1WI3A

Solution structure of the homeodomain of kiaa1034 protein
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
71
structure length
71
Chain Sequence
b'GSSGSSGPRSRTKISLEALGILQSFIHDVGLYPDQEAIHTLSAQLDLPKHTIIKFFQNQRYHVKHSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-binding protein SATB2
publication title Solution structure of the homeodomain of KIAA1034 protein
rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 14
structure length 71
sequence length 71
ec nomenclature
pdb deposition date 2004-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1wi3A00
5C4XJ 4C3JJ 2E1OA 5HODA 3A01B 2Y9YA 1B72A 1IGNA 1QPIA 2MGQA 2CUEA 3TEDA 4MO7A 2TCTA 2FD5A 3MN2A 1MBHA 5GPAA 3LSRA 1X2MA 1MSFC 1K61A 4JX4A 3GTMJ 5FJ8J 2K9NA 4MFDA 1ZQ3P 2FJ1A 4JX5A 2B63J 2DMPA 4A3LJ 2ECBA 3GTKJ 5FKKA 1WI3A 3CDLA 1LFUP 2QCOA 1MBJA 2D5VA 4UUSA 4V2GA 2PMZN 2CUFA 1ZR2A 4X1EA 1Q1VA 2G0EA 2L7FP 5IYBJ 1X58A 3BTJA 5JLWA 1BL0A 3S1MJ 2ELKA 2JN6A 3M3YJ 3Q0UA 5K7ZA 1ETKA 2LD5A 3O8HA 4M6VA 2W48A 2ID3A 1EF4A 3HKZN 1JTYA 2DMNA 1CQTA 3HB9A 1PUFB 1AKHA 2ME6A 3TP0A 2DA4A 1OCTC 1F43A 5M3MJ 2AO9A 4XRMA 2Y31A 5IPAA 5J1YA 2XB5A 1MBKA 3JREA 2GLOA 5FLVA 1I50J 3ZQIA 3VPRA 2AHQA 2CQXA 4MFEA 1T56A 3BTIA 2RAEA 3RZDJ 1DU0A 1WH7A 5F0FA 2R5YB 4A3MJ 4FE4A 1U9NA 3HOZJ 5EDNA 1W0TA 3H0GJ 2XPUA 3BT9A 2LLKA 5F04A 2R5ZA 3BG5A 1IV6A 1MBGA 1SANA 5M5WJ 1H88C 4Y52J 2IBDA 3K7AJ 3SDGA 2DA6A 3SFIA 1WGXA 4IHXA 1Z77A 1OCPA 4EEFG 4XIDA 4CYCA 3NAUA 2K40A 1RETA 2VKEA 2E2JJ 2FQ4A 1FIAA 5F08A 4A3JJ 2ID6A 4BY1J 2JA8J 2DTZA 2JWTA 4W1UA 1JT6A 3S14J 3JRBA 3LSGA 1JT0A 2DMUA 2VI6A 2Y30A 3A01A 1TWFJ 1GV2A 2JJ7A 5EG0B 2XB0X 1WH5A 4MIMA 1FEXA 2O9LA 3S16J 2ECCA 1IDYA 1I3QJ 2TRTA 3O8GA 3JRGA 5EZHA 1H89C 1ITYA 2L9RA 1JUMA 2DA1A 3BR2A 4IEJA 3TW7A 2LVSA 1P7JA 1D5YA 3QQAA 1BJZA 2H1KA 3ZQFA 1A6IA 2NVTJ 1FJLA 1WPKA 3MVPA 3GTJJ 4A3KJ 2I10A 3W6VA 2L7ZA 3DEWA 3BQZA 5EGOB 2VPRA 4M3GA 2Y9ZA 1GT0C 2VUMJ 2M34A 3FK7A 1F36A 4DZPA 3FK6A 4XRSG 1IDZA 4D7MA 2MW8A 1PUFA 4AUXA 3PO2J 2K9SA 3BG3A 1LE8B 1MBFA 3FKIJ 2LY9A 4FISA 4L5EA 1TC3C 2GM4A 3WHCA 1T33A 2COBA 2EQRA 4DYRA 4XRSA 2M2EA 5J3LA 1ETXA 3L1PA 3HOXJ 1ETVA 2CU7A 2IEKA 3HM5A 4A3IJ 1GV5A 1H8AC 2R5YA 4QSHA 3TW6A 1FTTA 3Q3SA 2JA5J 3GBGA 3DCFA 1SFOJ 4A3FJ 4J19A 5IYDJ 4S0HB 1JJ6C 3GTQJ 4D5FA 1GVDA 3IH4A 2GBYA 5JLXA 3FISA 1HF0A 2CRGA 2WB1N 2O8KA 2HOAA 3HEFA 3HBLA 1ZKGA 4I76A 2NS7A 1R9TJ 1QVTA 1JTXA 1K83J 5E3OA 4C2MJ 2HI3A 3LOCA 2WV1A 2M9HA 3BG9A 1G2HA 1QVUA 4AYBN 1ZR4A 2EZKA 1Y1WJ 3OSGA 4DYCA 5EG0A 3NARA 3ZQCA 5M5XJ 1VF9A 4IHWA 2EH3A 3BR5A 1LFBA 1BW6A 3G1MA 3JRCA 4A3DJ 3IH3A 5EEAA 2NOGA 3GTOJ 5C4JJ 4X6AJ 2R93J 1JUPA 3S1QJ 5FKMA 3S1NJ 1XG1A 2XGDA 3QPLA 4QTRA 4RDUA 4B3AA 1RR7A 1ETYA 4W97A 3ZQGA 3BR3A 4B4CA 5J1RA 1JJ8C 2R7ZJ 5DTDA 1S7EA 2EBIA 3HOUJ 2EZIA 3OIOA 1TWHJ 4A3BJ 2FX0A 4JX6A 4Y7NJ 3Q0WA 3LNQA 5BNGA 2N8GA 2K9QA 3JRAA 3BR1A 3RZOJ 1I6HJ 3CCYA 3FIWA 1MNMC 5EGOA 1JKQC 4QIWN 4DYQA 1TWCJ 4BBRJ 2R0QC 5C3EJ 2DA5A 3Q0VA 2OF7A 2XSDC 4RBOA 1E3OC 4MLOA 1BA5A 3BR0A 1LE8A 1TWAJ 4NDLA 2IAIA 3JRFA 3K2AA 3GTLJ 3E7LA 5FKOA 5J1UA 4FE7A 5E3MA 2NVYJ 3HGGA 4BKXA 5F1JA 3A03A 3I4NJ 3S2HJ 1A5JA 1NK2P 2E2IJ 3S17J 1ZGWA 2DMTA 5FKLA 1WCMJ 1NK3P 2NVQJ 5IOZA 1ENHA 2KT0A 1W0UA 1B8IB 2DMQA 4BXXJ 3H3VK 4AC0A 2DJNA 1VNDA 3BTCA 1HDDC 2CQQA 1GDTA 1POGA 2O7OA 2HYJA 3WHBA 3HOYJ 4M3FA 1ZK8A 1ETOA 9ANTA 2YS9A 2HQ5A 5K7HA 2LFBA 1Y1VJ 2YUSA 3RKQA 2E2HJ 5M5YJ 2M0CA 4D7NA 1OJLA 2HXIA 3BQYA 5K7FA 3JRIA 5DS9A 2KDZA 4M3EA 4C3HJ 4JP0A 5FLMJ 2X48A 2XPWA 4I6ZA 1IUFA 3OOUA 1AU7A 1JUSA 5F27A 2DA3A 2HDDA 2JK3A 5M3FJ 2L0KA 1JGGA 3JRDA 1ZTRA 1U8BA 1VFCA 3G1OA 1BW5A 1XC5A 2YU9J 1APLC 4BY7J 5IP9J 3IH2A 2LTPA 5EZGA 4GFBA 1MSEC 3JRHA 4DW6A 4HNVA 3HOVJ 4A69C 5F0CA 3M4OJ 1XS9A 1MH4A 4ABZA 1VI0A 4XK4A 4IHVA 1RPWA 5EF6A 4A93J 1UHSA 1Z0XA 5IP7J 1UG2A 4C3IJ 2QF7A 1B72B 1U78A 4LOCA 5GP9A 4G12A 1FIPA 1NTCA 2ZB9A 2H8RA 3OSFA 1ETWA 3JR9A 2DA2A 4B1RA 1O4XA 1HLVA 3RQIA 3MKLA 2L7MP 2EZHA 2R92J 3I4MJ 2HOSA 1OFCX 4D5CA 3SJMA 2WAQN 3GTGJ 3G1LA 2XRLA 4DZJA 2NS8A 2LKXA 1RESA 3LSPA 1DU6A 2E19A 4UUTA 4UUSB 1B8IA 5C44J 3HGYA 2EZLA 5F0HA 4JYKA 1IRZA 2DA7A 5IYCJ 1MBEA 1MH3A 1P7IA 2DN0A 2ME0A 3B6CA 2CJJA 5E3LA 3A02A 3B6AA 3C2BA 4M3BA 1AHDP 1JKRC 2JA7J 4XICA 5IOYA 1YRNA 3QPSA 1HOMA 1JKPC 3D1NI 1IJWC 3ZOBA 1JKOC 1AKHB 3F0CA 1HCRA 2MG4A 2LP0A 2OPTA 1UMQA 3PO3J 4A3CJ 4BBSJ 3S2DJ 5IP6A 3HDDA 1GUUA 2X9DA 4IHYA 1RKWA 3GTPJ 1X2NA 1HDPA 3BTLA 2MSYA 3ZQLA 2Y2ZA 3ZQHA 3HOWJ 4FTHA 3CQZJ 5FKNA 1U9OA 5EYRA 1TWGJ 5E3NA 2HOTA 4A3EJ 5GPCA 1ETQA 3TP3A 2R5ZB 2M8GX 1ORKA 2X6OA 3BR6A 3IV5A 2LK2A 1IC8A 1RKTA 2XPVA 2VKVA 4V2FA 3S1RJ 2JA6J 2LR8A 3S15J 2JMWA 3LSJA 3UKGA 1YRNB 4CYCB 4M3DA 1FTZA 2HXOA 2NVXJ 4A3GJ 3PM1A 2P81A 2XGCA 4FCYA 1IG7A 3CMYA 2Y0SN 1QRYA 2XGEA
chains in the Genus database with same CATH superfamily
3CTAA 4C3JJ 2CV2A 3KZZA 1IGNA 1QPIA 2MGQA 1KQ9A 2V6CA 3ELKA 2XDVA 1XPXA 2KDOA 4ENMA 5K5RA 4XLNF 4Y13A 3VYSB 4UV9A 4B44A 1WZ2A 1R22A 1RI7A 3ZN1A 1B9MA 1MSFC 1K61A 4JX4A 3GTMJ 1UZCA 4MFDA 3CF2A 3TQNA 3IKVA 3CCQI 1SFUA 4BU2A 2B63J 4A3LJ 3ZMTA 5FKKA 2MD5A 1JHHA 1XDUA 1WI3A 5LLQA 1LFUP 1A35A 4N9HA 4OIOF 1SFKA 4UUSA 1FOXA 1Y0NA 3DWLE 4CYDA 2QWWA 4CA0A 2CUFA 5EJCA 2EFWA 4EQQA 3KCCA 4X1EA 3QAHA 2ZCWA 1U0JA 3CUQB 3FHNA 5JLWA 3R60A 3P9CA 1MD0A 3E5QA 2L4MA 3PFYA 3G4SI 2STTA 1KU2A 2W48A 1EF4A 3EPZA 2EINH 4CHUA 1TQPA 4XOPA 3T8TA 2VBWA 3HB9A 2XV4S 1QO0D 2ME6A 3H36A 2W82A 3TL4X 1FX7A 2VC1A 4OAZA 5E18F 1F43A 2AO9A 3L2RA 2KIUA 1GLNA 3AG2H 4B48A 1HQCA 4DBQA 1G3WA 1G8XA 3VEPA 4CH7A 2P6TA 3VPRA 5B3SH 5DM6F 2EJRA 4MFEA 3GVAA 3BTIA 4XKCA 2RAEA 3RZDJ 1DU0A 2QSGX 2AXLA 3E5XA 3P9IA 4RAYA 5TGTA 3BPVA 3CJRB 4RB2C 4A3MJ 5L3DA 3HRSA 4WWCA 1U6GA 4E7KA 5EDNA 2RVCA 5ILSA 5F04A 4PSWA 4Y17A 2IBDA 3FXOA 1F1ZA 1BBYA 2VQLA 2ZMEA 4O3MA 3L7WA 4DBRA 3EQLF 3MZ8A 4PJNA 1TL8A 1HKSA 3P5JA 4IL6C 2E2JJ 4ETSA 1XSXA 4ZC3A 5F08A 3CCMI 4A3JJ 1S8NA 2FSWA 2MH2A 3OYCA 3L2QA 3H0DA 4W1UA 3JRBA 4PGHA 1JGSA 3ZN0A 3CDHA 1TWFJ 1GV2A 1R00A 5EG0B 2H1LA 2XB0X 1FEXA 1FBUA 4LFUA 3AAFA 4I0BA 3H5AA 2X85A 1O7LA 2ZXWH 3KFWX 3O8GA 5HDGA 2ZXJA 1MNEA 1H89C 2K7LA 2KKOA 5JI6A 3GZ5A 5K5OA 2KJBA 5FROA 3GFJA 1FZPB 5J47A 2L9SA 3Q9SA 2O0YA 2LVSA 2DU9A 4XN3A 2XUBA 4KMFA 1P7JA 3G2BA 1D5YA 3QQAA 1BJZA 5F64A 1A6IA 3HZJA 4RAZA 1K7AA 1WPKA 2K86A 2A07F 2ICWG 1K6OA 3TO7A 3ZQ7A 2I10A 1KU9A 4M74A 4P9UA 3CMAI 3FDYA 1BI2A 2BW3A 2VJIA 3BQZA 2CYYA 5EGOB 1WRJA 2LG4A 2P7CB 2M34A 4BHCA 3I53A 3FK7A 4DZPA 4X0GA 4XRSG 1FMWA 2DI3A 4HX8A 3KP5A 5BMZA 2CUJA 5D5WB 5EEGA 2EIKH 3BG3A 2BY2A 1YE9A 3GLLA 3FXRA 4GRIA 2BYVE 2MH9A 3IHUA 1LUJB 3I71A 2D1HA 5J6XA 2LY9A 3R0JA 3CP2A 5FB2A 1TC3C 2GM4A 2QQBA 2XKPA 2COBA 3K2ZA 2M2EA 2GQQA 3L1PA 4CUGA 3HOXJ 4MEXF 4BQOA 3OYAA 2JRMA 4LIUA 2IEKA 3C1DA 1FWZA 1BJAA 1H8AC 4QSHA 3I64A 3TW6A 4CCOA 2JA5J 1FTTA 1SFOJ 2FOKA 3OR2C 5ERIA 4A3FJ 3ZPLA 2XROA 4IVNA 4PJMA 3GTQJ 2W57A 2GBYA 1K6YA 2WB1N 3CCJI 3GFIA 2NS7A 4LITA 1R9TJ 3K10A 2H09A 4BHPA 1JTXA 5E3OA 1T98A 3M8FA 2Q0OA 5DDGA 5FO5A 2VLAA 1G2HA 2RQPA 1QVUA 3S3NA 1T0FA 2ZC2A 1S3JA 3GFMA 3OSGA 4DYCA 1BM9A 2HOEA 2MABA 1OR7A 3WE3A 2KIMA 4LG3A 1XTAA 2VASA 3DEUA 2L9NA 1RIOH 2QZ8A 2CMPA 3G73A 2P4WA 4I7HA 4L9TA 3UR3C 2HQNA 3E3VA 3H92A 2NOGA 4A12A 5C4JJ 2QSHX 1YW7A 4ASNA 3LAPA 4X6AJ 2W00A 3ASNH 5LBQA 2DQRA 1LQ1A 2XGDA 2YX7A 5H6RA 2OD5A 2KIQA 3KP3A 1D1CA 2PBIA 1JJ8C 3BR3A 4ZYEA 2LC2A 5J1RA 1ZRFA 2DK8A 3BZKA 2R7ZJ 1MDMA 3V8KA 2EZIA 4PJJA 3W6KB 2R7QA 1BI1A 3TBIA 4AU7A 3LNQA 3CCUI 3KX2A 4RB0A 3GZ6A 3X2QH 4FETA 1LEAA 4A6EA 3GFLA 4YIFA 1MNMC 2HTJA 1JKQC 2PJRA 1TW2A 1RUOA 4HQEA 4DYQA 1R6RA 3RIRA 3ZMUA 4I99C 5CYVA 2DOFA 5FLXK 1ZGJA 3BCBA 3H5NA 1YITI 