1WHWA

Solution structure of the n-terminal rna binding domain from hypothetical protein bab23448
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
99
structure length
99
Chain Sequence
GSSGSSGSGRLFVRNLSYTSSEEDLEKLFSAYGPLSELHYPIDSLTKKPKGFAFVTFMFPEHAVKAYAEVDGQVFQGRMLHVLPSTIKKEASQSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein RIKEN CDNA 1200009A02
publication title Solution structure of the N-terminal RNA binding domain from hypothetical protein BAB23448
rcsb
source organism Mus musculus
molecule tags Rna binding protein
total genus 10
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2004-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1whwA01
2CQ1A 5HO4A 2CPDA 2RRAA 3ZZZA 2KRBA 4C7QA 5GAEU 2MSTA 2XS5A 1U1LA 2MKIA 1VQ5S 4PRFA 2KXHA 1QVGR 4Z2XA 2L9WA 1QVFR 4LIRA 2RS2A 1VQ9S 3CMAS 4F25A 2ADCA 1U1PA 1N8RT 1H2TZ 3G6ES 3CD6S 3DXBA 1U1OA 1NJIT 1Q7YT 5LJ3Y 2CPFA 2K3KA 3Q2SC 1KD1T 3J7ZT 2DNLA 1VQKS 2D9PA 4IO9Q 2KN4A 1FXLA 1U6BA 1URNA 1XN9A 2RVJA 3TYTA 2LMIA 2VOOA 3MUMP 1QM9A 2MKKA 2CQDA 2LXIA 4U67Q 2LCWA 1Q86T 2CPXA 3ZZYA 2O3DA 4YUDA 5JVGQ 1DZ5A 3VALA 2OIHA 2ZJPQ 2AD9A 3VAFA 2ZJRQ 5FJ4A 3G96A 4BS2A 2M0GB 2MZRA 3MOJB 3NS5A 2D3OR 1SJRA 4TLQA 1X4CA 5CXTA 1WF0A 3THTA 2MQOA 1U1KA 2DGVA 1HA1A 5LSLA 5GMKa 1G2EA 2DNPA 2CPZA 4IOAQ 4W90B 4F02A 2MY7A 1UFWA 2DH7A 2DO0A 2VONA 1SJFA 1HD1A 3CCUS 2PE8A 2DNZA 3CXCR 2DK2A 5IQQA 2CQPA 1F9FA 2I38A 3FEXB 2RQ4A 2XNQA 3VAGA 3SXLA 3VAJA 1RK8A 5H1SV 1VBYA 3UCUP 2M8DB 2MKHA 3I55S 2YKAA 2JRSA 2CPEA 1WTBA 5DDPC 2L41A 1BY9A 1U2FA 1W2BR 1D8ZA 2MZJA 1WHVA 3IRWP 3EGZA 1YIJS 1KOHA 2HGNA 3UD3P 1N88A 4UQTA 1YI2S 2HGLA 2MXYA 1ZZFA 5DETA 1M1KT 3BS9A 1VQPS 1H2VZ 1OO0B 3NNCA 2LKZA 4WFAQ 1WHYA 2SXLA 5IM0B 1DRZA 5CYJA 4Y00A 2N3OA 4ED5A 3NNHA 5GAHU 3MD3A 3CMES 3S7RA 4QU6A 2G1DA 3MDFA 2G0CA 2CPHA 1YWXA 3D2WA 3H2UB 4CH0S 2XB2D 1DHMA 2F9DA 3CCVS 2XS7A 1P27B 2DGSA 2DIVA 2MY8A 3L3CA 4ZKAA 2DGTA 2EVZA 2WBRA 1X4GA 3V4MA 1VQ7S 3B4MA 2FY1A 1FJEB 2DHXA 4LMZA 4CH1A 1B7FA 1ZH5A 1M5VC 2I2YA 5JVHQ 1KQSR 4QU7A 1JJHA 2DGXA 5MLCV 2N82B 3MXHP 3CULA 5LXYA 2M7SA 2MQNA 2HVZA 2M8HA 3R1LA 2OTJS 2J76E 1WF2A 1JMTA 4TU9A 4YOEA 2KVIA 2DHSA 2GHPA 3PIPQ 2DGQA 1PO6A 2KRRA 2OSQA 2FPHX 2AYBA 4WCEQ 3UCGA 4Y0FA 3I56S 3P49B 1WEZA 4J5OA 1H6KX 2X1BA 1D9AA 2XS2A 1RKJA 2YH0A 1OIAA 2MHNA 1VQ8S 2Q79A 1NU4A 4WFNQ 2DNRA 5D77A 1N54B 3UWTA 2DHGA 2RS8A 2KI2A 2QFJA 1M5KC 1VQLS 1KC8T 1IQTA 4PKDB 3CC4S 2MGZB 2MJNA 2HGMA 5DDRC 2KG0A 3FEYB 2LXUA 5EN1A 1H2UX 2N7CA 1UP1A 2DNNA 3HHNB 2DHAA 3CCMS 2OJ3A 2G4BA 2VOPA 2CQ4A 1X4FA 2E5JA 2MSSA 3P5TL 1SJQA 2KFYA 5GADU 2YH1A 2LECA 4ERDA 1CVJA 1OWXA 2AYMA 2NLWA 5IM0A 5GVQA 3VAIA 1FJ7A 2UP1A 2YWKA 1WHWA 4V19X 5HL7Q 1WELA 1WI8A 3LPYA 2MMYA 3S6EA 4EGLA 5DDOC 1YJWS 1VQ4S 2MKCA 4IOCQ 1UAWA 1VC5A 3BO3A 2MZQA 3H2VE 1AUDA 1WG1A 3DLLQ 2X1AA 4CIOA 1VC0A 3CC2S 4YB1P 3ULHA 2DNKA 2FC8A 2M88A 1VQNS 2JWNA 1R8HA 1YITS 4IUFA 2HYIB 2M2BA 2CPJA 2MZ1A 1FT8A 1S72S 3Q2TC 3LQVA 2ERRA 1X4DA 1X4AA 3THPA 3UD4P 1VQ6S 2MZTA 3MURP 2DNGA 1N52B 4CQ1A 2LQ5A 3CCQS 2KM8C 2HZCA 2CQCA 3HI9A 1WF1A 2XNRA 4W92B 4FXWA 1VQMS 2BOPA 2CQGA 2CQHA 3CCRS 5CA5A 2RUGA 2MPUA 3NS6A 3U1MA 2KT5A 5DDQC 2DGUA 3P3DA 2M52A 1FNXH 2KHCA 2RU3A 3P6YC 2QA4S 3VF0B 1YJNS 2CPIA 2D9OA 4WKRA 2ZJQQ 1WWHA 1WI6A 1WHXA 2K8GA 2CQ0A 1U1QA 2E44A 2ADBA 3UCZP 5DM7Q 2EK1A 4UY8T 3G71S 1VBZA 2KYXA 2MGZA 1U1NA 3CPWR 2CJKA 1VQOS 1M5OC 2DH8A 4TU8A 5LJ5Y 3G8SA 3JB9k 4A8XA 4WFBQ 3VAKA 1X4BA 3U1LA 2RT3A 2LA6A 1S79A 1X4HA 1X0FA 1PGZA 1X5OA 2DNQA 1YTYA 1P1TA 4WIIA 1WG5A 4WF9Q 2KU7A 1A7GE 1R8PA 2J8AA 2M9KA 4C4WA 3RW7A 1X5SA 2CQIA 2EK6A 2DGOA 3US5A 1M90T 2DNMA 3S01A 2A3JA 1SXLA 2MQLA 2X1GA 2PEHA 1JJ4A 2DNOA 3EGNA 2YTCA 3J7YU 2B0GA 2V94A 2CQ3A 2GO9A 4OZ1A 3SDEB 3K0JA 2DIUA 1FO1A 3BEGB 3TP2A 1FHTA 2AYEA 2JVOA 2KXFA 3R27A 5LXRA 1JJ2R 1ZZNA 3CF5Q 2F3JA 2XSFA 3CCSS 3VAHA 2MKSA 3NNAA 2JVRA 2RQCA 1KOOA 1WG4A 2DITA 4FXVA 4OZ0A 2VODA 1X5TA 2U1AA 1SJ3P 2OSRA 2MQQA 1WEXA 2LYVA 1U1MA 5DM6Q 3CCLS 1Q82T 2LA4A 2DO4A 2BZ2A 2MJUA 3RW6A 2CPYA 1FJCA 3G8TA 1Q81T 3MD1A 5IFMA 5ITHA 3SMZA 1HD0A 1YHQS 3MI7X 3TO8A 2MKJA 2CQBA 2MYFA 3R1HA 2M4MA 4TU7A 2DGWA 3NMRA 1X5PA 2LEAA 3S8SA 1WEYA 2DNYA 1UW4A 3VAMA 4QPTA 1SJ4P 2JX2A 3N9UC 1M5PC 2J0QD 2J0SD 2N3LA 2MQPA 4C0OC 3CTRA 4LJMA 1A9NB 2NZ4A 3CC7S 5LSOA 2MZSA 4P6QA 3CCJS 2OTLS 1U6FA 2DH9A 2DNHA 3MUTP 1X4EA 2RRBA 2FHOB 5BJRA 5GAGU 4PR6A 1L3KA 2CQ2A 1VC6A 4RU2A 3CUNA 3BO4A 5D78A 2QEXS 2AYGA 1HL6A 2KG1A 1U1RA 3G4SS 3EX7B 2RNEA 4M5DB 1VBXA 1K73T 1K8AT 2KM8B 3OW2R 2F9JA 4F26A 1OPIA 2E5HA 2KXNB 2E5GA 1O0PA 4QQBA 2X1FA 2L08A 3UE2A 3IWNC 2E5IA 3CCES 2KH9A 3PIOQ 2MB0B 2M70A 2MQMA 1NO8A 3G9CA 1DBDA 3BO2A 2U2FA 2DB1A 3B4DA 3SDEA 1K9MT 2LEBA 3MUVP 1YJ9S 2FC9A 2DISA
chains in the Genus database with same CATH superfamily
