1WHWA

Solution structure of the n-terminal rna binding domain from hypothetical protein bab23448
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
99
structure length
99
Chain Sequence
GSSGSSGSGRLFVRNLSYTSSEEDLEKLFSAYGPLSELHYPIDSLTKKPKGFAFVTFMFPEHAVKAYAEVDGQVFQGRMLHVLPSTIKKEASQSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein RIKEN CDNA 1200009A02
publication title Solution structure of the N-terminal RNA binding domain from hypothetical protein BAB23448
rcsb
source organism Mus musculus
molecule tags Rna binding protein
total genus 10
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2004-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1whwA01
2G0CA 2KG1A 3BS9A 2MKKA 1FXLA 4ERDA 1KOOA 1X4FA 5IFMA 1G2EA 1YIJS 3G8TA 2K3KA 1M5OC 4WFAQ 1WHYA 2U1AA 1U1QA 1A9NB 3UCUP 3CCUS 3OW2R 3P3DA 2CQ3A 2DH8A 2DHXA 3TP2A 5CYJA 2DHSA 2N3LA 2NZ4A 2FY1A 3VAGA 1VQ9S 1HL6A 5MLCV 1K8AT 2MKCA 3SMZA 2PEHA 1WEZA 2U2FA 4CQ1A 1X5OA 2M8HA 5D77A 2KXNB 2QFJA 4YOEA 3HHNB 2XS7A 4RU2A 4IOAQ 2HGNA 3H2VE 1VC6A 1OIAA 1Q82T 2OSQA 2D9PA 3G96A 1QM9A 2OJ3A 4ED5A 1FJEB 2X1FA 2M2BA 1WF0A 1H2VZ 2M7SA 1CVJA 1RK8A 4TLQA 4Y0FA 4TU9A 3J7YU 2M88A 1X4AA 3I55S 2F9DA 2D9OA 2CJKA 2DO4A 2DNRA 4P6QA 5LSOA 1JJ4A 1L3KA 3R27A 2EK6A 1FO1A 2X1AA 2KFYA 3VAMA 3MOJB 2FHOB 2KHCA 2CQ1A 5DDPC 2YH1A 2A3JA 4TU8A 4Y00A 2DGSA 2MGZB 1NU4A 2V94A 2CQIA 1WWHA 2YKAA 2MJUA 2YWKA 4IOCQ 2DGWA 2DIVA 3S6EA 1K73T 2LXIA 1FNXH 1OPIA 3G8SA 2G1DA 3NS5A 2DGOA 4CH0S 3CUNA 3R1LA 2VOOA 1KQSR 2DNOA 2CPYA 2B0GA 3EGZA 2AD9A 2VOPA 2MZ1A 1HD1A 1N54B 2DNMA 2RRBA 1ZH5A 2HGLA 5GVQA 1U1NA 1VQPS 2M0GB 4W92B 1Q81T 1WHXA 1D9AA 1X4CA 3B4DA 1X5SA 4WIIA 3FEYB 3MUTP 2MQPA 3VAHA 1DRZA 5JVGQ 3TYTA 2DNGA 2YTCA 1U1KA 5DETA 5FJ4A 2MSSA 2MJNA 5DM7Q 3G6ES 3SDEA 2XNQA 2HZCA 3UD3P 2CQHA 1SJ3P 2KXHA 1H2TZ 2DNLA 3DLLQ 4UY8T 2MKJA 3VALA 2OTJS 2MZQA 2CQBA 2L41A 3CMES 2CQDA 2VONA 1U1LA 1X5TA 1X4BA 1WG1A 4F02A 5IQQA 3P6YC 2GHPA 1N88A 4LMZA 2KYXA 2KT5A 2RQ4A 2UP1A 2DH7A 2DNZA 1WTBA 1S72S 3K0JA 3MI7X 3JB9k 2EK1A 2MYFA 4F26A 3EX7B 2N7CA 1VQ6S 2CPJA 2FPHX 2J0QD 4V19X 4F25A 3D2WA 3G4SS 1WG4A 3UWTA 1URNA 1B7FA 1BY9A 1WI6A 2BOPA 1SJQA 3MUMP 4FXWA 2MKSA 1VQLS 2RT3A 3P49B 4W90B 4WKRA 2WBRA 2AYEA 4UQTA 4WCEQ 2KG0A 3VAKA 2CPHA 2MQMA 2LEAA 2XSFA 1U6BA 2DGQA 2DITA 2AYMA 4IUFA 1M5KC 2AYBA 1X4DA 2KVIA 2LA6A 3ULHA 3MUVP 5ITHA 5CXTA 1FJ7A 2GO9A 2MZRA 1R8PA 4CIOA 3CCLS 3PIPQ 1WI8A 5GAGU 4Z2XA 3DXBA 4PR6A 2DNYA 2J0SD 1JJ2R 3IWNC 5CA5A 5BJRA 2M70A 2MHNA 2JX2A 5LXRA 5DDRC 2MXYA 1P1TA 2DHAA 3MURP 2ZJRQ 3Q2SC 2AYGA 3Q2TC 2CPIA 3UD4P 1VBXA 1QVGR 2JVOA 2YH0A 1U1MA 3MD1A 2MKHA 1YI2S 3SXLA 2M52A 3U1MA 1WHVA 2DO0A 2KRRA 2I38A 5DDQC 2DISA 3S7RA 3G71S 2MQLA 1UP1A 4QU7A 1A7GE 2RU3A 5GADU 3SDEB 2KM8B 3VAJA 4WF9Q 2DHGA 2E44A 2DNPA 2RS8A 2J76E 2HGMA 3NNHA 3RW7A 2KRBA 4IO9Q 3THTA 2LQ5A 2KU7A 1ZZFA 2JRSA 1FHTA 2DGUA 2L9WA 1X4EA 2MZTA 2Q79A 2MZJA 1YJ9S 3TO8A 2I2YA 1SXLA 1AUDA 2KH9A 2CQ2A 2KN4A 3VAFA 1X5PA 1VQKS 2MQQA 2CPFA 2MY8A 3NNAA 2FC8A 2JVRA 1S79A 2CPDA 4A8XA 2X1GA 2CQGA 4EGLA 3CF5Q 3CC4S 2DGXA 2RUGA 3IRWP 2LA4A 2LCWA 3LPYA 4ZKAA 4C0OC 5IM0A 4WFNQ 1VQMS 2ZJQQ 3MXHP 5D78A 2M4MA 1VQOS 2XNRA 3CD6S 1X4HA 2EVZA 2MQOA 2LKZA 3J7ZT 1VBYA 3B4MA 1N8RT 2O3DA 3U1LA 2ZJPQ 5JVHQ 2F9JA 1IQTA 1SJRA 2MB0B 2VODA 1X0FA 2DNQA 1VBZA 1YWXA 3CPWR 4CH1A 1D8ZA 1H2UX 2ERRA 1DBDA 4YB1P 3CC2S 1O0PA 3H2UB 2E5GA 1Q7YT 2CQPA 2RS2A 2MQNA 3CCJS 1WHWA 3NMRA 3CTRA 2MSTA 1HA1A 2CQ4A 1WEXA 2PE8A 2OIHA 1FJCA 1PO6A 2D3OR 4YUDA 1YJNS 3NS6A 3UCGA 5GMKa 3MDFA 1JJHA 2G4BA 3UCZP 3CCES 2QEXS 2CQCA 4BS2A 5HL7Q 2MPUA 3BEGB 1NJIT 3CCQS 1WEYA 3PIOQ 2N82B 5LXYA 1U1OA 3CXCR 4QPTA 2RRAA 2E5IA 1K9MT 1M5VC 2DGVA 1WG5A 3BO4A 4LIRA 3S01A 4C4WA 2MMYA 3CCMS 2K8GA 1U1PA 1KD1T 1M90T 1YJWS 1KC8T 1JMTA 1RKJA 2HYIB 1W2BR 2KI2A 5EN1A 2KXFA 2XS2A 1P27B 3LQVA 1VQNS 3EGNA 1OWXA 2E5JA 1DZ5A 1VC5A 2CQ0A 2OTLS 1U2FA 3CULA 3UE2A 2J8AA 2F3JA 2CPZA 2M9KA 2SXLA 2BZ2A 1WELA 3CCSS 2M8DB 1NO8A 1VQ8S 3MD3A 2RQCA 5LJ5Y 1H6KX 2L08A 2DK2A 2LMIA 2RVJA 2KM8C 5IM0B 3N9UC 4QQBA 2RNEA 1F9FA 3HI9A 1WF2A 2CPXA 3CC7S 2MZSA 2FC9A 3V4MA 2NLWA 2OSRA 5DDOC 1M1KT 4QU6A 2DB1A 3RW6A 4PRFA 5GAEU 3L3CA 2DIUA 3FEXB 4J5OA 4U67Q 3ZZZA 3VAIA 2N3OA 2XB2D 3THPA 2ADBA 3S8SA 2ADCA 4LJMA 2MKIA 1VQ5S 1OO0B 1N52B 1WF1A 2DNKA 3I56S 3G9CA 1FT8A 1Q86T 1X4GA 5LJ3Y 2LYVA 1YITS 2MY7A 1UFWA 1YHQS 2X1BA 4FXVA 4M5DB 2LXUA 4WFBQ 1HD0A 1XN9A 3CCRS 2XS5A 1R8HA 2LECA 1YTYA 4PKDB 4TU7A 4OZ1A 2CPEA 3VF0B 1SJ4P 5DM6Q 2DH9A 3CMAS 3US5A 3BO2A 1DHMA 2MGZA 5LSLA 2DNHA 1VC0A 2E5HA 1M5PC 1UW4A 5H1SV 5HO4A 3NNCA 3CCVS 4C7QA 3ZZYA 2QA4S 2LEBA 3BO3A 3R1HA 1SJFA 1QVFR 1UAWA 2JWNA 1VQ4S 4OZ0A 3P5TL 1U1RA 1PGZA 2DGTA 1VQ7S 1ZZNA 2DNNA 1U6FA 1KOHA 2HVZA 5GAHU
chains in the Genus database with same CATH superfamily