3WE2A 4Q4ZF 4TV7A 1BA5A 3W2AA 1REPC 3VODA 1BR2A 4XQFA 3EETA 3F23A 4LLGF 3GTLJ 2UXNA 4GGGA 1BR1A 3HRMA 1ZG1A 5FKOA 2DPUA 2WAQA 2HS5A 2MD0A 2QQAA 4J00A 4BACA 4BKXA 1PDNC 3CJTB 1VQLI 3S2HJ 4RGXA 1NK2P 2P5KA 3CCSI 2E2IJ 1WSUA 1YTYA 2NVQJ 1UJ8A 4RGRA 2KT0A 2L7KA 1UCRA 2RREA 3IRQA 1EH7A 4HLYA 2AQFA 3H3VK 1U5TA 3GX4X 4L9NA 2FRHA 2L9VA 2A6TA 4MTEA 4E7HA 1GDTA 2NXNB 4E7SA 3EYIA 1G6NA 2FQ3A 1R23A 4OMZA 3RKYA 4KITB 2O7OA 4YEJA 1XMAA 3HOSA 4YIRX 4I09A 2VJ5A 1KQ0A 3M7GA 2HQ5A 1OMIA 2XAJA 5GAHJ 2V9PA 2BXYA 2YUSA 2O61A 2IPQX 1Z7LA 2XHKA 3E1SA 3FXLA 3HXLA 1W36D 5TISC 1R5ID 1WVRA 4ZH4F 2M0CA 2DK5A 5K7FA 4YIIA 4ZYGA 1Z67A 2E5NA 2VOOA 4M3EA 4CCMA 2DW4A 3KP7A 4QPQA 3MKWB 2AS5F 2X48A 3HYIA 2PN6A 5F27A 2AQEA 2FBIA 4RGSA 3RKXA 2DJIA 3MZYA 2KP6A 1DP3A 2XAFA 5M3FJ 2L0KA 3VWBA 1B6AA 4EV0A 1Z9CA 3JRDA 1ZTRA 5FGMA 3W2VA 2KRHA 5DCMA 1VFCA 1BW5A 1XC5A 2IVMA 5H20A 2EIJH 4BY7J 3VFZA 1R71A 5EZGA 4ENNA 4HNVA 2LNBA 3HOVJ 1P4AA 1QZYA 3RYPA 1VQKI 2YR2A 2DQLA 3EUHC 2DT6A 1RPWA 4BUPA 1Z0XA 3BROA 2LMDA 5IP7J 1G3TA 4P96A 2XGXA 4BAYA 3AKZA 4HSRA 3BJ6A 1X1BA 4LOCA 3FXUA 2Z9OA 4BJ6C 3DKWA 2LBFA 2VBYA 4BQAA 3JR9A 2DA2A 2L01A 1O4XA 5L3FA 4F52A 1BOAA 3DEEA 2L7MP 4OMYA 3I4MJ 1W5CC 2QGUA 3SJMA 3QYBA 2HZDA 1I27A 3OOPA 2F4MB 2JUGA 4NHJA 2E19A 3K9TA 2A61A 3E5UA 4UUTA 5E20A 4UUSB 1VQOI 1B8IA 2ZBKA 1ZGAA 4L0YB 3RI4A 2Q1ZB 1HKTA 1AWCA 4H4KC 1LVAA 2CS3A 2ME0A 3SZPA 4JQFA 4ZYDA 1MJBA 2P6SA 5HS8A 3SFZA 3B6AA 3C3WA 3WU2C 4DOZA 1E3PA 1KU7A 4LB5A 3M8JA 1UHWA 3MAJA 1LNWA 4RLQA 1YRNA 4IXAA 3OYIA 1JKPC 3ZOBA 2KLOA 2HKOA 1HCRA 2LH9A 1K79A 2AXTC 3W6JB 2MG4A 2LP0A 4A3CJ 1FNNA 3E97A 1UG0A 4XN0A 3S2DJ 4BBSJ 2D1VA 2F2EA 2X9DA 5CPRB 2WAEA 5D6FA 2BVMA 4XLPF 4IHYA 4HV6A 2NRAC 5IY5H 3TDUC 4F3QA 1VQ8I 2FE3A 5DYMA 4QPOA 1YHQI 4FTHA 1TWGJ 1PP8F 1HW5A 1MMAA 2DDBA 4M71A 4PCQA 2NOJB 3N4MA 4AIKA 2W7NA 1EV7A 3IV5A 1X1CA 4C2TA 3O3KA 2ZMEB 2OBPA 3S15J 2MLGA 5L3BA 1HA8A 2CQ7A 4A3GJ 2VE9A 3JAMZ 2QLZA 2P81A 2XGCA 2FMLA 4M9SA 4NBQA 3WTSC 3QPHA 3IRRA 2P8TA 1W5TA 2XGEA 4CCLA 5J4VA 4QWQA 3QOEA 1Z3YA 3CO7C 3WGHA 2OTLI 3HRUA 2FEZA 4MO7A 3LAJA 2CWEA 3MD2A 1MBHA 3OYFA 4II3A 3LSRA 1X2MA 4ZTJA 4IKFA 5FJ8J 2K9NA 2FJ1A 3FKJA 4HQMA 1MJ9A 3GTKJ 1MMSA 1FP1D 2F6CA 3CDLA 3OYEA 2JUCA 4V2GA 1G59A 3OYBA 1X4PA 4IRGA 4AIJA 4Q5SF 3I5UA 3F8BA 1EH8A 1HW2A 2L7FP 4DGWB 4HRIA 2BW3B 3BTJA 3DTEA 1BL0A 3S1MJ 2ELKA 1Q1HA 2JN6A 4PFPA 4EJVA 3QYFA 2JTVA 3O8HA 2ID3A 2O8XA 3FXKA 4FQGA 3BOQA 1CQTA 2BHYA 2FF4A 2W85A 2HQRA 1ONVA 1T0FC 3J80Z 2X6YA 2DA4A 4KICA 2LREA 4WXHA 5DD4A 3V8JA 3V4GA 5M3MJ 3VB2A 3I3LA 4XRMA 5IPAA 2HVQA 1OR7C 2OU2A 3F6OA 4U0WA 1MBKA 1P2FA 4PGGA 2TDXA 2GLOA 2V1XA 5FLVA 4XR6A 3DKYA 3K1MA 3FMQA 1I50J 4PFOA 1XGSA 4UXNA 2A6EF 2AHQA 2CQXA 1O3TA 2HEOA 1HBXG 5KK1A 3DTIA 4F7ZA 3D5SC 1TTYA 2OAZA 4D1QA 2EFQA 4MQ9F 1IV6A 4MGRA 2R7TA 2IGKA 2DA6A 1FOKA 3Q5FA 3RDIA 2BEOA 1P92A 2QSFX 1K4TA 1KONA 3CLOA 4AYBA 3CMEI 4C9YA 1FY7A 2K02A 3S8PA 3U1DA 4ESBA 2WV0A 1QGPA 4BY1J 1ODDA 5IT3A 2JA8J 2JWTA 3OYLA 3BLYA 3PQKA 2JVGA 3S14J 1ZG5A 1R49A 1JT0A 3OWTA 4LIVA 4U0YA 1RUNA 5B1AH 3S16J 2ECCA 4UHTA 4B3XA 2HYFA 5CVRA 2EFOA 4YFXF 3IAM2 5AIPA 2W4SA 1BIBA 4JK1X 4AVPA 4BYYA 1SD4A 2H6CA 1JUMA 1QPMA 3W3CA 2Y75A 1Z6TA 4KT6A 3WU1B 3CCLI 3TW7A 3KETA 2A68F 4EJTA 3FHZA 1J5YA 2NS0A 1MDMB 3QU6A 4I01A 2NVTJ 3U9GA 3MVPA 3OYDA 2M45A 2HVRA 4KN7X 4II2A 4U7DA 2ZFUA 1YO5C 3DEWA 4ZTFA 1KYZA 5ED4A 2PJRB 3DXJF 4M3GA 6PAXA 4ZZDA 3FXMA 3FK6A 4D7MA 3NRVA 1BR4A 1W7PA 2H8WA 4LG0A 4AUXA 1QNTA 1S7AA 3PO2J 4IRIA 1IXCA 2FU4A 2LYCA 4J01A 5JHFA 3G6EI 3K70C 2M30A 3FKIJ 3L00A 4WXCA 4N0BA 4AD9A 1KU3A 1ZARA 4U7BA 4FISA 4Y15A 3WHCA 2DLLA 4XRSA 4M6YA 4XKVA 4G6QA 2EA4A 2PLYA 4BXFA 1QZZA 1DGRM 2LRDA 2ZXIA 2H94A 2CU7A 2ZJQF 4HNTA 4G7HF 4A3IJ 5GTHC 2L3DA 2XSJC 4KIFA 5IYDJ 4XLFA 3RPQA 4J19A 3BCAA 2EK5A 2K3FA 2FBHA 1GVDA 1U5TB 2XF5A 3E6MA 3HJEA 5JLXA 2CRGA 3NEUA 2GOMA 3K4NA 2OZUA 3LSKA 3SEQA 2HPMA 1IXRC 1P4WA 2VXZA 5KAFC 1YQAA 2V26A 3KE2A 5EEHA 5E1ZB 3C2HA 1UB9A 3LOCA 3OYNA 4HW0A 4Y4RA 3BG9A 1ERDA 4B09A 1H0MA 3CJQB 2OQGA 3GMEA 2KPMA 4XRFA 2UZKA 1U8RA 1SMYF 5E8IA 4YG2F 2P0WA 4ESJA 4ENKA 1LFPA 3I0TA 3K1NA 4HG2A 4A0YA 5M5XJ 4IHWA 1V5FA 3F72A 1T8IA 3G71I 3K4CA 5D8KB 3JRCA 2CW7A 2YSRA 3HC7A 5EEAA 2HNHA 1CGPA 5AIQA 5HLIA 4EJUA 2LF7A 5LGTA 3MQ0A 1DDNA 2JSPA 4G7OF 3B73A 4BQQA 3I55I 3QPLA 1FPQA 4QTRA 4B3AA 4RDUA 4E7IA 4W97A 1WFXA 2WA0A 2V6EA 2OZ6A 3AG1H 4ZJZA 2IGOA 1IN7A 4B4CA 2H27A 3K6GA 5DCMB 1GXQA 1D1AA 3F8FA 4E7LA 4ESFA 1TZLA 4A3BJ 2FX0A 3OL4A 3FXQA 4Y7NJ 3Q0WA 2FNAA 1T95A 1LB2A 3JTHA 3DF8A 4Y33A 3SDBA 2K9QA 3BR1A 2V1UA 1OCZH 3KZIC 4L5IA 4D0PA 4E70A 2NYXA 2O3FA 4EM1A 3FIWA 5A2QK 1XCBA 3BC8A 1VQ9I 3C2GA 3D5LA 4F92B 1SD6A 3SZGA 2DFHA 4BBRJ 2R0QC 3R4KA 2DA5A 3Q0VA 2IS1A 2DXIA 1JI8A 1FSHA 3BR0A 4BDZA 4HSTA 4BE2A 1TWAJ 2CG4A 3JTGA 3ZQQA 2E34A 4A2UA 3K2AA 1VZ0A 2LBFB 2QQ9A 1XX5A 3CZ6A 3O2PE 5FFXA 2IS2A 1F4KA 3V7SA 1LDKB 1PYVA 4O5VA 3HGGA 4RA2A 1QHGA 4KMUX 5B1BH 1E3HA 1VTNC 1A5JA 4HYEA 4NC8A 1IN5A 3S17J 2DMTA 3M07A 3MEXA 5FKLA 5LFAA 1WCMJ 2IS6A 2M4KA 5IOZA 1ENHA 1W0UA 1B8IB 2DMQA 1SVOA 4BXXJ 2VODA 4AC0A 4XBFA 4XOTA 4LLNA 2DJNA 1OYIA 2HR3A 1YYVA 3COAC 1YI2I 3I58A 2CQQA 4BH9A 2RNJA 3ML6A 2IGMA 3SZTA 3R6SA 3FWEA 1FLIA 1ETOA 1IN8A 2J5OA 2VIXA 3I59A 3NQOA 4EATA 3GUDA 5DD8A 4R1HA 3CMMA 5IT9K 2YS9A 1TQIA 4OAYA 4F93B 3AFHA 2F4IA 2ESHA 2LFBA 4RB1A 2Y69H 1Y1VJ 4YRVA 2F48A 4XLEA 1TW3A 3WG7H 5FLXZ 5H6QA 3JRIA 3J81Z 3P7NA 5DS9A 3EYYA 2GIZA 2KDZA 2XF7A 1S72I 1VQ5I 5FLMJ 4I6ZA 3CDIA 1P4XA 2JT1A 4HX4A 3LSIA 4NUBA 2E7WA 2VT3A 4S04A 3U1KA 1FYLA 3KYCB 4KNYA 3IUOA 4Q48A 5LHIA 5HNHA 1YFHA 2YU9J 3IH2A 1OPCA 1P6RA 3DFGA 5CQGA 4IQ4A 3JRHA 1ZHFA 2G7HA 2FBKA 4R79A 2K27A 4G9YA 2MC3A 4A69C 1TNTA 2X6WA 3FXJA 2EILH 4GO1A 5DV5A 1MH4A 4ABZA 1VI0A 2CW8A 4ZZLA 5LEKA 1RNLA 4CO8A 2Z3YA 1W4MA 2DDAA 5L3GA 1N25A 1EKEA 2XASA 4UB6C 2ISYA 4MHGA 5GP9A 2Y48A 3EUKL 1NTCA 3LL7A 1U2WA 1YLFA 2LDUA 4L9JA 2H8RA 3OSFA 3F3XA 3S32A 5DCFA 5ICEA 2XIGA 3OYGA 1HLVA 1EH6A 3GCMA 3KP2A 5B5EC 3VDXA 1BC7C 3CC7I 3ZMSA 2DPDA 1XMKA 4KYWA 1KQ8A 2M4GA 3FF5A 1OFCX 3SHFA 4D5CA 2PI0A 3LSMA 3GTGJ 1Y8RB 3P9KA 3G1LA 4XORA 2HVSA 2NS8A 3CJNA 1OKRA 3E6BA 3PJRA 3HPHA 1I3AA 3R0AA 4XONA 1H9TA 1OISA 2BY0A 3ROUA 4LGWA 5L3EA 3K4KA 2OTJI 1DU6A 5H2FC 4NQWA 2EZLA 4RLFA 4JYKA 1KYWA 2GIVA 2Q2EA 1MH3A 4OINF 5IYCJ 5GADJ 4KIBA 2CJJA 1VQMI 3NWTA 2GA2A 2Y0MA 2BV6A 3H9JA 3HSFA 1TP4A 3QP5A 2LF8A 2JA7J 4XICA 3HUGA 1FC3A 3V7RA 1HOMA 1JKOC 2HFHA 1W1WE 1MJAA 3TMOA 5D6EA 1VQNI 5FFZA 3PNYA 2OPTA 3PO3J 3HTSB 2HDCA 3I9V2 2DT7B 5DEQA 3RCOA 4XKWA 4BGDA 5IP6A 3OYKA 3PUBA 4EVIA 1QHHD 4MNUA 3WGGA 2ETHA 4BEHA 4DIQA 5LHHA 2IT0A 1B4AA 2R7XA 3ZQLA 4BXUA 4KT5C 3ZQHA 5FKNA 5EYRA 1D0YA 2XC7A 2ADUA 4GCVA 2ACJA 3TP3A 4GDFA 4IRHA 4FHTA 2HDWA 3BR6A 2A5YB 3RPUA 2ELJA 4DQ2A 3BP8A 3QYEA 3ERMA 1RKTA 3S1RJ 3L2WA 2KL4A 2JA6J 2LR8A 3FX3A 2COMA 5KVRA 1FTZA 3H3UA 2LSOA 1T38A 3FMRA 2NVXJ 2MFZA 2E36A 4YFKF 1J2XA 2VB6A 2CFOA 2Y0SN 1DQUA 3TOAA 1QA6A 2CQKA 5C4XJ 4IHSA 5HODA 2I8DA 1ZYRF 1B72A 4IOAF 1U3EM 1OLTA 2ZNZA 3TEDA 2TCTA 4U88A 1D8KA 2BY3A 3F8MA 1B9NA 4HA8A 5GPAA 3MWMA 1EJ9A 4N4OB 1ZH5A 2YU3A 3Q9VA 3S93A 3OS1A 4EMSA 5DUKA 2DMPA 2Z1DA 2IP2A 1ON1A 1OCOH 2ECBA 2QUFA 1FOWA 1OQYA 1CF7A 4IPAA 2QCOA 2XRNA 5GTIC 1MBJA 1F5TA 4L18B 2L2OA 2PMZN 4PDKA 5LHGA 1R36A 4RM3A 1ZR2A 2IGNA 1Y56A 5IYBJ 4ON0A 1X58A 3Q0UA 1XGNA 4P1WA 5K7ZA 1ETKA 2LD5A 4M6VA 2CV1A 3DPUA 1T39A 3HKZN 2OCCH 1JTYA 2DMNA 4L0ZB 5KHDA 2VXDA 1P9QC 2ZSIB 5FD5A 1W7PB 4LG0B 2BOLA 1N75A 3DLLF 1AKHA 2BBYA 2V1DA 3ECHA 3C7JA 4LK0F 3OR1C 3SXYA 1V5GA 1HKQA 1LJ9A 2Y31A 2Z5UA 2HYGD 2WAFA 3REOA 2WY8Q 2K4BA 2XB5A 2M0MA 4UNOA 1ZN2A 5FRNA 1WJCA 