2W8KA 2XS5A 2D69A 4DN0A 1U1LA 2FDNA 1JQGA 4PRFA 1S6OA 1LW0A 2P6TA 4MK8A 4HTIA 2HNYA 3BQ0A 1TL7A 4F25A 2R2RA 1S49A 1KVIA 3I0SB 1GXUA 3DXBA 2ABYA 2AZ3A 5GAHI 3AOCA 1NB2A 1XWLA 4KV8B 1UETA 1Z2ZA 3OSPA 3GB0A 3PFEA 4PXDA 3MMAA 4HT5A 2VA3A 3LP1A 7FDRA 4YUDA 4QYZK 4BS2A 4N7TA 2WONA 2PI5A 3GIKA 3LO3A 2KKHA 4FDFA 1T03B 3P4UB 3ILJA 3I82A 1JJCB 2WSCC 2Z30B 3PX0A 1VIXA 1RK8A 1VBYA 2GZOA 4ED7A 1KONA 4CRJA 5EDWA 1U2FA 1V3ZA 3HVAA 2EI5A 3F44A 2AEFA 3NMAA 4QWBA 3GFHA 5E33A 1WOPA 4WFAQ 1DRZA 2RMLA 5KT3A 4IDKB 3NNHA 4QIWD 1U2RA 5F3ZA 1VISA 1NKBA 1GK8A 4LSZB 5KG0A 1E6YB 4WU3A 1DHMA 2W7PA 4CLKA 2QC3A 4JOUA 4F0HA 1ZH5A 1PKUA 3RBZA 2ZZMA 3LW5C 4K0KF 3NGDA 3IBCB 4ZMMA 4FPIA 1PAUB 2YQ1A 2C3OA 3UCGA 1BQMA 3TWZA 1SKUB 4DR4F 3P8BB 1GXTA 2R8IA 4LQ3A 3EDQB 1HNIA 2BV3A 4M94A 1SKRA 3RBDA 1XNRF 5T7LA 3DHWC 2V69A 5L39A 4HT7A 4IKAA 1LQ9A 3T9NA 2E7VA 1CG2A 3BN4A 4R8UB 4DUYJ 3T1YF 2E5JA 2KT3A 3D6TB 4K2JA 3GV5B 3DRPA 4F3MA 2UXCJ 4OLOA 3DRXA 4ID8A 5F8LA 4TLRA 2ZH9A 1WI8A 3LPYA 4NLSA 3ETOA 2YNIB 2HHQA 1GEHA 3SQGA 3LH2S 1WKKA 2BACA 1VC0A 1B4SA 3J7A1 2QGFB 1SQFA 1R8HA 4DV2F 3ILOA 5KG6A 3LQVA 2QT7A 3OUYB 2ZHBA 4N41A 2DVIA 2XWYA 3DU6A 3EGWB 3CCQS 4CT9A 2OPQA 2AJQA 2RB7A 1HMVA 2FB0A 3MM6A 1ROFA 4WWSA 1SL1A 3DOKB 2NXNA 1O5JA 2D9OA 2IY5B 2JLFA 1RT5B 3M8PA 4ANCA 1EARA 1WI6A 4IQXA 4IFYA 2YKOA 3PNIA 1RDRA 3G71S 1OSDA 2BJ9A 4DG1A 1TK8A 4TU8A 2OPPB 4Y65A 4KHRA 3VAKA 4DCOB 2E7WA 3CVKA 2XG8A 3DGPB 1X5OA 2DNQA 5G0RA 1HNWJ 1D8YA 1ZM3A 1WG5A 1PSDA 4NLRA 4GKKJ 1C2PA 4WKYA 1N6QA 2EK6A 1YK9A 1I5OB 2VFUA 2IC3A 3S01A 2RE1A 1FKOA 2ZDPA 2UVUA 1TVRA 3EPIA 3BEGB 2JVOA 4PQAA 2F3JA 1KOOA 3NWRA 1X5TA 1SJ3P 2OSRA 3HXMA 4F0MA 5HMYA 2VPYB 4OYAA 1GTEA 2HNYB 1ZTTA 1S77D 3G8TA 3CIZA 2GIQA 4YR3A 2VG7B 1WSRA 2JDJA 3DDNA 2MLZA 3NMRA 4IH5A 2VD3A 3MMAB 5E5NA 3KLVA 1A6LA 2N3LA 4CLYA 3HF5A 1NM2A 1HBOA 3R2CJ 2WONB 1S1TA 4QIEA 4P52A 4Q43A 1S0NA 2Y1JA 4ANEA 3D1HA 5HANA 1N36J 2WRMA 5D78A 5SZTA 5JXSA 3ETMA 5BYSA 2I6WA 4RW7A 3EX7B 2RNEA 2KM8B 3J81Y 1TUWA 4BBYA 2CZ9A 3OL9A 3C66A 4ED2A 2BKNA 4I4BA 4WIQA 1ITPA 4ZCMA 2DISA 2KRBA 4C7QA 3JXOA 4DL4A 1QVGR 2XZDB 2BA9A 4HI1A 3CD6S 3AQOA 1T11A 2KJVA 3FBBA 2B56A 2K7KA 2VB6A 4DPTA 1RBLA 3NCQA 4K4YA 3RRGA 2IBKA 2Y8WA 1KFSA 3VWSA 2MKKA 2CQDA 5JVGQ 1Q0NA 2J7WA 4G3IA 1TL5A 2OH2A 2ASYA 4X84A 2ZZTA 3KG0A 2MQOA 4PXCA 2DGVA 5EHHA 1G2EA 1BQMB 4Y28C 5D4OA 4BLGA 3TUJC 1HNIB 2HQIA 1RAEB 1GFWB 3UCUP 4LF9J 5T7LB 3AJDA 2AJ1A 4DLEA 1FDDA 4HHJA 2MZJA 2JEJA 2NUHA 2XSJB 4LIWA 1JLAA 3DRPB 4KPCA 1OO0B 2AIRB 1VK8A 1RCOB 3TI0A 3CMES 2G1DA 2GV1A 3SQGB 2PIIA 3NLCA 5E2QA 2R7RA 2WVFA 4CH0S 1W26A 2Z4PA 2O67A 4C8NA 3PKMA 4MK9A 5CABA 2B8QA 4RLEA 4RL1A 1QD1A 4H4OA 4I2QA 1NBEB 4CT8A 3Q8PB 2XGQA 1S6QA 1HI1A 1CJUA 2HQ3A 1HMVB 2DHSA 3SV4A 3MM6B 3M32A 2LP4A 2VFSA 2FVPA 2AGQA 3HJFA 3M8PB 4KJIA 4OZLA 1N54B 5C42A 3R8YA 3OHAA 2V34A 3JAMY 1VRQC 1LWCA 4DG1B 4CO4A 3C14A 4DV1J 1ZM9A 2ZD1B 1TMMA 4M5HA 1Y9OA 2E7XA 3SCKE 5G0RB 1KLMA 2KT2A 3WQPA 1HNXJ 4B08A 1YVFA 2YQ0A 3OHBA 1N6QB 2EBEA 2IC3B 2UP1A 2W25A 1VQ4S 1UAWA 2GQQA 2GMHA 1TVRB 3HDSA 4N56A 4YB1P 2DNKA 4RU9A 2LDYA 1KKHA 2QJ3A 4C8KA 3LP0A 2RDJA 4E2FB 3A1YG 3R7NB 3DU5A 5L9XA 1N52B 4DSKA 1HPZB 2LQBA 1FWPA 2CDQA 4ECYA 3CCRS 2MPUA 3CD7A 1TMJA 1LWEB 2QLFB 2RHSB 1MN9A 3IFEA 5KFZA 1B0PA 3VF0B 3HZEA 3PZPA 1HBOB 1U47A 5H9FJ 1WDTA 1S1TB 1DTQA 2XMJA 4DI6A 5K8OA 1EAYC 3G8SA 3JQJA 2ZHOA 5J2NA 4OJ3A 5AXLA 4O44A 3U1NA 3M8ZA 2V2VA 4RW7B 2M9KA 1FX2A 3DRSA 1C4CA 3T1HF 4U8VA 4RNFA 2XHCA 5HK4A 3WC2A 2FGOA 1XMOF 4PWWA 1SC1B 1NPRA 1EZZB 1IBMF 2R8JA 3H40A 2AYEA 4P10A 2R8GA 1FRLA 1WG4A 4K4VA 1UWBB 4OZNA 3V5RA 4XAKA 3KJNB 3PW5A 1IBKF 5IFMA 4XIUA 3D67A 3EYZA 3RB0A 1FKPB 2IAJB 4EYIB 2KVQE 3VAMA 3HX9A 3L09A 1YKWA 2HRUA 1KQKA 4ZVPB 1SJ4P 1KN6A 2J0SD 4C0OC 4M5DA 1UVLA 1A9NB 1RT6A 3IR5B 4ECZA 3KG1A 3AB2B 1VDHA 1XTZA 1S5ZA 4K5RA 4FVMA 5K9FA 2CQ2A 4RU2A 3PV8A 4WE1A 2ZDOA 5A2QY 1DJ0A 1EQ0A 3W66A 2VBZA 2DJWA 2HBYB 5E3QA 4ZCKA 1LKZA 1F1BB 1BWEA 4ES3A 4HH1A 1IM4A 1JLAB 3BBCA 1YJ9S 2VF3A 3G87A 5C24B 2FLLA 1WC4A 5M2PA 1GQEA 3ZTQA 1V5VA 1CJTB 4A8QA 2NCKL 2JJ4D 2W7AA 1L3VA 5M2UA 2UV8G 4B9NA 3TUZC 1U48A 5AE1A 2AV5A 3ZZ0A 2Y0BB 3QLHB 2XQCA 5KFDA 1U1OA 3J7ZT 4LUBA 1YX2A 8ATCB 4AQYF 5KFSA 4QBUA 3FC9A 2DR9A 1SQEA 2UUWA 3K8WA 2HVIA 4NLUA 1VLOA 4H4OB 3TQEA 4I2QB 2VQEJ 2O3DA 1H7XA 1Q8IA 2V9WA 3G96A 4E0DA 4ITSA 2GHWA 3BBBA 2D3OR 3CEDA 3PW4A 1CJUB 1SJRA 2EKNA 4J9UE 4NYPA 3M32B 4W90B 2ZFHA 2DO0A 4MKAA 3LUYA 1AT1B 5C42B 3SXLA 3DLEB 1LWCB 1WTBA 3C14B 4B3RJ 5DDPC 2LVWA 1HFEL 1HNVB 4LSLA 2BJ7A 3KJQB 3H90A 3W9IA 2P6SA 4B3OA 3KJFB 4RNNA 2E1RA 1RZMA 1Z4UA 5HVHA 4RBTA 3DDIA 1BQXA 2Q66A 2J6UA 2G0CA 2YPYA 4ER8A 1WUUA 4ILRA 3F0NA 1UEVA 2QO3A 3EM1A 1KTVA 4LF7J 5DG9A 3LP0B 2ZM6J 2ASDA 1U25A 3V4MA 1B0VA 1Q1KA 3ISNC 3L9ZA 2YNFA 3MMBA 2JEIA 2F40A 4M8LA 3V4IB 4OI4A 4WCEQ 4DX7A 3UNGC 1WEZA 3GTYX 2R7WA 5IV3A 3A8JA 1T3NA 2F4VJ 2DNRA 4X2BA 4LRBA 1XR7A 1S99A 1OY9A 3R2DJ 4YDXA 1GH8A 2B51A 4OMFG 4LFBF 4O3NA 5J2NB 3HD2A 2QFIA 4O44B 3OTEA 2V8PA 3A4TA 3DKDA 4ERDA 1S1VB 2R2TA 4UY85 3TA0A 1RLCL 3DRSB 2UVWA 2HFVA 2CJXB 3W65A 2HWIA 2GJ2A 4LVOP 5HQMA 3FMWA 4ZPBA 4ZJOA 3HT3A 1JNZB 3C6UA 1AUDA 2AX0A 5B0AA 1TP7A 3HHDA 4NEZA 3J81j 3BSNA 4M95A 3HSDA 2OKQA 1UEUA 1PC5A 3TVYA 5CZXA 1SB6A 1RTJA 2FJWA 2UUCF 3K59A 2PA8D 2E66A 3PHTA 4WZMA 3D1OA 4JI8F 5K8PA 2IJNA 3OTOJ 3UD5A 3TR5A 2MLYA 2MEWA 1FRHA 4X62J 1HWKA 2XGPA 1NPPA 1T9YA 4BDPA 1U1QA 3TUIC 1U09A 1UTAA 1RU2A 4OYXA 4UZCA 2HHTA 1PBUA 4F4XA 