1IBKJ 3PHTA 3TX0A 4ECWA 3GLJA 2U1AA 5AE2A 4ID5A 5CYJA 1RHRB 2KHDA 4CO4A 2Z2ZA 1V3ZA 1WEZA 2F4VJ 3CMQA 3L4BC 4RU2A 5IOLA 1NKEA 2HFOA 5CD4A 4HVZA 1RWWB 1CVJA 1J2VA 2R3VA 3G2XA 4BWMA 2B4PA 1QDUB 2DNRA 1L3KA 4RNHA 1F6TA 4KGZB 2KHCA 3MEDA 2BE2A 5LT5A 1TP7A 4DV4J 2DGSA 2V94A 2CQIA 1ZM9A 3IGNA 3KJQB 1RTDA 4PG5A 4IO1A 2EBEA 2HHVA 4GVBA 2ZUAA 4U6PA 1N5SA 3EGZA 2RJZA 4P73A 3LA0A 2W2PP 1WHXA 1X4CA 3U7JA 3UPFA 2MQPA 3VAHA 5E41A 5IWAF 1MWZA 1KNZA 4KHRA 3SDEA 3M8PA 1ZAWA 4DFMA 2EFQA 2DT9A 2OTJS 2AQ4A 5LOQA 3K5LA 4ZVPB 3GJQB 1WG1A 3IM9A 3FGVA 2FVSA 1S9GB 4WPAA 1UA1A 1QUVA 2J0QD 3D2WA 3F41A 4ZVRB 2H51B 1YRUA 5JUMA 2LEPA 4BWJA 2FY8A 2WBRA 3CCTA 2YXLA 1VBKA 1AA1B 3M8QA 1P1LA 4ED0A 4HT7A 5A8WB 3F73A 2Q1LA 2HBZB 3MUVP 4A8OA 2I6WA 2HMIB 2JEJA 4RW4A 2DHAA 3MWBA 3MURP 5HN0A 2YPZA 3DOLA 5D4PA 2CZ9A 3S7RA 1MLAA 3H7HB 3G6YA 3VAJA 4DV1F 2HGMA 4LT6A 4OMFG 5F8LA 3THTA 3QSYB 2E7WA 2V2ZA 1S1UA 1GMVA 1T9YA 4OYWA 3K7RA 2BW7A 3CNQP 2MZJA 3TO8A 2OAUA 3PYGA 2A6OA 3OUYB 2MQQA 1LWFA 1XQIA 3KK3B 2GMHA 3C8YA 2MHEA 2XULA 4C11B 3PYEA 5L1IA 2Z2LA 3FC9A 3LPYA 1T3NA 3EDQB 2ZH2A 2MTLA 2BJDA 1LFWA 2E1MC 2BKNA 4PWUA 3FRYA 3DU5A 4LFBF 2WOMA 1PIEA 1IQTA 4DFPA 3POTB 4PQUB 3IAS9 1X0FA 1NDCA 2V68A 2H54B 5ETVA 4CM2A 3NMRA 3NCPA 2WVDA 2YY3A 3M9NB 4OZJA 1HNVB 3CJQA 1PO6A 3OFHA 2IA6A 3KK2A 2G4BA 1SH3A 4S0MA 1ICEB 5HANA 5ETPA 2Y1IA 1N48A 3KK1B 2RE1A 5AJ3F 3KLFA 2C2NA 1LXNA 5KFIA 1JLCA 4N47A 1KC8T 2LP4A 4DX7A 2F1FA 5HLFA 2QO3A 3M4XA 2KI2A 1BC6A 1H38A 1OY6A 2XS2A 4PWDB 1RT2B 2DR9A 4FBTA 3Q8UA 1X9SA 3ZTRA 2L08A 2MLYA 3AB2B 3K57A 1HNIA 3MAAA 3HI9A 2YNGB 2I0XA 1XNRJ 4D3HA 4NLPA 2YQ3A 3L3CA 4PZVA 3ZZZA 3M2UB 3NEKA 5HBMA 1HI0P 2ADCA 4LJMA 5KFFA 1TMJA 1IXKA 1NB2A 4QIWD 4TNOA 1D9DA 2YWHA 3ILLA 4P75A 1QLNA 5K8NA 2X1BA 2BE9B 3KNGA 1YTYA 2K1RB 1RHKB 3ZZ0A 1HNXJ 4I1TA 3MR5A 2DNHA 3RTVA 4C3LA 1RT1A 2VICA 2QA4S 1C0TB 4ECQA 3HK2A 2P9GA 2JWNA 2DGTA 1U6FA 3A3PB 2BJ1A 3VWSA 4O44B 3T41A 2HQFA 1Q8BA 4RUAA 1H3DA 4UW2A 3TEHB 1X4FA 5L1KA 2WSEC 5C2GA 2LQJA 2QIFA 4J91A 1BE4A 4DPWA 3M30A 3F44A 5ETNA 1B64A 2F8HA 2VFVA 1NAQA 2KXNB 5HI7A 4IOAQ 2HGNA 3ZZOA 3HFZB 3H40A 4X64J 2M7SA 4TLQA 4Y0FA 1X4AA 4F4ZA 2X1AA 3VAMA 4CO5A 2IVFB 4WYLA 4I4BA 3PX4A 1HNWJ 2VG6B 1MNEA 5D0RA 4TU8A 4DV2F 2GS8A 2YKAA 3HD2A 1MN7A 3NS5A 3KNAA 1IKYA 1RTJA 3MM9B 1MMDA 4P9SA 4K5SA 3KMQA 3QRQA 4DS5A 1ZAXA 1UVLA 2WVEA 3KLHA 4ED2A 2Y8YA 1IKXA 1TKXA 5AE3A 2OMLA 2CADA 4B02A 1CQNA 4OV1A 1PBAA 3K89A 1TV6A 2AX1A 3W8PA 3T19A 3PJWA 1RAAB 2ZE2B 4OYPA 1QAXA 2MZQA 2VZ9A 4M5MA 1RISA 4K4SA 2HSEB 1WKLA 2XLKA 1N56A 1N0UA 5HMXA 3RBEA 2RQ4A 2FTRA 7AT1B 5HSPA 2MYFA 2CNOB 2B3TB 4B9SA 3PW2A 2I9SA 2C42A 4DN0A 5C5JA 1WI6A 2BOPA 4DSEA 2C2ZB 1U2CA 1W25A 2CJQA 1AUSL 3BDEA 5KFHA 4IUFA 2AYBA 2NXCA 3ULHA 1BMQB 4OX8A 4DF4A 2Q43A 1I6JA 4TQRA 2YQ1A 2QX0A 4JOUA 3QWUA 3UD5A 3O5TB 5DDRC 4WZMA 3Q2TC 3M2VB 2HHSA 1X7VA 5FDLA 4WZQA 3TZZA 4F4WA 1A7GE 4I2PB 3GCWP 1WSRA 2YNHB 4WF9Q 2L9WA 2ZD1A 4K2JA 2WVBA 2NS1B 5I42B 4QWAA 1Q5VA 3PO4A 2HURA 2V8HA 3X1LB 4DQIA 2GA7A 3DRYA 4C8NA 3LTOA 2FC8A 1Q0NA 2QA4G 3HHLA 4ZVOB 2DGXA 3D67A 1RT5A 4MYTA 2Z4PA 2ZJQQ 4NWBA 5D78A 3QIPB 2EC0A 3SBMA 1NB7A 1QJHA 4JV0A 1GX6A 2EVZA 1HMVB 3L9ZA 4N77A 4J9UE 4NLDA 3UDVA 3GYGA 4XDDA 4WP8A 4K7QA 4JI8J 2VODA 2DNQA 3LANA 4EFAC 1G1XA 2G2ZA 4KKOA 3MM5A 5KG0A 2RS2A 2VC1A 5CYMB 3MDFA 4OYXA 2ROPA 3A13A 3C6UB 4DX6A 6FD1A 2AF6A 4USTA 2HHQA 4HDHA 3PIOQ 2J9DE 3KUEA 4CYUB 4WTOB 3W61A 3P4UB 3OR2B 3ISND 3ETMA 2R7TA 3KWMA 5B09A 4M5JA 3NGKA 2CPZA 4DPXA 2CDRB 4NLRA 1BQNB 2W8LA 3B78A 4RW8A 3LWMA 2V8DA 4QQBA 2P8IA 2C22A 1LFPA 4A8FA 3OD2A 1VQSA 3LUYA 2I1RA 3GJTB 5DDOC 4D3GA 3HM9A 4C8ZA 3TW0A 4B3OA 3FEXB 1DTQB 2N3OA 2R7QA 4GC7A 3R5DA 2OEMA 2DR5A 3Q83A 4C0BA 1Q4RA 4ZN3A 1U0HA 2X3GA 2LYVA 1QY7A 2W01A 4URQU 2HG4A 4DUYF 1TKDA 1WOOA 2QMXA 3PFEA 3CMAS 4DL0C 1X60A 1QE1A 3BBBA 2YWGA 2UV8G 3EUNA 3MTJA 1X0PA 4KO0A 4X62J 2Q6BA 2AW0A 4OZ0A 1JLQA 4CH7A 3T5LA 4EZ9A 4OI0A 3M1VA 2KT2A 1REVA 1YJRA 4NA1A 2OD4A 2VFSA 3OQ2A 1X9MA 3ENWA 4ERDA 1JXEA 4ZPBA 1OY9A 3JAMU 1JLEB 1S9EB 2J5AA 4PUOB 1EQMA 2NZCA 1N5VA 4FF4A 3I31A 1MSWD 2E1RA 3OXLA 1AROP 2AEJA 4ZPTR 4YB7A 5L46A 4U7UK 1RSCA 4Q43A 1B99A 1RU2A 3J7YI 1RADB 2HK3A 2PIIA 2Z0GA 1UVNA 4DUZJ 2JL9A 4J9MA 1J5EF 1RWVB 4B9NA 5IT4A 3G8QA 5C42B 1U7LA 2JC0A 3TWZA 2HHXA 3SEOA 2A6MA 2C2RA 1RB0A 4OI2A 3R5BA 1FVQA 2KJVA 1FEHA 3UFCX 2IMOA 4ZJQA 5A8RB 2PI4A 1FNXH 3G8SA 4ZMMA 2GVDB 2DNOA 3BM7A 3I0RA 3BGRB 3DDKA 2B0GA 4OYOA 1EETA 5IC4B 3BV8A 4JI4J 3NGSA 4DG1A 3UVJB 2JFDA 3FEYB 1YGYA 4E8UA 2V67A 1BQXA 1NKBA 1TAUA 1CJVB 3V6JA 2RD5C 3CDUA 1G6BA 2VG7A 2VH7A 3KLIA 1RI7A 3NWGA 1ZPWX 4LMZA 3NKYA 3JS9A 2UP1A 3SYZA 2DCLA 3K0JA 3PKMA 2CPJA 3QT8A 3OVSA 3UWTA 3W5YA 3D3CJ 4JYAF 3E01B 3PW0A 1KDNA 2AYEA 4L75A 1AW0A 3SCLE 4H4KC 1DJ0A 3FRZA 3FSIA 3J81U 4XDCA 2KVIA 1IR1A 4RO0A 2Q6CA 4CIOA 1OQ3A 2K2PA 2YX1A 2GIRA 2J0SD 2XBPA 2AZ3A 3CEDA 2JDJA 1NDKA 4JI3J 1V3RA 1ITPA 4ECVA 5GADU 2ZH6A 4DQPA 3RW7A 3DDNA 1IR0A 5L1JA 3BKFA 1IVZA 2BX6A 5D3GA 1V9OA 2NXNA 2IM1A 2R8KA 2WRMA 1UL3A 4MMOA 2PDAA 3PYFA 1GXLA 1FDDA 4Z7CA 4LF9J 5IV3A 3OVAA 1FESA 3CWJA 3A8IA 4NLYA 3CO9A 3DLGB 5CHCB 2PI5A 2DR7A 4QIEA 3B4MA 1N8RT 4QJVA 4C8LA 5F8NA 2XYHB 2ZBPA 4DQRA 5E3PA 4NEZA 2WW8A 2VQEJ 4YB1P 1O0PA 1P6TA 2E5GA 3T1AA 1Q7YT 3W7BA 3CCJS 1K0VA 4E2FB 1OMSA 1YJNS 3QNWB 3W65A 3UCZP 1SC1B 3A1YG 4ZLJA 3KUGA 2PD1A 1YDLA 1L3VA 2R8IA 5HROA 4Y34A 5KFXA 5G0RA 3B6BA 5F0WA 3CCMS 1KN6A 1S1XA 1V5IB 1IBLF 2XHCA 2CQ0A 3MPUB 1HPZB 