2KXFA 2RRAA 4RU2A 1H6KX 3DXBA 4P6QA 2LECA 3NMRA 2GHPA 2JX2A 4F02A 3V4MA 1U2FA 5MLCV 4CIOA 3CCES 3S6EA 1U1RA 5DDQC 2DIVA 2D9OA 3CF5Q 5GAHU 2VOOA 5LXRA 4OZ1A 4CH1A 4IUFA 2CQ4A 2M8DB 1WHXA 1QVFR 2LMIA 1B7FA 1Q81T 1ZZNA 5GVQA 2RNEA 2XNQA 4QPTA 3JB9k 1FO1A 2CPEA 1U1KA 1BY9A 3FEYB 1YITS 2YKAA 2FHOB 3Q2TC 3G8TA 3CUNA 4Y00A 2MKCA 1S72S 1SXLA 3J7ZT 3R1HA 4PRFA 3CC2S 1FXLA 5LJ3Y 2DGWA 2V94A 3MI7X 1JJ2R 4QQBA 2MZSA 3MXHP 2N7CA 2MQMA 4C0OC 2CPXA 2XNRA 2MKJA 5HO4A 1G2EA 2M8HA 5DDRC 1JMTA 5LJ5Y 2XS2A 1HD0A 2OTJS 2MY7A 2YH1A 1NJIT 2DNYA 2DNGA 4Z2XA 4TU7A 3CMES 3BO2A 2BZ2A 2MYFA 2KG0A 1YJ9S 2MZ1A 1YJWS 2DB1A 3RW6A 5D77A 4LMZA 1URNA 1X4BA 2VOPA 1YHQS 4WFAQ 2FC9A 2ZJPQ 4EGLA 3CCUS 3SDEA 2HYIB 1X4FA 2LYVA 2SXLA 1WF0A 3SMZA 1ZZFA 1KQSR 2A3JA 2MXYA 1UAWA 3EGNA 2KRBA 1M90T 4QU6A 2LCWA 1U6BA 1OO0B 3ZZYA 3G4SS 2L9WA 1UW4A 2VODA 2DISA 3CC7S 1WF2A 3S01A 4PR6A 2DNRA 2MSTA 3LQVA 5DDOC 3CMAS 3N9UC 3HHNB 4M5DB 3SXLA 2J0SD 2X1AA 1OWXA 3P5TL 3VAFA 1Q82T 1PO6A 4CH0S 2DHSA 1VQ8S 2I2YA 5FJ4A 3HI9A 2KXNB 2MPUA 2DGUA 3S7RA 2X1FA 3I55S 5GMKa 1WI6A 4YOEA 3DLLQ 1RKJA 2BOPA 2EK1A 2KFYA 2ZJRQ 3MUMP 2K8GA 3NS5A 2DITA 5IM0B 4IOAQ 1NO8A 1H2UX 3LPYA 3MDFA 1M5OC 1VQOS 2DNKA 2MQLA 3THTA 2X1GA 2DH9A 2LEBA 3TP2A 5EN1A 2WBRA 2LA6A 3VAJA 2CQDA 1NU4A 1K73T 2LXIA 2JVOA 1WTBA 2U1AA 1X4EA 3H2UB 2RQ4A 3UWTA 2MGZA 3NNHA 2AYGA 2EVZA 1WEZA 1N54B 1HL6A 1UFWA 1R8PA 4WIIA 2CPJA 3U1MA 1FT8A 1OPIA 2CPHA 2LQ5A 2RU3A 1VQ6S 2RS2A 3UE2A 2KN4A 1P27B 2QFJA 1U1PA 1VBXA 1SJQA 5LXYA 4U67Q 1H2TZ 3I56S 2HGNA 1Q7YT 1R8HA 1KOOA 1VBYA 1FNXH 2DGXA 4ZKAA 3VAGA 2DGSA 3FEXB 2MKIA 1VBZA 2MQPA 1X5SA 2CPFA 3BEGB 4UY8T 2MZQA 1F9FA 4WFNQ 3CCMS 1VC5A 2FY1A 1A7GE 2N82B 2X1BA 1X4DA 1X4HA 4QU7A 3U1LA 3BO4A 5IQQA 4J5OA 1KD1T 3NNCA 2CQHA 1WEYA 3UCZP 2OSRA 4ED5A 1M1KT 3ULHA 2PE8A 5LSOA 3BO3A 2EK6A 2G4BA 5IFMA 3VAHA 3TYTA 2NLWA 4TU9A 1WELA 2G1DA 4TLQA 3MUTP 2M88A 3NNAA 1YI2S 2CQBA 4CQ1A 2AYBA 3IWNC 2CQIA 2MSSA 3ZZZA 2DNNA 3NS6A 1W2BR 1U6FA 2M7SA 4C7QA 2MQQA 1Q86T 1K9MT 1WF1A 2HZCA 2M9KA 1M5PC 2UP1A 4WKRA 2I38A 2XB2D 3CPWR 4BS2A 1U1MA 2M52A 2AD9A 2AYEA 1YIJS 2CPIA 1QVGR 2DNLA 3EGZA 3UD4P 2DO0A 1FHTA 4W92B 2DH7A 4IO9Q 3B4DA 2CQGA 2OTLS 2MHNA 4V19X 1VQLS 2F3JA 2RS8A 2DGOA 3G9CA 2KXHA 3VAKA 4C4WA 1WG4A 2KHCA 2MZRA 2KU7A 4LJMA 2K3KA 1WG1A 5D78A 1FJ7A 5JVHQ 3P3DA 5GAGU 2YH0A 1VQPS 2DNQA 2E5GA 2M4MA 2DO4A 1DHMA 3CXCR 1IQTA 4W90B 1X4AA 2MKSA 2B0GA 2N3OA 2J8AA 3CD6S 2DNMA 3P6YC 1D9AA 4PKDB 2MB0B 4YUDA 3G71S 3G8SA 4F25A 1WHWA 2RQCA 1SJRA 1U1QA 1X5TA 5LSLA 1AUDA 1VQNS 3CCRS 1SJ4P 1ZH5A 4F26A 5JVGQ 3BS9A 2KM8B 3UD3P 2OSQA 2KI2A 1M5VC 2MKKA 3P49B 2D3OR 2DGVA 2MY8A 2CQ1A 2E44A 2LEAA 4OZ0A 5GADU 4FXVA 1N8RT 1CVJA 5CA5A 2KM8C 4IOCQ 3CTRA 2CQCA 4FXWA 3MD3A 3IRWP 1HD1A 1VQ4S 1WWHA 2OJ3A 3Q2SC 2DNOA 3R27A 2O3DA 2RT3A 2CPDA 2XS5A 2DGQA 3VAIA 2DHXA 1O0PA 2HVZA 2DK2A 2AYMA 2DH8A 2MJNA 5DETA 3MOJB 1L3KA 4WF9Q 2MQNA 2MKHA 3G96A 1A9NB 1JJHA 2U2FA 2DHGA 2JWNA 2JRSA 3J7YU 3R1LA 1DBDA 4Y0FA 3CCQS 1X0FA 3PIOQ 2L08A 2JVRA 2L41A 2NZ4A 2F9JA 1HA1A 5H1SV 2KT5A 2KH9A 1FJCA 5BJRA 2RUGA 1QM9A 3VF0B 2E5IA 3EX7B 3CCSS 1K8AT 1VQ5S 3CULA 4YB1P 2DHAA 3UCGA 2LKZA 2RVJA 3MURP 1VC0A 2XS7A 3US5A 5CYJA 1H2VZ 2CJKA 3K0JA 2DNHA 3S8SA 5ITHA 2MGZB 1D8ZA 2HGLA 3UCUP 4LIRA 2D9PA 1WI8A 2MJUA 2KRRA 2DIUA 2FC8A 2QA4S 1KOHA 2LXUA 3CCJS 2FPHX 1VC6A 1WEXA 2CPYA 1FJEB 3D2WA 1X5PA 1YWXA 2CQ0A 2J76E 1VQ7S 2YWKA 1SJ3P 1N52B 4ERDA 1N88A 1VQ9S 1X4GA 2MMYA 3B4MA 1DZ5A 2G0CA 1VQMS 5DDPC 1OIAA 2RRBA 2CQPA 2MZJA 1U1NA 2DNZA 3MUVP 2ZJQQ 3CC4S 2PEHA 1X5OA 4WFBQ 3OW2R 5DM7Q 2QEXS 5CXTA 1M5KC 3VALA 1DRZA 1JJ4A 2HGMA 2LA4A 5IM0A 1P1TA 2DGTA 3TO8A 1S79A 2DNPA 2KYXA 1YJNS 1SJFA 2M70A 3VAMA 2E5HA 3L3CA 1WHVA 2CQ3A 1U1OA 2ADCA 2E5JA 2CPZA 2KVIA 2ADBA 1VQKS 1U1LA 3SDEB 1X4CA 4UQTA 1UP1A 3RW7A 2MQOA 1XN9A 3G6ES 2KG1A 2N3LA 5DM6Q 2Q79A 2CQ2A 3MD1A 1KC8T 2ERRA 4TU8A 1PGZA 2OIHA 2F9DA 4A8XA 2GO9A 5GAEU 2M0GB 2YTCA 2J0QD 4WCEQ 3H2VE 1WG5A 2M2BA 2MZTA 3THPA 5HL7Q 1WHYA 2VONA 1RK8A 3CCVS 3CCLS 3PIPQ
chains in the Genus database with same CATH superfamily
1S76D 2QYCA 4C8NA 2KXFA 3W64A 2OUGA 1F0XA 3HPOA 2UUCJ 3C15B 2VFRA 3S6EA 5C42A 4L3KA 3KLGA 4P7TA 3OFGA 1H73A 4JI6J 3OFEA 3MM7A 4I6YA 4OFZA 1UWAA 2VPZB 2AX1A 2YKAA 2YNIA 3AOBA 3D6TB 1RAOA 6FD1A 2JC1A 3EUNA 1J5OB 2UVWA 4WP9A 2JEGA 2JDJA 2VFSA 4KO0B 1BQNA 1S97A 4URQU 3GV8B 2UU9J 5A6PA 3D67A 1RT5A 4DR1F 4ZPBA 3WX8A 1T9XA 4PXCA 2E1CA 1C1BA 5E2QA 5D77A 3R2DJ 3CDWA 1LWEB 4I7FB 1YJUA 1NHVA 4CLFA 3UW1A 2ROPA 4QWAA 1O6XA 4C8KA 2FJVA 2V8VA 4J9SA 1S0MA 3I5CA 3GQCA 4ILLA 4DHVA 4X65F 3BBCA 2V6AA 1PYSB 4X62J 1FESA 4DX7A 4NWBA 1PKUA 2DHSA 3PYDA 1VQ8S 1X60A 1IUJA 5ETLA 1PC4A 4Y6IA 1RT1B 4ELVA 3IMQJ 2BQ3A 3RAMA 3O3LA 2R7OA 1YZ7A 2VQFF 2UXCJ 2CXEA 5IT4A 2ALZA 3ZNUA 3RB6A 4FPIA 1HNWJ 2F4VF 1JLEA 2OFGX 4N56A 5HQMA 3M8QA 4F4XA 2ZEJA 3OTCA 5ETMA 5KFLA 3M6VA 3TQEA 2GGPB 3U1MA 4HDGA 4UZCA 1OPIA 3Q89A 2GJFA 5ETQA 2QGFB 1U45A 1LEOA 3I96A 4URSA 1IKXA 2RUSA 3F44A 1N48A 4NZ6A 1HR0J 4N77A 3M8PA 1FFSB 3MM9A 5KG3A 3DLGB 3D6HB 3VQTA 2PO4A 