4WE1B 1XQIA 1X0FA 3QGPA 4ILMA 1SIZA 2V4QA 5C2GA 3CGIA 4DSIA 4ZP8A 1FJGF 1TV6A 4YS2A 4ANDA 2J8AA 2CQIA 3KXDA 4JI2F 1MMDA 4MJKA 1M90T 1T8EA 4RBUA 1U45A 4H4KA 2DNOA 3GSIA 1XEZA 4ZA1A 1I3OB 3N5BA 1OY8A 1JJ2R 4ZIWA 2MKSA 3BR8A 2H5IB 1KFDA 1Q82T 2V4JA 1JLEA 3RW6A 3KMSA 1LW2B 2NXJA 5KG1A 4F04B 1CC8A 3CJ5A 3G2XA 1YHQS 3TO8A 4C0BA 2MYFA 3R1HA 3E3XA 4PWUA 4CLZA 3GIJA 1S1XA 4DEZA 1M5PC 1HLWA 4C8OA 2MHEA 4Q5VA 3MM7B 2QG9B 4NXMF 4NOHA 4UZBA 4NWBA 2RJZA 4P73A 4ID5A 4DPYA 1FTCA 5BYRA 4ZCLA 4MT1A 1ELOA 2HK3A 1F2GA 4DOZA 4FF3A 2HPUA 2QLXA 4YB7A 2VBYA 2E5HA 4QWEA 4LSLB 1BGXT 3G9CA 2ALYB 3BO2A 4EUVA 3N0VA 3OT9A 3MFHA 3FDSA 3W3SA 3HHEA 3M8QB 3CD0A 4I0WA 2BQUA 3KJVA 2XZTB 5HJYA 2HW3A 4GO5X 4BWMA 1FNMA 4QR1A 1M5SA 1ZM4A 3ENVA 1WC6A 4DPXA 2EG1A 3OXLA 4QYZJ 2IPOB 2A2CA 5KFIA 4NCBA 2RVJA 3AQPA 3ZTPA 3DC2A 3VGSA 2CPXA 1JLCA 4ZPAA 1MWZA 2YNFB 3MMBB 3M8WA 3E2EA 1HQEA 3VAFA 4JI3F 2RSQA 5KFBA 1MG7A 1AUSL 5HSPA 4F02A 4C11A 3W8PA 1V5IB 3MEDB 1W2IA 3M9MB 4JI5F 5IQQA 2I0XA 3O6QA 3NOGA 2NZCA 4DX5A 1Y10A 2HBQB 2JRSA 3PW0A 3C46A 3IRWP 3MPUB 4YMEA 5BXIA 2RDIA 5CHCB 1SPBP 4DF8A 1UVMA 1H98A 1C4AA 5HVFA 3TOQA 4CNYA 3FSXA 4ED5A 2WSFC 4F50A 3L4BC 3ZNUA 5K5MA 3C6UB 2OMOA 3W9HA 5ETLA 1F0XA 3WHIA 1U2CA 3K2YA 2DIVA 3L3CA 4ZKAA 1U6ZA 1RTJB 2VH7A 2ZC3A 4DR4J 4Y6IA 3WIUA 4PPZA 1RUSA 1FDAA 1YJVA 4OJGA 1YRUA 3GIIA 1NSQA 3VZHA 4RW4A 4Y3CA 2E9ZA 2AYBA 1TK0A 4K2XA 2QLBB 1KWMA 2C2MB 2HFSA 1RKJA 1T9TA 3EPGA 3D7SB 3T1YJ 4OI2A 3I5BA 1IQTA 2V2QA 2RHQB 5F9LA 3D0GE 2ZBPA 3HHNB 4MTPA 2OJ3A 2CQ4A 2QA4G 1VOMA 4CO5A 5A8WB 2F8EX 4KGZB 3MF5A 4B3SJ 1TV6B 3H20A 5K20B 5DQIA 3VAIA 3PJXA 3QATA 3HKWA 2W24A 4ZPVR 4HHUA 4DV2J 1VC5A 2HG4A 3CD5A 4JV0A 5JJBA 3Q8QB 4LF8J 4ZVQB 2YNHA 2IVMA 3ULHA 1EKSA 3M4XA 4LF6J 4LR9A 3HLUA 1XIQA 1HR0J 4LF4F 5HLFB 1MSWD 2B4OA 2V4JB 1JLEB 2DNGA 1RT1B 4C2MA 2V63A 4ZP9A 2EXUA 4U7UK 1SH0A 1IWAA 3IA0A 2BM1A 2NREA 3DOMA 4M5JA 4USJC 4Y2IA 1S1XB 5HN0A 3ZXWA 3R6LB 2QTWA 1RB0A 2R2SA 4EZ6A 3I0RA 4NLYA 3HKZD 3UCZP 5DM7Q 4NCAA 2IYGA 4J91A 5DZ7A 4RUBA 3TAQA 4DQRA 2XMUA 3U1LA 2RT3A 2BBEA 2QSFA 2XLIA 4DQIA 3V81A 4ID5B 4M1KA 4WIIA 4J9KA 3AJ2A 1NK9A 5DLGA 4FN5A 4P2FA 3QJJA 2EBGA 2IM2A 3BYPA 1JJ4A 1UZHA 2GX8A 3NAIA 5KFUA 1FO1A 3M8RA 2RF2B 3VAHA 3CCSS 3NNAA 3NWGA 2HAIA 2H48B 4AT1B 3CCWA 2FHJA 1JLBA 5J1PA 2FJAB 2ZH3A 3QFHA 1VI7A 3PRDA 4FF1A 4Y2MA 3UDVA 4PEOA 4M63A 2VC0A 3A8KA 1H7WA 4YHHJ 4JP8A 3TZWA 4H4MA 1S9EA 4ZPDA 4TNOA 4HKQA 4C11B 3V6DA 4HEA9 4LT6A 2FHOB 3MPWA 4B9TA 1YJ7A 3Q86A 1HWLA 1AFJA 2R7VA 2HAFA 1RHQB 4LRCA 3OQ2A 2WB1D 2HVEA 4WFXA 4YY3F 1OPIA 1O0PA 3UE2A 5CQGA 1G6BA 1U26A 2M70A 2YKPA 3TQ1A 1TU0B 3ISZA 4PAAA 1QVFR 2GMJA 4QPXA 4YEAA 4J90A 2OD6A 1S6PA 2Q6BA 1QE1A 3UR3C 2HZVA 2DNLA 4DS4A 3OXFA 3KOAA 3OBIA 4IG3A 1OY6A 2OPRB 2OUGA 4DJBA 2BRLA 4F4WA 1JK9B 3QZ8A 3PJ9A 4TLQA 4TY9A 4N47A 4RW4B 2VKZG 4DWIA 5L38A 5LT5A 1HBNA 1RACB 2WBMA 4X4UA 2Z2YB 5E3AA 4EBDA 3GG0A 1NZ8A 3FRZA 2YKAA 2YKNA 3SCIE 1HNZF 3Q8RB 3FUYA 3K8VA 1OMSA 5FDLA 1RHMB 2I5JA 3B78A 1F5AA 3G82A 3T5LA 4QCLA 1H2VZ 1XMQF 3BPDA 2IYIA 2FLOA 3AD7C 2AW0A 3JQMA 4NLQA 4B3MJ 5D3GA 1NXIA 2Z56B 3D2WA 2YNHB 5KFYA 5A0YA 2XB2D 1SH2A 3CJ4A 5ETNA 2XBPA 1URRA 2W2NP 3CDBA 3B54A 4EO8A 4LBHA 2M7SA 4KB7A 4YN3B 4PWDA 3OLBA 4N76A 1X9SA 1T7PA 3R5DA 1KHVA 3QPIA 3MM8A 2XHWA 3TW0A 1R3NA 4LVNP 4WFNQ 2DKOB 1K0TA 5EUHA 3D3BJ 1CLFA 1R0AA 3KYLA 4OI3A 4OHZA 1MWYA 3OR2A 2BANA 4IQMA 3D66A 3AXMA 3A3OB 4X4TA 1D09B 4EGLA 1YJWS 1WKJA 4IOCQ 1NHUA 4A8MP 2I8EA 4MFBA 3RZAA 2HS0A 1JKHA 1WJ9A 5B09A 2UU9F 1DQAA 4C98A 2HHPA 4V19J 1S72S 2XO6A 1NDCA 1JLBB 3EVWA 2YXLA 4IH6A 4ECSA 4CDIA 2KDOA 3RB4A 1V3SA 2XNRA 4FXWA 5KFGA 3KLGA 3U1MA 2HHVA 2KT5A 5DDQC 2FJBB 1KBRA 2HFNA 2ZBRA 3SSRA 3JSYA 3IRXA 4P75A 4ZLNA 1S1UA 4WKRA 1WWHA 5HP1A 3ZFVA 3W60A 1QSSA 4H4MB 1S9EB 2FQQB 1WKLA 3V6DB 2J8SA 1PYTA 1D9DA 3DLGA 3T1HJ 2B9WA 1SC6A 1XMOJ 2R9LA 1IBMJ 1RWMB 5I42B 4Q7AA 2DNMA 2A3JA 2X1GA 1IQZA 3J7YU 5A8KB 3IP0A 3K89A 5KFEA 2ZEJA 3CF5Q 5DG7A 4DV4F 1YRXA 4ZJQA 2MQQA 2HHHJ 3T9ZA 3WC0A 1K1QA 2WB4A 5J1EA 1J27A 2HS4A 1SH3A 4O4GA 1U0SA 1S6PB 3LTOA 4ZVRB 4AUKA 3PJWA 3UVJA 1SC3B 3D68A 3HHKA 4ZHRA 2VA2A 4QWCA 4CP5A 2OELA 5E41A 3MEGA 2ZVSA 2CUYA 3VR1A 5AT1B 4MKBA 3QBCA 4YQWA 1FDNA 2NZ4A 4DQPA 4DSEA 3NS7B 1SCJB 4P6QA 2DCUB 3OL7A 3UN5A 4OHXA 4HR2A 2Z57B 4X4VA 1HBNB 2HHXA 3WX4A 4ZIVA 3JTPA 5J2MA 1VC6A 4ECVA 4TYAA 3VZIA 4JI6F 3A8IA 3G86A 1U1RA 2YKNB 1VBXA 1RWPB 2O66A 2W4DA 3QRQA 2HIQA 5FDLB 3CCES 1DBDA 2I5JB 1N0VC 3G82B 5IZHA 3W5ZA 4Z37A 1RAJA 1Y5IB 3GR0A 2MQ8A 2M3DA 2RS2A 4A8FA 4DV3F 2R7OA 4OZ3A 2G1HA 5D3GB 3I9V9 1KQFB 5I3UA 2PMWA 3I5CA 4BHQA 3W62A 4L74A 2K3KA 1N34J 4U6PA 1YG0A 2GVZA 4DUTA 4DV7F 1FXLA 2CZ4A 2VOOA 3H5YA 1UJ6A 2LCWA 3D6HB 2QZ8A 5LMUF 3MOZA 4HH0A 3GE9A 4OI0A 1RTHA 3QT5A 5H9EK 3VQSA 2H1YA 5HROA 3MM8B 2PE8A 2W4CA 5C5JA 1ZOTA 4A8KA 1YJTA 3VAJA 3G6YA 5JUMA 2BJDA 1SJ1A 3M30A 2UUAF 1R0AB 1TKDA 2GC8A 2OFGX 4MIWA 4LRAA 4J9SA 1NH7A 3IWLA 3OR2B 2BANB 3MHYA 2HLTA 4NRUA 4H54A 3KNGA 1IKVA 3W2VB 3MTKA 3M1VA 3CCTA 4FBTA 2E9TA 3FCHA 4ZPWR 3D6FB 3DRYA 2Y3YA 3RBXA 4MFBB 3KLEA 1JKHB 2F9DA 1N5YA 3CCVS 3M2RA 2G2OA 3MM9A 4LFAF 1Q8BA 2DY9A 4TVAB 4FYXB 