4LFAJ 2M9KA 4OHYA 3KLEA 4OI1A 1T9UA 2DYAA 3V4IB 1FRJA 5K5MA 1OQ6A 1TK8A 4C0HA 4ZHRA 1ULRA 3RRKA 4WE1A 3BQ0A 1N36F 4P72A 3H5XA 1MMNA 2R9LA 3GPAA 2IIHA 3ET6A 2COLA 5BYQA 2XB2D 5FLXU 4LF5F 1TVRA 2OD6A 3CJ8A 3GG1A 5C2CA 1XMOJ 3KDOA 1KHVA 3V6DB 2OFGX 4NI2A 4XTTA 1M5SA 4Y2IA 1VISA 2FVPA 4M5DB 1XMBA 3H42A 4DZ6A 3KLGA 3J7Z5 4QPXA 3RB6A 2OPRB 1Q1KA 5I3UA 1SKSA 3NCQA 5HO4A 2P6TA 2QMWA 1GH8A 4LRDA 5KG4A 3M8YA 1JJCB 3KMSA 4GKKF 1PGZA 3AD7C 1FXLA 4DOZA 3D6TB 2JLGA 2ZBCA 1WACA 5IS2A 1J5OA 3Q8SB 4AYBD 4B3SF 2XZWA 2QRRA 2E7VA 3OW2R 4N8OA 1LXJA 4LSNB 3AXKA 1HBNA 4Y6IA 4DL3A 3EE3A 3VAGA 1HW8A 4ELTA 2M8HA 2PC6A 4JB8B 1NLKL 3OSPA 2XSJB 1FRKA 1WF0A 2XO6A 4GRSA 2F9DA 4WTYA 4KGKA 1JLAA 3V81B 3IC1A 1FO1A 2HS4A 1WOPA 4ECYA 1SH2A 3TZYA 3HXMA 1Y5LB 2C2DA 2A10A 2OPPA 4GKJF 2HHTA 3M8RA 2B4UA 4L73A 3I87A 3D5MA 4I7FB 3EYZA 1N54B 1VGYA 2DNMA 1ZH5A 3VR1A 4DX5A 4CLWA 1W2IA 3TYTA 2DNGA 2Y0BB 4A47A 5A0YA 5ETTA 1NK6A 2IRYA 4M63A 1C1CA 2L41A 2NYIA 3FZ2A 1E6YA 2UU9F 2HFZA 1N88A 5HP1B 1FDBA 2WONA 4KBIA 4RNNA 1RWKB 3GU0A 4DV3J 3MI7X 4E98A 4X65F 3GIJA 4V19X 1FERA 2ZBRA 1FRIA 1FK9B 3AHPA 4X4SA 2AGOA 4ZLLA 2XSFA 1EP4B 1U6BA 3P45B 3CDBA 1WC5A 5CXTA 3CCLS 3DLBA 1V5VA 2I8EA 3NOCA 3AB4B 4CI0B 4CO0A 1BWEA 1LWEB 2MKHA 3QATA 3SXLA 4XIUA 3MPDA 4P7VA 3NBPA 1HW9A 1XR5A 3G71S 1HWLA 3D6FB 5D4OA 2E44A 2ZKUA 4LVOP 2J76E 1RHJB 2CWXA 1SQGA 2GVZB 2V63A 1T03B 3MMBB 3IAM9 1X4EA 1YJ9S 1DY3A 4DV7J 3VAFA 5D4NA 4DN9A 3LW5C 3OTOF 4NLGA 1S12A 3FBCA 2VHGA 4AQYJ 2CIMA 3ILIA 3CF5Q 2RUGA 4R5PA 4UY85 5KG6A 3MXHP 4TKTA 3CJKB 3Q8QB 4FNHA 1RT4B 1S4EA 4AXJA 2LKZA 1FTCA 1JXVA 3QQCD 2GCFA 4QIGA 3CPWR 1HHTP 2O01C 3EZ5A 4A8MP 4ES1A 1WHWA 1C4AA 5GMKa 3KFWX 4F3QA 3KLVA 5ETSA 1ZA2B 4C4WA 5IXUA 4NOHA 1M90T 4EU0A 4KV8A 2HYIB 4RWWA 1UTAA 4JI7F 1WTFA 2KO1A 3ZNUA 3CGIA 1TTHB 1OPZA 2OGUA 1CQMA 1SH0A 4OX7A 2Q66A 3TAMA 1KTQA 4LQ3A 3O6QA 3I9V9 1K0TA 4NXMJ 4NRUA 1R8CA 2RNEA 4JP8A 4ZN1A 1ZA1B 1AFIA 2BE7D 3DC2A 5J2MB 2FC9A 3FCHA 4FN5A 4PRFA 1HBOA 4U67Q 2ACMA 4XAKA 3R9LA 3T6JA 3S8SA 4IFVA 1UKUA 1IWGA 3TA0A 1OO0B 4JI5J 3HJFA 3DRPA 2AT1B 4NL5A 3G9CA 1Q86T 1X4GA 3ENAA 2KZZA 2YKNA 5E3RA 1YHQS 3TVYA 4B3TJ 3FKBA 4IDKA 3VVTA 5LL6d 4KH0B 4J9KA 3QO9A 3DYAB 5KFOA 3R5JB 5F9NA 2KG1A 3FFIB 4I6AA 4NXNJ 2HVDA 4OZ2A 1RAIB 2HNDB 2P6SA 4C3MA 5IFMA 3A12A 3R7BB 2K3KA 1M5OC 3DLEB 1AFJA 3QRRA 3ZO7A 1R0AA 1C0UA 3OXGA 4J9LA 2RILA 3GONA 2HK2A 1HL6A 2NXUA 4NLTA 1Q7LB 5GMEA 1YRXA 2OSQA 1RYSA 4YP3A 1URRA 4X4OA 4X4VA 2HHHJ 5F41A 2EK6A 5C25B 1BGXT 2H48B 4UOGA 5BXIA 4LF8J 3HD1A 2XMAA 3DGPA 3QSIA 3WDOA 3CJ2A 3HLUA 2FHJA 2E9RX 1Y3JA 2AWZA 2LXIA 2AJ2A 1N4LA 4C8KA 1G7CB 4KPCA 1FJGF 1NJWA 3RB3A 4USMA 2OEKA 2B4OA 3JSMA 1U1NA 4DBQA 3H5SA 2NYHA 3OL7A 4OX9F 3OTDA 4DEZA 1KKHA 5DM7Q 4ID5B 3ZC4A 2HQGA 3UD3P 2MKJA 1CS4A 2ILYA 3CDAA 4IFYA 2E5LJ 3M7VA 3FQLA 4MT1A 2QL9B 5KG2A 4PG7A 2KT5A 1TL1A 1WOSA 1S72S 4ZP7A 4RW7A 4DWIA 2KJWA 1HI8A 3LP1A 2F4VF 2HAFA 1N0VC 2BE2B 3N5BA 1QSSA 2R7WA 3UN5A 1VDHA 3TI0A 2LEAA 4KJIA 1SCJB 4CP5A 3RR7A 1RTDB 1KQGB 2GZOA 1RAFB 3GSDA 3AT1B 1HR0F 1LQ9A 4FZVA 4GVBB 3DXBA 1L3TA 3W2VA 2Y3YA 5CA5A 2PT0A 1Y3KA 4FYVB 1RDRA 2ZH8A 2KRRA 3JAMY 2Y0SD 1EARA 4MIBA 1FWPA 3NL0A 5SZTA 3SDEB 1SC4B 1HYSA 5H9EK 3M8PB 4FYYB 3UR0A 1FA0A 1VRUA 5AXNA 1Y9OA 3TARA 1LW2A 3SSQA 2JEIA 2C3YA 2I2YA 2CAJA 3GSIA 1RWNB 3HP6A 1VQKS 2OKQA 1HQEA 4M5IA 2UUAF 4CO2A 1S79A 2X1GA 3EXCX 5KT3A 4A46A 2W9AA 3CC4S 1FKOA 1IWAA 1KR4A 4ZKAA 4JV5F 1MN9A 4OYBA 2M4MA 4Z37A 3M8QB 3H59A 1O8BA 4RLEA 2XMWA 3W63A 2M3DA 1GAOA 1SL1A 4J9VA 2FYXA 4MKBA 4ECUA 3R6LB 3QWPA 3K8VA 2FLLA 4RW4B 4WP9A 2RMLA 2BJEA 1R6YA 1S6OA 1WKJA 3H2UB 2DY1A 3VQSA 3DOLB 2D69A 2CQ4A 3O2IA 1PC5A 2FJVA 1FJCA 2AZ1A 5KFZA 1OYEA 3FCWA 1UW9A 1PILA 3OR1A 2J7WA 2RRAA 2RDIA 1M5VC 1S1UB 1NXIA 1KD1T 4UT4A 3A8JA 2E66A 3VGVA 2W4DA 4ED4A 2KXFA 2V4JA 3GIIA 1LWFB 3CULA 2QG9B 3QJLA 2CVEA 3WC2A 1XBWA 5FD1A 2ILZA 4MIWA 3N9UC 4JI2F 3ITHA 2IM2A 5IC6B 3J81Y 3BR9A 5DQHA 5ETLA 4DPTA 2WOMB 5KG7A 4DL6A 5BYRA 2Y1JA 3KHHA 5KFBA 1DLOA 4H4OA 1I94J 2FZKB 3K5MA 3M8WA 2JEFA 5LJ3Y 3EVMA 4ZVTB 5J2QA 2CZVC 3B54A 4WFYA 2LDIA 3R5AA 3KK2B 5B0AA 1XN9A 2ZOMA 2H5EA 3C16A 3VF0B 5DM6Q 2DH9A 2EWHA 2UXBJ 3BO2A 1CEZA 4RU9A 3KLFB 4B9LA 4KB7A 2YNIA 1JLCB 2J9CA 5HLFB 4IH6A 2UXCJ 4XK8C 1HNZJ 3R2DJ 1PBUA 9ATCB 1VQ7S 1FI4A 2YKPA 3PRVA 5GAHU 1NPPA 3BS9A 4ED8A 1SC6A 1U09A 1TFYA 5EWGA 1HNIB 3MAAB 4IR1A 3UCUP 1D0EA 6FDRA 4MK8A 3T5JA 2CQ3A 4QOTA 1YKWA 2W9CA 1SPBP 2DHSA 2FGOA 3TZWA 2GGPA 2PA8D 2E1PA 5HBMB 1JLFA 3H2VE 1VRTA 2D9PA 1OSCA 1FJEB 1H2VZ 2MDAA 1R7IA 4B9UA 4N56A 2KFYA 2BVZA 3A8EA 3AQOA 4WK1A 3D9BA 2F40A 3QRPA 1YJTA 3T1HJ 5E3AA 1Q16B 3DHXA 1RT1B 2PGCA 3D0GE 3S6EA 4AT1B 3MGJA 2EFGA 3MPVA 2CKWA 5AT1B 2XMVA 4YR0A 2ROGA 4DMZA 3WC0A 5L8RC 2JNJA 4TY8A 5EX0A 4J7CA 4USKA 4RW6A 1F3FA 2ZH1A 5FJ4A 3FUYA 1RP5A 2XTJP 2RUSA 2IVMA 3PACA 3V5RA 2O66A 3H2LA 4ITSA 2XLJA 2B56A 5FLXY 1X4BA 4MK9A 4QR0A 3CJRA 1IR2A 1KS2A 3NXZA 2DNZA 1PKUA 4FBUA 4LF1A 4IQXA 1CJKA 4NX9A 4ZVQB 1CJUA 4OZ3A 2BKPA 3KTQA 4HTJA 4WKYA 3PW7A 2DITA 5T7LA 3NWRA 3HSJA 3TUZC 1S0OA 2GO9A 2MZRA 1S1VA 1U8SA 4A4JA 1IKYB 3W60A 1HNWF 1NZ8A 1Y5NB 5DGAA 2M70A 3LGNA 3KLHB 