3LQQA 3HTUA 2GXBA 2R7OA 3MZHA 1HC8A 3FZVA 1T56A 3OY9A 1NG7A 1UELB 2BE5F 1WH7A 4HF2A 1R4NB 2PMHA 3A0HC 5F0FA 4YELA 3OYMA 2WB1A 1W0TA 1J09A 1VQ7I 2V1NA 4ANJA 2LLKA 3HIFA 1ACIA 1R58A 3BG5A 2ZMEC 3E6CC 1MBGA 5M5WJ 1X1AA 4OWRB 3K7AJ 3SDGA 1HSJA 2BZTA 4NNJA 4ZDLA 3HRTA 2VJ4A 5K5QA 4IHXA 1Z77A 3BPXA 4EEFG 4ZDPA 3NAUA 2K40A 1RETA 3ONQA 2L5QA 2VKEA 1LVKA 2FQ4A 3KIOA 2Z33A 3ESWB 1ULYA 1H9GA 5BPDA 3WU0A 2EV0A 2DTZA 5HOOA 1Y6IA 1HSTA 1Z6RA 3WTVC 1N77A 3LSGA 1XN7A 3N05A 3A01A 4P55A 2K85A 4MIMA 1WH5A 2DT5A 2O9LA 1IDYA 3VYRB 1I3QJ 3K4BA 4OOIA 2I5UA 2LKPA 5EZHA 3IL2A 1ITYA 1G3SA 1X1PA 2L9RA 3DV8A 3EUAA 1LPQA 2G7UA 4B47A 1LDJA 2DA1A 2JSCA 3BR2A 4IEJA 4PJLA 3IC7A 3MCZA 3LFKA 3V42A 2H1KA 1N78A 4LB6B 3GTJJ 4UVAA 1XDSA 1GVJA 1O57A 2H6BA 3ULQB 1SC7A 2X6XA 3W6VA 3H5RA 2L7ZA 3KP4A 4Z2YA 4UVCA 1UHMA 2VPRA 2ELHA 1AA7A 2PEXA 3M1EA 3QPTA 3ZCOA 5CVUA 1RC9A 2MW8A 1PUFA 2VBXA 3K4LA 4G8XA 1D1BA 2M8EA 2K9SA 1D8JA 2KISA 5CVJA 1MZBA 5BS6A 4L5EA 3HSRA 4KN4X 1T33A 2IA0A 4DYRA 4IO9F 3KYDB 4CZCA 5LGUA 2M5WA 4RMNA 1IRFA 1DPUA 3HM5A 1GV5A 4I0AA 2R5YA 4G6TB 3Q3SA 3GBGA 1R1VA 3DCFA 1DP7P 4FX0A 2DFIA 4S0HB 1WJEA 2L54A 2IW5A 2VQGA 3IH4A 2XVCA 3FMSA 3FISA 1HF0A 2ZSHB 1O3SA 5FRMA 2HOAA 1T6SA 3HEFA 5E1WA 2A6HF 3HBLA 1ZKGA 4BS9A 2MYSA 4EM2A 4BNCA 3TKYA 1QVTA 1K83J 3U21A 3AG3H 3ABUA 1OCRH 2WADA 3I59B 1YIJI 2M9HA 3B02A 5D4SA 3IWZA 2EZKA 4JBAA 4KJZA 5GAGJ 4F55A 1WJBA 2XAQA 5D5XB 2NNYA 2JA2A 2V79A 5HDKA 3FBNB 4I02A 4Z6YA 2F5VA 4KIGA 2ZXHA 3ZQCA 3F8NA 1MMNA 1V55H 5CQEA 2ZJPF 4G7ZF 1JHFA 5FD6A 1LFBA 1SAXA 1KZHA 1C0WA 2VL8A 4UB8C 2GXGA 1VQ6I 4WCGA 3BZ6A 2BY1A 4RS8A 1V5EA 2B0LA 2E1MC 2FUG2 3IH3A 3OIPA 1WWXA 5HLHA 3GO5A 1SAUA 1JUPA 5HVQC 3S1QJ 1BN5A 5E1XA 4RAGA 4XNFA 2E1CA 1XG1A 1ON2A 2IS4A 1RR7A 1ETYA 2Q8KA 3QP6A 2X1CA 3CP8A 3PSIA 1E2XA 2Z2SB 2BVLA 2CW0F 1X3WB 4KUMA 3ZQGA 1S7OA 1S7EA 4XLHA 3HOUJ 1DUXC 3OIOA 1TWHJ 2EFNA 5D5UB 3L2UA 2DBBA 2M87A 2J5PA 3HOTA 3QWLA 3WTWC 4ZYHA 3RZOJ 2E71A 1I6HJ 3CCYA 1R1TA 5D4RA 2VE8A 2HQAA 1TWCJ 3ABKH 2IXSA 3ISPA 4E6KG 3CC2I 1XMXA 1WJDA 3E0JB 2XSDC 1R7JA 1E3OC 2R7FA 1LE8A 2RDPA 3QRFF 2IAIA 4XM3A 3JRFA 4A0ZA 5J40A 1IN6A 3DBRB 3E7LA 2IA1A 3HHHA 3I54A 1STZA 2FOWA 2QYOA 2E1MB 4FE7A 5E3MA 1X19A 2JZYA 1A36A 1LEBA 3ZGKA 5E8GA 2LOOA 2DOEA 4JOMA 4M9ZA 2HU9A 4NB5A 3VOEA 4KA4A 4OU0A 4P9FA 4BL0B 3KEQA 3ERED 1PUEE 1NK3P 3GXOA 1U5TC 4CICA 3BZCA 2OQRA 4NQWB 3RTRA 2CGPA 1MIJA 1YX5A 1UAAA 2P5VA 1YW8A 2Q2EB 1YJNI 3CLQA 5F6FA 2HGCA 4IOCF 1VNDA 3BTCA 1J7KA 1HDDC 3HHGA 5GAEJ 3E6DA 1D0XA 2QENA 2ZJRF 1JE8A 2VOPA 1LKXA 2WC2A 2HKXA 3PNTA 2HYJA 3OIQA 3HOYJ 4M3FA 1R4MB 2EPFA 2IJLA 5HS7A 4PJ0C 2R7RA 1T2KA 2UXXA 3HUGB 1J0RA 1FOYA 2VT2A 5J8FA 5K7HA 3J80K 2GOXB 5A2QZ 1XCVA 3L2CA 3RKQA 4BQNA 5M5YJ 1PP7U 4E7JA 4D7NA 3BQYA 2HXIA 1FT9A 3HSEA 3PQJA 1YJWI 4OIRF 2JQ7A 4BJTA 1L3LA 3DLAA 2W25A 4JP0A 4BEHB 3SQNA 2F5DA 2XPWA 4HLXA 1RRJA 2JRTA 1AU7A 2QM3A 1JUSA 4BE1A 1PVEA 2DA3A 2GA1A 2CV0A 2JK3A 3I4PA 3OV8A 4HV5A 4CSWA 4DJAA 1JGGA 1U8BA 2UUZA 2Z16A 2EIMH 3CESA 3SEZA 2K4JA 4HDVA 4OIQF 3G1OA 1MW7A 3RYRA 2MC4A 2HPIA 3HPGA 4Q47A 3L09A 4HDUA 1IW7F 4RM2A 1Z91A 4DW6A 1L0OC 3ZRGA 1KGSA 2NVUB 4HNUA 3M4OJ 2QBYA 1XS9A 2DTRA 1Z21A 4LJZF 5KCMA 4IHVA 4YFNF 2XAUA 2KRCA 5EF6A 4A93J 1FMVA 1WKMA 3WTTC 3EUHA 4M73A 1QQIA 4C3IJ 2E5ZA 2FXAA 1B72B 1J75A 5ILVA 5IT9Z 4G12A 1D0ZA 2IA2A 1Z1DA 3K69A 4WXDA 1V4RA 3CCVI 3BDDA 4BDYA 5LRRA 4HOBA 1R5GA 1B59A 2EZHA 1FYMA 2R92J 4B8XA 2HOSA 4MEYF 2DODA 4DNCA 2WAQN 3VSKA 3LMMA 4DZJA 2LKXA 1CF7B 4B43A 3LSPA 2DO7A 2G9WA 3WODF 4C30A 5C44J 3CF5F 3HGYA 4WK8F 3RSNA 1SFXA 5F0HA 1IRZA 2DA7A 1MBEA 1S5LC 3A4CA 3PFIA 2DN0A 3B6CA 1YX3A 5E3LA 3A02A 3OYHA 5JVGF 3U2RA 4IJAA 4ENJA 4M3BA 2FMYA 2HTSA 3PUFA 2O5RA 4L9VA 3ZMDA 1AHDP 2VN2A 1JKRC 3DTKA 1S6LA 2W24A 5BPIA 5CJ9A 5ILUA 3D1NI 1IJWC 1AKHB 1IXSB 1S9HA 2R7SA 2YX4A 2WY7Q 5E79C 1UMQA 4FT8A 3PL8A 5K1YA 2KQRA 1RZ4A 3HDDA 2VKDA 2E60A 2K3PA 2OV7A 4WF2A 2RC4A 2RN7A 1MGTA 2CUZA 4KFCA 1X2NA 1HDPA 1B1BA 2EFPA 2V7FA 3HOWJ 4EGYA 1U9OA 5DUIA 3J7ZI 3KLNA 2OCEA 5E3NA 2HOTA 5GPCA 4WX9A 2KZVA 2M8GX 1ORKA 2X6OA 4XLCA 5HLGA 2R7DA 2LK2A 1HXDA 2HZTA 2XPVA 2VKVA 2PFBA 3ZMVA 3S2WA 1F9NA 1VQPI 2A3SA 2JMWA 2PMUA 3UKGA 1YRNB 4CGZA 3L2VA 2X4HA 1QU3A 3BG6A 1IG7A 2QQ8A 2STWA 2R7VA 1ZREA 1QRYA 2KMUA 2E1OA 1XD7A 3T0YA 3A01B 2Y9YA 2A69F 1QBJA 3KP6A 3NWSA 2ZNYA 3DU5A 2CUEA 2CFXA 2FD5A 3MN2A 1IO2A 3VYTB 1TT5B 4AWXB 4XSXF 1ZQ3P 4JX5A 1WJFA 3DU6A 1LDDA 5HDNA 2QA4I 1SEUA 2D5VA 5AONA 2XKOA 2PQ8A 2QEXI 1OYYA 1Q1VA 2G0EA 2K9LA 3DQVC 2FA5A 3H9GA 1I5ZA 5LD2C 5B66C 4RGUA 1ZLJA 1K78A 3M3YJ 1MKMA 2V9VA 3A1YA 1IRXA 3PNVA 2E7XA 3CCRI 3IAS2 1ZLKA 1W7PD 2D2WA 3S3OA 2NAZA 1PUFB 5D8LB 2M1BA 3TO9A 1XGOA 5CVVA 3RJPA 3T5XA 3TP0A 1OCTC 1I1GA 1I39A 2M7AA 3BG7A 3UNGC 5JFRA 1TT0A 2K5CA 3F22A 1FP2A 5J1YA 3JREA 1XB4A 2A5WA 4HZFA 3FBIB 5D5VB 2CQNA 3ZQIA 1Y8QB 1YIOA 2OA4A 1G3YA 2MA3A 2DYRH 3K4MA 2R5YB 1A6QA 4FE4A 2F4OB 1U9NA 5JHUA 3HOZJ 3CCEI 2M3AA 2KIFA 3H0GJ 2XPUA 3BT9A 2R5ZA 1H88C 1SANA 2ESNA 4Y52J 3WTUC 4KDPA 3LSTA 3TDZC 2A05A 3SFIA 1WGXA 2E1NA 1YJ9I 3AG4H 1OCPA 4XIDA 4CYCA 3AL0C 2LY1A 1SFEA 1FIAA 1V54H 4GXOA 5BQTA 3F6VA 2ID6A 3DP7A 3ZMZA 2DFEA 1ZAOA 3OS0A 3V8LA 1JT6A 3RQ4A 3ZR8X 4NC6A 2DMUA 2VI6A 2Y30A 2R3SA 2X51A 1EA3A 4G6DA 5KNLA 2ISZA 2F5EA 2JJ7A 3J81K 4LK1F 4GYGA 2R7WA 3VYUB 2VBZA 3LA7A 2DYSH 1E0EA 3DPLC 2TRTA 3JRGA 4I98B 4QLCU 3RKWA 4LD5A 4LMYA 2ZJ2A 2Z99A 3BJOA 1O3QA 4HPQA 2NNNA 1ZRCA 3CD6I 2R4GA 3WGIA 4R8HA 3J7AY 2F5CA 4ZDOA 4FASD 3ZQFA 1FJLA 3QU3A 2WBMA 1NHAA 1KA8A 3GLXA 4Y3OA 1X3UA 2IRFG 4A0XA 4CDGA 1UFMA 3F9KA 2UWMA 4A3KJ 1WHUA 1OYWA 3AL0B 3CUQA 3M8EA 4PUSA 3QODA 1XSDA 3ECOA 2Y9ZA 1GT0C 2VUMJ 2VQHA 1BOBA 4MTDA 3O6BB 3N97A 1F36A 3GW2A 1IUYA 1IDZA 2C6YA 1Z7UA 3T1BA 3WTZA 2DCEA 5J8CA 4XSZF 2PG4A 4D9JA 1LE8B 4XL9A 4AM3A 1MBFA 1X3ZB 4N4NB 3F21A 4HBLA 3CUOA 1TBXA 1WQ2A 4BJ5C 1I6XA 3BY6A 1V3FA 2EQRA 3SYTA 5J3LA 2B9SA 3ABTA 1ETXA 1ZRDA 2JPBA 2ZKZA 1A31A 1WJ5A 1ETVA 3G3ZA 4M6XA 4CCKA 1SD5A 3A2KA 3WG9A 2JVHA 1WI9A 3LA3A 4A6DA 3L9FA 2KFDA 1D3YA 1YG2A 1JJ6C 3A0BC 4D5FA 5ICGA 5DM7F 3PIOF 1BI3A 1WJAA 2VC0A 3FM5A 1NG6A 2PJPA 4UY8I 5F1RA 2O8KA 3PSFA 3J7YJ 3MKYB 1ZG3A 3TO6A 2L02A 4I76A 2VONA 1IRGA 4IX7A 1SD7A 4C2MJ 2HI3A 3TOBA 2WV1A 3TGNA 4OIPF 3MMYB 4U87A 2HWVA 2ZFWA 1FSEA 4AYBN 1ZR4A 3K1PA 5LRSA 1Y1WJ 3KPHA 3DBLB 3GWZA 2EB7A 5EG0A 2GZWA 3NARA 2XAGA 4HF0A 4C2UA 1VF9A 5L3CA 1O3RA 2EH3A 3BR5A 3I56I 4HEA2 1BW6A 3G1MA 3MKZA 4A3DJ 2B7EA 4UVBA 2OC6A 1IV8A 1IZ1A 1PJRA 2OUMA 4N9IA 2R93J 3K4JA 3GTOJ 4XMYA 3DBHB 1FBQA 2QKMB 1T08B 5FKMA 1IAWA 4BE0A 3S1NJ 2W84A 2VJJA 4E4HA 4FX4A 3CO6C 2EV6A 2XAHA 4AIHA 5DTDA 1E17A 4A5NA 2EBIA 1FBSA 3MFKA 2OJED 2QKLB 4JX6A 3IWFA 2P5LC 3KEOA 3ABMH 1VQ4I 5BNGA 1A04A 2N8GA 5LEJA 3JRAA 2VPLA 2DFFA 3BJAA 1HW1A 3FM3A 5EGOA 4AVZA 3JSOA 2QBYB 4QIWN 1QZEA 4UV8A 2QVOA 5ICCA 3M1CA 1TLHB 5C3EJ 3WTYC 2OF7A 5J4YA 3V7CA 2GWRA 4RBOA 4MLOA 5CKTA 2E35A 2W1OA 4S05A 1G4DA 2BXZA 2CH0A 1BIAA 2EV5A 3KEYA 4NDLA 4IF4A 2FNPA 4P5OA 5J1UA 1W36C 3LWFA 4CZZA 3ASOH 2NVYJ 2M7BA 4HX7A 5F1JA 1SMTA 3A03A 1DPRA 3I4NJ 1Z3XA 3DKXA 2KJCA 4H0EA 1ZGWA 4EM0B 3CC4I 1R1UA 4IZZA 3D0SA 5HLTA 4HAMA 4L5JA 3H3ZA 2O03A 4K2EA 2D45A 2K9MA 3JW4A 2XF6A 4BHBA 3OYJA 2BGCA 3OS2A 2F5FA 1K4SA 1POGA 2CO5A 3WHBA 1ZK8A 3LA2A 4IHTA 2EA2A 9ANTA 1R5HA 2UV1A 2PX9A 3PIPF 1MMGA 1USTA 1YS7A 5HS9A 1YOVB 2E2HJ 5CVIA 3KLOA 1OJLA 4CCNA 4E7ZA 4RB3C 2DOAA 3IKTA 4C3HJ 1IUFA 3OOUA 2RNGA 3OL3A 2HDDA 4HF1A 1DGWY 2KHMA 4EJOA 3HL2A 3LQRA 4AIDA 2WWYA 3RPUD 4GYIA 1GHCA 3LFUA 4KISA 2ZO4A 1APLC 1X4OA 2RV8A 4M72A 2KZGA 2KRFA 5IP9J 2LTPA 4GFBA 4A5MA 1MSEC 2GAUA 3EDPA 2Y0SA 3IP4B 4PK4A 3K70D 3J7AO 5F0CA 3OMYA 3H1CA 1O7FA 4XK4A 4UUVA 1UHSA 4RAFA 1ZELA 1XSVA 3K0LA 4EGZA 4ZYAA 1UG2A 3H35A 2QF7A 1U78A 4U0VA 3JCUC 4IQJA 1FIPA 2ZB9A 2L4AA 1ETWA 3GF2A 3HG9A 4B1RA 3WTXC 3RQIA 3MKLA 2X0LA 4ITVA 2RQQA 1AOYA 4G94A 3C18A 2PMZA 1YS6A 5JVTA 3GEZA 5E17F 2MBFA 1TQMA 3M9AA 2XRLA 1RESA 3QOPA 1X1DA 4XLAA 1J59A 4F91B 1I1SA 2RKHA 1JXSA 3S3MA 2LKSA 3ZXSA 1Y0UA 1S29A 3JAMK 2VQCA 3ZP5A 1BC8C 1P7IA 3BWGA 2WTEA 4XKBA 5JR3A 3HKZA 1TNSA 1MNDA 2O6GE 2GXAA 2X1EA 4NC7A 1Y39A 1K78B 5HNFA 1NH3A 3C2BA 1W5SA 1USSA 2EWNA 2V9KA 5TJJA 1D5VA 1IF1A 5ICFA 5KAIC 5IOYA 2VKHA 3QPSA 5LGNA 1BI0A 1J9IA 1SVMA 3F0CA 1SVLA 1Z05A 4LLLA 4I2OA 3GZNB 3F8CA 2RGVA 3H9QA 3LSHA 4M9XA 2DAOA 2P7VB 1GUUA 4CCJA 5TRDA 1YW9A 1RKWA 2BHZA 3VSLA 3GTPJ 3BTLA 2V4JC 2MSYA 4O6JA 2R7UA 2Y2ZA 4MQVA 1GXPA 3CQZJ 4CXFA 3ABLH 3GYHX 4V19K 2LY2A 2X1DA 4A3EJ 1ETQA 3D5RC 2MLKA 4EJWA 2R5ZB 1M1EB 5CLSA 3T8RA 1FYKA 1IC8A 4PZJA 1OCCH 4V2FA 3KYLA 3LSJA 4CYCB 4M3DA 3KZYA 2HXOA 3CUQC 3PM1A 2YPRA 1XGMA 3R61A 5BOXA 2JPCA 3JSPA 4FCYA 2CSOA 3DPTA 3CMYA 1IN4A 4PSXA 3W2WA 1MMDA 1RR8C