5L1IA 5IOLA 5MLCV 1PCAA 3IC1A 3T5KA 5E3CA 2DR5A 4DV6J 2JFKA 3KLGB 3VTIA 1JMTA 1P1LA 2EW9A 3NKYA 4OX6A 4FYVB 1KEKA 3M6UA 2XS2A 3IRXB 2F5GA 3CW2C 3H0PA 3HMJG 1S1UB 2Q79A 4USVA 3DLBA 3CMQA 4LFBJ 2DHGA 4KGKA 4AXIA 2OEKA 3CCZA 1FWKA 1ZA1B 3TZYA 3R5CA 4U9RA 2DT9A 5E3PA 1F3FA 3DLGB 3H8YA 3ZC4A 4DSFA 2DNNA 1OJ4A 1S48A 2DBBA 2V8GA 2MSSA 1SUQA 1GMWD 1T05B 3DNCA 1W25A 2XEXA 3JSMA 2Z2ZA 3RU0A 3Q8YA 2DXFA 4BC7A 1CS4B 5KFJA 5HAOA 4JI1F 1VJQA 1UZDA 1J5EF 2OLWA 5LMNF 2HNDA 1NK5A 4P2XA 4IR9A 3J7YI 2Q1LA 4CO1A 2XZWA 5F41A 5J1EB 1HKAA 4UT4A 4RWXA 4ZCIA 1T9VA 5IT4A 4IOBA 2VJVA 1RWKB 4O4GB 2KM8C 3AFGA 1F9HA 1JX4A 1VQMS 3MR2A 3UVJB 5IXUA 1WSVA 3R9LA 4OYPA 4DLGA 3KLIA 1NK4A 3TX0A 2GMLA 3MEGB 3BN7A 1NDPA 4JV5F 5CYQA 3T6BA 2G0IA 2L9NA 3OTBA 3GONA 1WHXA 3HFKA 3PRVA 4O3RA 3VVUA 4USKA 2ZNYA 2HLUA 2DH8A 1YJRA 1TKZA 3KUEA 5LJ5Y 4M5IA 5J2MB 4JI2J 1LFWA 4R5PA 5D4NA 1HWJA 4DR7J 4HVZA 4N8OA 1A7GE 1HW9A 4Q44A 4IFVB 1IR2A 5LL6d 2BW7A 3BV8A 2ZBCA 3PFOA 1Z2LA 3TX8A 2GNKA 2DEIA 3HP6A 1AYEA 2KXFA 3O8WA 3M9NB 2IA0A 2R3VA 4KKOA 3BQ2A 2J7KA 3MEEB 2MJUA 2LU1A 4J9NA 2QL5B 1UW9A 4ELTA 3MD1A 3SMZA 2ZHAA 2KZZA 2GVZB 3P5BP 4NXMJ 2M4MA 2ZH1A 3S8SA 3DXSX 5ETSA 3NXZA 3H4BA 4LJMA 3CC7S 3RGIA 1TL3A 2YX7A 4RW6A 4AL7A 2VFRA 1RTHB 1UPPA 1GNKA 3HCXA 4UUWA 3Q23A 5HROB 2AZ1A 2OPSA 3RBEA 1FWLA 4OHYA 3BQ1A 2RU9A 2AX1A 4ZP6A 2F9JA 4NLOA 4F2SA 5IT9Y 3WX8A 2L3MA 2ROGA 3I0SA 2J9CA 4B3TF 1YSJA 2P9EA 5KG4A 3B4DA 3JSBA 4AL6A 4ZN1A 1S1WA 1RGVA 2RRAA 2MKIA 1IKVB 3M1VB 5B0FA 3FKBA 1U1PA 3GV7B 4HACB 5ETPA 3KLEB 1RHUB 1Q7YT 1N5YB 3M2RB 2J9EA 4R25A 4JI3J 1GMVA 3MM9B 1Q7LB 3TYTA 4FF2A 1PYOB 1Q86T 3CJTA 1FXRA 2ZJRQ 3BH6B 2BE2B 4JI5J 3PYGA 3OFHA 1FA0A 1UJ4A 3ZO7A 2WOMA 3CCUS 2DNZA 2YWFA 1F9FA 3UQSA 1Q8LA 3H59A 2W7OA 2M8DB 1T95A 5K8NA 5BR8F 1DQ8A 2YWEA 1DLOA 1B99A 1KOHA 2HGNA 1YI2S 1N88A 2HGLA 1SUQB 4W98A 2Q43A 3BS9A 4NLGA 3JSMB 1R8CA 1RCXB 4DUZF 5L1KA 5CYJA 4DX6A 4DU8A 3TNVA 2FD2A 4DR5J 2DY1A 2X51A 5F0UA 1LXNA 3D0HE 2DGSA 2UUTA 1IN0A 4JB8B 3I4HX 1NK0A 2X3GA 2MQNA 2M8HA 4ES2A 3BR9A 5IWAJ 3PR5B 3SI8A 1UFKA 1FKAF 1LWXA 3PX4A 3KLIB 2Y9HA 2XYHB 1TFWA 4E8UA 2HKEA 5CYQB 2NQPA 1JWWA 5DGBA 1HQUA 5CAAA 4CZCA 1GX5A 3RTVA 2GQCA 3FQLA 3H5SA 3KWMA 1FRJA 1SL0A 3CC4S 2E5LJ 3FEYB 2YNIA 5EN1A 3AD8C 4R5PB 2VOPA 3HT0A 3PCOB 3OUYA 2YBVA 2BE7D 2RKIA 4OJHA 3ITHA 2O1PA 2YWKA 4V19X 3DMJA 3H2VE 2UUBJ 5EX0A 1T94A 3KUGA 2HQDA 4KBIA 1T0TV 2VDHA 1VRUA 3UDEA 4KKOB 4ECWA 1X4AA 3THPA 1RT5A 3UD4P 4C3MA 5DO2A 1NDLA 3GYNA 2W9AA 2CIMA 1HBMA 2CPIA 2OHDA 2BXJA 2VPXB 1X9MA 2E44A 3Q83A 1NKEA 4QIVA 1LOUA 3OVAA 3H2LA 3KLHA 2ZVIA 4GVLA 2OPSB 1S79A 5L9NA 3D5MA 1PYSB 1YTYA 2ZC4A 4ZVUB 4XK8C 3TZXA 1S9FA 1JLQA 3MCNA 3TRGA 4HDHA 1GAOA 3US5A 4DV5F 8AT1B 4YDDB 2VG7A 2W1BA 4OZ1A 1RA6A 2HQFA 3ISND 1S1WB 3RAMA 3R5AA 4A8WA 4U7CA 2ZH7A 1S57A 2VODA 3NGTA 2LYVA 1NK8A 1SVDA 1KQGB 2LA4A 4PCQA 5HMXA 2JZ5A 2CPYA 3MR3A 4CM2A 3BJYA 4DQSA 2HBRB 1Q81T 4WZQA 3AA8A 2ZITA 4WTOB 4U95A 2MKJA 2UXCF 3EVOA 4KE5A 4QPTA 2CNNB 3N9UC 4KHPJ 3T5JA 4K50A 4NA1A 1QUVA 2ZWPA 3AJ1A 3IAM9 1X4EA 4NA2A 4FS1A 4YY3J 1L3KA 2WOMB 2AJFE 2FLNA 3OL6A 1BC6A 1DLOB 1K47A 4S0MA 3KDNA 2KH9A 4ZVEA 4PG5A 3LPEA 4F4YA 2E9RX 1NLKL 3GJRB 1NAQA 2G9OA 3N4WA 4W4MA 2CJ9A 1ULRA 2M5YA 3RW7A 4DL2A 2CPDA 1RLDA 1HARA 4OL8A 4B17A 3DI6B 5RUBA 4F8RA 3EJMA 4QW9A 3M6XA 1HNWF 3SIPB 4Y2AA 1NCLA 2CPFA 4USUA 1HHSA 1XN9A 4X4OA 2FZKB 3GSDA 2ASLA 5IC6B 2G13A 4JBCA 3N01A 2FVSA 3BSAA 1TL1A 2ZKTA 1YZ6A 2CG8A 2A6OA 4JV2A 4BWJA 3QYYA 4F3OA 3QGHA 5LSLA 3RB3A 2IRYA 1HWUA 5L1JA 1UFWA 2XSJA 1S6UA 1HNZJ 4UOFA 4IG0B 1HQUB 2AKWB 4X4SA 2DR7A 1FTRA 3HFZB 3W64A 2CPEA 3BF4A 1XMQJ 1UCNA 3Q22A 2QLJB 2QL9B 1SKSA 2XC9A 3IM8A 1WHVA 1RAFB 4WXWA 3HSZA 1HI0P 2R2UA 1QAXA 2RRNA 2NXEA 2V5HG 1EX8A 2RKIB 3IXQA 3ITHB 3DMJB 4KT0C 3IM9A 4K8RA 1PIEA 1D0EA 4GKJJ 1N36F 3AAWB 3UO0A 2XS7A 1VRUB 1ACMB 3M8YA 5FLXU 5AE2A 4PG8A 2P2CB 3R7SB 5KT5A 1B7FA 4Y34A 3CDWA 4OX8A 2AWZA 3I31A 3LGMA 2ZE2A 2ZD1A 3D6MB 3KMQA 4I69A 2VC1A 2KRRA 4WYWA 2ZH5A 2RQKA 2OFHX 5KFRA 4Y0FA 1HBMB 1DTTB 1RP5A 1FRIA 4A8OA 1I51B 1WC5A 3UWTA 5DDRC 3KLHB 3SCLE 3LGHA 3HVRA 3HJVA 2BUNA 2ZUGA 2CAJA 3W9JA 2OAUA 1AA1B 4IH7A 5GADU 2LECA 1JLQB 3M2VA 4RZRA 3JSRA 2UU9J 1HPZA 2C2KB 1KR4A 2MKCA 1RHRB 1KVKA 1CJVB 3IBFB 2PO4A 2POKA 1LWEA 2MDAA 1YBAA 5LSRA 4LF9F 1U8SA 1TELA 4IUFA 2JC1A 1OQ6A 2CPJA 3MWBA 3U27A 2ERRA 4JI0F 2J0XA 2MZTA 2KJWA 4CI0B 2DRDA 4I6WA 4NZ7A 2H4WB 2CNOB 2J5AA 2LQ5A 3MR6A 2HZCA 1OYDA 2CQCA 3M05A 2FJEB 5LM7E 2JC0A 1QUPA 3EWGA 4C9DA 3WZ0A 2CJYB 1FNXH 2HFOA 3G8QA 2RU3A 1KVJA 2A6MA 2KO1A 2ZZNA 2VQFF 4ELVA 2XULA 3NY0A 3WBZA 5M2RA 4UY8T 4UOCA 5J2PA 3I32A 1S4EA 1X4BA 3GP9A 4G1QB 1IKYA 1WC3A 1L5UA 2RAQA 1IBLF 5DQHA 3DN9A 4FXDA 4JI7F 3BYRA 3OJUA 1UWBA 4IRDA 4LF5J 4G65A 2NSBA 4ILLA 3C16A 4O0IA 2DPIA 2CQ3A 1FKPA 3LWMA 5J1NA 5K14A 2IAJA 3EE3A 1GMUA 4NCGB 3R27A 3NOCA 5LXRA 4C8YA 3R3TA 4USIA 2DITA 1BMQB 2U1AA 3QWPA 1NJXA 3K17A 1VFJA 1Y0HA 4FBUA 4HLBA 4MKVA 2HSEB 1NB7A 4XDCA 2LQJA 3SQOP 4CLTA 1NH8A 5HQLA 2KB2A 1NMEB 1EETB 2GS8A 2WW4A 3PX6A 1LNQA 5KFNA 1TL1B 1RWNB 2DD8S 1DARA 1V9OA 1XBWA 5HMZA 4O3SA 3EICA 4JI6J 3VCDA 3GCWP 4CLUA 4QJVA 