5THWA 3BPDA 4MYUA 3Q2SC 2RU9A 2CJXB 3NAHA 1VBXA 3GFXA 1QVGR 4ZPCA 3OL8A 1IKXB 3MD1A 1TKXB 2ZZMA 2O5DA 5E2QA 3GIRA 1TV6B 3G87A 5I3QA 5A8WA 4UOHA 3DGVA 3VCDA 2KRBA 2BBEA 3FSYA 3F56A 2W7PA 4LBPA 2JRSA 2EXUA 4K4TA 2YX4A 3CJ0A 3HVAA 3LP2A 2OEJA 1IKVB 2Z30B 3IBCB 2HRUA 3DHWC 4C6AA 3ZZRA 2EPIA 2CPFA 4CLLA 3FBBA 3EZUA 3FCVA 4A8XA 2YKQA 1BQMA 3QJPA 4ETZA 3OHBA 3I4HX 4DHVA 1VQMS 3I0SA 4LF2A 3OL6A 1N33F 1VS3A 3CD6S 4F7VA 3JQMA 4QYZJ 1U4BA 5HAOA 3ZZTA 1VBYA 3OUYA 4M8LA 1SJRA 2MB0B 2XMTA 1VBZA 4KRWA 5KT5A 1VHFA 3ETOA 3BQ2A 5FDLB 3T5KA 2HHWA 3ICLA 4KGVB 3L7PA 3GMGA 2HBQB 3CCZA 3KYLA 5LXYA 1R89A 1P8GA 2DGVA 1RAGB 2ZD1B 1RZMA 3POTA 2AEMA 4YR2A 2G9OA 5AJ3J 2PEBA 4NLUA 2PMHA 1U2FA 2ZHBA 1S9FA 5DQIA 2K06A 4Q2LA 1HKAA 2HAIA 1SV5A 3CIZA 1HQUA 1H6KX 1RT5B 3M32B 1F9HA 3AJDA 3DRRA 2ZZNA 2GX8A 2J6TA 2G1HA 1JIHA 1UEUA 2LU2A 1O5JA 3C14A 4FF3A 4FYDA 2MKIA 2ABYA 2N4DA 2LDYA 2ZNYA 4K5RA 2EFVA 1I1GA 1Y11A 1MU2A 4F4YA 4KKOB 2HVEA 2Q3PA 3ILJA 4DQSA 4I67A 3FK4A 5ADZA 1PYOB 4KAIA 4OZ1A 4Y28C 1SJ4P 2FDNA 1DHMA 4MIAA 1TELA 3N6LA 1M5PC 1N32F 3RBDA 4DFJA 3KJFB 3ZZYA 1XERA 1QVFR 3O8WA 1VQ4S 3HT3A 1RT3A 3P5TL 3PO5A 1KOHA 2V34A 1SVDA 1FD8A 4N5SA 4RW8B 1TK0A 1TR0A 1NSKL 2DRDA 1HHQA 2YX7A 4O3SA 2UUTA 3RRGA 3L09A 4B3OB 5KFKA 4K4XA 5EWEA 1U45A 1X5OA 5D77A 5KFJA 2BQUA 4YOEA 5GAGI 2AJ1A 4O44A 3PCOB 2X3DA 2HRTA 1JLGA 1U0HB 3I55S 3JQJA 1VMBA 4TXSA 2VDIA 5DZ6A 5D6GA 4ECSA 3W9JA 3BYPA 4USWA 5D0EA 4M1KA 1QE1B 1NHKL 3UO0A 1WDDA 1WWHA 2MJUA 1D9FA 2OPQA 1K73T 3PKYA 2RRNA 3RR8A 4DV2J 3CUNA 2D3O1 1KQSR 2XYGB 1JLQB 2CPYA 1KONA 1UVIA 1G4CA 2AD9A 2QZ8A 3M1VB 1REVB 2IM0A 3SCKE 2LU1A 4HI2A 4K59A 4K4VA 2OP5A 1X5SA 3DOKB 3Q8RB 5DQGA 3KUHA 1UCNA 1RTIA 4DJBA 4F67A 2HZCA 4NCAA 1IQZA 1Y7PA 1DURA 2AJ0A 3MR6A 3HVRA 2GQCA 4FNIA 3PNIA 3R7NB 1X5TA 1XR6A 2WZ1A 4F02A 2W24A 1JB0C 4MKAA 4EUVA 2VQFF 4TLRA 4ZITA 2QJ3A 2VA3A 4R25A 3EVWA 4NYPA 3N6MA 1SJQA 1RAEB 3HO1A 2C3PA 4FXWA 3UN2A 4CRJA 2XMKA 2QLBB 5IZHA 2KFZA 2CPHA 4DUZF 3MOZA 4NYZA 5I4MA 2HS3A 3W3SA 3BN7A 3QT5A 4C8OA 1XWLA 3I6PA 4X2BA 2HQDA 2KTQA 3I0RB 3PY8A 2OFHX 3IR7B 2WB1D 1EETB 4DCJB 2GAHC 5J2PA 3NAIA 1YI2S 4DG1B 2FD2A 1YQHA 3AQPA 3U1MA 1WHVA 2R7XA 2JEGA 3ENQA 4ZCKA 5KFLA 2YWEA 4USJC 1LEOA 3PW5A 4JI4F 2KU7A 2PA3A 2VG7B 3E51A 3KLIB 2Q79A 5G4DA 2D3UA 1NSPA 2KH9A 3BBCA 3KJVB 4DLEA 1G3OA 4KE5A 2MY8A 1MG7A 5M2PA 1WC4A 1RTHA 2LQBA 3R6GB 3MEKA 2P9CA 3IRWP 1QD1A 4LIWA 2ZUGA 4X4TA 3R8YA 4QCLA 4M5HA 4FF1A 2E29A 2D74B 3R2CJ 1AYEA 2BANA 1F5CA 3JSBA 4OJGA 5HMZA 1WD6A 1GMWD 2XHWA 3M6VA 4O3OA 3OFFA 2HBRB 4M5KA 4YUDA 3HMJG 1Z4UA 4OZLA 3M9OB 1KLMA 3KHLA 4NEYA 3M8SA 3GCXP 5HL7Q 4RPFA 2W9BA 4DR7J 2HVIA 3IBWA 5J2NA 1Q5YA 4PYAA 4LIRA 2G0IA 5D3GB 3SZ2A 5J1EA 2HLUA 3T1YJ 2RHSB 1F3VA 2I5JA 3EGNA 1YK9A 4HKQA 3IGVA 5B7WA 2RAQA 1T3OA 1ZM2A 2HWHA 3MD3A 3MPWA 5LJ5Y 4FS2A 4F2SA 2KM8C 2J7KA 2DEIA 2FJWA 4KHPF 3KJNB 1WC3A 3T9ZA 1RA7A 1HBUA 1S6PA 4RBVA 3LPEA 4J5OA 3UR3C 3AH6A 3AA8A 1VQ5S 2VKRA 2NSCA 3I56S 1RYRA 2XI3A 3CJTA 1XJWB 4Q44A 4ES3A 1SBRA 2JH3A 2EC2A 1S59A 4LF4J 4UOCA 4TU7A 1VYAA 5HROB 3UDLA 3VGTA 5G0RB 1YBUA 2C3UA 3CCVS 1CSJA 4DLGA 1S1XB 3R1HA 2XWYA 1T0TV 2WVCA 1C2PA 2H5IB 4PCQA 3CDEA 3BREA 2JZ5A 3QLHA 4E0DA 3KLEB 4C3KA 1YIJS 3G8TA 4M5LA 4ZHRB 4CLZA 1GT8A 1TL5A 2OUGA 2NQPA 2FJBB 2VIHA 2M5YA 1MMLA 2DH8A 4LFAF 1D1UA 2FY1A 4NA2A 3U27A 3LAKA 2PEHA 1R31A 3EMTA 3W66A 4LREA 1TVRB 4DSKA 3Q89A 1ZBTA 3PXGa 4TU9A 3IS9A 1WKKA 5LSOA 5L39A 2XMMA 1R8AA 3KLGB 3NGRA 5DDPC 2R2UA 1J5EJ 3IP0A 2B4VA 5I3UB 1YVFA 2DIVA 3QAEA 2G1DA 2ZH7A 1DTTA 5ETRA 2XO7A 1FFGB 1R3NA 1JKHA 3GTYX 4CCHA 3RRHA 4OQJA 4L3NA 3MMJA 2AV5A 2NSBA 4OZNA 2HGLA 4DSLA 1D9AA 2EG2A 3MM6A 4ECZA 1J5OB 1TL4A 5K8MA 3QT7A 4I56A 4CLYA 4HR2A 5L38A 4KTQA 1EZZB 3JTPA 2CQHA 1HBNB 2HW3A 2GVDA 1M1HA 3CMES 2CQDA 2UXDF 4FKXA 1GXUA 4A8SA 4XPCA 4ZIVA 1RABB 1TK5A 3IG1B 5EGYA 5JXSA 1PAUB 4YEAA 1F2GA 1VQ6S 1JLAB 3B82A 5U47A 2FB0A 3HVTA 2CJAA 1CJVA 3OV7A 1SQEA 2KL8A 2MKSA 2RT3A 1YBAA 2ZH4A 2KG0A 2OPPB 1CJTA 4JYAJ 2FLOA 2V6AA 3FJ2A 5ITHA 3GILA 4K0KF 1NRKA 2XGQA 1A6LA 5GAGU 3FDSA 3D66A 2KKHA 2QSWA 2I38A 3C19A 2QL7B 1UP1A 2BABA 2GHVC 5A0YB 3LAMA 3CIMA 1C1CB 2RF2A 2X7IA 5GAEI 1NJYA 3GFHA 2DPJA 5K14A 5KT7A 3HSDA 4YFUA 1E6YB 1SXLA 4UTGA 2MEWA 4CLKA 4LRFA 2WONB 1QAIA 2QN6B 3I5AA 2QV6A 2FVQA 3CB4A 3GV5B 5IT0A 3AODA 1NHVA 2ZVSA 3TA1A 1D09B 5ETOA 5K9FA 4HI1A 2Z8QA 4ZA1A 4L74A 3IN5A 2OHDA 3SV4A 3WIUA 2XNRA 1RT6A 3TJAA 3R5GA 3HKWA 2MQOA 3J7ZT 2O3DA 1B0PA 4DL4A 2VDHA 3BKTA 2D1CA 4JI1J 1D8ZA 1GFWB 3BGLA 3OFGA 2CQPA 1U26A 1VLOA 4N8NA 1DQ8A 2PSZA 4NA3A 1RAJA 4X4NA 5LMNJ 2IC3A 3TOQA 2VB6A 1U1OA 3Q86A 4RWXA 4K4ZA 4L3KA 2FGCA 3N01A 2XCPA 2E5JA 2KFNA 3LP0A 4U96A 3UE2A 4ILLA 2GHWA 4DPOA 1T7PA 3EJMA 5H9EJ 1NO8A 4IRCA 4YN3B 2BQRA 3W9HA 4ZP9A 4R5PB 1IBLJ 3U1NA 2UVWA 4AL5A 1CBKA 1UA0A 2QFIA 4HACB 3ONQA 4NMXA 2VJUA 3AD9C 2OSRA 4QU6A 1WC6A 4C9DA 4KFBA 4P2FA 4I6YA 5KFWA 4C2MA 1L5UA 1IBMF 2IBOA 3BQ1A 3THPA 1BLUA 1AXQA 1CC7A 2F4FA 2YKOA 2IM3A 3OJUA 3TJ9A 4K4UA 4LF5J 4F4XA 4DQQA 1WNEA 1HD0A 1RXOB 4PAAA 1XMQF 2KB2A 1RU1A 3K59A 1E6VB 4GC6A 2YKMA 1VC0A 4CDIA 3DOMA 2H1YA 1T9VA 3R5CA 2B9EA 4KV8B 3NS7B 3BSNA 