4C8LA 2OPSA 3CCMS 1L3UA 3HVTA 3G6XA 1CJUA 3C16B 1REGX 1EKSA 2OHDA 3LP1B 3AODA 3RAXA 1KBRA 2ZUGA 4M5GA 3SSQA 4DMZA 3TQ1A 1CG2A 3O44A 1BQXA 3W5YA 3MPWA 4NRTA 2LU2A 2R8IA 2J8SA 1Q86T 2UP1A 2WSCC 1TVRB 2W4DA 3TUZC 3DLEB 1NK5A 2DH7A 2G2ZA 1V3SA 2AJ1A 3W9JA 2JZ5A 4J9QA 2BQRA 5JVHQ 3ZTOA 3C15A 3N28A 3J7Z5 3BJYA 2P9EA 1TU0B 3WHIA 3R5GA 3UDLA 4F50A 3R6LB 2R2RA 2HBZB 1SIZA 4MIBA 2FY8A 4Q5VA 3MOZA 4DQPA 1XMOJ 5K5MA 2QX0A 4KSEB 2NYIA 1J5OA 1KP6A 4DF4A 2P6TA 2DGVA 2MY8A 1VS3A 4KO0A 4KTQA 3RB4A 1U24A 3Q2SC 3TVYA 1FTRA 2DGQA 4RNHA 2R7XA 2HVZA 4YY3F 1SC3B 1JJHA 2VG6B 3D6FB 2JWNA 3J7YU 2KZMA 1PJ5A 4MTPA 1GH8A 5KFHA 1LWEA 3EX7B 3KYLA 1G7CB 2D7SA 3IO1A 4OYPA 3Q8YA 3AFGA 4LF7J 1R43A 5KFQA 2KRRA 1U02A 4ZDNA 4A8OA 1YK9A 2BOAA 4ZS6A 7AT1B 5HVFA 2AJ2A 3BN4A 2Y0BB 1OIAA 2HFUA 2DR5A 1FDNA 4WFBQ 3I5AA 4DSFA 2DCLA 1U0SA 1V6HA 2ZE2B 3FSYA 1VLOA 2BA9A 1X9SA 3RZAA 2J9DE 1Y5IB 2POKA 1GK8A 3H4BA 2ZNYA 4DV7J 1TL3B 3O8WA 4ECWA 3V81B 4QIGA 4R5PB 2CZ9A 3MD1A 3UD5A 2GGPA 5L38A 2BRKA 2FVCA 2GO9A 1GXUA 1TKDA 3ZO7A 5B0FA 3H2VE 1SQGA 4YHHJ 3THPA 2OPPB 5GAEI 2OEKA 1ULRA 1N5TA 3ONQA 1Y11A 5E3PA 1B0VA 3DLGA 1C1CB 4OYXA 1DTTA 3QT8A 3A13A 4LF4F 2FGOA 4J9MA 4XK8C 2VOOA 1HWUA 1P8GA 3BKTA 3C16A 2RF2A 1FO1A 2CPEA 3GSIA 5AJ3J 5CYQB 4JI8F 4ZN3A 3QZ8A 2L9NA 4I64A 5ETOA 5HROB 2FJAB 4X66J 5KFRA 1JJ2R 2QTWA 1TVRA 3DLEA 4LF6J 3MMBA 3W2VB 1JX4A 3HFZB 3D6MB 3OPKA 2OP5A 3KUEA 5F0UA 4G1QB 3PACA 3N4WA 1TUVA 1UVNA 1SH2A 2BRLA 1TV6A 3ZZRA 4EGLA 3SDEA 4DG1A 1X4FA 5BYRA 4RNOA 1IJFB 1AYEA 2A3JA 3PNIA 3NAHA 2P6SA 1VHFA 1TAUA 3TJAA 4XAKA 4F4AA 4X64J 2CAJA 4KIAA 3LQVA 5DDOC 3HHKA 1F3FA 3W7BA 2GNKA 2W2NP 4Q45A 4NLQA 5G0RB 1RHRB 3EGVA 4ZCKA 1VK8A 3I55S 3PKMA 3BREA 4PG5A 2JL9A 1RKJA 2VG6A 1O5JA 1M0SA 4CO1A 3FCWA 1LW0B 2X3DA 1IKVB 1NO8A 7FDRA 3CJ0A 4OMFG 9RUBA 2HFZA 2GC8A 5C24A 2GMHA 4YR2A 3UWTA 2LVWA 4BBYA 2QA2A 4EUVA 1WEZA 2LU1A 3E01B 2LQ5A 5HMYA 4F4YA 4LBHA 2D1CA 4NZ0A 4FF4A 1B3TA 1JNZB 3GR0A 4C9DA 3PW4A 3M6XA 1B0PA 3BEGB 2C2MB 4DU7A 1AROP 3MM5B 1IVZA 4E98A 2ZE2A 3BPDA 1FE0A 3C6TA 1ZAVA 4OZ5A 2QA4G 1T0TV 4DBQA 3ULHA 4OLPA 1TL3A 3VAHA 3FUYA 3V81A 2DEJA 3RBEA 4YDXA 1YSJA 3TOQA 3DLKB 4R5PA 3RAQA 3GFXA 4OX8A 3UDEA 1D3WA 4X4OA 2HURA 1FHTA 2FD2A 2PFFB 2EFOA 2OTLS 2F3JA 2HVIA 2F8HA 3T6BA 4ZIVA 1QTNB 4RNFA 2AJ0A 3W60A 2DNQA 5A8WB 1IWAA 4NLXA 5IT9Y 5A6WA 1RWXB 2AGPA 3D7SB 4R0EA 2B6AB 3MR2A 5CHCB 4DR4J 2B4VA 4DZDA 3AA9A 1S0NA 5KFIA 5CYQA 1SJ4P 3M30A 2LFVA 2KM8B 1RE1B 4U96A 3CCWA 5HROA 1HHSA 1UJ6A 4FF3A 3CTRA 2OAUA 2FHJA 3W2VA 3DN9A 2RAQA 1DLOA 4PYDA 3MOJB 1F3VA 4G1QA 2XTJP 4PPZA 3FFIB 3CCQS 2L08A 1S1XB 2C42A 2NPFA 1N0UA 2KH9A 1DQAA 3QAEA 2W2QP 4LUBA 3HZEA 3AJ1A 4EZ9A 2B4PA 1ZETA 5CH7B 1Y10A 3VGSA 3PV8A 1BC6A 1WI8A 2WVFA 1GX5A 2LXUA 2E7VA 2FPHX 4DFJA 2HQ3A 4KGMA 4Y2MA 3O6QA 5G0RA 4LFAJ 1RWNB 2AX0A 1N32F 1HQEA 4XPEA 3K5OA 3SBMA 4PG8A 5CXTA 2NXEA 3HF5A 3MZIA 1FKPB 1LW0A 2LA4A 3V5RA 1IKVA 2VASA 2E1RA 4NYOA 4ELTA 1C4CA 4ZJOA 2J9DA 1CEZA 4UUWA 4J9UE 3LTOA 5EX0A 3E01A 3EYZA 2KTQA 2IM1A 5B0BA 4LFBJ 4I67A 1WHYA 3PIPQ 3QAUA 5KT5A 3K2YA 3DNCA 1RUSA 3IAS9 2W2MP 1H6KX 4EEYA 2VFTA 3IM9A 1Q0NA 3OR2B 3MM5A 3CF5Q 2JNJA 4BCAA 4WJBA 3CSKA 3QO9B 2XNQA 1NHUA 4V1Ak 1UEKA 3DLKA 4DQSA 3C3LA 1S72S 1SXLA 4X4VA 3QPIA 2ZH5A 2K7JA 5CCLA 1SB6A 2DGWA 3U1NA 1U0HB 2GMLA 2F40A 2DNGA 4DV5J 5LMNJ 3KG1A 1SQFA 5EWGA 4NLYA 5A8WA 3Q23A 1Q95G 3D68A 2LQJA 3DRXA 2ZM6F 2RQMA 3HSDA 1WC3A 2B6AA 1WSVA 3R5BA 2IA0A 3A12A 1EKRA 4KHMA 3IS9B 3KLHB 1AXQA 3DFEA 3MR6A 4J9OA 3L9ZA 4DSEA 3BKFA 1T7PA 3BSNA 4LF2A 5IXUA 2Q66A 1WD6A 3NGSA 3Q8VA 2I2YA 4OZJA 3HI9A 1D0EA 1PJ7A 2J7UA 5J2QA 5D0RA 2A10A 4JYAF 3GILA 3FFIA 4DF8A 1S5ZA 1JLQB 1S1XA 3F41A 2DITA 3LPYA 4ES2A 2DNKA 2XBPA 4DWIA 4M63A 4P2XA 1K0VA 1U4BA 3NNHA 2LDIA 1HBMB 3NAIA 4WIIA 2CPJA 2XMVA 1RCOB 1KONA 4P2MA 4JI4F 5H9FJ 3NGUA 1U1PA 2R2TA 5C2GA 2VDHA 1NPPA 3D54A 2XI2A 4DOZA 3PXGa 4AL7A 2AEJA 5I3PA 1FKPA 3GWCA 1X4DA 1FRKA 4CCHA 1F5CA 1TKZB 4Y3CA 2EK6A 1ZM3A 3MUTP 2CQIA 2QL9B 3KJFB 3OV7A 5DJBA 2RE1A 2AV5A 3BF4A 4HTJA 1M5PC 3DM2B 4ZPAA 1U1MA 2Y9HA 4DX8H 2VH7A 3EGZA 4KRWA 2DO0A 2HZAA 2GIRA 3ILJA 4ES1A 4DV3J 4G3IA 2KU7A 4GO7X 2W9BB 2EEYA 1KFSA 5EDWA 1H38A 1VQPS 4FDFA 3OR2A 1Y3KA 1YJRA 2YPZA 1FF2A 2WTFA 2XSJB 3P6YC 2VDIA 1D9AA 4K0KF 3QO9A 3OXFA 4RW9A 3I31A 5IT9U 2QL5B 2D3OR 4DQIA 4KGZB 4ED3A 4ATNA 3OSNA 2ASJA 1U0HA 3MD3A 4EBDA 3CNQP 2B56A 2H1YA 2FUG9 3ZTRA 4ES3A 3KG0A 2DK2A 2MJNA 3J80Y 4G1PA 1FJCA 3PG9A 3TZZA 2BE9B 3PKYA 3K0JA 2IJNA 3QSIA 2A6MA 4WFYA 1ZOTA 2GCFA 3VV2B 1Z2ZA 5B09A 1V3ZA 2CQ0A 3TX8A 1VQ7S 4W98A 3UR3C 3AB2B 2VUGA 4BWJA 4LF4J 2PEHA 3ETMA 5BYQA 1RT2B 4X4RA 5HQ8A 3CJKB 1DURA 3OD2A 4U95A 5L9NA 2GHVC 1S59A 4NEYA 1P1TA 1IJEB 1B0TA 3A8EA 1T9UA 2J0XA 2CPZA 2HFNA 4UQTA 5D4LA 2MQOA 5DM6Q 1HWKA 2Q79A 1HBMA 4TU8A 3K17A 2F9DA 5CQGA 5D6GA 2CFXA 4DV2J 3ETOA 1HQUB 4ID5A 5LL6d 2HAFA 2CJ9A 2ROEA 4ANDA 1IKYB 3RGIA 4KKOB 2PC6A 3H20A 2QSFA 2QJ3A 2R9LA 4JI0J 4KFBB 4RNMA 3AA8A 3EZOA 4CH1A 5KFNA 2XZWA 2N7YA 2A2DA 1S1WA 2QLWA 1FDBA 2QE5A 1RU1A 4PPDA 2HQDA 4N8NA 3DM2A 4CM2A 1FXLA 1S4EA 