4DR3F 2HMIA 5C24A 3B8HA 4RUAA 3RUBL 1CJTA 3EXYA 3OW2R 4DPWA 5EWGA 1NPKA 4OHVA 1H0HB 3W5XA 2HHUA 3QLHA 2MQMA 5A6WA 2DB1A 2IJRA 4DCPB 5KG7A 2CDRB 4DV3J 1G4CA 4K4TA 1RADB 2MSTA 1NRKA 4OX9F 4Z2XA 2V8HA 4LIRA 4WTYA 1VQ9S 1ZPVA 1MMNA 2XLJA 2CA9A 4Q2LA 5LJ3Y 4ECUA 5LMUJ 1RSCA 4KQZA 1YJUA 3MUMP 1FK9B 4ZP7A 3DLEA 4TQRA 3V6KA 3V6JA 2AD9A 1NSAA 5H9EJ 4DFPA 2XTJP 5EGYA 2ZE2B 3DOLA 2RUSA 3THTA 1HNVA 4CTAB 4CLLA 2MY7A 2DH7A 2YWGA 2IMOA 1PG5B 3HSJA 2I38A 2RQ4A 3VAGA 1DAXA 4I64A 2AQ4A 1M0SA 4ZOSA 2D3O1 1YIJS 4UQTA 3R5GA 4WXOA 4B02A 3MECA 4YFUA 3M2VB 3PHEA 2Y8YA 3Q24A 2YKMA 3OSNA 2UV8A 1RTIB 4ECTA 2WVBA 4NA3A 1WACA 5GADI 4Q8EA 3BGFA 4LFAJ 1YWXA 3T1AA 4ETZA 1RTZA 3V4IA 3T41A 1C1BA 1S59A 3RB6A 4P72A 5DLFA 1NK7A 2W9BB 2JNJA 4CH7A 2DGTA 2WBRA 1FJEB 1TTHB 4QOTA 3BSCA 3PO5A 1JJHA 4PG7A 3IS9A 4K4UA 4CLPA 3CULA 4LREA 5L1LA 2A10A 1R27B 1WF2A 3BKFA 4ZS6A 1FEHA 1NUEA 2OSQA 5KFTA 4ZVTB 3L7OA 3I56S 4J5OA 2IHR1 1VQ8S 2ILYA 1S1VA 4C3KA 3D4JA 2VICA 4Z7CA 3EXCX 2D3ZA 2OGUA 3C2PA 2R7UA 5J2PB 2VPWB 1H2UX 1QDUB 5KFPA 1IKYB 2N4CA 2VQEF 3GFZA 3P5TL 4JI1J 3PACA 3GLJA 1OWXA 5DJBA 2ROEA 2XY7A 4F36A 3C16B 1RBOB 2MZQA 2KTQA 4NPOA 3MEKA 5K14B 2QV6A 3FZ2A 3SSQA 4DBQA 1R31A 5F8JA 3NGKA 5D15A 2JWNA 5DG8A 4B3RF 2J9DA 2PMZD 1BXNA 3SFGA 1U8WA 3MPVA 5KFOA 3JS9A 5F8GA 4NX9A 1C0TB 1NSKL 3IMQJ 4JV5J 4NLVA 1W7WA 2DCLA 3MM5B 2LU2A 3QMQA 4B9MA 3A8EA 2C2RA 3P6YC 3OR1A 3HO1A 2RH3A 1CQMA 3D28A 1SC4B 4IO1A 1NK6A 2F8HA 3CJRA 4KO0B 3I6PA 1VLYA 2WSEC 4LF7F 5KTQA 4DL3A 1LK5A 2CJKA 5DGAA 2UXBJ 2JH3A 1YRTA 4WFBQ 1S97A 2HMIB 4DCJB 4F3QA 2VBWA 4CCHA 3FBFA 3CSKA 1Q8KA 3BGRA 2IRUA 4M5GA 1GXLA 2DTJA 1X5SA 3HD1A 3IG1A 4RBVA 4URSA 1CBKA 3HHLC 4NI2A 1S0MA 2GJIA 1LW2A 1VJWA 5MAOA 1N32F 4FPRA 2WK4A 3K0JA 2IDEA 2AJ2A 2PFFB 3GYXB 1VBKA 4GMKA 3BM7A 1ZZNA 2XSFA 4FXVA 1YBUA 1L3SA 1F9EB 5DM6Q 4ZLPA 3MM7A 5L8RC 2QYGA 3GJSB 2V2ZA 1S7IA 4FVCA 2HBZB 3DFEA 3MTJA 4LSNB 2CNKB 3UI3A 1VQYA 4CLSA 4ZLLA 1SL2A 4JI4J 3SSSA 4KRWA 3IN5A 2E1MC 5D6GA 4KR0B 1R89A 5IC4B 3OV7A 2MZSA 1KS2A 3DOLB 4FS2A 4JUZA 4P74A 3NP5A 2WAQD 4PR6A 4KAIA 5DZ6A 5F8NA 2GQ2A 3M8QA 2BJ8A 3MMCA 4OZ2A 2F65A 2VG5A 3T19A 3OTOF 3AA9A 3BREA 1LFPA 4BC9A 2GW8A 4Q8FA 4X62F 2MB0B 3QAUA 5IQ6A 3MECB 4NLTA 1T9XA 4GVBA 5HO4A 1FD2A 2YKMB 2PMHA 4P9SA 3KHHA 2HWTA 2ACMA 1M5HA 4K7QA 3R5BA 3X1LB 4B9LA 1GT8A 1C1BB 5G4DA 2DXDA 4A8YA 2CJQA 3MEDA 1XK8A 1N33J 2H5EA 3LWLA 3GYGA 5CCMA 3IS9B 3VALA 2OIHA 5B0GA 2C42A 3NAHA 3QO9A 1HA1A 5GMKa 1VS3A 2BABA 4A47A 3GFYA 3CJKA 1H73A 2DK2A 2ALZA 2XNQA 3CO9A 3VVTA 2BOAA 5H1SV 1EHWA 3ENQA 2B9YA 4MK7A 3EUNA 1GTHA 4LR7A 2PI4A 1BY9A 1D8ZA 4DL5A 4RX6A 4DUZJ 4USHA 4CWBA 1UL3A 1OQ3A 1M1KT 4DR2J 4FYDA 3NNCA 3PYEA 4LRDA 2SXLA 4YB6A 1A0OB 5IV4A 2C28A 3JQKA 2W9CB 1FEEA 4DV0F 3J80U 1M1GA 4OYBA 3N28A 3NG8A 1Q16B 1VQ7S 2VKRA 3B4MA 3EZ5A 5FIIA 4EWTA 2CADA 2DGXA 4K4ZA 4GO7X 2GCFA 3ZTSA 4XO0A 2J76E 1QTMA 2FPHX 3MCOA 3K7RA 2DXEA 3P49B 3M6VA 5A8WA 9RUBA 2G0JA 3OR1B 3UN2A 2KI2A 1M5KC 1EQMA 5U47A 3E51A 1IWGA 1P6TA 2HGMA 2V9KA 3J81U 4ED1A 2YPZA 5KFFA 2HFUA 2DYAA 2ZH6A 3IBWA 1UP1A 5KT6A 2HRTA 1WORA 2KFYA 2YH1A 3Q8VA 5HLFA 3BGRB 5HI7A 2AYMA 3IG1B 5IM0A 2IBOA 4NI2B 1RT1A 5HL7Q 3QZ7A 2MMYA 4U96A 4D3GA 2WHOA 3V6HA 4C0HA 1SI9A 4J9MA 1VCTA 1YITS 2YVSA 1I94F 3ET6A 5E0OA 1Q5YA 4I2PA 3JTOA 1NNDA 1R7IA 4NASA 3AHPA 4AD6A 2EFQA 5C25B 3RG6A 4DFKA 2KHDA 4W92B 2QA1A 1U4BA 3NS6A 3Q0AA 3BB5A 1PAEX 1F6TA 2DGUA 4O3PA 4UTGA 2VU5A 2CXEA 4QYRA 4E98A 4PXEA 1HIYA 2CQ0A 1RWWB 3GU0A 1OSCA 4IRCA 3W7BA 2B9EA 1MU2A 4A8XA 2RF2A 1H74A 2LA6A 3MFIA 4DV5J 4OV6A 1T9UA 3IR6B 3Q89A 3MMCB 2EG2A 2VG5B 2KU7A 1FFWB 4KGXB 5ETTA 3JYTA 2XMKA 1Y7PA 1SKWA 2PEHA 4R0EA 2VG6A 3TUPA 3VV2B 3C15A 4GVBB 5KFVA 2XM3A 4BCAA 1WEXA 4OYOA 1U1MA 3TA1A 2BZ2A 1FF2A 5CZVA 1FJCA 3FMBA 2Y0SD 3J7AN 1L3TA 2QX0A 3PYDA 1HD0A 4B3SF 1UA1A 4TU7A 1X5PA 2IA6A 5AJ3F 3FVYA 2DNYA 5C2CA 4FYYB 4PXBA 2L9DA 3KK1A 3GILA 4LF8F 3A3PB 3OFGA 3G6XA 3JAMU 4WP9A 2PDAA 3LF0A 3H98A 2OTLS 4LF6F 3CJ8A 2CVIA 3QO9B 1HR0F 3CWJA 5D4LA 2RRBA 1RISA 3CJKB 5GAGU 3GG1A 1RJJA 3HULA 2BX6A 4PG4A 4DPOA 2AYGA 1MWQA 1K73T 3I4PA 1K8AT 2JLEA 2QN6B 2AJ4A 1XR5A 3OL8A 2B3TB 2BKPA 3N5FA 4B9VA 3TANA 2ZH2A 4C48A 4K0KJ 1N56A 2HEKA 2FC9A 2OPRA 2WVDA 2AP6A 3KDOA 4O3QA 2GIFA 1HW8A 1FD8A 2QSWA 5SUHA 1XNRJ 1IKXA 1F2HA 1PC4A 1FDBA 2B43A 1KD1T 3VGVA 1H3DA 1TKTA 1FVSA 2B6AA 2XMTA 2LXIA 2HQGA 1BE4A 2CJBA 1LW0B 3TEGA 4ZVOB 2LXFA 3CO0P 2ZJPQ 3K5LA 1VK3A 1TL7B 3RR7A 4NE9C 1X4CA 2AMCB 4NLPA 3GV8B 4GC7A 3J80Y 1UPMB 4I67A 4FYWB 3LP1B 1IJEB 3RJMB 3UR0A 2J7UA 2DR8A 3TA2A 1QAJA 3DGVA 3WDOA 2CRLA 3UD3P 1AZSA 5DETA 4YHHF 1VQPS 3VGTA 5IM0B 4Q45A 4M5NA 3MD3A 3V2UC 2CWXA 2FUG9 2OMLA 4EK2A 1T3OA 3T3FA 3NBPA 3O3LA 2AEJA 2FYXA 3ET6B 4I2PB 6FD1A 2FY1A 2DEJA 4CH1A 1RWVB 1KQSR 1VIOA 2N82B 3MXHP 3NGRA 2XO7A 2VIHA 2OTJS 2D74B 2GHPA 3PIPQ 3PVXA 2DGQA 3LAMA 4ES1A 4EBCA 2PD1A 1NDKA 2EFPA 2X1BA 1TK5A 5ADZA 5A2QU 4ZPCA 2EWHA 4LQ9A 3LP2A 1TL4A 2J9DE 2C2EA 2Z58B 2HQCA 4CLWA 1QAYA 4ZVSB 1Q95G 3OFFA 2HZAA 4PKDB 2LXUA 4OI1A 4OIXA 1REVA 1BD6A 1MU2B 3PEJA 3O2IA 1X4FA 5IT0A 3H42A 2V6AA 2B4VA 1KP6A 1SJQA 2EEYA 1SBRA 1FE4A 2W2QP 3JYTB 2UXDF 3R7BB 1O6XA 5GVQA 2IJFA 1WHWA 3PXGa 1K1SA 1QJHA 4A4JA 2V4RA 2VG6B 3BGUA 4JI0J 3C15B 1H72C 1PBAA 1RABB 2M88A 3DLHA 3QSIA 2V8DA 3P45B 2BJ1A 3QIPA 2MZ1A 2B4PA 1J2VA 1DFDA 2BRKA 1FI4A 3ENAA 2F63A 2YWHA 3K57A 1Q5VA 5KOWA 1JXLA 2AJ0A 4QR0A 2VQFJ 2RUGA 1JNRB 2DPJA 4RNMA 2KHCA 2C2OB 2P9CA 3KK1B 4CO0A 4CM0A 4B3MF 5I42A 1WTFA 4OZ5A 2E29A 2K8GA 3FSIA 2ADBA 1IBLJ 4DFMA 1VBZA 1Y5LB 3QNWB 3N6NA 4JI7J 1RQ0A 3W2WA 2E1PA 2OPQB 2NUUG 4QIFA 2B4UA 5A8KA 3K5PA 2CWKA 4B9UA 2RILA 1R8PA 4ED6A 5GAGI 2XI2A 4IFYB 4U8YA 1WD6A 4B9SA 3EMTA 1UVKA 1SXLA 2ASJA 1Y3KA 5T41A 5HATA 3KHLA 1CQNA 2HWHA 1RT4A 1IBCB 1CEZA 2B5JA 2JVRA 2VFVA 1S7HA 3TAPA 3PR4A 4KC5A 3AD9C 4C6AA 1K44A 3QT8A 4WYLA 3AH6A 2YKQA 2ZH8A 4O0NA 1FKOB 5I3PA 4DHVA 1CSJA 2VL1A 1IKXB 3ENWA 1TKTB 1WEYA 2B6AB 4OFZA 1C1CA 1R0CB 4OX7A 4CO3A 2J0QD 3PO4A 3PDNA 2BEFA 4DR3J 4USMA 3UPFA 1Q53A 4L6V3 4RNOA 1R8BA 5B0EA 2DHHA 2ILZA 2L48A 4F67A 5GMEA 1X31C 4P2SA 1HL6A 3KG4A 5CYMA 3HK2A 3E01A 4OYZA 1KHWA 2KXNB 2QRRA 3IWNC 1HHTP 4OX9J 2FVCA 4DMZA 1RE1B 1AZSB 4OYWA 4JV1A 4QIGA 3AY0A 2GHVC 3ZZZA 2V67A 4M5KA 2A0FB 5AE3A 2X3DA 4ED8A 3OTCA 1PJ5A 3HVWA 4ED0A 1N5SA 3NBPB 4WK3A 5KFCA 1EIYB 4KFBA 1XNQF 2ZOMA 1D1UA 2LMIA 5HQ8A 1M1HA 1CPZA 2HVHA 4NZ6A 2KZMA 4UQGA 4J9RA 2LQ8A 2A18A 3N6LA 2AGPA 1RT7A 2EFNA 3CJQA 5CXTA 1WF0A 1U1KA 6AT1B 2PN6A 2CPZA 1SIWB 2WCXA 2HHHF 2VONA 2FJXA 1VRTA 3NCPA 3LP2B 2UVRA 4X66F 5AXNA 1UA0A 1HQ2A 3FNNA 3W2VA 3SEOA 3NL0A 5B0DA 3U7JA 1N5TA 1Y00A 2F1FA 4HL9A 1REVB 2F4FA 3BGOP 4ALZA 1IM6A 2EFOA 5KFLA 2W01A 4I68A 1ZZFA 2W2PP 1Y5NB 2JOQA 2BJEA 3R6GB 1FE0A 3BZQA 1WHYA 4PQUA 2CFXA 2B7CB 2NSCA 4Y00A 2N3OA 1QY7A 2IVFB 2J6TA 4NRTA 4QU6A 1P8GA 4P7TA 2AGOA 2FZGB 1VMBA 1G7CB 3GCXP 1S76D 2C3MA 4USWA 4ZVFA 1MN7A 2EFGA 2PSZA 3QIPB 2MY8A 2ZBIA 4J37A 4L3NA 3UFCX 2EVZA 5DS7A 2DHXA 5I4MA 3MCMA 2YQ3A 2IRXA 3TJ8A 2WTFA 4DR1F 2H9ZA 4ZVGA 1XR6A 5KG5A 5LXYA 2HVZA 4YOEA 1JIHA 1FX4A 3HPOA 3OVSA 3NGSA 1T05A 2K7JA 2MHNA 5CD4A 3RAXA 2HVDA 2QFJA 4DL7A 5D0GA 1KC8T 1CS4A 4RR5A 1N34F 1S6QB 3W2WB 2LEPA 4DXLA 2XMMA 2XCAA 2DHAA 4K5SA 1IBKJ 4G1PA 3N6MA 2NPIA 3O44A 5KFXA 1CVJA 4I56A 2OEMA 1XMBA 2YX4A 3MPYA 1WELA 3KNAA 4CO2A 3BO3A 4X65F 3AOAA 1WG1A 4DDFA 4CIOA 1VHIA 1RT4B 2B5JB 1VQNS 3FZBA 3QJPA 4ZDNA 1KLMB 2M2BA 4OQJA 4NL5A 1S10A 1B70B 4CQ1A 3ELHA 3QGGA 4JYAF 4NEYA 3QWUA 3PEHA 2BOPA 2ZOGA 4TXSA 2CQHA 4YB5A 5B0CA 2AT1B 4DR6F 3SV3A 3D9BA 3KLFA 2M52A 3CDAA 3FCVA 1C1CB 3PW7A 3WIVA 2RQMA 4ENOA 2WVEA 4IFVA 1GMWA 2ATCB 4RO0A 5F3TA 1RTDA 1VHFA 1MW7A 1N32J 4KH1B 5CYMB 4WF9Q 3DRRA 3E01B 4LBIA 4DV6F 1KSPA 1FXDA 4AQYJ 3MEEA 5B08A 4AE5A 2C3PA 2V8VA 1DTQB 3QRPA 3I87A 2J6SA 2AF6A 5A76A 2H5JB 1VGYA 1O8BA 1QLNA 5D8HB 1HYSA 1RT2A 2LQ9A 3CCLS 2LFVA 2DO4A 4KFBB 5ITHA 5K8MA 3PYFA 4DS5A 3MI7X 4Q0BA 4M5LA 2H4YB 2DGWA 4PUOA 1UW4A 2XYGB 4RNHA 3CTRA 3TARA 2G2ZA 1RT7B 1AB8A 2ROPA 3QFWA 3QAEA 5GMDA 2D3UA 5KFHA 3CT9A 3ZZUA 4K4WA 1Y4ZB 1VRTB 1Q78A 4HYKA 3T6JA 5CH7B 3M8SA 2HS3A 3ILIA 1UVIA 4MIBA 3BPSP 4M5DB 2C1EB 3L7UA 1RT6B 1S9GA 4KIAA 1LWFA 1XJWB 4HACA 1UMJA 1TKXA 3PIOQ 4L75A 3H4DA 3CB4A 3SDEA 3MUVP 1TAQA 2CQ1A 2FJDB 4PQUB 2FHMA 1ZETA 2L9WA 2K1RA 2BE2A 3W5YA 3GJTB 2C2ZB 4F7VA 3G6ES 4DR7F 4DZDA 2Q6CA 3Q2SC 4IO9Q 2XLKA 1URNA 2XMAA 1MNEA 4F4ZA 2P9GA 2N4DA 2XCPA 4WP8A 2MZRA 4X64F 3NS5A 2C3YA 3RRKA 3NEKA 4ZN3A 1B7YB 1QSYA 3CXCR 2CQPA 3FEXB 2PT0A 2VFTA 4I6YA 5KFQA 1FERA 1KTQA 1CULA 3ZZRA 3W61A 6FDRA 2UUCJ 3TAMA 4JI8J 4WFZA 4DV0J 4HDGA 2BYCA 4CLFA 4NXNF 4WJBA 3S7RA 2FLPA 1BQNA 2V2KA 3MDFA 4RUCA 4GC6A 4HTJA 3D0IE 3LOUA 4HHHA 3POTA 2FIUA 1DY3A 1R43A 1AW0A 5LOQA 2H51B 4OHWA 4B3OB 3HSGA 2Y1RI 2BR0A 4L76A 1SV5A 4LFCF 4LMZA 2BE9B 4P2MA 2I2YA 3FQKA 4QWDA 2BQRA 3UDLA 2MKYA 2VBXA 2A1BA 1FJGJ 1OPZA 1AROP 5D0HA 3KLFB 1NJWA 2FVQA 3EZUA 1H6KX 4OLPA 1D9AA 1RI7A 2CJAA 1NKCA 1NU4A 4FP9A 2RS8A 1Y3JA 1RAOA 3FGVA 1BWVA 4IYQA 2NYHA 1RTDB 3PRBA 4EFAC 3A12A 3IR7B 3DRRB 3OTDA 3TEHB 5KT7A 3O5TB 4DL0C 2D41A 3PY8A 1RAAB 2C2NA 1HHQA 2ZUAA 3S6EA 1ZAVA 4N77A 4TQSA 5F8MA 1BUXA 1I94J 3OJSA 2KYZA 3OPKA 1Z1ZA 3F73A 2R7SA 4R0JA 1HYSB 1RT2B 4NLDA 2HYIB 2C3UA 3GR1A 2C22A 3Q2TC 2NXUA 3CIMA 2GIRA 3NRBA 1S4FA 1P9YA 2OO4A 3ZZPA 1WF1A 4J9VA 2D1CA 1VQSA 1FCAA 2BKOA 4Q0BB 4RW9A 4PUOB 4UW2A 1RXOB 2QA4S 1JXVA 2ZBQA 4DR5F 2ZJQQ 4OJ1A 4QW8A 3HHLA 3CPWR 2VPZB 3QIDA 2K06A 2I1RA 3JB9k 3C6TA 4Y2CA 5E7OB 4ECRA 2KFZA 2ATLA 1G1XA 2JEGA 2JFDA 3AT1B 1P1TA 2B7BB 1ZPWX 4L73A 1XERA 3IGNA 2YWWA 5IWAF 1AFIA 2EFVA 4CNZA 1S9GB 1LWFB 2MQLA 4RJVA 1TKXB 2ZWOA 2V94A 2IM3A 3SDEB 3A13A 1FHTA 4KY3A 3GZ7A 4K4SA 1UVNA 4WK1A 5F9NA 2E5LF 1BLUA 1V6HA 2K1RB 5AJ3J 1YBTA 5D4PA 2Y1IA 2RD5C 4A46A 4N5SA 1N48A 4QZVB 5DRKA 5JMNA 3QGIA 3D3CJ 1NSPA 2CQBA 3VGUA 1Y11A 4LR8A 4YP3A 3F56A 1B0TA 2UVVA 4I6AA 2UUBF 2PGCA 4ICLA 2WW8A 5L46A 3J7Z5 3L95X 4RUHA 2QYCA 3CUNA 1YQHA 3X3UA 3K5NA 3BO4A 1R6YA 3DI6A 2FVRA 3MR7A 2EPIA 4NMLA 3G6VA 4QQBA 1CULB 3FBEA 2Z2LA 4TYBA 3M7VA 1NO8A 2HURA 2U2FA 3SCJE 2ZH4A 1U02A 3TAMB 3FEZA 3HVTA 3S1TA 5THWA 3R97A 1VQ5S 2X7IA 3KK2A 2NR0A 1BQNB 3W63A 2ADCA 3PKYA 2OP5A 3BBFA 2FZCB 3EGVA 4TKTA 3POTB 3CJ0A 1VQKS 3UW1A 4IG0A 4M5MA 1IVZA 1SV5B 4FZVA 3D54A 5I3QA 4P7VA 4EZ9A 4DL6A 2YY3A 