1SJFA 2APOA 4Q0BA 3V6DA 1ZZNA 1LK5A 4UF4A 1KQKA 3PFOA 1IKWB 3TAMB 7FDRA 4UUWA 5C24A 1MROA 1O51A 3P3DA 4ANEA 3TEGA 4PPDA 5F9LA 1HBOB 2WW4A 4ZVFA 4IFVB 1UFLA 2NREA 2C2MB 3DRPB 1S76D 3NY0A 3D3BJ 3K5OA 1H7WA 5DS7A 1N6QA 2IDEA 3PX6A 2YKNB 2N4CA 4DR1J 1UEKA 4USIA 2V8VA 1TKZA 2R7SA 4IOCQ 1QTNB 1VLYA 3W5ZA 4GKJJ 1DARA 2K7KA 3VZIA 4C8YA 2W7OA 3FEZA 1HD1A 3HHDA 4GO5X 4CTAA 3PG9A 2B9YA 1ZAVA 4B3RJ 2AHOB 4K4WA 1SJ1A 2HHPA 3PEHA 1R0AB 1C0UB 3ZNJ1 2MSSA 5E7OB 5E5NA 4ECTA 2DD8S 1SJ3P 1H2TZ 4UY8T 2AIRB 3MMAB 4Q8FA 4NXNF 2BR0A 1H0HB 4DR5J 4Q45A 3R3TA 4KGXB 5CD4H 3ILOA 5CABA 2NPFA 4NZ6A 3CJ4A 4DV6J 2GHPA 4AL6A 1NH7A 2KYXA 5HATA 1R0CB 3QGIA 4ED6A 4PWWA 2W2OP 2N7CA 4YY3J 2UU9J 5HMYA 2VC0A 4MK7A 2C2KB 1FKAF 1RACB 4UQTA 5DG8A 3MAHA 3MCOA 3DGPB 4R0JA 2H4WB 3MMCB 2HQ3A 2DXDA 4PYDA 2YNFA 3O44A 4YS2A 2JX2A 4JI0J 2FLPA 1SUQA 3JSMB 1KVIA 4DR2F 4Y2CA 1NSQA 5DDQC 5KFYA 5HK4A 1YG0A 1S5ZA 4USHA 2RU3A 5D4LA 1EP4A 2KM8B 4EEYA 2DNPA 2J6SA 1NM2A 2LQ5A 1CS4B 5CZXA 4LR9A 4IFYB 3Q8YA 3LGHA 4O4GA 1NK7A 2XI2A 2J6UA 2KN4A 3H5YA 1IJEB 1TL1B 3DFEA 4HHHA 4RW7B 3VTIA 2BJ8A 2E7XA 1SKUB 4TVAB 1I3OB 3LP1B 1RWPB 2WTFA 1ZOTA 3MM8B 4TN2A 1T03A 1VQOS 4NRTA 3SIPB 2R4FA 4RJVA 4OYMA 5IT9U 3KOAA 3KHGA 1CULA 1NSAA 3QFHA 2F9JA 4J9QA 5HQ8A 1RTZA 2XZTB 3W2VB 3MEEA 3H25A 1S77D 4WBFA 5CYQA 1YWXA 2IYIA 1DBDA 1NMEB 1U8WA 4F04B 2ZH9A 1LOUA 5HVFA 3CCWA 4J9PA 2DR6A 3I5CA 1JJHA 3UN3A 2FQQB 1RGVA 1NPRA 1HYSB 1WEYA 1VRUB 4LF7F 1K9MT 1LW2B 4DR6J 2QYGA 4LSLA 3S01A 2K8GA 4BBYA 1LKZA 1JMTA 3JYTA 1KQFB 3GYXB 4EYHB 3GJSB 1IN0A 1VQNS 5CH7B 1VC5A 3D6MB 1S6QA 3K2YA 5EHHA 1HQEB 2BQ3A 1WELA 2BA9A 4PG4A 3CCSS 3TR5A 2RQCA 1S1WB 2HZVA 5KT4A 2AP6A 4F4KA 3W9IA 1X8DA 3JQKA 1F9FA 4CO1A 3NRBA 2B6AA 4ID8A 3V4MA 3THVA 4TY9A 5GAEU 1KBRA 1S1TA 3T3FA 3GE9A 5GMDA 3RAMA 3VAIA 2YQ0A 3I9ZA 4I2QA 3D68A 4IG3A 2ASDA 2NPIA 4DF8A 5DRKA 1R27B 4UUXA 2G2OA 2HWTA 2HFNA 3OT9A 2LECA 1UZHA 3ADAC 3MEGB 3OR1B 3TA2A 2BMBA 2MGZA 1S6UA 2E5HA 2ASYA 3CD5A 3I96A 4BHQA 2B7CB 2V4JB 4DR3J 3HHKA 1NHUA 1TUGB 2G0CA 3ISZA 3OHAA 2CZ4A 2XEXA 4ATNA 2ALZA 3RGIA 5F8MA 2FHJD 3MM7A 1G2EA 3GR1A 3IWLA 1Y10A 2VBXA 3D1QA 2F7VA 5E3QA 2UUCJ 1KWMA 2J0XA 2ASLA 2N3LA 2ZVIA 2NZ4A 2XCAA 1FX4A 4EMDA 1YZ6A 3SMZA 1DQAA 4P2XA 3B8HA 1TL3A 1UMJA 4EZ6A 4H4OB 3P96A 2DO4A 3OFEA 3QGGA 3V6KA 3MCNA 2F8EX 2CUYA 5DZ7A 3C16B 3D0HE 1RBOB 4QR1A 4WFZA 2A3JA 1I94F 2BRKA 1UZDA 3I5BA 3IFEA 4ZJOA 3D4JA 2YNIB 1EKSA 4EO8A 1KRPA 1GXTA 4OI3A 3GFYA 3JTOA 1YLXA 3R1LA 2IRXA 2UXBF 3L7UA 4ELVA 2ZEJA 1LW0A 4PQAA 1Q81T 1FJGJ 4JBCA 1HNZF 5DETA 4H4MA 5KG1A 2WAQD 3HCXA 1RE1B 3K5PA 3IRXA 1QAYA 4LF6J 2W9CB 3N4WA 2GGPB 5B0BA 4OX9J 2VA2A 4J9NA 1F5BA 2C1EB 4HLBA 2GQQA 5KFGA 1JLFB 2RB7A 1RCOB 1VRTB 5H9FJ 4ED1A 4WU3A 2DH7A 3EX7B 1HWIA 4F25A 5HVHA 3DM2A 3PRBA 4JI6F 1FKPA 1M5HA 3H4DA 3PTWA 5K8PA 3P49B 2JLFA 4C8MA 3VHQA 1GNKA 2V2QA 3FNNA 1V3SA 1Y0HA 4OJ1A 1X4DA 1ELOA 3TNVA 5BJRA 1LWCA 2MHNA 2FJXA 2QLJB 3T1HF 2AYGA 2FLNA 1HR0J 2J9DA 2M52A 4IG0A 5F3ZA 2DISA 4TY8B 2R8JA 3J81j 2R8HA 1T8EA 3QPIA 2HNZA 4RW6B 3ZZUA 4EBEA 5ETMA 5A2QU 2AGQA 5HQMA 2H3EB 5DG9A 2RS8A 4FYXB 4DPUA 3MFHA 4RNFA 1FHTA 2DGUA 4P52A 3EWGA 3JXOA 1WSVA 3QT6A 2G2YA 2CQ2A 5ETKA 2QC3A 4PABA 1T9TA 4X4PA 4ZLPA 4RW9A 4URSA 2ZITA 1CPZA 4XO0A 5B0FA 1CJKB 4EO6A 3W2WA 3LALA 2IRUA 1CJUB 2FIUA 3TUJC 3MF5A 2UUAJ 1EAYC 5T7LB 4ZPWR 3VGSA 1NK9A 2KT3A 4JV5J 1S1VB 1U6ZA 3CE8A 4F3MA 3EZOA 4P74A 5KFUA 4DV5F 1VJWA 3EPIA 2VG5A 5KFVA 2MSTA 3LOUA 1QSYA 3HHEA 4MH8A 1U47A 5A8KB 2EFNA 3Q22A 4KQZA 2MPUA 5F8GA 4IQMA 1Y5IB 3CXCR 5LSRA 1PYSB 3G6XA 2NR0A 3SSRA 3LP2B 4DR4F 5DJBA 1RJJA 1PCAA 1YJWS 3G6VA 3Q24A 1RKJA 1H7XA 1CG2A 3CD7A 5B0DA 2V0NA 1OWXA 3J7AN 1P9QC 2DVIA 1YRTA 2F3JA 1NDLA 1C1BA 1BQMB 2CWKA 3E3XA 5KFNA 4Y2MA 4V1Ak 3I0SB 4BC7A 2FVRA 3S1TA 3QGPA 3CC7S 2DB1A 2VBWA 1FNMA 2B43A 4J90A 4JI2J 2WCXA 2DRBA 4AD6A 1OJ4A 4IKAA 2ROEA 3NGTA 1WF1A 2ASJA 3IO1A 4WFXA 2E1AA 4YB5A 4ZPAA 2ZM6J 3M9MB 4CWBA 2W2MP 4ZK7M 1YJUA 4HHJA 4YB6A 5LSLA 4MAKA 5B0GA 1DFDA 3C6TA 2IJNA 4DU8A 3NNCA 2QL5B 1EKRA 3BO3A 1JK9B 4O23A 2HVZA 3ZFVA 3R97A 2OPSA 2IAJA 1SV5B 1HQUB 1RWUA 3C15A 2QYCA 3DRRB 3DMJA 1WHYA 1ZTTA 1XNQJ 3G82A 4OZ5A 1WJ9A 5IV4A 3SFUA 2OH2A 4I69A 3C14B 2W2QP 1MU2B 1BUXA 3J7YU 3WQPA 2W1BA 1EHWA 3MECA 2EW9A 3VVUA 3NG8A 2FHOB 5DG7A 4PPZA 4ZDNA 1UFKA 4PEOA 4P2MA 1NH8A 1W7WA 4NASA 1Q8KA 5KFMA 2YWKA 3OJSA 2J0WA 4MKYA 1XTZA 3TAQA 2LVWA 1RWOB 3IM8A 1V6HA 2QLXA 1RT3B 3IR5B 3IBFB 2R7VA 4B3MF 2RH3A 2GIFA 3RBXA 4O3QA 1Y4ZB 4ZS6A 2VJVA 3B4DA 4WIIA 1R8BA 4G1IA 4KHMA 5AXKA 3LH2S 2L9DA 3TVKA 1EB0A 4EBCA 2EFPA 3U02A 1UWBA 3OBIA 2CJYB 4OX6A 2QE5A 1SIWB 4ECRA 2XY5A 1NCLA 1JLGB 4DV0F 1NBEB 2VBYA 2V9WA 4ZVSB 1T05A 3GIMA 5KTQA 2FPHX 2IMWP 4MFBA 2MKYA 4OI4A 1N5YA 3HSZA 4DPYA 5L9NA 3MUMP 4FP9A 4F4AA 3ELHA 3SCJE 2RKIA 4WCEQ 2FJDB 1FDAA 2AYMA 5F8JA 3EM1A 3PJXA 4LFCF 3M2RA 2OPQB 2XC9A 2C28A 4OV6A 2E1CA 3QZ7A 1VR6A 3HDSA 3CSKA 4CZCA 2ZJRQ 1F60B 3UD4P 2JVOA 4FKYA 4L76A 5KFTA 4DU7A 5GADI 1ZPVA 5CZVA 4QU7A 3MTKA 3WX8A 1QUPA 4LR8A 1RTIB 1RT7B 2HLTA 1FRLA 2WBMA 4X66F 1AZSA 1NZAA 1JQGA 1UPMB 2MZTA 3D28A 3NOGA 4EYIB 4CLSA 2B8PA 4ZVEA 3N79A 3UDCA 1FF2A 3SQOP 