chains in the Genus database with same CATH topology
5C4XJ 4C3JJ 2E1OA 5HODA 3A01B 2Y9YA 1B72A 1IGNA 1QPIA 2MGQA 2CUEA 3TEDA 4MO7A 2TCTA 2FD5A 3MN2A 1MBHA 5GPAA 3LSRA 1X2MA 1MSFC 1K61A 4JX4A 3GTMJ 5FJ8J 2K9NA 4MFDA 1ZQ3P 2FJ1A 4JX5A 2B63J 2DMPA 4A3LJ 2ECBA 3GTKJ 5FKKA 1WI3A 3CDLA 1LFUP 2QCOA 1MBJA 2D5VA 4UUSA 4V2GA 2PMZN 2CUFA 1ZR2A 4X1EA 1Q1VA 2G0EA 2L7FP 5IYBJ 1X58A 3BTJA 5JLWA 1BL0A 3S1MJ 2ELKA 2JN6A 3M3YJ 3Q0UA 5K7ZA 1ETKA 2LD5A 3O8HA 4M6VA 2W48A 2ID3A 1EF4A 3HKZN 1JTYA 2DMNA 1CQTA 3HB9A 1PUFB 1AKHA 2ME6A 3TP0A 2DA4A 1OCTC 1F43A 5M3MJ 2AO9A 4XRMA 2Y31A 5IPAA 5J1YA 2XB5A 1MBKA 3JREA 2GLOA 5FLVA 1I50J 3ZQIA 3VPRA 2AHQA 2CQXA 4MFEA 1T56A 3BTIA 2RAEA 3RZDJ 1DU0A 1WH7A 5F0FA 2R5YB 4A3MJ 4FE4A 1U9NA 3HOZJ 5EDNA 1W0TA 3H0GJ 2XPUA 3BT9A 2LLKA 5F04A 2R5ZA 3BG5A 1IV6A 1MBGA 1SANA 5M5WJ 1H88C 4Y52J 2IBDA 3K7AJ 3SDGA 2DA6A 3SFIA 1WGXA 4IHXA 1Z77A 1OCPA 4EEFG 4XIDA 4CYCA 3NAUA 2K40A 1RETA 2VKEA 2E2JJ 2FQ4A 1FIAA 5F08A 4A3JJ 2ID6A 4BY1J 2JA8J 2DTZA 2JWTA 4W1UA 1JT6A 3S14J 3JRBA 3LSGA 1JT0A 2DMUA 2VI6A 2Y30A 3A01A 1TWFJ 1GV2A 2JJ7A 5EG0B 2XB0X 1WH5A 4MIMA 1FEXA 2O9LA 3S16J 2ECCA 1IDYA 1I3QJ 2TRTA 3O8GA 3JRGA 5EZHA 1H89C 1ITYA 2L9RA 1JUMA 2DA1A 3BR2A 4IEJA 3TW7A 2LVSA 1P7JA 1D5YA 3QQAA 1BJZA 2H1KA 3ZQFA 1A6IA 2NVTJ 1FJLA 1WPKA 3MVPA 3GTJJ 4A3KJ 2I10A 3W6VA 2L7ZA 3DEWA 3BQZA 5EGOB 2VPRA 4M3GA 2Y9ZA 1GT0C 2VUMJ 2M34A 3FK7A 1F36A 4DZPA 3FK6A 4XRSG 1IDZA 4D7MA 2MW8A 1PUFA 4AUXA 3PO2J 2K9SA 3BG3A 1LE8B 1MBFA 3FKIJ 2LY9A 4FISA 4L5EA 1TC3C 2GM4A 3WHCA 1T33A 2COBA 2EQRA 4DYRA 4XRSA 2M2EA 5J3LA 1ETXA 3L1PA 3HOXJ 1ETVA 2CU7A 2IEKA 3HM5A 4A3IJ 1GV5A 1H8AC 2R5YA 4QSHA 3TW6A 1FTTA 3Q3SA 2JA5J 3GBGA 3DCFA 1SFOJ 4A3FJ 4J19A 5IYDJ 4S0HB 1JJ6C 3GTQJ 4D5FA 1GVDA 3IH4A 2GBYA 5JLXA 3FISA 1HF0A 2CRGA 2WB1N 2O8KA 2HOAA 3HEFA 3HBLA 1ZKGA 4I76A 2NS7A 1R9TJ 1QVTA 1JTXA 1K83J 5E3OA 4C2MJ 2HI3A 3LOCA 2WV1A 2M9HA 3BG9A 1G2HA 1QVUA 4AYBN 1ZR4A 2EZKA 1Y1WJ 3OSGA 4DYCA 5EG0A 3NARA 3ZQCA 5M5XJ 1VF9A 4IHWA 2EH3A 3BR5A 1LFBA 1BW6A 3G1MA 3JRCA 4A3DJ 3IH3A 5EEAA 2NOGA 3GTOJ 5C4JJ 4X6AJ 2R93J 1JUPA 3S1QJ 5FKMA 3S1NJ 1XG1A 2XGDA 3QPLA 4QTRA 4RDUA 4B3AA 1RR7A 1ETYA 4W97A 3ZQGA 3BR3A 4B4CA 5J1RA 1JJ8C 2R7ZJ 5DTDA 1S7EA 2EBIA 3HOUJ 2EZIA 3OIOA 1TWHJ 4A3BJ 2FX0A 4JX6A 4Y7NJ 3Q0WA 3LNQA 5BNGA 2N8GA 2K9QA 3JRAA 3BR1A 3RZOJ 1I6HJ 3CCYA 3FIWA 1MNMC 5EGOA 1JKQC 4QIWN 4DYQA 1TWCJ 4BBRJ 2R0QC 5C3EJ 2DA5A 3Q0VA 2OF7A 2XSDC 4RBOA 1E3OC 4MLOA 1BA5A 3BR0A 1LE8A 1TWAJ 4NDLA 2IAIA 3JRFA 3K2AA 3GTLJ 3E7LA 5FKOA 5J1UA 4FE7A 5E3MA 2NVYJ 3HGGA 4BKXA 5F1JA 3A03A 3I4NJ 3S2HJ 1A5JA 1NK2P 2E2IJ 3S17J 1ZGWA 2DMTA 5FKLA 1WCMJ 1NK3P 2NVQJ 5IOZA 1ENHA 2KT0A 1W0UA 1B8IB 2DMQA 4BXXJ 3H3VK 4AC0A 2DJNA 1VNDA 3BTCA 1HDDC 2CQQA 1GDTA 1POGA 2O7OA 2HYJA 3WHBA 3HOYJ 4M3FA 1ZK8A 1ETOA 9ANTA 2YS9A 2HQ5A 5K7HA 2LFBA 1Y1VJ 2YUSA 3RKQA 2E2HJ 5M5YJ 2M0CA 4D7NA 1OJLA 2HXIA 3BQYA 5K7FA 3JRIA 5DS9A 2KDZA 4M3EA 4C3HJ 4JP0A 5FLMJ 2X48A 2XPWA 4I6ZA 1IUFA 3OOUA 1AU7A 1JUSA 5F27A 2DA3A 2HDDA 2JK3A 5M3FJ 2L0KA 1JGGA 3JRDA 1ZTRA 1U8BA 1VFCA 3G1OA 1BW5A 1XC5A 2YU9J 1APLC 4BY7J 5IP9J 3IH2A 2LTPA 5EZGA 4GFBA 1MSEC 3JRHA 4DW6A 4HNVA 3HOVJ 4A69C 5F0CA 3M4OJ 1XS9A 1MH4A 4ABZA 1VI0A 4XK4A 4IHVA 1RPWA 5EF6A 4A93J 1UHSA 1Z0XA 5IP7J 1UG2A 4C3IJ 2QF7A 1B72B 1U78A 4LOCA 5GP9A 4G12A 1FIPA 1NTCA 2ZB9A 2H8RA 3OSFA 1ETWA 3JR9A 2DA2A 4B1RA 1O4XA 1HLVA 3RQIA 3MKLA 2L7MP 2EZHA 2R92J 3I4MJ 2HOSA 1OFCX 4D5CA 3SJMA 2WAQN 3GTGJ 3G1LA 2XRLA 4DZJA 2NS8A 2LKXA 1RESA 3LSPA 1DU6A 2E19A 4UUTA 4UUSB 1B8IA 5C44J 3HGYA 2EZLA 5F0HA 4JYKA 1IRZA 2DA7A 5IYCJ 1MBEA 1MH3A 1P7IA 2DN0A 2ME0A 3B6CA 2CJJA 5E3LA 3A02A 3B6AA 3C2BA 4M3BA 1AHDP 1JKRC 2JA7J 4XICA 5IOYA 1YRNA 3QPSA 1HOMA 1JKPC 3D1NI 1IJWC 3ZOBA 1JKOC 1AKHB 3F0CA 1HCRA 2MG4A 2LP0A 2OPTA 1UMQA 3PO3J 4A3CJ 4BBSJ 3S2DJ 5IP6A 3HDDA 1GUUA 2X9DA 4IHYA 1RKWA 3GTPJ 1X2NA 1HDPA 3BTLA 2MSYA 3ZQLA 2Y2ZA 3ZQHA 3HOWJ 4FTHA 3CQZJ 5FKNA 1U9OA 5EYRA 1TWGJ 5E3NA 2HOTA 4A3EJ 5GPCA 1ETQA 3TP3A 2R5ZB 2M8GX 1ORKA 2X6OA 3BR6A 3IV5A 2LK2A 1IC8A 1RKTA 2XPVA 2VKVA 4V2FA 3S1RJ 2JA6J 2LR8A 3S15J 2JMWA 3LSJA 3UKGA 1YRNB 4CYCB 4M3DA 1FTZA 2HXOA 2NVXJ 4A3GJ 3PM1A 2P81A 2XGCA 4FCYA 1IG7A 3CMYA 2Y0SN 1QRYA 2XGEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5C4X J;  4C3J J;  2E1O A;  5HOD A;  3A01 B;  2Y9Y A;  1B72 A;  1IGN A;  1QPI A;  2MGQ A;  2CUE A;  3TED A;  4MO7 A;  2TCT A;  2FD5 A;  3MN2 A;  1MBH A;  5GPA A;  3LSR A;  1X2M A;  1MSF C;  1K61 A;  4JX4 A;  3GTM J;  5FJ8 J;  2K9N A;  4MFD A;  1ZQ3 P;  2FJ1 A;  4JX5 A;  2B63 J;  2DMP A;  4A3L J;  2ECB A;  3GTK J;  5FKK A;  1WI3 A;  3CDL A;  1LFU P;  2QCO A;  1MBJ A;  2D5V A;  4UUS A;  4V2G A;  2PMZ N;  2CUF A;  1ZR2 A;  4X1E A;  1Q1V A;  2G0E A;  2L7F P;  5IYB J;  1X58 A;  3BTJ A;  5JLW A;  1BL0 A;  3S1M J;  2ELK A;  2JN6 A;  3M3Y J;  3Q0U A;  5K7Z A;  1ETK A;  2LD5 A;  3O8H A;  4M6V A;  2W48 A;  2ID3 A;  1EF4 A;  3HKZ N;  1JTY A;  2DMN A;  1CQT A;  3HB9 A;  1PUF B;  1AKH A;  2ME6 A;  3TP0 A;  2DA4 A;  1OCT C;  1F43 A;  5M3M J;  2AO9 A;  4XRM A;  2Y31 A;  5IPA A;  5J1Y A;  2XB5 A;  1MBK A;  3JRE A;  2GLO A;  5FLV A;  1I50 J;  3ZQI A;  3VPR A;  2AHQ A;  2CQX A;  4MFE A;  1T56 A;  3BTI A;  2RAE A;  3RZD J;  1DU0 A;  1WH7 A;  5F0F A;  2R5Y B;  4A3M J;  4FE4 A;  1U9N A;  3HOZ J;  5EDN A;  1W0T A;  3H0G J;  2XPU A;  3BT9 A;  2LLK A;  5F04 A;  2R5Z A;  3BG5 A;  1IV6 A;  1MBG A;  1SAN A;  5M5W J;  1H88 C;  4Y52 J;  2IBD A;  3K7A J;  3SDG A;  2DA6 A;  3SFI A;  1WGX A;  4IHX A;  1Z77 A;  1OCP A;  4EEF G;  4XID A;  4CYC A;  3NAU A;  2K40 A;  1RET A;  2VKE A;  2E2J J;  2FQ4 A;  1FIA A;  5F08 A;  4A3J J;  2ID6 A;  4BY1 J;  2JA8 J;  2DTZ A;  2JWT A;  4W1U A;  1JT6 A;  3S14 J;  3JRB A;  3LSG A;  1JT0 A;  2DMU A;  2VI6 A;  2Y30 A;  3A01 A;  1TWF J;  1GV2 A;  2JJ7 A;  5EG0 B;  2XB0 X;  1WH5 A;  4MIM A;  1FEX A;  2O9L A;  3S16 J;  2ECC A;  1IDY A;  1I3Q J;  2TRT A;  3O8G A;  3JRG A;  5EZH A;  1H89 C;  1ITY A;  2L9R A;  1JUM A;  2DA1 A;  3BR2 A;  4IEJ A;  3TW7 A;  2LVS A;  1P7J A;  1D5Y A;  3QQA A;  1BJZ A;  2H1K A;  3ZQF A;  1A6I A;  2NVT J;  1FJL A;  1WPK A;  3MVP A;  3GTJ J;  4A3K J;  2I10 A;  3W6V A;  2L7Z A;  3DEW A;  3BQZ A;  5EGO B;  2VPR A;  4M3G A;  2Y9Z A;  1GT0 C;  2VUM J;  2M34 A;  3FK7 A;  1F36 A;  4DZP A;  3FK6 A;  4XRS G;  1IDZ A;  4D7M A;  2MW8 A;  1PUF A;  4AUX A;  3PO2 J;  2K9S A;  3BG3 A;  1LE8 B;  1MBF A;  3FKI J;  2LY9 A;  4FIS A;  4L5E A;  1TC3 C;  2GM4 A;  3WHC A;  1T33 A;  2COB A;  2EQR A;  4DYR A;  4XRS A;  2M2E A;  5J3L A;  1ETX A;  3L1P