2HMIB 4ZCLA 2R4FA 1U49A 3PFOA 2FHKA 1HD0A 1EAYC 2DNYA 2UVUA 1ZS6A 3R5AA 3BGOP 3VQSA 2W9BA 2V4JA 3NY0A 1KTQA 2RKIB 3Q83A 3T1HF 2GS8A 5GMDA 2XSJA 3MAAB 1RTIB 1OO0B 3P45B 4HHUA 1VBKA 1KQGB 2GQCA 1TK0A 1MN9A 5ETRA 3ZTPA 1NCLA 1S9EB 2ZFHA 3PX6A 3RRKA 3H2LA 3W5XA 2B5JB 3MCOA 2MLZA 3EXCX 3U27A 4MT1A 3A3PB 1SCJB 5GMKa 3GYXB 3V6DA 5D4OA 2Z0GA 2EK1A 4AXIA 2OD4A 5KG5A 3QGHA 3D0HE 2I5JB 1VQOS 4JI3F 1FEHA 1WOPA 2C2NA 4IFVA 3SCJE 3KDNA 1K44A 2BM0A 4F2SA 3DKDA 3N6NA 3R3TA 3DRYA 3ILIA 4B3TF 1W26A 2IJRA 2GZOA 4QOTA 1J5EF 3N01A 3KWMA 3RR7A 2HGNA 3M6UA 1VMBA 3JQKA 2DGXA 4LF9F 1G3OA 1RT2A 1VQSA 3CJKA 4YR0A 2JEIA 1I6JA 2CDRB 5AE2A 4I0WA 5IQQA 4QIEA 4DV1J 2OSRA 4WBFA 2IAJB 3KNGA 1FEEA 2PE8A 4TU9A 2ZH8A 2GIFA 1VHIA 3QFWA 4J9VA 2AGQA 3PZPA 2XULA 2HNDB 4DR6F 1RB0A 4ZVSB 3MECB 3BGLA 1TL1B 1HQUA 2HW3A 4O4RA 4DZ6A 2BXJA 3MPDA 2W7PA 2CQGA 1TELA 1IKYA 2QRRA 3FZBA 2H4WB 4M1KA 2FLNA 1NXIA 4Y28C 4HACA 4C6AA 3M4XA 4DL6A 3KHLA 1FD8A 2HRTA 1KSPA 1VLYA 2HIYA 1H3DA 1ZAWA 2PFDA 2WVCA 2UUBF 1FA0A 3BSCA 1H98A 2RJZA 4RU9A 2VC1A 2E44A 4OZ0A 3EPGA 3MM6B 3FDSA 1N8RT 3CCZA 5AE3A 3HK2A 2OJ3A 3EGWB 2FDNA 2R7UA 4JP8A 2KL8A 4CM0A 2B8PA 3RTVA 3MR3A 2RKIA 4PWWA 3EJMA 5H1SV 2XY6A 3MAAA 2RHQB 1X8DA 4CO3A 4OV6A 1X31C 1RTIA 3WBZA 5CYJA 5L8RC 3T5LA 1U2RA 3J80U 2L48A 2B9XA 2QA4S 4BWMA 1VC6A 1Y0HA 4TXSA 1NRKA 1S9EA 3ENVA 1B64A 3CJRA 3T1AA 3TAMB 3IC1A 3MCNA 2MLYA 1HNZJ 4LRFA 2CDQA 2WK4A 1JIHA 2ZJQQ 3O2IA 5IV3A 4JV5J 4PZVA 2V34A 3MMJA 2I5JA 3NP5A 2PDAA 5KG0A 2XHWA 2RB7A 5F3TA 4KR0B 1E6YB 2DR8A 1GXTA 4ZVFA 1PYTA 1JK9B 2WBMA 2EFGA 3CJQA 2GVZB 2HWHA 4U7UK 2RDDA 3VVUA 2HLTA 4ETZA 1NSPA 3D3BJ 1JQGA 4O44B 3DMJB 5DZ6A 2XSFA 3T6JA 4RU2A 1IBLF 5HJXA 2B43A 5MLCV 5I3UB 3IGVA 3VGUA 4CIOA 1MN7A 5AXKA 2HQIA 3MPVA 4WIQA 1VRQC 2ZKUA 1TMMA 2IAJA 5CAAA 1OQ6A 1UL3A 4HLBA 2UXBJ 3LAMA 3JB9k 1YITS 3W5ZA 1PIEA 2CADA 4DX5A 2HNDA 4I4BA 3MI7X 3MECA 3PJWA 4UOCA 2MZSA 1TL1A 4C0OC 2CPXA 2XS2A 3GV7B 3BH6B 1M1GA 2BDPA 1U09A 2J7KA 1E6VB 3UDVA 3BO2A 1YJ9S 2MYFA 1YJWS 5IS2A 1Z2LA 3E8OA 4C48A 5IQ6A 3A8JA 2AJ4A 2FC9A 2HYIB 1NKCA 2W7AA 2LYVA 2SXLA 4H4OB 2MXYA 2HHPA 5L1JA 2KB2A 5HATA 3SV4A 1AZSB 3SCKE 4L74A 5K8PA 1NM2A 3SEOA 1RWUA 1RTDB 3CC7S 4X84A 1LOUA 2UUTA 5HQLA 2FIUA 3MM6A 4LF8F 5K8OA 3PYEA 3QJJA 2ZH9A 1D9DA 3GIRA 3KDOA 4ETXA 4M5LA 2I1RA 5DQHA 3VTIA 4LBPA 3D66A 1UVIA 2IDLA 1KS2A 2VF3A 4EYIB 2K8GA 2AWZA 4D3GA 3T3FA 4ZJQA 3AH6A 1M5OC 4L3NA 2LA6A 3NLCA 4ZCIA 2C2DA 1RSCA 2KT2A 1WDTA 1HMVB 4Y65A 4RLEA 1QLNA 4IG0B 3LH2S 4WP8A 4OV1A 3UE2A 2XWXA 3UQSA 5J1NA 1JLFB 3KNAA 3TAMA 4O3PA 5J1PA 3M8RA 1KOOA 1ZAXA 1DTQA 2ZDPA 3L7PA 4OHYA 1X5SA 2E29A 1HNIB 4GRSA 4CH7A 2WOMB 3B82A 5F8NA 3OJSA 1EIYB 2B3TB 2O67A 3KUHA 4J91A 5E0OA 1E6YA 2CWKA 1DARA 2Z2ZA 2M88A 4ZPWR 3IWNC 2JSXA 3SSSA 1R8CA 2W2PP 2WVDA 2MQQA 2GVZA 2ZITA 2B8QA 1I5OB 3I32A 2Y1RI 3L95X 3DMJA 2W01A 4QJVA 1UTAA 2FZKB 4DV0J 2RS8A 2B9EA 2KXHA 3GV5B 3LW5C 1XR7A 3JQJA 4I6AA 4C3KA 2HHWA 1FJ7A 5HSPA 2YH0A 5I3UA 2M4MA 1IQTA 1XNRF 5DQIA 4RPFA 2IY5B 2B51A 2C3UA 1GFWB 4C98A 5LSLA 1AUDA 2J9EA 5KFVA 1ZH5A 3HJVA 3R5JB 1R8AA 4C8OA 3G86A 2ZDOA 3AOCA 2XMMA 5CA5A 1L3SA 2HKEA 3SQGB 4PXEA 2V67A 2YKPA 4P75A 2DT9A 1E6VA 4OJ3A 4ZVHA 3KLEB 2U2FA 2J6TA 3Q22A 2JVRA 2L41A 2DRDA 4CP5A 2FYXA 1HA1A 1UFLA 4H4OA 1R89A 1QM9A 1AZSA 1GMUA 1VC0A 3SFGA 1RXOB 1RTDA 4JI7F 3PCOB 4W4MA 1RP5A 3CCJS 2L3MA 5E41A 3D2WA 4RKUC 2B9YA 4DI6A 2G0IA 1JXEA 1EHWA 2MMYA 2AJQA 1DZ5A 3JSMB 1SKSA 2OPRB 4J9PA 3CD0A 3CVKA 3CC4S 8AT1B 4B3RJ 1TL7B 2PSZA 1RAIB 1FJGJ 2X7IA 5A8KB 5B0AA 1HNXF 2HG4A 2QL7B 2HHXA 1YJNS 2E5HA 4FYYB 3MAQA 4WU3A 3RR8A 1Y5NB 1HMVA 2N3LA 5DGAA 1OPZA 2ACMA 4DV6J 1J27A 1T95A 2OGUA 4IG0A 3JXOA 3M8YA 4ZLLA 3HD2A 1RBLA 1JLFA 1RK8A 3C19A 5LMUF 4USVA 3DXBA 4F02A 4X4PA 1HNIA 3SFUA 2WOMA 3TJ9A 4MK7A 5LXRA 3S1TA 3TZYA 3GU0A 1T8EA 1ZZNA 1NB7A 3QFHA 2Z4PA 2V2VA 5C25B 1U1KA 2ZZTA 1CJVB 2CJQA 4ZPCA 2LLZA 4C0BA 4WXOA 5G4DA 1TUGB 1LQ9A 4DFMA 1ZTTA 3V6HA 1S1VB 3T41A 1SUQA 2A2CA 2VG5B 1IXKA 2GVDB 4F2RA 2ZBCA 2UV8A 3EMTA 3BQ0A 1NJIT 5K14B 2IRYA 4Z2XA 2P8IA 3D0GE 2MZ1A 1SC1B 2XCPA 3QJPA 3CJ8A 3T9ZA 4X4NA 4HHHA 1W25A 2DXEA 2FHJD 1S99A 3N5BA 4RBTA 1OY9A 4B3TJ 3UN2A 4NCBA 3DGPB 4ZP8A 2DNRA 1HBUA 1BE4A 2AF6A 1PILA 2J9CA 3VAFA 3NGRA 4CH0S 2QLFB 3PHTA 5HANA 3DOLA 3G82A 4QW8A 4U8YA 2RHSB 2R42A 3OLAA 2NR0A 4KT0C 1JJCB 4K4WA 2D3O1 4KH0B 1YBAA 3HFVA 2VQEF 3ENWA 3MGJA 5KFYA 3NS5A 1MROB 3FMWA 1S0VA 1QAJA 4NLGA 2OEMA 2HHHF 2X1GA 3PO5A 4CDIA 2U1AA 4QIVA 2ZZMA 2AYGA 1K47A 4DFPA 1UFWA 2CPHA 3FQLA 3NCPA 4NXMF 1RWWB 2ZZNA 2XMUA 2WRMA 1SJQA 1EQMA 4PQUB 3EM1A 1ITPA 4QWBA 3JSMA 4JI5J 4HI1A 3IN5A 3M32B 2OPRA 1OY8A 2CPFA 3DLJA 2MZQA 3CDEA 2FY1A 1TL7A 4RBVA 5JMNA 2XEXA 1X4HA 4TYAA 3BO4A 2R3VA 3BBBA 4I2PB 3PFEA 3FSXA 2IM2A 2MDAA 4ZVRB 3LP0B 1XQIA 2AYBA 1HQ2A 1IN0A 3R7NB 3HP6A 1W2BR 2A1BA 3BQ1A 3PRBA 1IBMF 2HSEB 4UOGA 1YJ7A 1XMQF 3GCWP 3A1YG 2IBOA 1GNKA 4HVZA 3LA0A 3QQCD 5BR8J 3T1YF 4C4WA 5KG7A 4MH8A 1HWJA 4YN3B 3LGMA 2HK2A 1NKEA 4W90B 5D0EA 1S77D 2J8AA 5I42B 3WC0A 2MB0B 4ZVTB 2XO6A 2J0WA 3G71S 4F25A 1U8WA 5C25A 1CJVA 