1VR6A 1RKIA 3KJVB 5FJ4A 1RYRA 5J2QA 2XY6A 3GIRA 2HRYA 2XYPB 2QMWA 3HHLD 1L3UA 4ATNA 1JLCB 2QMUB 1WC0A 4MAKA 1HQEB 4LF4J 4QR2A 2J0WA 3CNQP 3BSOA 3QQCD 2DRBA 3MZIA 3EGZA 1ZA2B 4ETXA 5D0EA 4KHPF 1N0UA 2AEMA 2LKZA 5F8HA 5AXKA 2JLGA 4DSJA 3C19A 3THVA 3BDPA 1TAUA 1R6VA 5KOXA 2CPHA 1T02A 5A8RA 3H2UB 4RWWA 2R8HA 1P27B 1T9WA 1DTTA 3EVMA 2W2MP 1X4GA 1DQ9A 1B64A 3VQTA 5B7WA 3FJ2A 3N79A 4RW8A 1YDLA 1Q4RA 3M2UA 1TZ0A 4MMOA 4KYZA 2ZOFA 4TU9A 4RW9B 3PW2A 4PYAA 3LALA 1YZ7A 1QSLA 2QA2A 2HHSA 3QT6A 2W8LA 2EKYA 2FY8A 9ATCB 2YX1A 1IUJA 3HHLB 1NZAA 1MMLA 4FF4A 1CJVA 5KFMA 1KRPA 2O5DA 2N7CA 3C6TB 2UXDJ 2YNGA 1B3TA 1RT3A 2HIYA 1ZAWA 1F5CA 4X4NA 1N4LA 4DX8H 4DUYF 2V50A 5DDOC 4ZPTR 4UUXA 3GFXA 3DLLQ 1ICEB 4PYDA 3H7HB 3KKFA 1NEEA 1OS5A 3OLAA 4IRKA 3K5MA 1VQ6S 2XI3A 3KK3A 1RAGB 1D3WA 2VZ9A 1LK7A 3DM2A 3Q8SB 4A48A 7FD1A 2FHJD 4G1QA 1UJ5A 1WC1A 1JLGA 2COLA 1FFGB 4O3OA 2C2DA 7AT1B 4J9OA 4GKJF 4ICLB 3ICLA 2MGZA 1U1NA 1U0HA 2ZNZA 4CYUA 2AHOB 1M5OC 1U49A 3L7PA 2H54B 2W2OP 4NCGA 3Q8UA 2NPFA 3DOMB 1PGZA 4OYIA 4EYHB 3KTQA 2CNLB 3U02A 4U7UD 3M6WA 4C4WA 4QWAA 4O4RA 1ZAXA 3I0RB 2W4PA 1J5OA 1RWUA 2O01C 1JXEA 3DYAA 2YTCA 1V3RA 2B0GA 4GKKF 3TP2A 3OVBA 3V81B 2ACYA 3W1YC 3HVTB 2RQCA 3BGLA 3OXGA 1EETA 3KK2B 3TJ9A 2R8KA 1JB0C 3VHQA 2IVYA 3CDUA 1RHKB 3MMJA 3EDRB 2PFDA 1EP4A 2R4FA 4J9LA 2JX2A 1KDNA 1X9WA 4C8LA 1X7VA 5LSOA 5J2QB 1NHKL 2DNHA 5HJXA 4USTA 1UFLA 2QEXS 3IO1A 5ETVA 1LV5A 3KHGA 5AXMA 4MKYA 1GX6A 3TZZA 2E5GA 2X1FA 2RIJA 1QTNB 1HBUA 4A8SA 4ECQA 2PC6A 1U7LA 3DCAA 1RYSA 3OD2A 5GAEU 5KFKA 1FK9A 4IR1A 1XNQJ 3FFIA 5KT2A 5HBMA 1KLNA 3CMAS 2FTRA 5A8RB 1N8RT 1H2TZ 2LDIA 1VYAA 1NJIT 4CTAA 3H25A 3GJQB 2KN4A 3A3NB 1U6BA 3RYLA 4LF5F 2OI2A 1QM9A 2GO8A 2E1CA 4L72B 4UOGA 3IGVA 1DZ5A 4RW8B 4PABA 2HFZA 2A2DA 3M2UB 3K58A 2V68A 2MTLA 2GA7A 4X66J 2D7SA 4LF2A 5KAKA 1QE1B 2AU0A 4IOAQ 1FESA 4DPUA 2V0NA 4IG3B 1EB0A 2E1AA 3W8GA 2APOA 4MYUA 4I7FA 5C7PA 3I55S 1RTIA 4Q2MA 2NS1B 3IWXA 4TY8A 1FRKA 4F0KA 2L41A 4I1TA 1ZYQA 4O23A 1LEOA 2YNGB 1REGX 1TFYA 1X0PA 3CJ3A 2MXYA 2W9BA 1RT3B 4XPCA 1QAIA 4F4KA 3I5AA 2QIFA 4OI6A 2GVDA 2K3IA 2BM0A 3ZZTA 5F8IA 1EKRA 4DR1J 4NLXA 4NYZA 3ZTRA 3BKTA 1TUGB 2OD4A 1CJKA 1SQGA 2VJUA 3KK3B 1M5VC 3FCWA 2QMXA 4KH0B 3DM2B 3O1LA 4J9QA 2IIHA 3DLKA 5EX3A 1DURA 1PO6A 2CKWA 5A0YB 3H5XA 4ED4A 1JLGB 4DU7A 4ED3A 5ETQA 2YH0A 4EO6A 2Q3PA 4KTQA 4KGMA 1ZM2A 2QLWA 8RUCA 4DV4J 2Y1LB 2MGZB 2KG0A 5IT9U 1U0HB 4CYUB 3C3LA 4PWDB 4C8MA 3QJLA 3CCMS 1F5BA 3LANA 2G4BA 4DF4A 4J9PA 3BDEA 5F0WA 4ZITA 4X65J 1S0OA 3NGUA 1R0BG 4DV1F 2HNZA 1EJ7L 3SBMA 3GQCA 1FJ7A 1C0UA 1FRMA 1UKUA 5A6PA 1J5OB 3UDCA 3K5OA 1C0TA 3BH7B 4LRFA 3DYAB 1HNXF 4PG6A 2F8MA 2KFNA 3MCSA 2FC8A 2HK2A 3MM5A 3RAQA 4DSLA 4JYAJ 1FT8A 4WBFA 3KFWX 4DR6J 2JL9A 4GRSA 1ZBTA 4KO0A 1FNOA 1ZS6A 4WFYA 1WNEA 2HHWA 4EBEA 3HM9A 2P8IA 2CQGA 5CA5A 2BW2A 1EP4B 4X4RA 2GAHC 5CCLA 2FGCA 2Z2MA 1UWAA 3AB4B 4G1IA 4NMXA 4WPAA 4X4QA 1YJNS 4N8NA 2DRAA 5KFAA 4D3HA 2VV5A 2KYXA 1VQOS 2WZ1A 5H9FK 5D0RA 5KFWA 4AXJA 2GGPA 4FKYA 3SFUA 1PILA 4DV7J 3MAQA 5HP1B 3T5HA 1UEKA 4KPYA 1UVJA 3EGNA 1RA7A 1HBUB 1RWXB 4XPEA 3IAS9 5T14A 4NZ0A 4LSNA 4OZ0A 3FFIB 2VASA 3SYZA 5HBMB 2IM0A 5GAEI 1MROA 4H4KC 3KHRA 4J7CA 2WVCA 3UNYA 5EWFA 4OZJA 2IFXA 2UUAJ 3MGJA 5E3RA 4P71A 5FLXY 2B9XA 1BHNA 2NXCA 1RAIB 1IKWA 1F60B 3PG9A 3QT7A 1U6FA 1Q79A 1WOSA 2DH9A 2IDLA 3GWCA 4ZHRB 4HI2A 5BJRA 3MR5A 1JLFA 2RDDA 5FD1A 3C8YA 4FNIA 2KG1A 4I7FB 3G4SS 1APSA 1TR0A 2GAGC 4TY8B 3EZOA 1D9FA 4RPFA 4F26A 4ZLJA 3CJSA 1X8DA 1PJ7A 1RBAA 3MAAA 2Z0GA 2JHEA 1K9MT 4NYOA 2LEBA 2BDPA 5EWEA 3ZNJ1 1KNZA 1TQLA 2KXHA 3AOBA 2UXBF 4XDDA 5ETRA 4DN9A 2FJVA 4DFJA 2GVDB 4EI2A 1OYEA 5ETMA 1N5VA 1FFSB 4YR0A 2H3EB 4F2RA 2D9PA 4X64J 2EC2A 5KT4A 5CD4H 1CJKB 4ELUA 4WP3A 4AL5A 3CJ2A 5DQGA 2VDIA 1FRXA 4U67Q 3ZZYA 3MPDA 3LGNA 1E6VA 2BVZA 3AODA 2M0GB 3DLKB 3MOJB 1YGYA 5I3UB 3B82A 4LF1A 2DNPA 1K0VA 3I96A 2CVEA 1SJFA 1HD1A 4ZK7M 4DZ6A 1X60A 1YLXA 4NLWA 5B0BA 1J5EJ 2MKHA 5LMNJ 2R7XA 1NJZA 3MAHA 2MLXA 4ZJLA 4K4XA 1W2BR 3KUHA 2UZAA 2FHKA 2W9CA 2EC0A 3DHXA 4NXNJ 4JI4F 1U24A 5KG2A 2HNZB 4FKXA 4ZVHA 1C0UB 1NJYA 3JTNA 2B8PA 5GAHU 2GFFA 4URQU 3M30B 2XWXA 4LFCJ 1I1GA 2BJ3A 1TUVA 3TVKA 4MIAA 4UOHA 4KV8A 4OYMA 3NCRA 1HWIA 5JVHQ 4QU7A 2BMBA 2GJFA 5KG3A 3DDKA 2ZKUA 4C3LA 4L3KA 4LBPA 2R7TA 3R1LA 2CG4A 4Y2KA 2ZM6F 4WU2A 2KVIA 4DQQA 3ILLA 1T03A 1OIAA 2DR6A 2N7YA 1H38A 4UF4A 5D77A 3E8OA 1I6JA 2LLZA 1VQLS 4G6VB 2QE5A 3GIMA 1LXJA 2MJNA 1ZTWA 3ADAC 3RR8A 1N33F 3I9ZA 2F4VF 1XC9A 4PPDA 2XMWA 2IM1A 2XMVA 1F3VA 2R42A 3UN3A 3PTWA 2GGPB 2JEFA 2NLWA 3BKUA 5C25A 4IDKA 3TVZA 3R5JB 4MH8A 2VHGA 1AXQA 2OEJA 3ONQA 2X1AA 4AYBD 3CC2S 1E6YA 1N5QA 4C97A 4ECXA 2XY5A 1RHJB 1X4DA 1PJ6A 2QL7B 3MURP 1NHVA 1S0VA 4EEYA 3OFEA 1MROB 2PEBA 3HI9A 4PZVA 4DR2F 4KGVB 1G3OA 4XTTA 3TJAA 4C8ZA 3P3DA 2HNDB 4B3TJ 3DLJA 4FNHA 1IKWB 1HI8A 2EK1A 2G2YA 3FSYA 3ZZOA 2IMWP 1JLFB 1WDDA 1X4HA 4R8UA 4MYTA 4V1Ak 2CZVC 4RKUC 3QSYB 2F7VA 3ZTOA 2KL8A 2DGOA 3D1QA 4AFFA 3GMGA 4KSEB 5HVGA 3MAAB 1TKZB 2GO9A 3RRHA 2DIUA 5HMWA 1FVQA 1WOOA 3P96A 3SZ2A 1CC7A 1IJFB 3HFVA 2CYYA 4EU0A 3FBCA 2NYIA 1IR1A 2I9SA 3CDEA 4YR2A 3F41A 5BR8J 4F4AA 4X4PA 2K2PA 4URGA 1MLAA 2LEAA 3HZGA 4KHMA 3LAKA 2JSXA 3DOKA 1RWOB 2MQPA 2Z8QA 1E6VB 1S12A 4TN2A 3CCJS 1RAHB 3QRRA 3MUTP 1RU1A 2P5VA 2OPPA 4EMDA 1R8AA 4OV1A 2VUGA 4K59A 5IS2A 3DGPA 3M9OB 2R7QA 4Z7YA 2H65B 1O51A 3FK4A 2BQ3A 1P9QC 1TL3B 3B6BA 4RW6B 2L08A 2PA3A 3AXKA 3CE8A 2E5IA 3LA0A 5ETOA 3GPAA 3FRYA 3PM9A 3H5UA 1IXKA 5ETKA 5BYQA 1IR0A