3QMQA 3NMAA 3N5FA 4ICLA 2CQGA 2P2CB 3PV8A 2EI5A 2QT7A 1KFDA 2CFXA 2MLXA 3DI6A 5IM0A 2F8MA 4QWCA 9RUBA 3H4BA 1IKVA 5M2RA 3HPOA 4ANCA 3U1LA 3QBCA 4ZPVR 1N33J 4UOFA 5KFCA 1IM6A 3BH6B 1JLBA 5J2PB 3M6XA 1N34F 1XIQA 3CTRA 2BYCA 2IPOB 4YHHJ 2W4CA 3NS6A 3RG6A 1R43A 4OLOA 1RAHB 2IHR1 3BJYA 3BEGB 2UUBJ 2XWXA 2R7RA 1KFSA 4Q2MA 4DCOB 1B3TA 5EN1A 2B51A 2FZGB 1P27B 2B8QA 4DS4A 3M6WA 3N28A 2V69A 2OTLS 1FFWB 4IH7A 1CC8A 1RTHB 2BZ2A 4NCBA 3HHLC 1F1BB 1WF2A 1UJ4A 4NCGA 5KT2A 4B08A 2HPUA 2X51A 1RLDA 3FSXA 2BANB 4P2SA 2DRAA 2VFRA 1N52B 2B7BB 3EVOA 1LK7A 4YDDB 3M32A 4LVNP 4Q5VA 5KFSA 1F2HA 1FXDA 1KLMB 4TYAA 4YMEA 2IA0A 4CLUA 2C2EA 4PKDB 3RB0A 3W64A 2W9BB 3US5A 1RWXB 2OI2A 5J2NB 1Q8LA 5J1EB 3FMWA 4LUBA 2I5JB 1IBKF 4A8QA 4CLFA 3MR3A 1U1RA 5B08A 4DR7F 1N32J 2BJ3A 3LGMA 2L9NA 2FJAB 2J8SA 3T1YF 2A0FB 1L3SA 5CCMA 1A9NB 3MEDB 4M5NA 2H4YB 2CVIA 5IT9Y 3DLJA 2DHXA 5BR8J 1HBUB 1S6PB 4ZPDA 3ZTQA 3CJ5A 1JX4A 1YX2A 4K8RA 1TU0B 2U2FA 1Q79A 5M2UA 2IDLA 2X1FA 2M2BA 2DHHA 2D9OA 4DV4F 2R2RA 3V6HA 1GMWA 3D1OA 1KVKA 4WWSA 2NUHA 4DDFA 4U8YA 2O1PA 3HF5A 4AL7A 4CLPA 2DPIA 4G1QA 2V9KA 3OTBA 3SFGA 1OPIA 1S97A 2NUUG 4LF4F 4QW8A 1QSLA 2VOPA 2D3ZA 2P5VA 3QLHB 3AXMA 4IH5A 2M0GB 4PG8A 1HI1A 2QTWA 3D6HB 4K2XA 2HEKA 1HBMA 1YJVA 2N7YA 1SKRA 2HHUA 2EG1A 1U1LA 1SKWA 3CJSA 1M0SA 5B0CA 4P7TA 2XLIA 5EWFA 4NE9C 4O3RA 1WTBA 2C3MA 4OHVA 3JB9k 2DEJA 4ZCIA 3IS9B 3DOKA 2ZFHA 5KFEA 2JLEA 2F63A 3PEJA 2GV1A 2RQMA 2VQFJ 2HNYA 1EIYB 7FD1A 3DLKA 2H9ZA 4QZVB 1Y00A 2JFKA 4FPIA 2XG8A 2DGQA 4RR5A 2BRLA 4FPRA 1FJ7A 1DTTB 2B5JA 3VQTA 1WI8A 1REGX 5EX3A 1JJ2R 1K44A 1N5TA 1JKHB 2CG4A 3GV7B 2CPIA 2YH0A 5LMUJ 3GQCA 4C98A 1KHWA 1F9EB 4TQSA 3MM6B 4FXDA 1NEEA 3UDEA 3SCIE 3FBEA 4H54A 4FVMA 5E33A 4A48A 4LRAA 3OTCA 4DSFA 4Y65A 5E0OA 3SQGA 2ZOGA 1TUVA 1TL7A 3HJVA 1RUSA 2DR8A 1GTEA 1GTHA 4HH1A 2DJWA 1NJZA 3HVTB 4U8VA 1VK8A 3RBZA 2A2DA 5L9XA 4NPOA 5T41A 1SB6A 3N6NA 2VPYB 3CDWA 3KKFA 4MTPA 1CJTB 3Q0AA 3DRSA 4NLXA 4R8UA 3R7SB 4QYZK 3BR8A 4TYBA 5JVHQ 3KJVA 2CYYA 4O3NA 4ZCMA 2ERRA 4NZ7A 2WHOA 3O1LA 4OJ3A 3QYYA 1KSPA 1VRQC 2CQCA 5JMNA 1VJQA 1EQ0A 3GG0A 4LSZB 4QPTA 2E5IA 1WC1A 2RF2B 2K3IA 3BO4A 1TKTA 1R6VA 1U1PA 4G65A 5K14B 3BGOP 4FYWB 4HH0A 3LQVA 4PG6A 1UVJA 2HIQA 2QGFB 3RU0A 1FVSA 1XNRF 1UVKA 4AE5A 1LWXA 2DK2A 2E9ZA 4N41A 4F3OA 3H8YA 1RT6B 3W8GA 3X3UA 3MPYA 3TUPA 4KHPJ 3M8ZA 1UEVA 2WK4A 3HT0A 1FX2A 2LFVA 4CM0A 3DN9A 3WX4A 4OHWA 1NK4A 2RHQB 1YITS 5JJBA 2MY7A 1HHSA 1HNXF 1U24A 4WFBQ 2DKOB 3CCRS 3HULA 5A2QY 2IC3B 1WORA 3FMBA 3OLAA 2W7AA 4JI1F 3TQ1A 4K4YA 1NUEA 1J27A 3HX9A 2VPZB 1FNOA 2FHMA 5H1SV 3M30B 4U95A 5CQGA 2LEBA 1NDPA 1GEHA 2MQ8A 5IWAJ 3W62A 1O6XA 2VASA 5LMNF 4QYRA 1SC3B 3LP0B 3G86A 3EICA 1U2RA 4URGA 2ATCB 1KEKA 2MKKA 2FVCA 1HWUA 2BM1A 1PJ6A 1KOOA 1HWKA 4GMKA 4KH1B 3BSCA 3CCUS 1YZ7A 1LNQA 1RHUB 1D3WA 4KFBB 4X64F 2MKCA 2BJ7A 2AJFE 1VC6A 5T14A 2OJ3A 3DXSX 1S9GA 1RTJB 1RK8A 3H5UA 4N7TA 1SQFA 2RQKA 1FFSB 3KHRA 3OTEA 2BOAA 1LV5A 2KYZA 2CQ1A 3D1HA 3EPGA 1L3UA 2ZDOA 2YH1A 1FRMA 3PR4A 1TZ0A 2DCUB 4ZLNA 3AOAA 2YKMB 4HDGA 2DGWA 3DOMB 2VFTA 4F2RA 2DGOA 2HMIA 3RAXA 2VOOA 1MWYA 2L48A 4DV1J 4Q0BB 2MZ1A 4M94A 2BM0A 2ZC4A 3E2EA 4ED7A 2RIJA 5C24B 4OIXA 1RA6A 1MROB 4O0IA 3WBZA 3KG1A 1T95A 3PX0A 5KFQA 3G6ES 2QLWA 1MW7A 1HLWA 1S57A 4YR3A 2HRYA 2DNLA 5KOXA 2GFFA 4R0EA 5HQLA 4QW9A 4FS1A 1FTRA 1W26A 5IQQA 1Q78A 3CT9A 1T94A 2BW2A 4PXBA 4ILRA 4WYWA 1UETA 4WP3A 1YJ7A 3TQEA 1N6QB 3KK3A 2UXDJ 4ED3A 4F26A 4O3PA 4C11A 4LFBJ 3P8BB 3I82A 1BY9A 4BLGA 4W90B 3PHEA 1TKZB 2OMOA 3KG4A 3A8KA 4FDFA 3BGUA 3SV3A 1U0SA 4DR1F 4O0NA 4Y2AA 3IG1A 5IQ6A 2ZKTA 4PQUA 1T9XA 3GIKA 2FZCB 2C3OA 4K50A 3JSYA 4K0KJ 4CTAB 5D0GA 4OHXA 5AXLA 1U1MA 1HNVA 1RWMB 2DO0A 4QR2A 2YBVA 1GX5A 1HARA 1TUWA 3HHLB 1U02A 4ILMA 5MAOA 3MAQA 1HWJA 3KK1A 2QA1A 1VI7A 4USVA 3GZ7A 1ZZFA 2VPXB 4QBUA 4B3RF 4QWEA 1JNRB 4ZOSA 1QAJA 1NKCA 3GYNA 3BN4A 2ZWOA 3AOCA 4PWDA 1RT2A 3NP5A 2ZNZA 2D7SA 1VQYA 3I4PA 1GMUA 2CPDA 4DR5F 3RAQA 4N76A 3MM5B 4U9RA 4BDPA 4ER8A 4DV6F 4WFNQ 3H98A 2YNGA 1ROFA 4JI8F 2LLZA 3QZ8A 2V8GA 4LBIA 5HMWA 4YY3F 5KFPA 3M2UA 2YNFB 4OLPA 4PXEA 3ZTOA 4RNMA 4XPEA 1H2UX 3ZZPA 1SUQB 2IYGA 3HKZD 1UJ5A 2PE8A 2OIHA 1QTMA 3AA9A 3CCES 2ZWPA 2ZBIA 5HJXA 1FRXA 5AXMA 2K1RA 2BJ9A 4JI0F 1NJIT 3CCQS 2N82B 3QIDA 4Z7YA 4DL5A 2JHEA 4U7UD 4O4GB 2J7UA 1C0TA 1T9WA 3UNYA 3IWXA 4MKVA 1DZ5A 2IY5B 3PDNA 4LQ9A 3H20A 1S48A 2UVVA 5DGBA 3T5HA 1U25A 4G1PA 4OFZA 4HEA9 4OYAA 1NK5A 2NLWA 2HBYB 4X4RA 1CULB 2G0JA 2RDDA 2ADBA 3MEEB 4F0MA 1S10A 5CYQB 4KO0B 2DNKA 1IBMJ 3CW2C 5F8HA 1B4SA 1VCTA 2R7OA 3O3LA 4HACA 3T9NA 3Q8PB 4L6V3 1I51B 3V2UC 2VG6A 3W5XA 3UNGC 4X62F 5KAKA 2AJ4A 4Q8EA 4LSLB 4C7QA 1JNZB 2P9EA 3JYTB 5F8IA 5KFDA 4DL7A 3WIVA 3MM9A 1XMQJ 5GAHI 3TRGA 5KT6A 3DKDA 1S6QB 2HQIA 3JTNA 4RUBA 5A6WA 4DR6F 5CAAA 3J80U 3VGUA 2CA9A 3BBFA 4WFAQ 2NXJA 3OLBA 1U1QA 2UVRA 1E6VA 2A18A 3C3LA 4BCAA 2B6AB 2ZE2A 3TP2A 1VQ9S 5MLCV 2XZDB 1K8AT 1S1TB 3J7A1 2A1BA 1ZM3A 3HHNB 2HFUA 4I2QB 3HHLD 4ES2A 1BWVA 2R7UA 4IG3B 1IKWA 1JWWA 2XQCA 2M88A 3P5BP 5A76A 3N0VA 3R27A 3LWLA 5F3TA 3MOJB 1RBLA 2DXFA 3CO0P 2MGZB 4HT5A 1Q95G 3CVKA 3MCSA 4W98A 4ZVGA 1H74A 1SI9A 1B0TA 1XR7A 4DFKA 1APSA 