2ZH7A 3KHGA 1WC0A 3H7HB 2FZGB 2OSQA 1M5VC 2YQ1A 1RT4B 1S1VA 1F9HA 3LF0A 4KQZA 2VG5A 2GVDA 4IRCA 1NUEA 3I87A 3C14B 4CNZA 5K14A 1O0PA 1WC6A 4PQAA 1WUUA 4PWDB 4Q8FA 4NPOA 3PJXA 4H4KA 2NZ4A 3GJTB 2R7VA 1LWCB 2KT5A 3QT7A 5K8NA 3VF0B 3KLFA 1NSKL 2C3MA 3B8HA 1M1HA 1MMNA 3KKFA 1SPBP 2Y3YA 3DGPA 3CJ5A 2FC8A 4LF1A 2MKYA 4RX6A 2AKWB 4Z7CA 3CIMA 2YKMB 3QWUA 3LALA 2CNNB 1IBLJ 4OYIA 3FNNA 2RQKA 2BJDA 3TW0A 2ASLA 3K58A 1SV5B 3MUVP 2UXDF 5DM7Q 4KV8B 4B02A 4LVOP 1T03A 1MROA 3FBCA 3FZ2A 4B9MA 5FD1A 4QWCA 2M70A 3VAMA 5IWAF 1RTJA 3E2EA 5F8JA 3R8YA 2DBBA 3Q24A 5IC4B 4USMA 4RW4A 1JB0C 1N34J 4F4WA 1S9FA 2J0QD 2HK3A 3J7A1 2M2BA 4PQUA 1FE4A 2ASDA 2WSFC 3QZ7A 2EXUA 3M32A 1WACA 3R6GB 4P6QA 2LECA 4USKA 2GHPA 4GKKF 4H4MB 1Q1KA 2HS4A 4AL6A 1S9GB 2G9OA 2HHSA 4WFZA 1B7FA 1SBRA 4I2PA 5GAHI 2DJWA 1TK5A 2GA7A 1YQHA 4B3SJ 2P9CA 2VPWB 4FVMA 3CB4A 1RBOB 4K2XA 5ETPA 2DXFA 3J7ZT 4LF8J 3J81Y 3W1YC 3DOMB 3TWZA 2ZOMA 2VV5A 2N7CA 3MTKA 1WSRA 2FQQB 1YZ6A 2XHCA 1UVLA 3CMES 3RW6A 2M5YA 5HLFB 2DCUB 1X4BA 1XJWB 1APSA 5I42A 2CJAA 3Q0AA 4ZP6A 1WF0A 5CZXA 1NSAA 5B0GA 2XMWA 2YX1A 3BDPA 1U6BA 1SL0A 1FTCA 1ZA2B 4QCLA 2ZC3A 3S01A 4OQJA 4DR5F 1VYAA 3UN5A 3CMAS 1TFWA 1RT4A 2J0SD 5E3AA 1OWXA 3QRQA 4CLPA 4N41A 2VA2A 2D69A 3A3OB 1XNQJ 2I8EA 2DGUA 3C14A 4WWSA 4P71A 4AQYF 1IR0A 4LRAA 4CYUB 4NASA 4X4SA 2BABA 1H0HB 3P8BB 1H2UX 1LWCA 2MQLA 1AFIA 1IWGA 2LXIA 4UOFA 1FRMA 2H9ZA 4UZBA 1FT8A 3MF5A 2VZ9A 1LXJA 2YKMA 4LQ3A 1N4LA 2HS3A 2BJ1A 1H2TZ 1ACMB 5HBMB 4HH1A 2W25A 1Q8BA 1WJ9A 1SV5A 3VAGA 5F41A 1TKXA 2OMLA 1UCNA 2E9TA 1IBKJ 3G8QA 2GJ2A 2VJVA 3TAPA 1HHTP 4LF5J 2YWHA 4J5OA 1KD1T 1FWKA 4K5SA 1XR6A 3BO3A 3H5XA 5E7OB 4B9SA 1OYEA 1QSYA 1RBAA 2G1DA 2PGCA 2YNFB 4TLQA 5ADZA 1YI2S 5EX3A 3ZZZA 2K1RB 1S6OA 2DNNA 1KVIA 1U6FA 3ZZTA 2I38A 4ZLPA 3KLIB 3K8WA 2ZBPA 1FRXA 3G9CA 2V8HA 2MZRA 3N79A 5D78A 2YNHB 2YXLA 4P72A 2WONB 1DQ9A 3JQMA 3I0RB 2WVEA 4PABA 4RW7B 5DLGA 1X4AA 2N3OA 2FGCA 1R6VA 4NXNJ 4IDKA 5KFUA 5LSRA 3G8SA 2NXUA 5D4NA 2ZH4A 1GQEA 2WB4A 3TAQA 4WXWA 3BB5A 1UJ5A 3JSBA 3DOMA 1FK9B 4YDDB 4UF4A 1VGYA 5GADI 3F73A 3OUYB 2XMJA 1VFJA 3G96A 2FTRA 5HLFA 1S1UB 1OMSA 1F5BA 3PDNA 4YB1P 2GW8A 5F8MA 1RHKB 2AGOA 2E9RX 1H2VZ 2DNHA 5ITHA 1D8ZA 1S0OA 1KOHA 3HHLB 3W9IA 1URRA 1YDLA 1N52B 3GCXP 2XO7A 3GIKA 2V4QA 1RWOB 5T14A 3VZHA 1LXNA 3X1LB 1JNRB 2DHHA 1S6PB 1C0UB 3QLHB 3OVBA 3OTOJ 4F0HA 2BKNA 4O3SA 1M5KC 3VALA 4CYUA 4ZIWA 1ZPVA 2DGTA 3KG4A 4P2SA 3M7VA 4DN9A 2Q6BA 2PA3A 2XGQA 1P9YA 2ADBA 2Q1LA 1S12A 2N4CA 5CZVA 2ZH3A 3H5YA 4J9NA 2CQ2A 2VU5A 1HNVA 3J81j 1VRUA 2XZDB 5GAEU 3HD1A 4YB7A 2OI2A 1WG5A 5HL7Q 2C28A 3UVJB 5KT4A 2WZ1A 2EKYA 1PC5A 1KQKA 2AJFE 2LQ9A 4C0HA 3SSRA 2UUWA 1HPZB 4HEA9 2IVFB 3CJSA 2BJ7A 1N36J 2M8DB 3KJVB 5GVQA 2PEBA 3GTYX 1BY9A 2YNFA 4K50A 3G8TA 1QSLA 2K1RA 3CUNA 3TARA 1Y3JA 4KHRA 4OX9F 1XC9A 3IXQA 5E3RA 4PEOA 1H72C 4HI2A 4AL5A 1Q5YA 2YNHA 2VQEJ 2WONA 3OSPA 2BX6A 4AT1B 4J9LA 3I0RA 4RW7A 4EK2A 3J81U 3CGIA 4WFAQ 4NLPA 5KFBA 3PYFA 4IYQA 1TFYA 3G4SS 3DU5A 4DPOA 3Q8QB 1RKIA 3DDKA 1QAXA 4NXMJ 3H40A 3RB0A 4M5DB 4LFCJ 2UUAF 1VISA 4GVLA 4KJIA 5KG6A 2KKHA 1B7YB 3GONA 2W2OP 3DRPB 2MPUA 2A0FB 2M3DA 5B0CA 1SC6A 3MM8B 1WI6A 4JV0A 1JKHB 4DUZF 2J5AA 1FDAA 1F5AA 4CT9A 2JC0A 2PT0A 4ELUA 5EN1A 1M5SA 2CQDA 4B9NA 2JHEA 1KLNA 2JVOA 4PWUA 2V4RA 4DSLA 2CZVC 2QFIA 4DR3F 5FLXY 2G13A 1N54B 2CJYB 3HHLA 4C97A 2IM0A 1FERA 4BC7A 1XWLA 2YBVA 4B3MF 1HWIA 3HX9A 1IBCB 4M5JA 3QBCA 4DR7J 2DGSA 3QGPA 1GXLA 3IP0A 1S6PA 1C0UA 3QLHA 2E5LJ 2NXJA 3MCMA 1F9FA 4I7FA 5ETSA 4ED2A 2XLJA 3HVWA 5HN0A 2UUCF 2H4YB 5CCMA 3AXKA 3Q86A 3TYTA 2NLWA 3NMAA 5KG4A 2QMWA 5F8LA 4EU0A 2BBEA 1UW9A 1U48A 1N5SA 4JI6F 3CPWR 3I6PA 4DXLA 3JTPA 2V9KA 1YIJS 2V2ZA 1RT1A 4O3QA 1Y7PA 3UVJA 2YY3A 4IO9Q 3B4DA 1QAYA 2ZH2A 4ECUA 2XMTA 4OYOA 3HULA 2C2EA 1ZA1B 2E5GA 3CXCR 2UU9F 3BGFA 1RAEB 3ET6B 5DS7A 3CD6S 3W66A 1XK8A 2I9SA 3KJVA 2FHMA 1UFKA 1U1QA 3AAWB 2GAGC 1RDRA 3ILOA 2Z57B 3DLHA 5KTQA 3GIJA 4OZ3A 4EO8A 1XBWA 2DR6A 2RDJA 5L39A 2UV8G 1GX6A 2CQCA 1HD1A 4O4GB 2BJ8A 4G65A 5J2MB 4QR0A 2CPDA 4X62F 1NNDA 2MKHA 2DHGA 3LP1A 1NPKA 4J37A 1DBDA 2FLOA 4NLDA 1BWVA 3LUYA 5IWAJ 1UVKA 4U9RA 4DSIA 3TNVA 2B7BB 1U26A 3OHAA 4K4XA 5L1IA 2DR9A 2UXCF 3F0NA 2GQ2A 1S57A 1HNWF 4M5DA 1YWXA 3WIUA 3IRXB 2ALYB 2BJEA 1SJ3P 3B78A 1Y00A 1FFGB 4N8OA 3FC9A 3GR1A 3IBFB 2DNZA 3MM8A 4PCQA 2QEXS 3LWMA 1NDCA 3O5TB 5BYSA 2F8EX 3R5CA 1JKHA 4JI2J 1GTEA 1I3OB 1T9VA 2QLXA 3N5FA 5LM7E 5CABA 2DNPA 1HR0F 2V0NA 4WK1A 2F7VA 4F8RA 3TUIC 1GMWA 2V2KA 4JV1A 3UPFA 1HI1A 2O01C 4ER8A 2VG7B 5A0YB 2BV3A 2PI4A 2NXNA 3SCIE 3QNWB 4ENOA 2ZOGA 2H65B 3EDQB 1X7VA 4LQ9A 1D1UA 4Q43A 1U6ZA 1RYSA 2HEKA 1KR4A 2GX8A 3TEGA 2I0XA 3IFEA 2DYAA 2XYPB 2EC2A 3T5JA 2E7XA 2D9OA 3PM9A 2CA9A 3CDAA 3SQOP 3E3XA 3H5UA 1NK4A 2LMIA 1Q81T 4KH1B 2MQ8A 2DY1A 3BBFA 5RUBA 4DPWA 2FHOB 3Q2TC 1K1SA 4DR5J 4ID8A 1WORA 5KT6A 3AOAA 4B3OB 1XMOF 5HO4A 2CG4A 5L1KA 3EVOA 2YWWA 2ATCB 4CI0B 3JAMY 4F4ZA 3M2VB 4NE9C 4PG7A 1FRHA 3IR5B 4YB5A 4CLWA 1ZZFA 2VFUA 3KJQB 1P6TA 4QU6A 1RAJA 4IRKA 4WTOB 4NEZA 1S10A 1UW4A 2DRAA 2VODA 1IR2A 1NZAA 4OHVA 