chains in the Genus database with same CATH topology
2W8KA 2CQ1A 4K4TA 2FJDB 4PQUB 2FHMA 2MSTA 2XS5A 3ISZA 4DN0A 1ZETA 1U1LA 2FDNA 4PRFA 1S6OA 1LW0A 1NRKA 2P6TA 4OX9F 4Z2XA 2L9WA 2V8HA 4LIRA 1QVFR 4WTYA 1VQ9S 4MK8A 4HTIA 2GMJA 2HNYA 3BQ0A 2K1RA 2BE2A 1ZPVA 4F25A 4QPXA 2R2RA 4YEAA 1MMNA 2OD6A 1S6PA 2Q6BA 1QE1A 1S49A 3UR3C 2XLJA 1KVIA 3G6ES 3I0SB 4DR7F 1GXUA 3DXBA 2ABYA 4Q2LA 5LJ3Y 2Q6CA 4ECUA 5GAHI 3Q2SC 2DNLA 4IO9Q 4KQZA 4DS4A 1XWLA 1YJUA 3OXFA 2XLKA 4KV8B 1URNA 1UETA 3KOAA 3OBIA 1Z2ZA 4IG3A 3OSPA 3GB0A 3PFEA 3MUMP 1MNEA 4PXDA 4F4ZA 2OPRB 3MMAA 4HT5A 1FK9B 3LP1A 4ZP7A 3DLEA 2P9GA 2VA3A 7FDRA 4TQRA 4YUDA 3V6KA 3V6JA 2N4DA 4DJBA 2XCPA 2AD9A 2BRLA 5H9EJ 4F4WA 4DFPA 4BS2A 5EGYA 2MZRA 2ZE2B 4X64F 1JK9B 3NS5A 2WONA 3DOLA 3QZ8A 4TLQA 4TY9A 4N47A 4RW4B 2VKZG 2C3YA 2PI5A 4DWIA 3RRKA 3GIKA 5L38A 3THTA 5LT5A 3LO3A 2KKHA 1HNVA 1HBNA 4CTAB 1T03B 2MY7A 2WBMA 2DH7A 3I82A 1QSYA 4X4UA 2WSCC 2YWGA 2IMOA 3CXCR 2CQPA 2I38A 3FEXB 5E3AA 4EBDA 2RQ4A 3VAGA 2PT0A 3PX0A 1VIXA 1RK8A 1DAXA 4I64A 3GG0A 1VBYA 2VFTA 3FRZA 2YKAA 4I6YA 2YKNA 3SCIE 4ED7A 5KFQA 1KONA 1HNZF 3Q8RB 2AQ4A 3K8VA 5EDWA 1M0SA 1U2FA 1V3ZA 3HVAA 2EI5A 4ZOSA 1FERA 1KTQA 3ZZRA 3F44A 1YIJS 6FDRA 5FDLA 3NMAA 4UQTA 4QWBA 2I5JA 3GFHA 5E33A 4WXOA 3B78A 4B02A 1F5AA 3T5LA 4QCLA 1H2VZ 3MECA 3TAMA 1XMQF 4YFUA 3M2VB 4WFAQ 4WFZA 3PHEA 3Q24A 1DRZA 2IYIA 2FLOA 2YKMA 4HDGA 2BYCA 3OSNA 2RMLA 2AW0A 2UV8A 5KT3A 4NXNF 1RTIB 4ECTA 4IDKB 3NNHA 4WJBA 4QIWD 4NA3A 3S7RA 1WACA 5GADI 4Q8EA 3BGFA 1BQNA 1U2RA 2V2KA 5F3ZA 3MDFA 4NLQA 4RUCA 2FLPA 4GC6A 4HTJA 1YWXA 3D0IE 1NKBA 5D3GA 3T1AA 4ETZA 3D2WA 2YNHB 3LOUA 3V4IA 5KFYA 5A0YA 1E6YB 4WU3A 5KG0A 1C1BA 2XB2D 1DHMA 1SH2A 3CJ4A 3POTA 2FIUA 3RB6A 1R43A 1AW0A 2W7PA 5DLFA 1NK7A 2W9BB 4CH7A 2XBPA 4OHWA 2DGTA 4B3OB 1URRA 4JOUA 2WBRA 2Y1RI 2BR0A 1SV5A 1FJEB 4LFCF 3CDBA 4LMZA 4QOTA 3BSCA 3PO5A 1ZH5A 2I2YA 3FQKA 4QWDA 4EO8A 1JJHA 4PG7A 3IS9A 4K4UA 3CULA 2M7SA 2BQRA 3UDLA 2ZZMA 2VBXA 2A1BA 3LW5C 4K0KF 3NGDA 5L1LA 2A10A 1R27B 4KB7A 1WF2A 1OPZA 4ZMMA 4PWDA 3OLBA 4ZS6A 1FEHA 1AROP 4N76A 2C3OA 2OSQA 5KFTA 3UCGA 3KLFB 1NJWA 1X9SA 2FVQA 1BQMA 3L7OA 1T7PA 3I56S 3R5DA 3EZUA 4J5OA 1KHVA 1H6KX 3QPIA 4OLPA 4DR4F 1D9AA 1RI7A 1GXTA 2R8IA 4LQ3A 2IHR1 3MM8A 2XHWA 2CJAA 3TW0A 1VQ8S 1R3NA 2ILYA 1S1VA 4C3KA 1NKCA 4LVNP 1HNIA 1NU4A 4WFNQ 2BV3A 4FP9A 4M94A 1SKRA 3RBDA 3EXCX 2RS8A 1Y3JA 1XNRF 2D3ZA 5T7LA 3DHWC 1K0TA 5EUHA 5L39A 3C2PA 2R7UA 1CLFA 4HT7A 4IKAA 5J2PB 1LQ9A 2VPWB 3FGVA 4IYQA 3T9NA 1H2UX 1R0AA 3KYLA 1CG2A 4OI3A 5KFPA 1RTDB 1IKYB 3BN4A 2N4CA 4R8UB 3T1YF 2VQEF 4OHZA 3GFZA 2E5JA 3PRBA 2KT3A 4EFAC 1MWYA 3IR7B 3OR2A 2BANA 3P5TL 3GV5B 3DRPA 4IQMA 3PACA 3DRRB 4F3MA 3OTDA 5KT7A 1OWXA 3O5TB 4OLOA 3DRXA 5DJBA 4DL0C 2D41A 2ROEA 4ID8A 3PY8A 4X4TA 5F8LA 2XY7A 4TLRA 2ZH9A 1WI8A 3LPYA 3S6EA 4NLSA 4EGLA 1YJWS 1ZAVA 4N77A 4IOCQ 3ETOA 1NHUA 4TQSA 5F8MA 2MZQA 4A8MP 2KTQA 2YNIB 2HHQA 4NPOA 2I8EA 3MEKA 3SQGA 5K14B 3OJSA 2KYZA 3LH2S 1Z1ZA 3OPKA 3F73A 2BACA 2QV6A 3FZ2A 3SSQA 1VC0A 2R7SA 4R0JA 4MFBA 3RZAA 1R31A 4DBQA 1HYSB 1RT2B 2HS0A 5F8JA 1JKHA 3NGKA 3J7A1 2JWNA 1R8HA 5B09A 2UU9F 1DQAA 4C98A 4NLDA 5DG8A 2C3UA 2HYIB 4DV2F 2HHPA 3GR1A 4V19J 2C22A 1S72S 3Q2TC 5KG6A 3LQVA 4B3RF 2QT7A 2NXUA 3OUYB 2J9DA 1JLBB 4IH6A 2PMZD 2ZHBA 4N41A 3SFGA 3MPVA 2DVIA 5KFOA 2XWYA 3CIMA 4ECSA 3DU6A 2GIRA 3NRBA 2KDOA 1S4FA 3EGWB 5F8GA 3RB4A 1V3SA 4NX9A 3CCQS 1C0TB 2OO4A 3ZZPA 1WF1A 2XNRA 4CT9A 2D1CA 4FXWA 5KFGA 3KLGA 2OPQA 2AJQA 2RB7A 1VQSA 1FCAA 4NLVA 4Q0BB 4RW9A 1HMVA 2FB0A 3U1MA 2HHVA 3MM6A 1ROFA 2KT5A 5DDQC 4PUOB 2DCLA 2FJBB 4UW2A 3MM5B 1SL1A 2LU2A 2HFNA 3QMQA 3SSRA 4B9MA 3A8EA 3JSYA 2C2RA 3DOKB 3IRXA 3P6YC 2QA4S 3OR1A 3HO1A 1O5JA 1S1UA 2D9OA 2RH3A 2JLFA 4WKRA 1RT5B 3M8PA 1CQMA 3D28A 4DR5F 2ZJQQ 1WWHA 4OJ1A 4QW8A 1WI6A 4IQXA 4IFYA 5HP1A 4IO1A 1NK6A 2F8HA 4KO0B 3ZFVA 2YKOA 3HHLA 3I6PA 3PNIA 1QSSA 4H4MB 1RDRA 1VLYA 3G71S 1OSDA 1S9EB 2WSEC 4LF7F 5KTQA 3CPWR 1LK5A 4DL3A 2CJKA 4DG1A 2VPZB 1TK8A 5DGAA 3QIDA 4TU8A 3V6DB 2OPPB 4Y65A 2I1RA 2JH3A 1YRTA 3C6TA 3JB9k 4Y2CA 5E7OB 4KHRA 4WFBQ 3VAKA 4ECRA 1D9DA 2KFZA 3DLGA 2ATLA 1S97A 2HMIB 2E7WA 3CVKA 2XG8A 1G1XA 4F3QA 2JEGA 2JFDA 2VBWA 4CCHA 1X5OA 2B9WA 2DNQA 5G0RA 1D8YA 3CSKA 1SC6A 1ZM3A 1P1TA 2B7BB 1WG5A 1PSDA 1ZPWX 4NLRA 2R9LA 1XERA 3IGNA 3BGRA 5IWAF 2IRUA 1C2PA 4WKYA 5I42B 1GXLA 2DTJA 1X5SA 4Q7AA 3IG1A 4RBVA 1N6QA 2EK6A 4URSA 2EFVA 1AFIA 4CNZA 3HHLC 1S9GB 2VFUA 2IC3A 2GJIA 1S0MA 1LWFB 1LW2A 1VJWA 2DNMA 5MAOA 3S01A 2A3JA 2MQLA 2RE1A 1FKOA 2X1GA 1N32F 2ZDPA 1TKXB 1IQZA 2UVUA 1TVRA 3J7YU 4FPRA 2V94A 2IM3A 2WK4A 3SDEB 3K0JA 3EPIA 3BEGB 2PFFB 3GYXB 5A8KB 1FHTA 2JVOA 4GMKA 3GZ7A 3BM7A 5KFEA 4PQAA 2F3JA 2XSFA 3CF5Q 5DG7A 1ZZNA 4K4SA 4DV4F 1KOOA 4FXVA 1X5TA 1YRXA 2OSRA 4WK1A 5F9NA 3HXMA 1SJ3P 1UVNA 2E5LF 1BLUA