5AE1A 5C7PA 3M2VA 3HZEA 3MM7B 4ZVUB 3MUTP 1DRZA 4KR0B 1U1KA 4I2PA 1AT1B 4DR3F 2YNHA 2VONA 4CT9A 4CLTA 5D0HA 3AJ2A 5I42A 3PVXA 4BC9A 3MCMA 1TL3B 2ATLA 1IUJA 2UUCF 5J1NA 1DAXA 2WVFA 1IBCB 2JOQA 2YWWA 1VQLS 4WKRA 3MMAA 3QIPA 1HMVA 2HVHA 1SIZA 1BHNA 2BKOA 2CNLB 4Z2XA 4A8WA 4PR6A 5D8HB 4JI3F 1T02A 3TUIC 5LXRA 2QSFA 2MXYA 1P1TA 2CXEA 3BPSP 3ZTSA 1LW0B 2KVQE 1X31C 5CYMA 4AXIA 3TX8A 1A0OB 2GJIA 1Q53A 1AB8A 3C6UA 4H4MB 4X4QA 2YPYA 2DHGA 1UVMA 3F0NA 4DR2J 3IRXB 3PW4A 4J37A 3MMCA 3VZHA 3FBFA 4CYUA 2VKZG 3DRXA 2F5GA 4ETXA 1AUDA 3OR2A 1X5PA 1FDNA 4LF9F 3A3OB 2PO4A 4LF6F 3MHYA 1M1GA 2CRLA 2IJFA 1BQNA 3DM2B 4EWTA 1FKPB 3KDNA 2L3MA 4DSJA 4RBUA 2CJBA 3CD0A 4AUKA 3NGUA 2XY7A 1X4HA 3PZPA 3AOBA 3AY0A 2A2CA 2VQEF 1DTQA 2ZJPQ 4DCPB 2GQ2A 2GW8A 4EK2A 4DUYJ 2VF3A 2JJ4D 1LWCB 2CNNB 2Y8WA 2XMJA 2MQNA 1KTVA 3NLCA 2NXEA 3HVWA 1HA1A 4IG0B 1WEXA 1Z2LA 3MM8A 3HFKA 2HNZB 5DLFA 1H73A 3FQKA 3D54A 4WE1B 1WG5A 1NPKA 1FCAA 1RHQB 3IMQJ 2WSCC 1WUUA 3BKUA 1VK3A 3ET6B 4LF7J 4NLVA 2C2OB 4WXOA 4RW9B 4JV2A 4RNOA 5EDWA 3OVBA 3EGWB 3W2WB 4NI2B 2RVJA 1WC0A 1JLEA 1S9EA 3NCRA 1D8YA 1S7IA 4PUOA 2FJEB 2CPXA 2MZSA 2CNKB 4NZ0A 5EUHA 1XMOF 4CNYA 1PJ7A 2AKWB 2Y1LB 3UI3A 2XM3A 2EKNA 2VG5B 2CG8A 3HZGA 2AMCB 1S1WA 1PG5B 3GJRB 5C42A 1R8HA 4LRCA 2R8GA 3PM9A 2W8KA 5F0UA 3AAWB 2MLZA 3BYRA 3KG0A 1FE4A 5A8RA 4HL9A 3KXDA 3MR7A 1ZTWA 3C66A 2R2TA 3LO3A 3BGRA 4F0HA 2DNNA 4LBHA 1T11A 4DZDA 1C1BB 4RZRA 4B9TA 3UVJA 1TMMA 3MEGA 2HQCA 1PYTA 2XGPA 2V50A 5DO2A 4RBTA 3GR0A 4JUZA 5I3PA 2BDPA 4CQ1A 3K5NA 4Q7AA 2XS7A 5KFAA 1Q82T 1BD6A 4KGMA 1EX8A 4ED5A 4B17A 3Q8VA 2V4QA 8AT1B 4P6QA 1P9YA 5E3CA 2F65A 2E9TA 2JSXA 1PAEX 3E01A 2KDOA 4GO7X 3DLHA 2V8PA 4Y00A 5K20B 1NU4A 3C6TB 4DL2A 2ZM6F 4HTIA 1WDTA 1S4FA 2ALYB 2XYPB 5J1PA 2VU5A 3IA0A 2OPSB 3GB0A 1S49A 3W1YC 5GVQA 1NJXA 1GQEA 2IAJB 4O4RA 4HHUA 8RUCA 2UUWA 3C15B 5JVGQ 3DMJB 3D0IE 3G82B 2OLWA 1NK8A 2MJNA 4PXDA 1S7HA 2XNQA 4HYKA 2KXHA 4ZP6A 3DLLQ 2CQBA 3PR5B 2VL1A 3IR6B 4DV3F 1IJFB 4ZVHA 3OXFA 3E8OA 1X9WA 2PFDA 5KFRA 1XNQF 1B0VA 2VBZA 1MWQA 2Z58B 4KT0C 2ZOFA 1K1QA 2O67A 2EK1A 3ENVA 3H90A 1SL0A 4RUCA 2UZAA 2VV5A 2HIYA 3MECB 2Z56B 2GAGC 2GIQA 4WU2A 2ZH5A 4RL1A 1B7FA 1URNA 4YDXA 3NBPB 2BXJA 3VAKA 1PSDA 1FXRA 3DLGA 3WHIA 3TJ8A 4JI6J 1M5KC 3QFWA 2LA6A 1R8PA 2B9XA 3PIPQ 2AU0A 2H5JB 4MJKA 1ACMB 2G13A 3HSGA 3IWNC 1XEZA 4WK3A 1FWKA 1NNDA 1S0MA 2HZAA 2PMZD 3TZXA 2LXFA 3GV8B 2IBKA 3BZQA 4KYZA 4CT8A 2MQLA 5RUBA 2AJQA 4DV7F 4JV1A 4QIFA 3NNHA 3LF0A 1VHIA 4KPYA 3PJ9A 1UWBB 1RLCL 2BV3A 4C48A 4AQYF 4OJHA 2HKEA 5L1LA 1N36J 2EEYA 2EBGA 1HPZA 3RZAA 3NNAA 4WIQA 1T05B 1B70B 2XY6A 4MFBB 4RUHA 1N5YB 4EGLA 3V4IA 1YBTA 2LCWA 3OPKA 3M05A 2HFSA 2IFXA 2GC8A 2RKIB 3M6UA 4NYOA 2OELA 1FEEA 3CJ3A 3M2RB 4IR9A 1K47A 2POKA 2ZHAA 2WSFC 4NLSA 2GMJA 4OI6A 3CC2S 3UW1A 1F5AA 3BSAA 4DV5J 2D3OR 3UCGA 4ECXA 4M5DA 1XC9A 4L72B 4UZBA 3PYDA 4BS2A 2DY9A 4GKKJ 4ANDA 2ACYA 1AZSB 4GVLA 1VIOA 4UQGA 2OPRA 2WB4A 4I0WA 1W2BR 3JSRA 1EJ7L 2ZDPA 4B3SJ 3PRDA 4J9RA 4NXMF 4DR4J 4G3IA 4ZP8A 2VPWB 4KSEB 4ICLB 2OO4A 3AJ1A 3K58A 2M8DB 4F0KA 2K7JA 1VQ8S 5A8KA 3DI6B 2LMIA 5IM0B 3C2PA 1H72C 3BB5A 3AD8C 4JI5F 4LSNA 1M1KT 4KIAA 2DIUA 1FRHA 3K17A 4LR7A 4IDKB 4J9OA 3EDRB 4YQWA 3Q23A 4P10A 3GFZA 1UPPA 4CNZA 3NGDA 2XSJA 3L7OA 2GMLA 1TQLA 3C46A 1JLBB 1Q8IA 1FT8A 2DTJA 5HJYA 3QO9B 3FZBA 4B3TF 3V81A 5D15A 4FXVA 5LM7E 5BYSA 2CPEA 5SUHA 1U49A 4M5GA 4DX8H 1TAQA 1N5QA 4YHHF 2VUGA 4I7FA 1U48A 1UAWA 4X84A 3SI8A 4OL8A 4Y2KA 2DXEA 1ZYQA 2YWFA 2UUBF 1RBAA 3A3NB 4X4UA 2BACA 4EBDA 2IVYA 2W25A 1RCXB 4IYQA 2RDJA 3BF4A 4DI6A 4NCGB 4X65J 1YSJA 1C4CA 1Z2ZA 2QFJA 2HHHF 2Y1RI 1OIAA 4NLOA 3G96A 1QM9A 2PMWA 5HP1A 1IM4A 1PC4A 2H65B 3TANA 1UWAA 4LF8F 2CJKA 3EXYA 1JJ4A 1ZS6A 3HFVA 1FK9A 1DQ9A 1ZETA 1KP6A 3A4TA 2ZH3A 1XK8A 1JXLA 1OY8A 2Y9HA 2R42A 5KG3A 4ENOA 1CLFA 2FHKA 4CH0S 1OYDA 2YVSA 4A8KA 3GWCA 2Z2YB 2Z2MA 4IRKA 4RX6A 1NK0A 2RRBA 3TAPA 1LWEA 3GP9A 5A6PA 1TFWA 3RUBL 2CJ9A 1VQPS 4W92B 3K8WA 1KVJA 1OS5A 2YTCA 1K1SA 2ZC3A 4B3MJ 1FD2A 2E5LF 2ZHOA 4I6WA 3OTOJ 4EI2A 3VALA 2GVZA 2W2NP 3MMBA 5KG5A 4QIVA 2HFVA 4A8YA 3P6YC 3L95X 4U7CA 2LQ8A 4I64A 5H9FK 1RQ0A 5BR8F 3BDPA 3BH7B 1VOMA 3DU6A 1KLNA 3I32A 3MFIA 4PXCA 3G4SS 2J9EA 2PN6A 3RB4A 1WG4A 4ELUA 5K8OA 4DV0J 2CDQA 4RKUC 1SL2A 4ZCLA 3CJKA 2XMUA 2JC1A 2MQMA 2AGPA 4G1QB 1RT4A 2FUG9 2EKYA 1HFEL 2DNYA 2EFOA 4NMLA 4LFCJ 2GJ2A 2GO8A 4F50A 1R0BG 3DCAA 3J80Y 4M95A 2QA2A 2B9WA 4KY3A 4KC5A 3ISNC 4USUA 2W4PA 4F8RA 1HBMB 4JI7J 6AT1B 1BXNA 1FKOB 4IOBA 2BEFA 3AFGA 2IJRA 3VV2B 2KZMA 4IO9Q 2GNKA 3ZTPA 2AX0A 2DBBA 3IXQA 1FE0A 3ZXWA 2UVUA 4X66J 4F36A 2D41A 4J9SA 4G6VB 4ZIWA 1B7YB 2Z57B 4ZJLA 2V4RA 4OYZA 2JVRA 2V2VA 4P71A 1RT7A 3EGVA 2LA4A 4B9MA 3D7SB 2HNYB 2RSQA 4C0OC 3MR2A 3DNCA 3DLKB 3FVYA 3RYLA 8ATCB 1S0VA 5J2MA 4V19J 4DXLA 4B9VA 3BGFA 2B5JB 1PJ5A 4OYIA 3QGHA 2PFFB 3RJMB 4CO3A 4AFFA 2VD3A 4CH1A 2HWIA 3WZ0A 1VFJA 4WXWA 1H98A 1HQ2A 4NLWA 2BUNA 4QWBA 3T6BA 3DDIA 1ZM4A 5CCLA 2QEXS 4DUTA 3MZIA 4LRBA 5KOWA 1N34J 1RAOA 3TVZA 1F0XA 4UZCA 3ITHB 2V2KA 4NLQA 2QMUB 5LMUF 5HVGA 2MMYA 3SQGB 1TL7B 1GK8A 1RHMB 4W4MA 2ZZTA 3DYAA 5ETQA 2GJFA 1S99A 1DLOB 2J8AA 3FFIA 2AEFA 2SXLA 2HNDA 4FF2A 2ZBQA 4WJBA 4Y3CA 5J2QB 2QLFB 3DLEA 1Z1ZA 1VIXA 5DLGA 4I68A 2V5HG 2NCKL 4ALZA 3QAUA 5B0EA 3RW6A 1FWLA 2R2SA 1S0NA 3DRSB 4R8UB 4H4KA 4IRDA 1UJ6A 1HIYA 3UQSA 1OSDA 2LQ9A 2UV8A 1I5OB 4C97A 1UFWA 1RKIA 3BSOA 4OHZA 5C25A 2LXUA 2VFUA 3OL9A 2XS5A 3SSSA 2UXCF 4FVCA 4DSIA 1UW4A 3QJJA 1TKTB 4QWDA 2HS0A 3H0PA 3OSNA 5FIIA