7FD1A 2OPPA 3HHNB 2L9DA 3RB3A 3T19A 2NZCA 1C1CA 4O4GA 4WU2A 4ED8A 2ZWPA 4USIA 2YX7A 2V2QA 4DU8A 3DLLQ 1FVSA 5C7PA 4ZHRB 4IOAQ 2HIQA 3V6KA 3THTA 4TY8B 4DV4J 2XQCA 4I56A 1FFWB 3GLJA 3UR0A 4R25A 1YRTA 5SZTA 1N5VA 1NDKA 2EG2A 1UETA 4Y2AA 2IVYA 1HYSB 3P4UB 2UVRA 4AXJA 4LRDA 4DV7F 4WK3A 2V8GA 1P27B 4DPTA 2FJWA 1SJ1A 4C8MA 5KT3A 3EPIA 4U67Q 4J9KA 2GO8A 1LFWA 5KFEA 5HAOA 3R7BB 1LNQA 3WQPA 3D1QA 5FLXU 4YHHF 4RUAA 2N82B 4NCGB 4QU7A 2R2UA 4X4QA 3BR8A 4JV2A 5I4MA 2KVQE 2EBEA 5IFMA 3EVMA 4J7CA 2K2PA 4DDFA 5D3GB 5A0YA 1V9OA 4QZVB 3DHXA 4WKRA 3DGVA 3LP2B 5LOQA 5AJ3F 2R8HA 2VBZA 1ZYQA 2YWFA 2JOQA 3H42A 2MHNA 5DG8A 2DGOA 4QWEA 2KHCA 4MKBA 2K3KA 4X66F 5HP1B 4CLYA 4RJVA 4NLTA 1HIYA 2PI5A 2VICA 5J1EB 1VOMA 5GAGI 2BKOA 1DY3A 5EHHA 4YUDA 1R8BA 5ETVA 3BQ2A 2DKOB 4DUTA 3FBEA 3U02A 1VRTB 3UO0A 3DLBA 3CCRS 3TEHB 1Y4ZB 3HHDA 1I94F 4DR1J 2KI2A 4ECZA 2IJFA 2Z58B 4NMXA 2KM8C 4B3OA 4WZQA 1CS4B 4TYBA 4X64F 2IYGA 1LK5A 1PAUB 4OI1A 3HMJG 2O5DA 3THVA 2XY7A 1A9NB 3B54A 1V3RA 1SKRA 4XPCA 2IVMA 1UJ4A 2P9GA 2RUGA 2HRYA 4X65J 3I0SB 5JJBA 5C42B 3CULA 4M5NA 3GYGA 2F8MA 2ZVIA 3OHBA 4B08A 4ZMMA 2XZTB 3MM7B 4PUOB 1RAAB 2CJXB 1X4GA 3C8YA 2VHGA 3HZGA 2VQFJ 2A18A 4KPCA 1U1NA 3NOGA 1BQNB 2Q6CA 1SH0A 2F4VJ 4LRCA 3V2UC 4BLGA 3SIPB 4ZHRA 2IBKA 2BJ9A 1GAOA 4F3QA 1OYDA 4TY8A 2IMOA 1WHVA 1S4FA 4QYZJ 2KVIA 1TKTB 4YMEA 1A0OB 2CNOB 1HYSA 4B9LA 3MR5A 2RU9A 2IPOB 3RG6A 2GMJA 1NK8A 2Z2LA 3NXZA 4N47A 2ASYA 4I1TA 2JX2A 1EETB 3LO3A 4DL0C 2CQ4A 4O0IA 1V5VA 3V6JA 2JLGA 1EB0A 1ZM9A 3JYTB 3HLUA 2RNEA 5CD4A 4NX9A 2VB6A 3BSAA 2FVPA 1RHMB 1JLEB 4TKTA 1SIWB 2FJDB 3LP2A 4HT7A 1G2EA 3D1HA 2E9ZA 5DDRC 1Q8IA 1JMTA 2V63A 1RT7B 3CE8A 4ZP9A 4NLSA 1D09B 3GFZA 1N0VC 1IKXB 5HP1A 2C3YA 4F4KA 2O1PA 1NSQA 1RWMB 1LV5A 4NA1A 3M8PB 4QIFA 3TR5A 3W8GA 2OPSB 3L4BC 3KJNB 3HVTB 2Z56B 2KZZA 2HQFA 1VRTA 2L9WA 1ELOA 2H5EA 3JAMU 3BGRB 1D9FA 3A4TA 3HXMA 1NH8A 3CWJA 3N9UC 1X9MA 4FYVB 4YY3J 3CEDA 4ANCA 4GMKA 2OEJA 1CS4A 4IH5A 4RUCA 8RUCA 5FJ4A 5THWA 1CQNA 1U7LA 3PYGA 1QDUB 3BZQA 5KT2A 4IR1A 2AT1B 4NA3A 1MLAA 4GVBB 4LFAF 4U8VA 3MDFA 3ZTQA 1CC8A 3I0SA 4KY3A 2AZ3A 2C3OA 4PG4A 3TP2A 5KFSA 1K73T 3RRHA 1N5YB 3HDSA 3M8ZA 4WFXA 4X4TA 1RAHB 4MKYA 1UZHA 4L73A 1KLMB 4PUOA 3LWLA 2LXFA 4ZVUB 4DCPB 3I56S 1S1TB 4YB6A 2MQPA 5B0DA 3OTBA 2C2OB 5KAKA 4LFBF 2ZBIA 2R7TA 4KGXB 3NOCA 2R8KA 5C2CA 2CNKB 3ISND 2XI3A 4OHZA 2VFVA 3U1LA 4DLGA 5HMXA 3IS9A 3KLHA 1QJHA 5AT1B 2YQ3A 3B6BA 1NK9A 1TKTA 3TI0A 2W7OA 3MFHA 3A8IA 4JB8B 2AYEA 4QYZK 1FXDA 3VHQA 1ZM2A 2FLLA 4S0MA 4EYHB 3JTOA 1VQLS 3DC2A 4Z37A 1JLQA 4ALZA 1EETA 3VR1A 2RD5C 2MKSA 4JI8J 1JLCB 3V4IB 2BW7A 2D41A 2GJIA 3BSOA 4DV5F 5LMNF 1RA7A 3PJ9A 2V8DA 3JYTA 5AXNA 1WHWA 3TUPA 2RQCA 4K4ZA 5AXMA 4LIWA 2PMZD 1T3OA 2GIQA 2WCXA 2CQ1A 2NPIA 5F9NA 1JLGB 1VK3A 3NKYA 5KFXA 1VQ4S 4RZRA 1RT7A 3MTJA 2H5JB 1L3KA 1TKZA 5KFDA 3UN3A 1NEEA 2ATLA 2AQ4A 1DTTB 4TQRA 3UCGA 1S6QB 3OR1B 3Q8SB 1TUWA 3BGRA 3QGIA 3ZZUA 2RF2B 3PRVA 2ZHAA 2C1EB 3VWSA 4H54A 5KOXA 3MEEB 4MKAA 2YWKA 4M5KA 2DRBA 3B4MA 5KFJA 1FWPA 2RRBA 3FSIA 4IRDA 3MMBB 2X51A 3HT0A 4USUA 3IA0A 4ECTA 3AD8C 4OI2A 2AEMA 4GVBA 2CYYA 1RTHB 2C2ZB 1U1OA 5ETNA 2R8JA 1TV6B 4TLRA 4OI6A 4C11B 1N5YA 1WOOA 3SDEB 3NBPB 4DG1B 1UP1A 1XN9A 3QMQA 2BVZA 2OLWA 4OYAA 4ZVQB 2XMAA 2OIHA 5LT5A 1KLMA 1Q5VA 2XGPA 3FMBA 4ZK7M 1KRPA 1N6QB 5IC6B 5KFWA 1EQ0A 1S1TA 4DSJA 3M6WA 4B9VA 2FJEB 3RJMB 3PVXA 3R2CJ 4HTIA 1RAGB 2EWHA 1U1RA 1CSJA 4IUFA 3DYAB 4DV3F 1DFDA 1CJTB 4F0MA 4Y2IA 2RIJA 4WYWA 2BM1A 2XC9A 5EWEA 3R9LA 1OJ4A 5C24B 4YP3A 2G2OA 2IC3B 1H7WA 4NMLA 4MYUA 2O66A 3K89A 5KFMA 3TANA 1VI7A 4DL3A 2MY7A 2HVEA 2FB0A 2ZH6A 1MWZA 1SQEA 2HNYB 3K59A 2G0JA 1PBUA 2JLFA 3D3CJ 2DB1A 3M2UB 4K2JA 3X3UA 2DEIA 1URNA 3V4IA 1JLCA 3M1VB 5DG9A 2ZJPQ 3CCUS 1RACB 2QV6A 1KVJA 1UAWA 4MJKA 4F36A 2MEWA 2CKWA 2H54B 3GJSB 3C6TB 3ZC4A 2YKNB 1WF2A 4CLUA 2Y8WA 2RILA 3F56A 4IG3B 3SXLA 5CYMB 3I9ZA 1PO6A 4KKOA 1JLGA 2EFNA 1NB2A 5F3ZA 5AXLA 5KFAA 4KFBA 2EW9A 3KXDA 2I6WA 4RNNA 2EBGA 1TZ0A 4GC6A 3NWRA 1JXVA 3OVAA 2BOPA 4LSNB 1F2HA 3FBBA 4LREA 3K5LA 3OL9A 3Q8UA 4MYTA 1S6QA 3OR1A 3H4DA 2QLBB 3JSRA 1RWKB 4L75A 1PAEX 2APOA 2HMIA 2AW0A 1R8PA 2E7WA 1UVJA 4UW2A 3AQOA 1DAXA 1N32J 1RLCL 4LBIA 2J6UA 1S6UA 3M30B 3MEEA 2G1HA 5IV4A 5F8GA 2AU0A 2XYGB 3ZZPA 4DN0A 4LRBA 1FNXH 3FEXB 2MKIA 5JUMA 4UY8T 3GPAA 4DV2F 3ITHB 4RUHA 1T94A 3W62A 1DLOB 1HWLA 2PA8D 1RTHA 3PR5B 4DL2A 4CO4A 2K7KA 2EKNA 5LSOA 1WELA 4C11A 3NBPA 4JI0F 4CQ1A 1I94J 2MSSA 4X4UA 3GE9A 4UTGA 2B5JA 2XB2D 2KT3A 1F60B 4BS2A 4ZVPB 2JJ4D 3UD4P 5KFPA 1N6QA 2BE7D 1NK7A 2ZBQA 4DLEA 3NGDA 1WKLA 5HK4A 1LWFB 3BDEA 1FVQA 1HW8A 2CVIA 3T5KA 1DHMA 3IWXA 1RWVB 3HVAA 4A8SA 1HQEB 1FD2A 2LEPA 1EP4B 3DYAA 1S49A 2W4PA 1CJTA 1UZDA 1ZBTA 1SL1A 1SJRA 4YR3A 3CW2C 4RUBA 4A8FA 4F3OA 1SL2A 4FZVA 1I1GA 4C2MA 4K4UA 4HDHA 2DR7A 2UZAA 2IC3A 1F2GA 3AJDA 1CLFA 4CO5A 2QSWA 3KMSA 1CVJA 3AXMA 1LW2B 4WTYA 4IOCQ 2C2KB 4QR2A 2ZM6J 5DO2A 2W4CA 2W9AA 3N0VA 2VPXB 2HNYA 2NSBA 3HFKA 1YRUA 3W8PA 4DR2F 3R1LA 4IQXA 3M2UA 1FDDA 4OJ1A 2IYIA 3SYZA 3M1VA 2NCKL 5BJRA 4M5HA 1NLKL 3J7YI 1L3TA 3T5HA 