A;  3HOX J;  1ETV A;  2CU7 A;  2IEK A;  3HM5 A;  4A3I J;  1GV5 A;  1H8A C;  2R5Y A;  4QSH A;  3TW6 A;  1FTT A;  3Q3S A;  2JA5 J;  3GBG A;  3DCF A;  1SFO J;  4A3F J;  4J19 A;  5IYD J;  4S0H B;  1JJ6 C;  3GTQ J;  4D5F A;  1GVD A;  3IH4 A;  2GBY A;  5JLX A;  3FIS A;  1HF0 A;  2CRG A;  2WB1 N;  2O8K A;  2HOA A;  3HEF A;  3HBL A;  1ZKG A;  4I76 A;  2NS7 A;  1R9T J;  1QVT A;  1JTX A;  1K83 J;  5E3O A;  4C2M J;  2HI3 A;  3LOC A;  2WV1 A;  2M9H A;  3BG9 A;  1G2H A;  1QVU A;  4AYB N;  1ZR4 A;  2EZK A;  1Y1W J;  3OSG A;  4DYC A;  5EG0 A;  3NAR A;  3ZQC A;  5M5X J;  1VF9 A;  4IHW A;  2EH3 A;  3BR5 A;  1LFB A;  1BW6 A;  3G1M A;  3JRC A;  4A3D J;  3IH3 A;  5EEA A;  2NOG A;  3GTO J;  5C4J J;  4X6A J;  2R93 J;  1JUP A;  3S1Q J;  5FKM A;  3S1N J;  1XG1 A;  2XGD A;  3QPL A;  4QTR A;  4RDU A;  4B3A A;  1RR7 A;  1ETY A;  4W97 A;  3ZQG A;  3BR3 A;  4B4C A;  5J1R A;  1JJ8 C;  2R7Z J;  5DTD A;  1S7E A;  2EBI A;  3HOU J;  2EZI A;  3OIO A;  1TWH J;  4A3B J;  2FX0 A;  4JX6 A;  4Y7N J;  3Q0W A;  3LNQ A;  5BNG A;  2N8G A;  2K9Q A;  3JRA A;  3BR1 A;  3RZO J;  1I6H J;  3CCY A;  3FIW A;  1MNM C;  5EGO A;  1JKQ C;  4QIW N;  4DYQ A;  1TWC J;  4BBR J;  2R0Q C;  5C3E J;  2DA5 A;  3Q0V A;  2OF7 A;  2XSD C;  4RBO A;  1E3O C;  4MLO A;  1BA5 A;  3BR0 A;  1LE8 A;  1TWA J;  4NDL A;  2IAI A;  3JRF A;  3K2A A;  3GTL J;  3E7L A;  5FKO A;  5J1U A;  4FE7 A;  5E3M A;  2NVY J;  3HGG A;  4BKX A;  5F1J A;  3A03 A;  3I4N J;  3S2H J;  1A5J A;  1NK2 P;  2E2I J;  3S17 J;  1ZGW A;  2DMT A;  5FKL A;  1WCM J;  1NK3 P;  2NVQ J;  5IOZ A;  1ENH A;  2KT0 A;  1W0U A;  1B8I B;  2DMQ A;  4BXX J;  3H3V K;  4AC0 A;  2DJN A;  1VND A;  3BTC A;  1HDD C;  2CQQ A;  1GDT A;  1POG A;  2O7O A;  2HYJ A;  3WHB A;  3HOY J;  4M3F A;  1ZK8 A;  1ETO A;  9ANT A;  2YS9 A;  2HQ5 A;  5K7H A;  2LFB A;  1Y1V J;  2YUS A;  3RKQ A;  2E2H J;  5M5Y J;  2M0C A;  4D7N A;  1OJL A;  2HXI A;  3BQY A;  5K7F A;  3JRI A;  5DS9 A;  2KDZ A;  4M3E A;  4C3H J;  4JP0 A;  5FLM J;  2X48 A;  2XPW A;  4I6Z A;  1IUF A;  3OOU A;  1AU7 A;  1JUS A;  5F27 A;  2DA3 A;  2HDD A;  2JK3 A;  5M3F J;  2L0K A;  1JGG A;  3JRD A;  1ZTR A;  1U8B A;  1VFC A;  3G1O A;  1BW5 A;  1XC5 A;  2YU9 J;  1APL C;  4BY7 J;  5IP9 J;  3IH2 A;  2LTP A;  5EZG A;  4GFB A;  1MSE C;  3JRH A;  4DW6 A;  4HNV A;  3HOV J;  4A69 C;  5F0C A;  3M4O J;  1XS9 A;  1MH4 A;  4ABZ A;  1VI0 A;  4XK4 A;  4IHV A;  1RPW A;  5EF6 A;  4A93 J;  1UHS A;  1Z0X A;  5IP7 J;  1UG2 A;  4C3I J;  2QF7 A;  1B72 B;  1U78 A;  4LOC A;  5GP9 A;  4G12 A;  1FIP A;  1NTC A;  2ZB9 A;  2H8R A;  3OSF A;  1ETW A;  3JR9 A;  2DA2 A;  4B1R A;  1O4X A;  1HLV A;  3RQI A;  3MKL A;  2L7M P;  2EZH A;  2R92 J;  3I4M J;  2HOS A;  1OFC X;  4D5C A;  3SJM A;  2WAQ N;  3GTG J;  3G1L A;  2XRL A;  4DZJ A;  2NS8 A;  2LKX A;  1RES A;  3LSP A;  1DU6 A;  2E19 A;  4UUT A;  4UUS B;  1B8I A;  5C44 J;  3HGY A;  2EZL A;  5F0H A;  4JYK A;  1IRZ A;  2DA7 A;  5IYC J;  1MBE A;  1MH3 A;  1P7I A;  2DN0 A;  2ME0 A;  3B6C A;  2CJJ A;  5E3L A;  3A02 A;  3B6A A;  3C2B A;  4M3B A;  1AHD P;  1JKR C;  2JA7 J;  4XIC A;  5IOY A;  1YRN A;  3QPS A;  1HOM A;  1JKP C;  3D1N I;  1IJW C;  3ZOB A;  1JKO C;  1AKH B;  3F0C A;  1HCR A;  2MG4 A;  2LP0 A;  2OPT A;  1UMQ A;  3PO3 J;  4A3C J;  4BBS J;  3S2D J;  5IP6 A;  3HDD A;  1GUU A;  2X9D A;  4IHY A;  1RKW A;  3GTP J;  1X2N A;  1HDP A;  3BTL A;  2MSY A;  3ZQL A;  2Y2Z A;  3ZQH A;  3HOW J;  4FTH A;  3CQZ J;  5FKN A;  1U9O A;  5EYR A;  1TWG J;  5E3N A;  2HOT A;  4A3E J;  5GPC A;  1ETQ A;  3TP3 A;  2R5Z B;  2M8G X;  1ORK A;  2X6O A;  3BR6 A;  3IV5 A;  2LK2 A;  1IC8 A;  1RKT A;  2XPV A;  2VKV A;  4V2F A;  3S1R J;  2JA6 J;  2LR8 A;  3S15 J;  2JMW A;  3LSJ A;  3UKG A;  1YRN B;  4CYC B;  4M3D A;  1FTZ A;  2HXO A;  2NVX J;  4A3G J;  3PM1 A;  2P81 A;  2XGC A;  4FCY A;  1IG7 A;  3CMY A;  2Y0S N;  1QRY A;  2XGE A; 
#chains in the Genus database with same CATH topology
 3CTA A;  4C3J J;  2CV2 A;  3KZZ A;  1IGN A;  1QPI A;  2MGQ A;  1KQ9 A;  2V6C A;  3ELK A;  2XDV A;  1XPX A;  2KDO A;  4ENM A;  5K5R A;  4XLN F;  4Y13 A;  3VYS B;  4UV9 A;  4B44 A;  1WZ2 A;  1R22 A;  1RI7 A;  3ZN1 A;  1B9M A;  1MSF C;  1K61 A;  4JX4 A;  3GTM J;  1UZC A;  4MFD A;  3CF2 A;  3TQN A;  3IKV A;  3CCQ I;  1SFU A;  4BU2 A;  2B63 J;  4A3L J;  3ZMT A;  5FKK A;  2MD5 A;  1JHH A;  1XDU A;  1WI3 A;  5LLQ A;  1LFU P;  1A35 A;  4N9H A;  4OIO F;  1SFK A;  4UUS A;  1FOX A;  1Y0N A;  3DWL E;  4CYD A;  2QWW A;  4CA0 A;  2CUF A;  5EJC A;  2EFW A;  4EQQ A;  3KCC A;  4X1E A;  3QAH A;  2ZCW A;  1U0J A;  3CUQ B;  3FHN A;  5JLW A;  3R60 A;  3P9C A;  1MD0 A;  3E5Q A;  2L4M A;  3PFY A;  3G4S I;  2STT A;  1KU2 A;  2W48 A;  1EF4 A;  3EPZ A;  2EIN H;  4CHU A;  1TQP A;  4XOP A;  3T8T A;  2VBW A;  3HB9 A;  2XV4 S;  1QO0 D;  2ME6 A;  3H36 A;  2W82 A;  3TL4 X;  1FX7 A;  2VC1 A;  4OAZ A;  5E18 F;  1F43 A;  2AO9 A;  3L2R A;  2KIU A;  1GLN A;  3AG2 H;  4B48 A;  1HQC A;  4DBQ A;  1G3W A;  1G8X A;  3VEP A;  4CH7 A;  2P6T A;  3VPR A;  5B3S H;  5DM6 F;  2EJR A;  4MFE A;  3GVA A;  3BTI A;  4XKC A;  2RAE A;  3RZD J;  1DU0 A;  2QSG X;  2AXL A;  3E5X A;  3P9I A;  4RAY A;  5TGT A;  3BPV A;  3CJR B;  4RB2 C;  4A3M J;  5L3D A;  3HRS A;  4WWC A;  1U6G A;  4E7K A;  5EDN A;  2RVC A;  5ILS A;  5F04 A;  4PSW A;  4Y17 A;  2IBD A;  3FXO A;  1F1Z A;  1BBY A;  2VQL A;  2ZME A;  4O3M A;  3L7W A;  4DBR A;  3EQL F;  3MZ8 A;  4PJN A;  1TL8 A;  1HKS A;  3P5J A;  4IL6 C;  2E2J J;  4ETS A;  1XSX A;  4ZC3 A;  5F08 A;  3CCM I;  4A3J J;  1S8N A;  2FSW A;  2MH2 A;  3OYC A;  3L2Q A;  3H0D A;  4W1U A;  3JRB A;  4PGH A;  1JGS A;  3ZN0 A;  3CDH A;  1TWF J;  1GV2 A;  1R00 A;  5EG0 B;  2H1L A;  2XB0 X;  1FEX A;  1FBU A;  4LFU A;  3AAF A;  4I0B A;  3H5A A;  2X85 A;  1O7L A;  2ZXW H;  3KFW X;  3O8G A;  5HDG A;  2ZXJ A;  1MNE A;  1H89 C;  2K7L A;  2KKO A;  5JI6 A;  3GZ5 A;  5K5O A;  2KJB A;  5FRO A;  3GFJ A;  1FZP B;  5J47 A;  2L9S A;  3Q9S A;  2O0Y A;  2LVS A;  2DU9 A;  4XN3 A;  2XUB A;  4KMF A;  1P7J A;  3G2B A;  1D5Y A;  3QQA A;  1BJZ A;  5F64 A;  1A6I A;  3HZJ A;  4RAZ A;  1K7A A;  1WPK A;  2K86 A;  2A07 F;  2ICW G;  1K6O A;  3TO7 A;  3ZQ7 A;  2I10 A;  1KU9 A;  4M74 A;  4P9U A;  3CMA I;  3FDY A;  1BI2 A;  2BW3 A;  2VJI A;  3BQZ A;  2CYY A;  5EGO B;  1WRJ A;  2LG4 A;  2P7C B;  2M34 A;  4BHC A;  3I53 A;  3FK7 A;  4DZP A;  4X0G A;  4XRS G;  1FMW A;  2DI3 A;  4HX8 A;  3KP5 A;  5BMZ A;  2CUJ A;  5D5W B;  5EEG A;  2EIK H;  3BG3 A;  2BY2 A;  1YE9 A;  3GLL A;  3FXR A;  4GRI A;  2BYV E;  2MH9 A;  3IHU A;  1LUJ B;  3I71 A;  2D1H A;  5J6X A;  2LY9 A;  3R0J A;  3CP2 A;  5FB2 A;  1TC3 C;  2GM4 A;  2QQB A;  2XKP A;  2COB A;  3K2Z A;  2M2E A;  2GQQ A;  3L1P A;  4CUG A;  3HOX J;  4MEX F;  4BQO A;  3OYA A;  2JRM A;  4LIU A;  2IEK A;  3C1D A;  1FWZ A;  1BJA A;  1H8A C;  4QSH A;  3I64 A;  3TW6 A;  4CCO A;  2JA5 J;  1FTT A;  1SFO J;  2FOK A;  3OR2 C;  5ERI A;  4A3F J;  3ZPL A;  2XRO A;  4IVN A;  4PJM A;  3GTQ J;  2W57 A;  2GBY A;  1K6Y A;  2WB1 N;  3CCJ I;  3GFI A;  2NS7 A;  4LIT A;  1R9T J;  3K10 A;  2H09 A;  4BHP A;  1JTX A;  5E3O A;  1T98 A;  3M8F A;  2Q0O A;  5DDG A;  5FO5 A;  2VLA A;  1G2H A;  2RQP A;  1QVU A;  3S3N A;  1T0F A;  2ZC2 A;  1S3J A;  3GFM A;  3OSG A;  4DYC A;  1BM9 A;  2HOE A;  2MAB A;  1OR7 A;  3WE3 A;  2KIM A;  4LG3 A;  1XTA A;  2VAS A;  3DEU A;  2L9N A;  1RIO H;  2QZ8 A;  2CMP A;  3G73 A;  2P4W A;  4I7H A;  4L9T A;  3UR3 C;  2HQN A;  3E3V A;  3H92 A;  2NOG A;  4A12 A;  5C4J J;  2QSH X;  1YW7 A;  4ASN A;  3LAP A;  4X6A J;  2W00 A;  3ASN H;  5LBQ A;  2DQR A;  1LQ1 A;  2XGD A;  2YX7 A;  5H6R A;  2OD5 A;  2KIQ A;  3KP3 A;  1D1C A;  2PBI A;  1JJ8 C;  3BR3 A;  4ZYE A;  2LC2 A;  5J1R A;  1ZRF A;  2DK8 A;  3BZK A;  2R7Z J;  1MDM A;  3V8K A;  2EZI A;  4PJJ A;  3W6K B;  2R7Q A;  1BI1 A;  3TBI A;  4AU7 A;  3LNQ A;  3CCU I;  3KX2 A;  4RB0 A;  3GZ6 A;  3X2Q H;  4FET A;  1LEA A;  4A6E A;  3GFL A;  4YIF A;  1MNM C;  2HTJ A;  1JKQ C;  2PJR A;  1TW2 A;  1RUO A;  4HQE A;  4DYQ A;  1R6R A;  3RIR A;  3ZMU A;  4I99 C;  5CYV A;  2DOF A;  5FLX K;  1ZGJ A;  3BCB A;  3H5N A;  1YIT I;  3WE2 A;  4Q4Z F;  4TV7 A;  1BA5 A;  3W2A A;  1REP C;  3VOD A;  1BR2 A;  4XQF A;  3EET A;  3F23 A;  4LLG F;  3GTL J;  2UXN A;  4GGG A;  1BR1 A;  3HRM A;  1ZG1 A;  5FKO A;  2DPU A;  2WAQ A;  2HS5 A;  2MD0 A;  2QQA A;  4J00 A;  4BAC A;  4BKX A;  1PDN C;  3CJT B;  1VQL I;  3S2H J;  4RGX A;  1NK2 P;  2P5K A;  3CCS I;  2E2I J;  1WSU A;  1YTY A;  2NVQ J;  1UJ8 A;  4RGR A;  2KT0 A;  2L7K A;  1UCR A;  2RRE A;  3IRQ A;  1EH7 A;  4HLY A;  2AQF A;  3H3V K;  1U5T A;  3GX4 X;  4L9N A;  2FRH A;  2L9V A;  2A6T A;  4MTE A;  4E7H A;  1GDT A;  2NXN B;  4E7S A;  3EYI A;  1G6N A;  2FQ3 A;  1R23 A;  4OMZ A;  3RKY A;  4KIT B;  2O7O A;  4YEJ A;  1XMA A;  3HOS A;  4YIR X;  4I09 A;  2VJ5 A;  1KQ0 A;  3M7G A;  2HQ5 A;  1OMI A;  2XAJ A;  5GAH J;  2V9P A;  2BXY A;  2YUS A;  2O61 A;  2IPQ X;  1Z7L A;  2XHK A;  3E1S A;  3FXL A;  3HXL A;  1W36 D;  5TIS C;  1R5I D;  1WVR A;  4ZH4 F;  2M0C A;  2DK5 A;  5K7F A;  4YII A;  4ZYG A;  1Z67 A;  2E5N A;  2VOO A;  4M3E A;  4CCM A;  2DW4 A;  3KP7 A;  4QPQ A;  3MKW B;  2AS5 F;  2X48 A;  3HYI A;  2PN6 A;  5F27 A;  2AQE A;  2FBI A;  4RGS A;  3RKX A;  2DJI A;  3MZY A;  2KP6 A;  1DP3 A;  2XAF A;  5M3F J;  2L0K A;  3VWB A;  1B6A A;  4EV0 A;  1Z9C A;  3JRD A;  1ZTR A;  5FGM A;  3W2V A;  2KRH A;  5DCM A;  1VFC A;  1BW5 A;  1XC5 A;  2IVM A;  5H20 A;  2EIJ H;  4BY7 J;  3VFZ A;  1R71 A;  5EZG A;  4ENN A;  4HNV A;  2LNB A;  3HOV J;  1P4A A;  1QZY A;  3RYP A;  1VQK I;  2YR2 A;  2DQL A;  3EUH C;  2DT6 A;  1RPW A;  4BUP A;  1Z0X A;  3BRO A;  2LMD A;  5IP7 J;  1G3T A;  4P96 A;  2XGX A;  4BAY A;  3AKZ A;  4HSR A;  3BJ6 A;  1X1B A;  4LOC A;  3FXU A;  2Z9O A;  4BJ6 C;  3DKW A;  2LBF A;  2VBY A;  4BQA A;  3JR9 A;  2DA2 A;  2L01 A;  1O4X A;  5L3F A;  4F52 A;  1BOA A;  3DEE A;  2L7M P;  4OMY A;  3I4M J;  1W5C C;  2QGU A;  3SJM A;  3QYB A;  2HZD A;  1I27 A;  3OOP A;  2F4M B;  2JUG A;  4NHJ A;  2E19 A;  3K9T A;  2A61 A;  3E5U A;  4UUT A;  5E20 A;  4UUS B;  1VQO I;  1B8I A;  2ZBK A;  1ZGA A;  4L0Y B;  3RI4 A;  2Q1Z B;  1HKT A;  1AWC A;  4H4K C;  1LVA A;  2CS3 A;  2ME0 A;  3SZP A;  4JQF A;  4ZYD A;  1MJB A;  2P6S A;  5HS8 A;  3SFZ A;  3B6A A;  3C3W A;  3WU2 C;  4DOZ A;  1E3P A;  1KU7 A;  4LB5 A;  3M8J A;  1UHW A;  3MAJ A;  1LNW A;  4RLQ A;  1YRN A;  4IXA A;  3OYI A;  1JKP C;  3ZOB A;  2KLO A;  2HKO A;  1HCR A;  2LH9 A;  1K79 A;  2AXT C;  3W6J B;  2MG4 A;  2LP0 A;  4A3C J;  1FNN A;  3E97 A;  1UG0 A;  4XN0 A;  3S2D J;  4BBS J;  2D1V A;  2F2E A;  2X9D A;  5CPR B;  2WAE A;  5D6F A;  2BVM A;  4XLP F;  4IHY A;  4HV6 A;  2NRA C;  5IY5 H;  3TDU C;  4F3Q A;  1VQ8 I;  2FE3 A;  5DYM A;  4QPO A;  1YHQ I;  4FTH A;  1TWG J;  1PP8 F;  1HW5 A;  1MMA A;  2DDB A;  4M71 A;  4PCQ A;  2NOJ B;  3N4M A;  4AIK A;  2W7N A;  1EV7 A;  3IV5 A;  1X1C A;  4C2T A;  3O3K A;  2ZME B;  2OBP A;  3S15 J;  2MLG A;  5L3B A;  1HA8 A;  2CQ7 A;  4A3G J;  2VE9 A;  3JAM Z;  2QLZ A;  2P81 A;  2XGC A;  2FML A;  4M9S A;  4NBQ A;  3WTS C;  3QPH A;  3IRR A;  2P8T A;  1W5T A;  2XGE A;  4CCL A;  5J4V A;  4QWQ A;  3QOE A;  1Z3Y A;  3CO7 C;  3WGH A;  2OTL I;  3HRU A;  2FEZ A;  4MO7 A;  3LAJ A;  2CWE A;  3MD2 A;  1MBH A;  3OYF A;  4II3 A;  3LSR A;  1X2M A;  4ZTJ A;  4IKF A;  5FJ8 J;  2K9N A;  2FJ1 A;  3FKJ A;  4HQM A;  1MJ9 A;  3GTK J;  1MMS A;  1FP1 D;  2F6C A;  3CDL A;  3OYE A;  2JUC A;  4V2G A;  1G59 A;  3OYB A;  1X4P A;  4IRG A;  4AIJ A;  4Q5S F;  3I5U A;  3F8B A;  1EH8 A;  1HW2 A;  2L7F P;  4DGW B;  4HRI A;  2BW3 B;  3BTJ A;  3DTE A;  1BL0 A;  3S1M J;  2ELK A;  1Q1H A;  2JN6 A;  4PFP A;  4EJV A;  3QYF A;  2JTV A;  3O8H A;  2ID3 A;  2O8X A;  3FXK A;  4FQG A;  3BOQ A;  1CQT A;  2BHY A;  2FF4 A;  2W85 A;  2HQR A;  1ONV A;  1T0F C;  3J80 Z;  2X6Y A;  2DA4 A;  4KIC A;  2LRE A;  4WXH A;  5DD4 A;  3V8J A;  3V4G A;  5M3M J;  3VB2 A;  3I3L A;  4XRM A;  5IPA A;  2HVQ A;  1OR7 C;  2OU2 A;  3F6O A;  4U0W A;  1MBK A;  1P2F A;  4PGG A;  2TDX A;  2GLO A;  2V1X A;  5FLV A;  4XR6 A;  3DKY A;  3K1M A;  3FMQ A;  1I50 J;  4PFO A;  1XGS A;  4UXN A;  2A6E F;  2AHQ A;  2CQX A;  1O3T A;  2HEO A;  1HBX G;  5KK1 A;  3DTI A;  4F7Z A;  3D5S C;  1TTY A;  2OAZ A;  4D1Q A;  2EFQ A;  4MQ9 F;  1IV6 A;  4MGR A;  2R7T A;  2IGK A;  2DA6 A;  1FOK A;  3Q5F A;  3RDI A;  2BEO A;  1P92 A;  2QSF X;  1K4T A;  1KON A;  3CLO A;  4AYB A;  3CME I;  4C9Y A;  1FY7 A;  2K02 A;  3S8P A;  3U1D A;  4ESB A;  2WV0 A;  1QGP A;  4BY1 J;  1ODD A;  5IT3 A;  2JA8 J;  2JWT A;  3OYL A;  3BLY A;  3PQK A;  2JVG A;  3S14 J;  1ZG5 A;  1R49 A;  1JT0 A;  3OWT A;  4LIV A;  4U0Y A;  1RUN A;  5B1A H;  3S16 J;  2ECC A;  4UHT A;  4B3X A;  2HYF A;  5CVR A;  2EFO A;  4YFX F;  3IAM 2;  5AIP A;  2W4S A;  1BIB A;  4JK1 X;  4AVP A;  4BYY A;  1SD4 A;  2H6C A;  1JUM A;  1QPM A;  3W3C A;  2Y75 A;  1Z6T A;  4KT6 A;  3WU1 B;  3CCL I;  3TW7 A;  3KET A;  2A68 F;  4EJT A;  3FHZ A;  1J5Y A;  2NS0 A;  1MDM B;  3QU6 A;  4I01 A;  2NVT J;  3U9G A;  3MVP A;  3OYD A;  2M45 A;  2HVR A;  4KN7 X;  4II2 A;  4U7D A;  2ZFU A;  1YO5 C;  3DEW A;  4ZTF A;  1KYZ A;  5ED4 A;  2PJR B;  3DXJ F;  4M3G A;  6PAX A;  4ZZD A;  3FXM A;  3FK6 A;  4D7M A;  3NRV A;  1BR4 A;  1W7P A;  2H8W A;  4LG0 A;  4AUX A;  1QNT A;  1S7A A;  3PO2 J;  4IRI A;  1IXC A;  2FU4 A;  2LYC A;  4J01 A;  5JHF A;  3G6E I;  3K70 C;  2M30 A;  3FKI J;  3L00 A;  4WXC A;  4N0B A;  4AD9 A;  1KU3 A;  1ZAR A;  4U7B A;  4FIS A;  4Y15 A;  3WHC A;  2DLL A;  4XRS A;  4M6Y A;  4XKV A;  4G6Q A;  2EA4 A;  2PLY A;  4BXF A;  1QZZ A;  1DGR M;  2LRD A;  2ZXI A;  2H94 A;  2CU7 A;  2ZJQ F;  4HNT A;  4G7H F;  4A3I J;  5GTH C;  2L3D A;  2XSJ C;  4KIF A;  5IYD J;  4XLF A;  3RPQ A;  4J19 A;  3BCA A;  2EK5 A;  2K3F A;  2FBH A;  1GVD A;  1U5T B;  2XF5 A;  3E6M A;  3HJE A;  5JLX A;  2CRG A;  3NEU A;  2GOM A;  3K4N A;  2OZU A;  3LSK A;  3SEQ A;  2HPM A;  1IXR C;  1P4W A;  2VXZ A;  5KAF C;  1YQA A;  2V26 A;  3KE2 A;  5EEH A;  5E1Z B;  3C2H A;  1UB9 A;  3LOC A;  3OYN A;  4HW0 A;  4Y4R A;  3BG9 A;  1ERD A;  4B09 A;  1H0M A;  3CJQ B;  2OQG A;  3GME A;  2KPM A;  4XRF A;  2UZK A;  1U8R A;  1SMY F;  5E8I A;  4YG2 F;  2P0W A;  4ESJ A;  4ENK A;  1LFP A;  3I0T A;  3K1N A;  4HG2 A;  4A0Y A;  5M5X J;  4IHW A;  1V5F A;  3F72 A;  1T8I A;  3G71 I;  3K4C A;  5D8K B;  3JRC A;  2CW7 A;  2YSR A;  3HC7 A;  5EEA A;  2HNH A;  1CGP A;  5AIQ A;  5HLI A;  4EJU A;  2LF7 A;  5LGT A;  3MQ0 A;  1DDN A;  2JSP A;  4G7O F;  3B73 A;  4BQQ A;  3I55 I;  3QPL A;  1FPQ A;  4QTR A;  4B3A A;  4RDU A;  4E7I A;  4W97 A;  1WFX A;  2WA0 A;  2V6E A;  2OZ6 A;  3AG1 H;  4ZJZ A;  2IGO A;  1IN7 A;  4B4C A;  2H27 A;  3K6G A;  5DCM B;  1GXQ A;  1D1A A;  3F8F A;  4E7L A;  4ESF A;  1TZL A;  4A3B J;  2FX0 A;  3OL4 A;  3FXQ A;  4Y7N J;  3Q0W A;  2FNA A;  1T95 A;  1LB2 A;  3JTH A;  3DF8 A;  4Y33 A;  3SDB A;  2K9Q A;  3BR1 A;  2V1U A;  1OCZ H;  3KZI C;  4L5I A;  4D0P A;  4E70 A;  2NYX A;  2O3F A;  4EM1 A;  3FIW A;  5A2Q K;  1XCB A;  3BC8 A;  1VQ9 I;  3C2G A;  3D5L A;  4F92 B;  1SD6 A;  3SZG A;  2DFH A;  4BBR J;  2R0Q C;  3R4K A;  2DA5 A;  