chains in the Genus database with same CATH topology
4URGA 1KEKA 2KG1A 2MKKA 3FFIB 4I6AA 1KQKA 2FVCA 3PFOA 1IKWB 1HWUA 3TAMB 2BM1A 2HNDB 7FDRA 2P6SA 4C3MA 1KOOA 4UUWA 5C24A 1HWKA 4GMKA 1MROA 4ECWA 5IFMA 2K3KA 1O51A 1M5OC 3DLEB 1AFJA 1R0AA 1C0UA 2U1AA 3OXGA 4J9LA 2RILA 5AE2A 3BSCA 3CCUS 3P3DA 4ID5A 5CYJA 1D3WA 4PPDA 2KHDA 5F9LA 4CO4A 4KFBB 1HL6A 4X64F 2MKCA 1HBOB 2NXUA 1V3ZA 4NLTA 1WEZA 1Q7LB 2AJFE 4ZVFA 4IFVB 4RU2A 1UFLA 1VC6A 5T14A 1YRXA 2NREA 2OSQA 1NKEA 1RYSA 2HFOA 3DRPB 3DXSX 2OJ3A 1S76D 3K5OA 4HVZA 4YP3A 1S9GA 1URRA 1RTJB 4X4OA 1CVJA 1RK8A 1H7WA 5DS7A 1N6QA 1J2VA 3PX6A 5F9NA 4BWMA 2B4PA 3H5UA 4X4VA 2DNRA 2RQKA 5F41A 3KHRA 2YKNB 1L3KA 2EK6A 2N4CA 4RNHA 3OTEA 5C25B 2KHCA 1BGXT 1LV5A 2KYZA 3MEDA 2BE2A 2CQ1A 3D1HA 3EPGA 1L3UA 2ZDOA 4USIA 5LT5A 2YH1A 2V8VA 1FRMA 1TP7A 3PR4A 1TZ0A 1TKZA 2DGSA 2V94A 2DCUB 2CQIA 2R7SA 1ZM9A 4HDGA 2YKMB 3IGNA 3DGPA 4IOCQ 3WDOA 1RTDA 2DGWA 4PG5A 3CJ2A 2VFTA 2FHJA 3HLUA 2E9RX 1Y3JA 2AWZA 2LXIA 1N4LA 4C8KA 4F2RA 2DGOA 4IO1A 2HMIA 3RAXA 1VLYA 2EBEA 2VOOA 2HHVA 1G7CB 1DARA 2K7KA 1MWYA 3VZIA 1FJGF 1NJWA 2L48A 4U6PA 1N5SA 2W7OA 4C8YA 4Q0BB 3EGZA 3FEZA 2MZ1A 4M94A 2BM0A 1HD1A 2ZC4A 2RJZA 3HHDA 3RB3A 4GO5X 3E2EA 4CTAA 2B4OA 2B9YA 3JSMA 1U1NA 1ZAVA 4ED7A 2RIJA 5C24B 4OIXA 1RA6A 1WHXA 1MROB 1X4CA 4DBQA 3H5SA 4K4WA 4O0IA 1SJ1A 3WBZA 3KG1A 3U7JA 3UPFA 2HHPA 2MQPA 1T95A 3OL7A 3VAHA 4OX9F 5E41A 3PEHA 5IWAF 3PX0A 5KFQA 1C0UB 1MWZA 1R0AB 1KNZA 2MSSA 3OTDA 5E7OB 4DEZA 5E5NA 4KHRA 3G6ES 2QLWA 5DM7Q 3SDEA 1MW7A 4ID5B 3ZC4A 4ECTA 3UD3P 3M8PA 1ZAWA 2DD8S 4DFMA 4YR3A 1SJ3P 1H2TZ 2DNLA 2EFQA 2HRYA 5KOXA 4UY8T 3MMAB 2DT9A 2MKJA 4Q8FA 2GFFA 4R0EA 4NXNF 2OTJS 2AQ4A 2BR0A 1H0HB 2ILYA 3CDAA 3K5LA 4Q45A 4IFYA 3R3TA 5CD4H 2NPFA 4QW9A 4FS1A 4NZ6A 1FTRA 3FQLA 1WG1A 3CJ4A 5IQQA 1Q78A 3CT9A 1T94A 2BW2A 4PXBA 4ILRA 2GHPA 1UETA 4WYWA 5KG2A 4AL6A 3FGVA 1NH7A 4PG7A 2KYXA 2KT5A 1S9GB 2FVSA 1TL1A 1UA1A 1S72S 4ZP7A 1QUVA 1N6QB 3KK3A 3QGIA 4ED3A 4RW7A 4DWIA 4ED6A 4F26A 4O3PA 4C11A 2N7CA 2J0QD 3D2WA 5HMYA 2KJWA 3F41A 2VC0A 1HI8A 4MK7A 3I82A 3LP1A 2F4VF 1YRUA 5JUMA 1N0VC 1BY9A 2LEPA 2BE2B 3N5BA 4BWJA 1QSSA 2R7WA 1FKAF 4W90B 2WBRA 3CCTA 4UQTA 3PHEA 1TKZB 3TI0A 2LEAA 2OMOA 4KJIA 5DG8A 3KG4A 3M8QA 1P1LA 4ED0A 3MAHA 4HT7A 5A8WB 3F73A 3RR7A 1RTDB 1KQGB 4R0JA 2Q1LA 3BGUA 3SV3A 3MUVP 3GSDA 3MMCB 4DR1F 4A8OA 2HQ3A 2HMIB 1HR0F 1LQ9A 4FZVA 4Y2AA 2JEJA 2YNFA 3IG1A 5IQ6A 2ZKTA 3O44A 1L3TA 3DXBA 4PQUA 3W2VA 5CA5A 3GIKA 2JX2A 4RW4A 2PT0A 1Y3KA 2DHAA 3MWBA 3MURP 2FLPA 2C3OA 4K50A 1RDRA 3JSYA 4CTAB 5HN0A 1SUQA 4OHXA 5AXLA 3JSMB 1U1MA 1KVIA 4DR2F 3DOLA 4Y2CA 2ZH8A 1HNVA 2DO0A 2KRRA 4QR2A 5DDQC 5KFYA 3JAMY 5D4PA 2Y0SD 1YG0A 3S7RA 1GX5A 4MIBA 2RU3A 4USHA 1HARA 5D4LA 3HHLB 3NL0A 1EP4A 5SZTA 4ILMA 5MAOA 3MAQA 3SDEB 2KM8B 3G6YA 4EEYA 3VAJA 4DV1F 1HYSA 2DNPA 3M8PB 3UR0A 1HWJA 2J6SA 1FA0A 2HGMA 4LT6A 3KK1A 2QA1A 1VRUA 4OMFG 5AXNA 3THTA 2LQ5A 1VI7A 1Y9OA 3GZ7A 5F8LA 2E7WA 1LW2A 1ZZFA 3TARA 2VPXB 5CZXA 1S1UA 3SSQA 4QBUA 4IFYB 4B3RF 2JEIA 3K7RA 4QWEA 1JNRB 2MZJA 4ZOSA 4O4GA 2C3YA 3TO8A 2I2YA 1NK7A 1QAJA 2OAUA 2XI2A 1NKCA 2J6UA 3OUYB 2KN4A 3GYNA 3BN4A 3H5YA 1IJEB 3HP6A 1VQKS 4PWDA 1TL1B 2MQQA 1RT2A 1LWFA 2OKQA 3NP5A 2ZNZA 3DFEA 3KK3B 2D7SA 2GMHA 1VQYA 3C8YA 4RW7B 3VTIA 3I4PA 1HQEA 2MHEA 2UUAF 2XULA 4C11B 4CO2A 1S79A 2CPDA 4DR5F 2E7XA 2X1GA 3EXCX 5KT3A 3RAQA 4N76A 5L1IA 3MM5B 4A46A 2W9AA 2Z2LA 3CC4S 1FKOA 3LP1B 1KR4A 4U9RA 3LPYA 4ZKAA 1T3NA 2WTFA 1ZOTA 2ZH2A 3MM8B 4DV6F 4BDPA 4WFNQ 4TN2A 3H98A 4JV5F 2M4MA 2YNGA 1T03A 2BJDA 1LFWA 2E1MC 4Z37A 1VQOS 4NRTA 1ROFA 4JI8F 3M8QB 2LLZA 3H59A 2R4FA 1O8BA 4RLEA 2XMWA 3QZ8A 2M3DA 2V8GA 4PWUA 3FRYA 3DU5A 1GAOA 5HMWA 4LFBF 1SL1A 3KOAA 3KHGA 4YY3F 5KFPA 2WOMA 3M2UA 2YNFB 4OLPA 2F9JA 4PXEA 4MKBA 5HQ8A 4J9QA 4DFPA 3POTB 1IQTA 4PQUB 3IAS9 3W2VB 3MEEA 4RNMA 3H25A 4ECUA 1X0FA 1S77D 3QWPA 5CYQA 1YWXA 3K8VA 2FLLA 2IYIA 4RW4B 2RMLA 2BJEA 1H2UX 4XPEA 1R6YA 1DBDA 1S6OA 3ZZPA 3H2UB 1SUQB 3VQSA 3NMRA 2IYGA 2ZH9A 3HKZD 3NCPA 2YY3A 3M9NB 3DOLB 1LOUA 1UJ5A 1HNVB 2CQ4A 1PC5A 2PE8A 3O2IA 4OZJA 2FJVA 2OIHA 1FJCA 1PO6A 3CCWA 4J9PA 1QTMA 3I5CA 3OFHA 3AA9A 5KFZA 2IA6A 1JJHA 3KK2A 2G4BA 3CCES 1SH3A 1RGVA 2ZBIA 5AXMA 1FRXA 2Y1IA 1PILA 1N48A 1HYSB 2K1RA 3OR1A 4JI0F 2J7WA 3KK1B 2RE1A 1WEYA 5AJ3F 1VRUB 2N82B 3KLFA 3QIDA 3CCQS 4LF7F 2RRAA 2RDIA 1LXNA 1LW2B 1K9MT 1M5VC 4DL5A 5KFIA 1S1UB 2JHEA 1JLCA 4LSLA 3S01A 2K8GA 4BBYA 4N47A 1KD1T 1LKZA 1KC8T 1JMTA 4O4GB 2F1FA 5HLFA 3JYTA 2QO3A 3M4XA 2J7UA 2KI2A 1C0TA 3GYXB 1KQFB 1BC6A 4EYHB 2E66A 2W4DA 1H38A 2KXFA 2XS2A 2V4JA 3GIIA 1IN0A 3IWXA 1VQNS 4PWDB 5CH7B 1RT2B 1DZ5A 1LWFB 1VC5A 1S6QA 3CULA 3K2YA 3PDNA 5EHHA 2DR9A 3QJLA 1HQEB 2CVEA 4LQ9A 4FBTA 3H20A 3WC2A 2BQ3A 1WELA 1S48A 1XBWA 2BA9A 4PG4A 3CCSS 3TR5A 1X9SA 5FD1A 2ILZA 2RQCA 1S1WB