1VQ5S 2JFDA 2OMOA 2DHAA 4A48A 3W3SA 4R8UB 1FX2A 1BQMB 3D28A 3H25A 2AMCB 3TUJC 2YKNA 4YS2A 2DIUA 5KFKA 1BGXT 1T9TA 2CPYA 5E33A 4IG3A 5CYMA 4NCAA 4JYAJ 5JXSA 4Q7AA 2HAIA 1VQ9S 4C3LA 2CQPA 2J6SA 4KYZA 2B7CB 1FNOA 5D8HB 3HHLD 4LSNA 1YG0A 3OT9A 4GKJF 1BWEA 2HQCA 2OH2A 4ILRA 4LSZB 4QWDA 2H5IB 4P52A 1Q8KA 2V9WA 4JI4J 4QW9A 2R7WA 4IFYB 2CQ3A 4E8UA 1VQKS 1U1LA 4XDDA 4EMDA 3MFIA 2DY9A 4FS1A 1QY7A 4DV1F 2ERRA 2NUUG 4UOHA 4A8XA 4F67A 5KT7A 1NZ8A 4D3HA 4USTA 5DZ7A 4ECRA 2CIMA 3ITHA 3CCES 2DIVA 2OELA 1YRXA 5J2QB 3RBZA 3TJ8A 2OPQB 1WHXA 3A8KA 4KB7A 3CT9A 5EGYA 2ROGA 1FNMA 1FRLA 1RT6B 1N5QA 1T9YA 4PRFA 3AY0A 4ED1A 3PW2A 3GJQB 2MQMA 3DI6B 4PAAA 4IH7A 2M8HA 4RO0A 1KN6A 2V68A 4KC5A 2YH1A 1KFDA 2VKZG 1F1BB 4K0KJ 1MMDA 2NSCA 1YJTA 4WYLA 3ZTSA 1LWFA 3KHHA 2XMKA 4CTAB 1R27B 4WPAA 4UT4A 1UWBB 1EP4A 2AZ1A 4KE5A 1KQSR 4MIWA 3DRRB 3P5BP 4DS4A 4A46A 5A2QY 3RYLA 3WZ0A 4A8KA 4OI0A 4O44A 5D0HA 1CJKB 2MSTA 2KHDA 2LDYA 1T02A 4ZVOB 1RISA 1LW2A 4F0KA 1NK6A 4B9UA 1S48A 2BANB 4UQGA 1VJQA 1YJVA 2QN6B 4M95A 4X2BA 1R7IA 2ZJRQ 1HW9A 2QYGA 2GQQA 3UFCX 5IM0B 1HNZF 3K7RA 4R8UA 1WTBA 3UDCA 4JV5F 1BQMA 2KJWA 2R2SA 1FRJA 1YBUA 1XIQA 4DUYF 1S7IA 4LT6A 4EFAC 1VQ6S 4RW9B 3L7OA 2ZOFA 2IMWP 1GMWD 4ZPVR 1VDHA 4ZKAA 4NL5A 1UA0A 4NLVA 2ZHOA 5DG7A 4DCJB 3PW7A 1WEYA 1YGYA 3H0PA 2H51B 2ZBRA 4IFYA 4L6V3 1LWXA 3CIZA 4ZLJA 5GMEA 4WE1B 3OFFA 3C46A 4C7QA 4Q2LA 8ATCB 4KGKA 2XYHB 2M9KA 3GJRB 4XIUA 1SH3A 2UXBF 2M52A 1KEKA 1QVGR 1EZZB 2BW2A 5KOWA 2HQGA 2VJUA 4O3NA 2ZH1A 3PO4A 2Y8YA 2JEJA 2ZWOA 3DXSX 4V19X 1CULB 1AA1B 3UNGC 1Z4UA 4CLTA 3D0IE 2HWTA 3AD7C 4O3RA 2OPQA 4FPRA 4F7VA 4UY85 2RDIA 1H7XA 3AHPA 4Z7YA 1KTVA 2CNLB 4RW8B 3AQPA 4FYDA 3PR4A 1X5TA 1HBNB 2MTLA 4CRJA 4IQMA 4NLRA 2VBXA 1RT6A 3PX4A 4ED0A 2BQUA 3P49B 5HMZA 3K5PA 4FNHA 3DI6A 1SC4B 4IO1A 1U2CA 3GMGA 3T1HJ 4MKVA 5FIIA 5HMWA 3NS7B 4NOHA 2AYMA 4ID5B 4OZ2A 1WNEA 2HHTA 1FXRA 3ZXWA 4CTAA 2BUNA 1X0FA 3CD5A 1UWBA 4P74A 3IAM9 1U47A 3Q8PB 2XCAA 2XY5A 3DRRA 3EWGA 2R8GA 3VGVA 3ADAC 3KTQA 1NJZA 1CJKA 1X5PA 2OO4A 1S1WB 4BC9A 1KWMA 3FBFA 4U7CA 4K59A 2BANA 3FQKA 4JI3J 4A8QA 2PN6A 5KFFA 3OW2R 3GIMA 3C6UB 1PBAA 5IM0A 2V4JB 1REVB 5M2PA 1UEUA 4K8RA 1J5EJ 4M5IA 4ITSA 5DRKA 3IM8A 4ZJLA 2WB1D 1PGZA 1QE1B 1XEZA 4ZLNA 4LF9J 4N76A 3FKBA 3SQGA 2YTCA 4WZMA 2HVDA 2IFXA 4NLUA 4LSLB 3ISZA 4DL4A 5J2PB 3ICLA 3KLEA 2HHUA 3PHEA 2WW4A 2DPIA 4PXDA 2FLPA 4OJHA 3DCAA 1L5UA 3V4MA 3ZNJ1 2XLIA 3KK1B 5GAHU 3KUGA 4DV0F 2EFQA 2R7SA 5EUHA 3V6DB 2B4UA 5ETTA 2KO1A 1WKKA 3MCSA 5CD4H 4DR6J 3QYYA 3GFHA 4TVAB 3M8SA 4WE1A 1OSDA 5F0WA 2XLKA 4IFVB 3HCXA 1IM6A 4MIAA 3G6YA 1O51A 2QIFA 1Q7LB 9ATCB 2XNRA 3GFYA 2ZC4A 2ILZA 1U25A 3M05A 1CULA 1PJ6A 4U7UD 5A8KA 3HVRA 1NHKL 1C2PA 1CQMA 1MW7A 3K8VA 4AYBD 2UUBJ 3TA0A 1SKWA 1W7WA 1Q53A 4H4KC 3JS9A 1GEHA 4RW8A 4Q0BB 1HBNA 4DSKA 4KBIA 3W2WB 1OS5A 4MFBB 3SCLE 4ANEA 3OQ2A 2DPJA 4J90A 4NZ7A 1RLDA 2AIRB 2YVSA 5A2QU 3S7RA 3CJ2A 1OY6A 2VBWA 4ED4A 1TP7A 5T7LB 4F3MA 1MU2B 3CO0P 5H9FK 1RZMA 2YQ0A 2AHOB 2ILYA 4OI3A 2DTJA 1M5HA 4HACB 4TNOA 3H90A 4B3RF 1YX2A 3H2UB 1XR5A 2RQ4A 1FJGF 2QT7A 3MEDB 1W2IA 4ILMA 3QSYB 4YFUA 1VBXA 1NDPA 2V69A 2QG9B 2OFHX 3QRPA 3OL6A 3ISNC 2D3UA 1FX4A 1T9WA 4DV6F 2LP4A 4RWXA 3QWPA 3KK2B 1A7GE 1TL4A 4G1IA 3C6UA 2HVHA 1REVA 4KHPF 4ED5A 2VD3A 3IR6B 1RWPB 2F1FA 2RH3A 2Y0SD 3G87A 2EC0A 1QE1A 2R7RA 3PX0A 4E2FB 4OX6A 3BYPA 4LSLA 1PCAA 3J7AN 5J2PA 4FN5A 4W92B 3PRDA 5I3QA 1B4SA 5A8RB 2W1BA 5A76A 4A8YA 3POTB 4CLLA 4LR7A 1WG4A 3FCHA 4K7QA 4DR2J 3P3DA 1G6BA 4FXDA 4FNIA 2DO4A 3UNYA 3KK1A 2V8PA 2NREA 3P96A 4AFFA 2WAQD 2JH3A 2DD8S 2ZUAA 2LQ8A 1QTMA 1UMJA 4JBCA 3OTEA 2YWGA 4R0JA 3OFHA 3UD3P 2IM3A 4M8LA 2LEAA 5GADU 3IRWP 3H59A 3NG8A 1HI0P 1MSWD 2O3DA 2XS5A 3VAIA 4HL9A 4ZP7A 1NBEB 2HBRB 4GKJJ 4Y0FA 4ECYA 3LP0A 3BKUA 4FYWB 3M9OB 2HLUA 4EWTA 3TZWA 2EG1A 4Q0BA 3MEGB 2HGLA 1NMEB 2MJUA 3W2WA 3PY8A 1X0PA 3FGVA 4MFBA 2Z30B 4JI1F 3HHEA 5BXIA 4MK9A 5HVHA 1EJ7L 1N88A 3WIVA 3MR7A 2KDOA 5C5JA 4QBUA 3CJ3A 3IBCB 1GTHA 3HKZD 4P2FA 4P73A 3HJFA 3TA1A 4ECVA 4O3OA 3KLVA 5T7LA 4E0DA 5F9LA 1MU2A 1JJ4A 4J9RA 2A6OA 4JI5F 1KKHA 1BLUA 1S79A 3MHYA 1VR6A 1KDNA 1AUSL 5IT0A 2WVBA 1O8BA 2VL1A 2AP6A 1YKWA 2QC3A 4Q8EA 1HLWA 3AB4B 3MEDA 3LGNA 5EWFA 2B4OA 2M0GB 1MG7A 5T41A 5K9FA 3CMQA 1NJXA 4C8YA 1R3NA 2VONA 4PWDA 4CO2A 2CZ4A 3EVWA 2YX4A 2RRAA 4PYAA 3D9BA 4OI4A 5H9EJ 3AT1B 4P7VA 4K4YA 3TA2A 3KK2A 4G6VB 3D5MA 1U8SA 1FKOB 5BR8F 1QVFR 1T05B 5KFOA 4OYZA 3LGHA 4QPTA 4EI2A 3KMQA 2IHR1 3IG1B 1T3NA 2QA1A 4Y00A 2MKCA 3AD9C 1UKUA 3NRBA 3R1HA 3KOAA 3CC2S 2R7QA 1RT3B 3I9V9 4EBCA 3MXHP 3TRGA 3SV3A 1WC1A 4OYBA 5A8RA 4KV8A 2HBQB 3POTA 4QR1A 3A3NB 5B08A 3H8YA 1XNRJ 4I68A 2KG0A 5AE1A 4KPYA 4DCOB 1QSSA 1WDDA 1DTQB 2VBYA 2VOPA 1I51B 3SMZA 3AJ2A 4Y2CA 3W61A 1NH7A 3BH7B 3R97A 2KYZA 4HT5A 5DQGA 1RAFB 2F63A 4DUYJ 1V5IB 3MAHA 1BHNA 3HM9A 4ZPTR 1JWWA 2X1AA 1QAIA 1NDLA 2BKPA 1Q16B 4H4MA 2NYHA 4OZLA 3ILLA 2KXNB 4IH6A 1S9GA 5KFTA 1LFPA 2MHEA 4NA2A 4ED6A 4CWBA 3HSGA 1FCAA 2KFYA 3MUMP 4EO6A 4JI7J 4DX6A 2FVSA 1IKWB 3VAJA 4MAKA 4AD6A 2BE2B 3RBXA 2N4DA 3MEGA 4FP9A 2E1AA 