3Q0V A;  2IS1 A;  2DXI A;  1JI8 A;  1FSH A;  3BR0 A;  4BDZ A;  4HST A;  4BE2 A;  1TWA J;  2CG4 A;  3JTG A;  3ZQQ A;  2E34 A;  4A2U A;  3K2A A;  1VZ0 A;  2LBF B;  2QQ9 A;  1XX5 A;  3CZ6 A;  3O2P E;  5FFX A;  2IS2 A;  1F4K A;  3V7S A;  1LDK B;  1PYV A;  4O5V A;  3HGG A;  4RA2 A;  1QHG A;  4KMU X;  5B1B H;  1E3H A;  1VTN C;  1A5J A;  4HYE A;  4NC8 A;  1IN5 A;  3S17 J;  2DMT A;  3M07 A;  3MEX A;  5FKL A;  5LFA A;  1WCM J;  2IS6 A;  2M4K A;  5IOZ A;  1ENH A;  1W0U A;  1B8I B;  2DMQ A;  1SVO A;  4BXX J;  2VOD A;  4AC0 A;  4XBF A;  4XOT A;  4LLN A;  2DJN A;  1OYI A;  2HR3 A;  1YYV A;  3COA C;  1YI2 I;  3I58 A;  2CQQ A;  4BH9 A;  2RNJ A;  3ML6 A;  2IGM A;  3SZT A;  3R6S A;  3FWE A;  1FLI A;  1ETO A;  1IN8 A;  2J5O A;  2VIX A;  3I59 A;  3NQO A;  4EAT A;  3GUD A;  5DD8 A;  4R1H A;  3CMM A;  5IT9 K;  2YS9 A;  1TQI A;  4OAY A;  4F93 B;  3AFH A;  2F4I A;  2ESH A;  2LFB A;  4RB1 A;  2Y69 H;  1Y1V J;  4YRV A;  2F48 A;  4XLE A;  1TW3 A;  3WG7 H;  5FLX Z;  5H6Q A;  3JRI A;  3J81 Z;  3P7N A;  5DS9 A;  3EYY A;  2GIZ A;  2KDZ A;  2XF7 A;  1S72 I;  1VQ5 I;  5FLM J;  4I6Z A;  3CDI A;  1P4X A;  2JT1 A;  4HX4 A;  3LSI A;  4NUB A;  2E7W A;  2VT3 A;  4S04 A;  3U1K A;  1FYL A;  3KYC B;  4KNY A;  3IUO A;  4Q48 A;  5LHI A;  5HNH A;  1YFH A;  2YU9 J;  3IH2 A;  1OPC A;  1P6R A;  3DFG A;  5CQG A;  4IQ4 A;  3JRH A;  1ZHF A;  2G7H A;  2FBK A;  4R79 A;  2K27 A;  4G9Y A;  2MC3 A;  4A69 C;  1TNT A;  2X6W A;  3FXJ A;  2EIL H;  4GO1 A;  5DV5 A;  1MH4 A;  4ABZ A;  1VI0 A;  2CW8 A;  4ZZL A;  5LEK A;  1RNL A;  4CO8 A;  2Z3Y A;  1W4M A;  2DDA A;  5L3G A;  1N25 A;  1EKE A;  2XAS A;  4UB6 C;  2ISY A;  4MHG A;  5GP9 A;  2Y48 A;  3EUK L;  1NTC A;  3LL7 A;  1U2W A;  1YLF A;  2LDU A;  4L9J A;  2H8R A;  3OSF A;  3F3X A;  3S32 A;  5DCF A;  5ICE A;  2XIG A;  3OYG A;  1HLV A;  1EH6 A;  3GCM A;  3KP2 A;  5B5E C;  3VDX A;  1BC7 C;  3CC7 I;  3ZMS A;  2DPD A;  1XMK A;  4KYW A;  1KQ8 A;  2M4G A;  3FF5 A;  1OFC X;  3SHF A;  4D5C A;  2PI0 A;  3LSM A;  3GTG J;  1Y8R B;  3P9K A;  3G1L A;  4XOR A;  2HVS A;  2NS8 A;  3CJN A;  1OKR A;  3E6B A;  3PJR A;  3HPH A;  1I3A A;  3R0A A;  4XON A;  1H9T A;  1OIS A;  2BY0 A;  3ROU A;  4LGW A;  5L3E A;  3K4K A;  2OTJ I;  1DU6 A;  5H2F C;  4NQW A;  2EZL A;  4RLF A;  4JYK A;  1KYW A;  2GIV A;  2Q2E A;  1MH3 A;  4OIN F;  5IYC J;  5GAD J;  4KIB A;  2CJJ A;  1VQM I;  3NWT A;  2GA2 A;  2Y0M A;  2BV6 A;  3H9J A;  3HSF A;  1TP4 A;  3QP5 A;  2LF8 A;  2JA7 J;  4XIC A;  3HUG A;  1FC3 A;  3V7R A;  1HOM A;  1JKO C;  2HFH A;  1W1W E;  1MJA A;  3TMO A;  5D6E A;  1VQN I;  5FFZ A;  3PNY A;  2OPT A;  3PO3 J;  3HTS B;  2HDC A;  3I9V 2;  2DT7 B;  5DEQ A;  3RCO A;  4XKW A;  4BGD A;  5IP6 A;  3OYK A;  3PUB A;  4EVI A;  1QHH D;  4MNU A;  3WGG A;  2ETH A;  4BEH A;  4DIQ A;  5LHH A;  2IT0 A;  1B4A A;  2R7X A;  3ZQL A;  4BXU A;  4KT5 C;  3ZQH A;  5FKN A;  5EYR A;  1D0Y A;  2XC7 A;  2ADU A;  4GCV A;  2ACJ A;  3TP3 A;  4GDF A;  4IRH A;  4FHT A;  2HDW A;  3BR6 A;  2A5Y B;  3RPU A;  2ELJ A;  4DQ2 A;  3BP8 A;  3QYE A;  3ERM A;  1RKT A;  3S1R J;  3L2W A;  2KL4 A;  2JA6 J;  2LR8 A;  3FX3 A;  2COM A;  5KVR A;  1FTZ A;  3H3U A;  2LSO A;  1T38 A;  3FMR A;  2NVX J;  2MFZ A;  2E36 A;  4YFK F;  1J2X A;  2VB6 A;  2CFO A;  2Y0S N;  1DQU A;  3TOA A;  1QA6 A;  2CQK A;  5C4X J;  4IHS A;  5HOD A;  2I8D A;  1ZYR F;  1B72 A;  4IOA F;  1U3E M;  1OLT A;  2ZNZ A;  3TED A;  2TCT A;  4U88 A;  1D8K A;  2BY3 A;  3F8M A;  1B9N A;  4HA8 A;  5GPA A;  3MWM A;  1EJ9 A;  4N4O B;  1ZH5 A;  2YU3 A;  3Q9V A;  3S93 A;  3OS1 A;  4EMS A;  5DUK A;  2DMP A;  2Z1D A;  2IP2 A;  1ON1 A;  1OCO H;  2ECB A;  2QUF A;  1FOW A;  1OQY A;  1CF7 A;  4IPA A;  2QCO A;  2XRN A;  5GTI C;  1MBJ A;  1F5T A;  4L18 B;  2L2O A;  2PMZ N;  4PDK A;  5LHG A;  1R36 A;  4RM3 A;  1ZR2 A;  2IGN A;  1Y56 A;  5IYB J;  4ON0 A;  1X58 A;  3Q0U A;  1XGN A;  4P1W A;  5K7Z A;  1ETK A;  2LD5 A;  4M6V A;  2CV1 A;  3DPU A;  1T39 A;  3HKZ N;  2OCC H;  1JTY A;  2DMN A;  4L0Z B;  5KHD A;  2VXD A;  1P9Q C;  2ZSI B;  5FD5 A;  1W7P B;  4LG0 B;  2BOL A;  1N75 A;  3DLL F;  1AKH A;  2BBY A;  2V1D A;  3ECH A;  3C7J A;  4LK0 F;  3OR1 C;  3SXY A;  1V5G A;  1HKQ A;  1LJ9 A;  2Y31 A;  2Z5U A;  2HYG D;  2WAF A;  3REO A;  2WY8 Q;  2K4B A;  2XB5 A;  2M0M A;  4UNO A;  1ZN2 A;  5FRN A;  1WJC A;  3LQQ A;  3HTU A;  2GXB A;  2R7O A;  3MZH A;  1HC8 A;  3FZV A;  1T56 A;  3OY9 A;  1NG7 A;  1UEL B;  2BE5 F;  1WH7 A;  4HF2 A;  1R4N B;  2PMH A;  3A0H C;  5F0F A;  4YEL A;  3OYM A;  2WB1 A;  1W0T A;  1J09 A;  1VQ7 I;  2V1N A;  4ANJ A;  2LLK A;  3HIF A;  1ACI A;  1R58 A;  3BG5 A;  2ZME C;  3E6C C;  1MBG A;  5M5W J;  1X1A A;  4OWR B;  3K7A J;  3SDG A;  1HSJ A;  2BZT A;  4NNJ A;  4ZDL A;  3HRT A;  2VJ4 A;  5K5Q A;  4IHX A;  1Z77 A;  3BPX A;  4EEF G;  4ZDP A;  3NAU A;  2K40 A;  1RET A;  3ONQ A;  2L5Q A;  2VKE A;  1LVK A;  2FQ4 A;  3KIO A;  2Z33 A;  3ESW B;  1ULY A;  1H9G A;  5BPD A;  3WU0 A;  2EV0 A;  2DTZ A;  5HOO A;  1Y6I A;  1HST A;  1Z6R A;  3WTV C;  1N77 A;  3LSG A;  1XN7 A;  3N05 A;  3A01 A;  4P55 A;  2K85 A;  4MIM A;  1WH5 A;  2DT5 A;  2O9L A;  1IDY A;  3VYR B;  1I3Q J;  3K4B A;  4OOI A;  2I5U A;  2LKP A;  5EZH A;  3IL2 A;  1ITY A;  1G3S A;  1X1P A;  2L9R A;  3DV8 A;  3EUA A;  1LPQ A;  2G7U A;  4B47 A;  1LDJ A;  2DA1 A;  2JSC A;  3BR2 A;  4IEJ A;  4PJL A;  3IC7 A;  3MCZ A;  3LFK A;  3V42 A;  2H1K A;  1N78 A;  4LB6 B;  3GTJ J;  4UVA A;  1XDS A;  1GVJ A;  1O57 A;  2H6B A;  3ULQ B;  1SC7 A;  2X6X A;  3W6V A;  3H5R A;  2L7Z A;  3KP4 A;  4Z2Y A;  4UVC A;  1UHM A;  2VPR A;  2ELH A;  1AA7 A;  2PEX A;  3M1E A;  3QPT A;  3ZCO A;  5CVU A;  1RC9 A;  2MW8 A;  1PUF A;  2VBX A;  3K4L A;  4G8X A;  1D1B A;  2M8E A;  2K9S A;  1D8J A;  2KIS A;  5CVJ A;  1MZB A;  5BS6 A;  4L5E A;  3HSR A;  4KN4 X;  1T33 A;  2IA0 A;  4DYR A;  4IO9 F;  3KYD B;  4CZC A;  5LGU A;  2M5W A;  4RMN A;  1IRF A;  1DPU A;  3HM5 A;  1GV5 A;  4I0A A;  2R5Y A;  4G6T B;  3Q3S A;  3GBG A;  1R1V A;  3DCF A;  1DP7 P;  4FX0 A;  2DFI A;  4S0H B;  1WJE A;  2L54 A;  2IW5 A;  2VQG A;  3IH4 A;  2XVC A;  3FMS A;  3FIS A;  1HF0 A;  2ZSH B;  1O3S A;  5FRM A;  2HOA A;  1T6S A;  3HEF A;  5E1W A;  2A6H F;  3HBL A;  1ZKG A;  4BS9 A;  2MYS A;  4EM2 A;  4BNC A;  3TKY A;  1QVT A;  1K83 J;  3U21 A;  3AG3 H;  3ABU A;  1OCR H;  2WAD A;  3I59 B;  1YIJ I;  2M9H A;  3B02 A;  5D4S A;  3IWZ A;  2EZK A;  4JBA A;  4KJZ A;  5GAG J;  4F55 A;  1WJB A;  2XAQ A;  5D5X B;  2NNY A;  2JA2 A;  2V79 A;  5HDK A;  3FBN B;  4I02 A;  4Z6Y A;  2F5V A;  4KIG A;  2ZXH A;  3ZQC A;  3F8N A;  1MMN A;  1V55 H;  5CQE A;  2ZJP F;  4G7Z F;  1JHF A;  5FD6 A;  1LFB A;  1SAX A;  1KZH A;  1C0W A;  2VL8 A;  4UB8 C;  2GXG A;  1VQ6 I;  4WCG A;  3BZ6 A;  2BY1 A;  4RS8 A;  1V5E A;  2B0L A;  2E1M C;  2FUG 2;  3IH3 A;  3OIP A;  1WWX A;  5HLH A;  3GO5 A;  1SAU A;  1JUP A;  5HVQ C;  3S1Q J;  1BN5 A;  5E1X A;  4RAG A;  4XNF A;  2E1C A;  1XG1 A;  1ON2 A;  2IS4 A;  1RR7 A;  1ETY A;  2Q8K A;  3QP6 A;  2X1C A;  3CP8 A;  3PSI A;  1E2X A;  2Z2S B;  2BVL A;  2CW0 F;  1X3W B;  4KUM A;  3ZQG A;  1S7O A;  1S7E A;  4XLH A;  3HOU J;  1DUX C;  3OIO A;  1TWH J;  2EFN A;  5D5U B;  3L2U A;  2DBB A;  2M87 A;  2J5P A;  3HOT A;  3QWL A;  3WTW C;  4ZYH A;  3RZO J;  2E71 A;  1I6H J;  3CCY A;  1R1T A;  5D4R A;  2VE8 A;  2HQA A;  1TWC J;  3ABK H;  2IXS A;  3ISP A;  4E6K G;  3CC2 I;  1XMX A;  1WJD A;  3E0J B;  2XSD C;  1R7J A;  1E3O C;  2R7F A;  1LE8 A;  2RDP A;  3QRF F;  2IAI A;  4XM3 A;  3JRF A;  4A0Z A;  5J40 A;  1IN6 A;  3DBR B;  3E7L A;  2IA1 A;  3HHH A;  