1WHZA

Crystal structure of a hypothetical protein from thermus thermophilus hb8
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
70
structure length
70
Chain Sequence
MWMPPRPEEVARKLRRLGFVERMAKGGHRLYTHPDGRIVVVPFHSGELPKGTFKRILRDAGLTEEEFHNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein
publication title Crystal structure of a hypothetical protein from thermus thermophilus HB8
rcsb
source organism Thermus thermophilus
molecule tags Structural genomics, unknown function
total genus 21
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2004-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07927 HicA_toxin HicA toxin of bacterial toxin-antitoxin,
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.920.30 Alpha Beta 2-Layer Sandwich Metal Transport, Frataxin; Chain A Hypothetical protein. 1whzA00
4P78C 4C26A 1WHZA
chains in the Genus database with same CATH superfamily
2FQLA 3S5EA 1EKGA 3T3TA 3T3JA 1LY7A 1SOYA 4LP1A 4P78C 4LK8A 4C26A 3IMOA 2FUG7 3SSDA 3GD9A 3OEQA 2GA5A 3GD0A 3IAM7 3T3KA 3I9V7 4JPDA 1V5RA 1WHZA 3IAS7 2P1XA 3A5PA 3OERA 3SSEA 4HEA7 3S5FA 3T3XA 3SSCA 3S5DA 4HS5A 4EC2A 2EFFA 3S4MA 1D2MA 3T3LA 1EW4A
chains in the Genus database with same CATH topology
2E5OA 4P78C 1XNEA 4C26A 1TE7A 3IUWA 2KKUA 1WK2A 1S04A 1WHZA 2DP9A 2Z0TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4P78 C;  4C26 A;  1WHZ A; 
#chains in the Genus database with same CATH topology
 2FQL A;  3S5E A;  1EKG A;  3T3T A;  3T3J A;  1LY7 A;  1SOY A;  4LP1 A;  4P78 C;  4LK8 A;  4C26 A;  3IMO A;  2FUG 7;  3SSD A;  3GD9 A;  3OEQ A;  2GA5 A;  3GD0 A;  3IAM 7;  3T3K A;  3I9V 7;  4JPD A;  1V5R A;  1WHZ A;  3IAS 7;  2P1X A;  3A5P A;  3OER A;  3SSE A;  4HEA 7;  3S5F A;  3T3X A;  3SSC A;  3S5D A;  4HS5 A;  4EC2 A;  2EFF A;  3S4M A;  1D2M A;  3T3L A;  1EW4 A; 
#chains in the Genus database with same CATH homology
 2E5O A;  4P78 C;  1XNE A;  4C26 A;  1TE7 A;  3IUW A;  2KKU A;  1WK2 A;  1S04 A;  1WHZ A;  2DP9 A;  2Z0T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...