4FYXB 2W9CB 2NQPA 2HS0A 3TVZA 1ZM4A 2NXCA 2RS2A 3HO1A 2WW8A 5LXYA 2HZVA 1Q7YT 3M9MB 4MK8A 3R5DA 1HNXJ 3D1OA 1KHVA 4K4VA 5K8MA 1N34F 1VBZA 1RYRA 2BJ3A 4HKQA 4I6WA 4A4JA 4IR9A 1F6TA 2NS1B 3PEHA 5E5NA 4ZOSA 1RJJA 1LKZA 1M1KT 2UVVA 3RUBL 2G4BA 3DDNA 2K06A 3M9NB 1QUPA 2CQBA 4ED7A 4FKXA 4DPYA 3K57A 5LMUJ 2M7SA 5D4PA 4ZA1A 2OD6A 2E66A 4BDPA 1WC4A 2IA6A 4B3SF 4K4SA 5D15A 3ZFVA 3PTWA 5M2UA 3H98A 2EI5A 5HJYA 1Y5LB 4C8ZA 3CD7A 3C2PA 2P2CB 2B0GA 3WC2A 1FKOA 2HWIA 3GB0A 3OJUA 1T05A 1VJWA 4FKYA 3ELHA 1VQYA 5H9EK 3ENAA 1D8YA 5K20B 4ZPDA 3IG1A 5JVGQ 1TK8A 4RR5A 1X9WA 2MKKA 1ROFA 3JSYA 5HBMA 3NL0A 4DL5A 3MPYA 4FXVA 1RT3A 4DFKA 4FXWA 1NJWA 2RT3A 4Q2MA 4F04B 2MQNA 1N33F 1SVDA 2JRSA 3KK3B 4NYPA 3KFWX 1XNQF 3MMAB 1WC5A 2E5IA 5SUHA 2RVJA 3MURP 2EPIA 3US5A 1MWYA 5F8IA 3TVKA 2OKQA 2MGZB 3KLIA 3CJ4A 4WKYA 4LIRA 4FBTA 2LQBA 2W8KA 3IBWA 1XTZA 1IQZA 1FJEB 1RHUB 2HBYB 3FRYA 3CDUA 2FJBB 1NAQA 4ERDA 4YQWA 1RABB 3HHLC 1VQMS 2CG8A 1Q78A 2HHHJ 1SUQB 3T9NA 3OXGA 3NCQA 2ZVSA 1NJYA 4ZVEA 4FVCA 2QLJB 2Z2MA 3DHWC 3TO8A 4IOBA 3GYNA 2W8LA 1IKWA 1IBKF 2E5JA 4K4TA 1C4AA 1G4CA 1X4CA 2BE2A 3RW7A 3G6ES 1TR0A 4AE5A 4LF5F 2JLEA 4OX7A 1FK9A 2W9CA 1KC8T 4USJC 3LAKA 3GSDA 4WCEQ 3OUYA 2IRUA 2ZKTA 5IZHA 3CCVS 2V50A 1HBUB 2VPYB 4DEZA 1S1UA 3NMRA 2DXDA 4O0NA 3QATA 4NLWA 2WSEC 1JLAB 3DOLB 3G82B 1WTFA 1K0TA 1VIOA 4PXBA 4OZ1A 4ZITA 1IBMJ 1HBOB 4GO5X 1CBKA 3D4JA 1IR1A 4UUXA 2FZCB 1XMQJ 1ZPWX 2VIHA 2H48B 4ZCMA 4K5RA 4DL7A 4NXNF 1AFJA 3T1YJ 4NI2B 1TL5A 5KG1A 5LJ3Y 4URGA 4HH0A 1EX8A 4YEAA 3RRGA 4PG6A 2MKJA 3SI8A 3GG1A 1F9EB 2OTJS 5HVGA 5DGBA 1UPMB 3DOKB 2KFZA 4O23A 5HI7A 1NKBA 3NGTA 2BZ2A 4WP3A 2PD1A 1UVMA 3MWBA 4RW6B 4LMZA 1YBTA 2ZNZA 4B9TA 4OYMA 3DDIA 4LVNP 3M2RB 4CLKA 3QIPB 1M90T 2FVQA 2LCWA 5E3CA 2E1PA 3I4HX 2DISA 2IRXA 3BYRA 2E1MC 1RI7A 5D0GA 1ZTWA 3FJ2A 1Q82T 3MEKA 2Q3PA 3OLBA 1SI9A 4L72B 3JTNA 3O1LA 3QJLA 1HPZA 2HRUA 2F5GA 3ZZOA 3EXYA 4Y2KA 1R0AB 1MWQA 3EE3A 4FS2A 5DLFA 3IR7B 3I4PA 3KK3A 4KHPJ 4MMOA 4OIXA 3WDOA 3OL7A 1UPPA 1FKAF 3EICA 3MMAA 2CRLA 3WX4A 3OTOF 1WKJA 2ZHBA 2WBRA 1X4EA 3GP9A 2COLA 2MGZA 1BMQB 1RQ0A 2EVZA 3QRRA 2C2RA 4A47A 4QPXA 3OVSA 1DQ8A 4USHA 2IDEA 2UXDJ 2PMWA 4CNYA 2HHQA 5IOLA 2RRNA 2DVIA 1QD1A 1VBYA 3RBDA 4NLOA 1RADB 3FVYA 3G2XA 2YWEA 1GT8A 4WFNQ 4ECSA 2X1BA 1Q4RA 5E3QA 1AW0A 3NNCA 2CQHA 1IM4A 3BR9A 2VKRA 3NGKA 3VVTA 3UCZP 3VGTA 3BM7A 6AT1B 2YKQA 4U6PA 3NNAA 4RL1A 5L1LA 3KLFB 1N36F 3CDBA 2ABYA 1WF1A 3I82A 2CJBA 2X3GA 2Y1IA 4Y34A 4ECXA 3DRPA 4GKKJ 2CPIA 4P10A 3NWGA 3OBIA 2Q43A 2D3ZA 2QMXA 2HFSA 1GMVA 4LR8A 5GAGU 4BHQA 1JLAA 1JXLA 2GV1A 3CCTA 1Q8LA 1FI4A 5KFGA 2DNMA 4PKDB 3FEZA 3W63A 1RCXB 1HBOA 5ETKA 1T03B 1VQNS 4F26A 2B9WA 1RTJB 1JLBB 4NYZA 5MAOA 1CPZA 4JI1J 3U7JA 4NI2A 4XO0A 4M5MA 5B0EA 3NEKA 2PIIA 2FJXA 2YNGB 1YVFA 4HYKA 3PW5A 4RW4B 2C22A 1AB8A 2BMBA 1N56A 1A6LA 3W9HA 4DQRA 2DNOA 3R27A 2VC0A 3DOKA 2DHXA 2DH8A 4LFCF 3TZXA 1BUXA 4V19J 4RW6A 2GAHC 3EZUA 3FK4A 1S7HA 3M2RA 3QIPA 4JOUA 4OHWA 3CCSS 4RBUA 1BXNA 3DU6A 2KJVA 3UCUP 3CJTA 3EDRB 1P9QC 1HI8A 1KNZA 4ICLB 2RSQA 3DRSB 4JUZA 2BYCA 4AQYJ 3ENQA 5M2RA 4QIWD 3ET6A 4A8WA 2JFKA 1R0AA 3GIIA 1FWLA 4DS5A 1WOSA 4DR7F 5FDLB 1SJFA 4LR9A 3L3CA 2E5LF 2ADCA 3VCDA 1RHJB 2KG1A 1FRIA 4IKAA 4LF7F 4EBEA 2BACA 2IIHA 5J2MA 2PMHA 4C3MA 6FDRA 1PG5B 1YTYA 4Q44A 1XERA 4RWWA 3EZ5A 1U2FA 3R7SB 4XDCA 1BD6A 1L3VA 5DDQC 4OYWA 5B7WA 4B17A 1R6YA 4OHXA 4I2QB 1Y9OA 3FEYB 4HHJA 4FF2A 3IRXA 1P1LA 3K5NA 2XWYA 5L9XA 2XM3A 4HR2A 2V94A 4QQBA 2HNZB 3BN7A 5LJ5Y 3HKWA 3MPUB 3N6LA 1UEVA 1QUVA 3HSJA 4TU7A 1HKAA 3M8WA 5J2NB 1KVKA 1TKXB 1YHQS 1B99A 3MMCB 4N7TA 4CO0A 2AEFA 3UI3A 3EGNA 2KRBA 2VG7A 2YPYA 3ZZYA 1G1XA 2BEFA 2GFFA 1HFEL 3GZ7A 1R0CB 2HPUA 4CLZA 1JLBA 4TN2A 4PR6A 3PW0A 2WHOA 3E51A 2BR0A 3QGGA 3QIDA 2ZD1B 3P5TL 2YKOA 2YNGA 3PEJA 1LK7A 4OJGA 4LF6F 1C0TB 1PSDA 2X1FA 2VA3A 2HHVA 4N5SA 4YOEA 2QMUB 3TX0A 1ICEB 4ECQA 1TTHB 4CT8A 2DH9A 2LEBA 1NU4A 4M94A 2KFNA 3NCRA 4FBUA 4IDKB 4JI2F 2F65A 4EZ6A 2Y1JA 2W24A 4ICLA 1HL6A 3DRSA 4OZNA 2RU3A 2MLXA 2KN4A 2CWXA 2QFJA 1R0BG 2CUYA 3M2VA 3H5SA 1R8HA 3CO9A 2H3EB 4DJBA 4DPXA 4KAIA 3KHRA 2HFOA 1OQ3A 1VC5A 2Z8QA 4CZCA 3KLGB 2HFVA 1K1QA 2EFVA 5FDLA 3L7UA 2XG8A 1TMJA 3HT3A 2YNIB 4QYRA 3NS6A 1K9MT 3HSZA 2HZCA 1T11A 1B70B 2Y1LB 1NK0A 1MNEA 2AD9A 2DNLA 2CVEA 1HARA 5U47A 4FF1A 3L09A 3K5MA 5KG2A 1RT5B 2V5HG 3BGUA 5KFZA 3VAKA 2Z2YB 4LJMA 1Q79A 1N33J 1Z1ZA 3LOUA 1WG1A 3W65A 3G6VA 1C1BB 1AT1B 4A8MP 4XTTA 3LANA 3FCVA 1KQFB 2RMLA 2D74B 4OX9J 1KHWA 2QZ8A 4I2QA 5KFCA 4OLOA 2FVRA 2NUHA 5L46A 3BS9A 1RTZA 2F4FA 3Q8RB 4P9SA 1R31A 1XMBA 1DJ0A 4TQSA 2GHWA 2HNZA 3IWLA 1PYOB 3SZ2A 1HNVB 1WWHA 1VRUB 4NRUA 3BV8A 4NCGA 2G2YA 4WF9Q 5DETA 1CC7A 3PIOQ 5J2NA 3N6MA 2F9JA 3MMCA 4OL8A 1VIXA 4AUKA 2J7WA 2JEFA 4ZVGA 2EFPA 1K8AT 5D3GA 4DPUA 1YLXA 1EARA 2LKZA 2XS7A 2UUAJ 1MMLA 3LPEA 3M8QB 4DR4F 2CJKA 3S8SA 1VCTA 2D9PA 1RHQB 4I69A 3VZIA 1RA6A 1TQLA 1WEXA 4DV4F 4KGVB 3GG0A 1H74A 4GC7A 2ZD1A 4USWA 2J76E 5F8HA 3RU0A 4DUZJ 2ACYA 2G0CA 3QT5A 2C3PA 3BPSP 5DDPC 1C0TA 2MZJA 4CLSA 1J2VA 5J1EA 3MM9B 3QT6A 2QO3A 1X5OA 1OSCA 4DQQA 3OXLA 1DRZA 4TY9A 1SKUB 2HGMA 3I5BA 3OL8A 4DR3J 1NPRA 3FRZA 1CJUB 1RU2A 2KYXA 1HHQA 4ZN1A 4B3MJ 3ZZ0A 2K3IA 1TAQA 3IGNA 4L76A 3OTDA 1UA1A 1RGVA 3C66A 2MZTA 2P5VA 3CCLS
chains in the Genus database with same CATH topology
2XSFA 3ICLA 3KLEA 2QYCA 1S76D 4C8NA 3PHEA 2HHUA 3T6JA 2KXFA 1U6ZA 1RYSA 4RU2A 2DPIA 1IBLF 4PXDA 1KR4A 2FLPA 4OJHA 2GX8A 1F0XA 3DCAA 3HPOA 2B43A 1L5UA 2I0XA 3V4MA 5MLCV 5I3UB 3IFEA 3IGVA 2VFRA 4CIOA 2XLIA 3S6EA 3KK1B 5AXKA 5C42A 3KLGA 3T5JA 2E7XA 2D9OA 4P7TA 5GAHU 2HQIA 3MPVA 3OFGA 3PM9A 3CDAA 4DV0F 3E3XA 3H5UA 2EFQA 2R7SA 5EUHA 3V6DB 2B4UA 2LMIA 1NK4A 1Q81T 2KO1A 2ZKUA 2IAJA 3OFEA 1OQ6A 3MCSA 3MM7A 1UL3A 3QYYA 4HLBA 4I6YA 3GFHA 4OFZA 3LAMA 2VPZB 3M8SA 3JB9k 2AX1A 1YITS 2YKAA 2FHOB 3Q2TC 4WE1A 1OSDA 2YNIA 5F0WA 1K1SA 2XLKA 4IFVB 6FD1A 4ID8A 2JC1A 3EUNA 1J5OB 2UVWA 4MIAA 2JEGA 3G6YA 2HNDA 5KT6A 1O51A 2JDJA 4I4BA 3MI7X 2QIFA 1Q7LB 3MECA 3PJWA 4UOCA 2MZSA 2VFSA 4KO0B 1BQNA 1TL1A 4C0OC 2CPXA 1XMOF 4B3OB 1S97A 2XNRA 4URQU 3GV8B 5HO4A 3GFYA 5A6PA 2ZC4A 2CG4A 2XS2A 2ILZA 1RT5A 3GV7B 5L1KA 4DR1F 1U25A 3M05A 2BDPA 1U09A 2J7KA 4ZPBA 1E6VB 4CI0B 3JAMY 4F4ZA 5A8KA 3BO2A 1YJ9S 2MYFA 3M2VB 1YJWS 3HVRA 4PXCA 2E1CA 1C1BA 1C2PA 5IS2A 5E2QA 1CQMA 1Z2LA 3E8OA 5D77A 1MW7A 4PG7A 3K8VA 5IQ6A 1FRHA 3CDWA 2AJ4A 2FC9A 4AYBD 2HYIB 1NKCA 2W7AA 3IR5B 4YB5A 2LYVA 2SXLA 4H4OB 3TA0A 1SKWA 1LWEB 1ZZFA 2VFUA 4I7FB 2MXYA 2HHPA 5L1JA 1Q53A 4H4KC 1P6TA 1YJUA 1NHVA 2KB2A 4QU6A 3SV4A 1RAJA 3SCKE 4RW8A 4IRKA 3UW1A 2ROPA 4QWAA 4Q0BB 4C8KA 2FJVA 1HBNA 4DSKA 2V8VA 5K8PA 1UW4A 1S10A 4J9SA 2DRAA 2VODA 3SEOA 1S0MA 1NZAA 1RWUA 3I5CA 4KBIA 4OHVA 1RTDB 3CC7S 3GQCA 4ILLA 4DHVA 3W2WB 1OS5A 4MFBB 3SCLE 7FD1A 4X65F 3OQ2A 1LOUA 2OPPA 2UUTA 4X84A 3HHNB 2DPJA 2FIUA 3MM6A 4NZ7A 2L9DA 3RB3A 3T19A 5K8OA 4LF8F 3QJJA 2ZH9A 1D9DA 1FESA 4ETXA 2I1RA 4NWBA 5DQHA 1C1CA 2DHSA 2YVSA 4O4GA 3VTIA 1VQ8S 4WU2A 1IUJA 4ED8A 1PC4A 4Y6IA 1RT1B 3S7RA 4USIA 4ELVA 1UVIA 3CJ2A 2YX7A 2BQ3A 3RAMA 1KS2A 3O3LA 2VBWA 3DLLQ 1FVSA 1TP7A 5T7LB 4EYIB 4F3MA 2K8GA 2AWZA 2R7OA 1MU2B 4D3GA 3T3FA 4ZHRB 4IOAQ 2VQFF 2HIQA 3AH6A 1M5OC 3V6KA 5IT4A 3THTA 4TY8B 2ALZA 3RB6A 4L3NA 2ILYA 4OI3A 2DTJA 2LA6A 2F4VF 1M5HA 4TNOA 3NLCA 1JLEA 4ZCIA 2C2DA 4I56A 4B3RF 2KT2A 2OFGX 4N56A 3M8QA 4F4XA 3UR0A 4R25A 1YRTA 3H2UB 5SZTA 1XR5A 2RQ4A 1N5VA 3OTCA 1HMVB 1FJGF 4Y65A 5KFLA 2EG2A 3M6VA 2QT7A 1UETA 4Y2AA 2IVYA 1HYSB 2GGPB 4RLEA 3MEDB 1W2IA 3U1MA 4HDGA 4ILMA 1OPIA 2UVRA 1QLNA 4AXJA 4IG0B 3LH2S 4DV7F 4WK3A 4OV1A 2V8GA 3UE2A 1P27B 1U45A 2FJWA 3I96A 4YFUA 1VBXA 2XWXA 3UQSA 5J1NA 1JLFB 1SJ1A 4C8MA 3TAMA 5KT3A 4O3PA 4URSA 1IKXA 4U67Q 3EPIA 4J9KA 2OFHX 5J1PA 3F44A 3M8RA 2GO8A 1N48A 1KOOA 3OL6A 1LFWA 3ISNC 2D3UA 5KFEA 4DV6F 4NZ6A 1ZAXA 4RWXA 4N77A 1DTQA 2ZDPA 3M8PA 3L7PA 4OHYA 3MM9A 3D1QA 1X5SA 3QWPA 3DLGB 5KG3A 2E29A 3VQTA 3KK2B 2PO4A 4C8LA 4YHHF 2OPSA 4RUAA 1HNIB 3CCMS 1L3UA 3HVTA 1A7GE 1TL4A 4G1IA 3C6UA 2N82B 2HVHA 4CH7A 4NCGB 2WOMB 3B82A 4QU7A 5F8NA 2R2UA 3OJSA 3G6XA 1REVA 4KHPF 4X4QA 2B3TB 3BR8A 4JV2A 2O67A 4ED5A 3LP1B 5I4MA 5E0OA 2EBEA 2VD3A 1E6YA 3IR6B 1N5YA 1DARA 5IFMA 3RAXA 2M88A 2ZUGA 3SSQA 4ZPWR 4DMZA 3TQ1A 3IWNC 2F1FA 1CG2A 2JSXA 2K2PA 2RH3A 3O44A 4DDFA 1BQXA 3MPWA 4NRTA 3SSSA 2LU2A 1R8CA 2Y0SD 2R8IA 2EC0A 2MQQA 5D3GB 5A0YA 2ZITA 1Q86T 1QE1A 1V9OA 4QZVB 2R7RA 3DHXA 2UP1A 4WKRA 3PX0A 2WSCC 3I32A 4OX6A 2Y1RI 3LP2B 1TVRB 2W4DA 5AJ3F 4LSLA 3TUZC 3DLEB 2R8HA 3L95X 3DMJA 5J2PA 2VBZA 1NK5A 4FN5A 4W92B 3PRDA 5I3QA 1ZYQA 4QJVA 2DH7A 5A8RB 2YWFA 1V3SA 2AJ1A 4A8YA 2JOQA 3POTB 2MHNA 2RS8A 2JZ5A 5DG8A 2DGOA 4QWEA 4J9QA 2KXHA 1WG4A 2KHCA 3LW5C 1XR7A 4MKBA 4I6AA 2K3KA 4C3KA 3GV5B 2HHWA 3FCHA 4X66F 1FJ7A 2BQRA 5JVHQ 3P3DA 5HP1B 2YH0A 5I3UA 1G6BA 3N28A 4FXDA 3J7Z5 2M4MA 4FNIA 2DO4A 3KK1A 3BJYA 4NLTA 2P9EA 2PI5A 1IQTA 5J1EB 1VOMA 3P96A 2NREA 4AFFA 5GAGI 3UDLA 5EHHA 2WAQD 4F50A 4YUDA 2JH3A 1XNRF 5DQIA 2DD8S 1R8BA 2R2RA 2B51A 3BQ2A 2C3UA 1SIZA 4C98A 1QTMA 4MIBA 1UMJA 4JBCA 1VRTB 3U02A 5LSLA 1AUDA 3DLBA 4Q5VA 3MOZA 3OTEA 3CCRS 4DQPA 2J9EA 5KFVA 1ZH5A 2YWGA 4R0JA 1R8AA 3OFHA 3UD3P 4C8OA 5K5MA 1Y4ZB 3HHDA 2NYIA 4KSEB 3G86A 1J5OA 1I94F 2KI2A 4DF4A 2P6TA 2IM3A 2ZDOA 4ECZA 4M8LA 2DGVA 2MY8A 2LEAA 2XMMA 2IJFA 5GADU 1VS3A 5CA5A 4KO0A 2KM8C 4KTQA 4B3OA 4WZQA 3IRWP 4TYBA 1L3SA 3RB4A 3H59A 3NG8A 4X64F 1HI0P 1U24A 2IYGA 1LK5A 3Q2SC 1MSWD 3SQGB 2O3DA 3TVYA 4PXEA 4OI1A 2YKPA 2O5DA 3HMJG 2XS5A 1FTRA 2DT9A 1E6VA 2DGQA 4RNHA 3VAIA 2HVZA 3THVA 2R7XA 4OJ3A 2XY7A 4YY3F 4HL9A 4ZP7A 4ZVHA 1A9NB 1JJHA 3KLEB 2U2FA 2VG6B 1V3RA 2JWNA 3J7YU 2KZMA 2J6TA 4Y0FA 3Q22A 4ECYA 2JVRA 2L41A 4MTPA 1SKRA 4XPCA 2IVMA 1GH8A 1HA1A 1UJ4A 2P9GA 1UFLA 3LP0A 4H4OA 5KFHA 1LWEA 2RUGA 3M9OB 2HLUA 2HRYA 4EWTA 1R89A 1QM9A 3I0SB 5JJBA 3EX7B 3KYLA 1G7CB 2D7SA 5C42B 3CULA 3IO1A 2F8MA 1VC0A 2EG1A 3SFGA 4Q0BA 3OHBA 4B08A 3MEGB 2HGLA 1R43A 5KFQA 1RTDA 4ZMMA 4JI7F 2MJUA 3MM7B 3W2WA 2KRRA 3PY8A 1X0PA 3FGVA 1RP5A 4MFBA 3CCJS 4PUOB 2L3MA 4ZDNA 4A8OA 5E41A 3D2WA 4JI1F 4RKUC 4ZS6A 3HHEA 2B9YA 1JXEA 4MK9A 1N88A 1X4GA 2KDOA 5C5JA 2MMYA 4QBUA 3CJ3A