3I54 A;  1STZ A;  2FOW A;  2QYO A;  2E1M B;  4FE7 A;  5E3M A;  1X19 A;  2JZY A;  1A36 A;  1LEB A;  3ZGK A;  5E8G A;  2LOO A;  2DOE A;  4JOM A;  4M9Z A;  2HU9 A;  4NB5 A;  3VOE A;  4KA4 A;  4OU0 A;  4P9F A;  4BL0 B;  3KEQ A;  3ERE D;  1PUE E;  1NK3 P;  3GXO A;  1U5T C;  4CIC A;  3BZC A;  2OQR A;  4NQW B;  3RTR A;  2CGP A;  1MIJ A;  1YX5 A;  1UAA A;  2P5V A;  1YW8 A;  2Q2E B;  1YJN I;  3CLQ A;  5F6F A;  2HGC A;  4IOC F;  1VND A;  3BTC A;  1J7K A;  1HDD C;  3HHG A;  5GAE J;  3E6D A;  1D0X A;  2QEN A;  2ZJR F;  1JE8 A;  2VOP A;  1LKX A;  2WC2 A;  2HKX A;  3PNT A;  2HYJ A;  3OIQ A;  3HOY J;  4M3F A;  1R4M B;  2EPF A;  2IJL A;  5HS7 A;  4PJ0 C;  2R7R A;  1T2K A;  2UXX A;  3HUG B;  1J0R A;  1FOY A;  2VT2 A;  5J8F A;  5K7H A;  3J80 K;  2GOX B;  5A2Q Z;  1XCV A;  3L2C A;  3RKQ A;  4BQN A;  5M5Y J;  1PP7 U;  4E7J A;  4D7N A;  3BQY A;  2HXI A;  1FT9 A;  3HSE A;  3PQJ A;  1YJW I;  4OIR F;  2JQ7 A;  4BJT A;  1L3L A;  3DLA A;  2W25 A;  4JP0 A;  4BEH B;  3SQN A;  2F5D A;  2XPW A;  4HLX A;  1RRJ A;  2JRT A;  1AU7 A;  2QM3 A;  1JUS A;  4BE1 A;  1PVE A;  2DA3 A;  2GA1 A;  2CV0 A;  2JK3 A;  3I4P A;  3OV8 A;  4HV5 A;  4CSW A;  4DJA A;  1JGG A;  1U8B A;  2UUZ A;  2Z16 A;  2EIM H;  3CES A;  3SEZ A;  2K4J A;  4HDV A;  4OIQ F;  3G1O A;  1MW7 A;  3RYR A;  2MC4 A;  2HPI A;  3HPG A;  4Q47 A;  3L09 A;  4HDU A;  1IW7 F;  4RM2 A;  1Z91 A;  4DW6 A;  1L0O C;  3ZRG A;  1KGS A;  2NVU B;  4HNU A;  3M4O J;  2QBY A;  1XS9 A;  2DTR A;  1Z21 A;  4LJZ F;  5KCM A;  4IHV A;  4YFN F;  2XAU A;  2KRC A;  5EF6 A;  4A93 J;  1FMV A;  1WKM A;  3WTT C;  3EUH A;  4M73 A;  1QQI A;  4C3I J;  2E5Z A;  2FXA A;  1B72 B;  1J75 A;  5ILV A;  5IT9 Z;  4G12 A;  1D0Z A;  2IA2 A;  1Z1D A;  3K69 A;  4WXD A;  1V4R A;  3CCV I;  3BDD A;  4BDY A;  5LRR A;  4HOB A;  1R5G A;  1B59 A;  2EZH A;  1FYM A;  2R92 J;  4B8X A;  2HOS A;  4MEY F;  2DOD A;  4DNC A;  2WAQ N;  3VSK A;  3LMM A;  4DZJ A;  2LKX A;  1CF7 B;  4B43 A;  3LSP A;  2DO7 A;  2G9W A;  3WOD F;  4C30 A;  5C44 J;  3CF5 F;  3HGY A;  4WK8 F;  3RSN A;  1SFX A;  5F0H A;  1IRZ A;  2DA7 A;  1MBE A;  1S5L C;  3A4C A;  3PFI A;  2DN0 A;  3B6C A;  1YX3 A;  5E3L A;  3A02 A;  3OYH A;  5JVG F;  3U2R A;  4IJA A;  4ENJ A;  4M3B A;  2FMY A;  2HTS A;  3PUF A;  2O5R A;  4L9V A;  3ZMD A;  1AHD P;  2VN2 A;  1JKR C;  3DTK A;  1S6L A;  2W24 A;  5BPI A;  5CJ9 A;  5ILU A;  3D1N I;  1IJW C;  1AKH B;  1IXS B;  1S9H A;  2R7S A;  2YX4 A;  2WY7 Q;  5E79 C;  1UMQ A;  4FT8 A;  3PL8 A;  5K1Y A;  2KQR A;  1RZ4 A;  3HDD A;  2VKD A;  2E60 A;  2K3P A;  2OV7 A;  4WF2 A;  2RC4 A;  2RN7 A;  1MGT A;  2CUZ A;  4KFC A;  1X2N A;  1HDP A;  1B1B A;  2EFP A;  2V7F A;  3HOW J;  4EGY A;  1U9O A;  5DUI A;  3J7Z I;  3KLN A;  2OCE A;  5E3N A;  2HOT A;  5GPC A;  4WX9 A;  2KZV A;  2M8G X;  1ORK A;  2X6O A;  4XLC A;  5HLG A;  2R7D A;  2LK2 A;  1HXD A;  2HZT A;  2XPV A;  2VKV A;  2PFB A;  3ZMV A;  3S2W A;  1F9N A;  1VQP I;  2A3S A;  2JMW A;  2PMU A;  3UKG A;  1YRN B;  4CGZ A;  3L2V A;  2X4H A;  1QU3 A;  3BG6 A;  1IG7 A;  2QQ8 A;  2STW A;  2R7V A;  1ZRE A;  1QRY A;  2KMU A;  2E1O A;  1XD7 A;  3T0Y A;  3A01 B;  2Y9Y A;  2A69 F;  1QBJ A;  3KP6 A;  3NWS A;  2ZNY A;  3DU5 A;  2CUE A;  2CFX A;  2FD5 A;  3MN2 A;  1IO2 A;  3VYT B;  1TT5 B;  4AWX B;  4XSX F;  1ZQ3 P;  4JX5 A;  1WJF A;  3DU6 A;  1LDD A;  5HDN A;  2QA4 I;  1SEU A;  2D5V A;  5AON A;  2XKO A;  2PQ8 A;  2QEX I;  1OYY A;  1Q1V A;  2G0E A;  2K9L A;  3DQV C;  2FA5 A;  3H9G A;  1I5Z A;  5LD2 C;  5B66 C;  4RGU A;  1ZLJ A;  1K78 A;  3M3Y J;  1MKM A;  2V9V A;  3A1Y A;  1IRX A;  3PNV A;  2E7X A;  3CCR I;  3IAS 2;  1ZLK A;  1W7P D;  2D2W A;  3S3O A;  2NAZ A;  1PUF B;  5D8L B;  2M1B A;  3TO9 A;  1XGO A;  5CVV A;  3RJP A;  3T5X A;  3TP0 A;  1OCT C;  1I1G A;  1I39 A;  2M7A A;  3BG7 A;  3UNG C;  5JFR A;  1TT0 A;  2K5C A;  3F22 A;  1FP2 A;  5J1Y A;  3JRE A;  1XB4 A;  2A5W A;  4HZF A;  3FBI B;  5D5V B;  2CQN A;  3ZQI A;  1Y8Q B;  1YIO A;  2OA4 A;  1G3Y A;  2MA3 A;  2DYR H;  3K4M A;  2R5Y B;  1A6Q A;  4FE4 A;  2F4O B;  1U9N A;  5JHU A;  3HOZ J;  3CCE I;  2M3A A;  2KIF A;  3H0G J;  2XPU A;  3BT9 A;  2R5Z A;  1H88 C;  1SAN A;  2ESN A;  4Y52 J;  3WTU C;  4KDP A;  3LST A;  3TDZ C;  2A05 A;  3SFI A;  1WGX A;  2E1N A;  1YJ9 I;  3AG4 H;  1OCP A;  4XID A;  4CYC A;  3AL0 C;  2LY1 A;  1SFE A;  1FIA A;  1V54 H;  4GXO A;  5BQT A;  3F6V A;  2ID6 A;  3DP7 A;  3ZMZ A;  2DFE A;  1ZAO A;  3OS0 A;  3V8L A;  1JT6 A;  3RQ4 A;  3ZR8 X;  4NC6 A;  2DMU A;  2VI6 A;  2Y30 A;  2R3S A;  2X51 A;  1EA3 A;  4G6D A;  5KNL A;  2ISZ A;  2F5E A;  2JJ7 A;  3J81 K;  4LK1 F;  4GYG A;  2R7W A;  3VYU B;  2VBZ A;  3LA7 A;  2DYS H;  1E0E A;  3DPL C;  2TRT A;  3JRG A;  4I98 B;  4QLC U;  3RKW A;  4LD5 A;  4LMY A;  2ZJ2 A;  2Z99 A;  3BJO A;  1O3Q A;  4HPQ A;  2NNN A;  1ZRC A;  3CD6 I;  2R4G A;  3WGI A;  4R8H A;  3J7A Y;  2F5C A;  4ZDO A;  4FAS D;  3ZQF A;  1FJL A;  3QU3 A;  2WBM A;  1NHA A;  1KA8 A;  3GLX A;  4Y3O A;  1X3U A;  2IRF G;  4A0X A;  4CDG A;  1UFM A;  3F9K A;  2UWM A;  4A3K J;  1WHU A;  1OYW A;  3AL0 B;  3CUQ A;  3M8E A;  4PUS A;  3QOD A;  1XSD A;  3ECO A;  2Y9Z A;  1GT0 C;  2VUM J;  2VQH A;  1BOB A;  4MTD A;  3O6B B;  3N97 A;  1F36 A;  3GW2 A;  1IUY A;  1IDZ A;  2C6Y A;  1Z7U A;  3T1B A;  3WTZ A;  2DCE A;  5J8C A;  4XSZ F;  2PG4 A;  4D9J A;  1LE8 B;  4XL9 A;  4AM3 A;  1MBF A;  1X3Z B;  4N4N B;  3F21 A;  4HBL A;  3CUO A;  1TBX A;  1WQ2 A;  4BJ5 C;  1I6X A;  3BY6 A;  1V3F A;  2EQR A;  3SYT A;  5J3L A;  2B9S A;  3ABT A;  1ETX A;  1ZRD A;  2JPB A;  2ZKZ A;  1A31 A;  1WJ5 A;  1ETV A;  3G3Z A;  4M6X A;  4CCK A;  1SD5 A;  3A2K A;  3WG9 A;  2JVH A;  1WI9 A;  3LA3 A;  4A6D A;  3L9F A;  2KFD A;  1D3Y A;  1YG2 A;  1JJ6 C;  3A0B C;  4D5F A;  5ICG A;  5DM7 F;  3PIO F;  1BI3 A;  1WJA A;  2VC0 A;  3FM5 A;  1NG6 A;  2PJP A;  4UY8 I;  5F1R A;  2O8K A;  3PSF A;  3J7Y J;  3MKY B;  1ZG3 A;  3TO6 A;  2L02 A;  4I76 A;  2VON A;  1IRG A;  4IX7 A;  1SD7 A;  4C2M J;  2HI3 A;  3TOB A;  2WV1 A;  3TGN A;  4OIP F;  3MMY B;  4U87 A;  2HWV A;  2ZFW A;  1FSE A;  4AYB N;  1ZR4 A;  3K1P A;  5LRS A;  1Y1W J;  3KPH A;  3DBL B;  3GWZ A;  2EB7 A;  5EG0 A;  2GZW A;  3NAR A;  2XAG A;  4HF0 A;  4C2U A;  1VF9 A;  5L3C A;  1O3R A;  2EH3 A;  3BR5 A;  3I56 I;  4HEA 2;  1BW6 A;  3G1M A;  3MKZ A;  4A3D J;  2B7E A;  4UVB A;  2OC6 A;  1IV8 A;  1IZ1 A;  1PJR A;  2OUM A;  4N9I A;  2R93 J;  3K4J A;  3GTO J;  4XMY A;  3DBH B;  1FBQ A;  2QKM B;  1T08 B;  5FKM A;  1IAW A;  4BE0 A;  3S1N J;  2W84 A;  2VJJ A;  4E4H A;  4FX4 A;  3CO6 C;  2EV6 A;  2XAH A;  4AIH A;  5DTD A;  1E17 A;  4A5N A;  2EBI A;  1FBS A;  3MFK A;  2OJE D;  2QKL B;  4JX6 A;  3IWF A;  2P5L C;  3KEO A;  3ABM H;  1VQ4 I;  5BNG A;  1A04 A;  2N8G A;  5LEJ A;  3JRA A;  2VPL A;  2DFF A;  3BJA A;  1HW1 A;  3FM3 A;  5EGO A;  4AVZ A;  3JSO A;  2QBY B;  4QIW N;  1QZE A;  4UV8 A;  2QVO A;  5ICC A;  3M1C A;  1TLH B;  5C3E J;  3WTY C;  2OF7 A;  5J4Y A;  3V7C A;  2GWR A;  4RBO A;  4MLO A;  5CKT A;  2E35 A;  2W1O A;  4S05 A;  1G4D A;  2BXZ A;  2CH0 A;  1BIA A;  2EV5 A;  3KEY A;  4NDL A;  4IF4 A;  2FNP A;  4P5O A;  5J1U A;  1W36 C;  3LWF A;  4CZZ A;  3ASO H;  2NVY J;  2M7B A;  4HX7 A;  5F1J A;  1SMT A;  3A03 A;  1DPR A;  3I4N J;  1Z3X A;  3DKX A;  2KJC A;  4H0E A;  1ZGW A;  4EM0 B;  3CC4 I;  1R1U A;  4IZZ A;  3D0S A;  5HLT A;  4HAM A;  4L5J A;  3H3Z A;  2O03 A;  4K2E A;  2D45 A;  2K9M A;  3JW4 A;  2XF6 A;  4BHB A;  3OYJ A;  2BGC A;  3OS2 A;  2F5F A;  1K4S A;  1POG A;  2CO5 A;  3WHB A;  1ZK8 A;  3LA2 A;  4IHT A;  2EA2 A;  9ANT A;  1R5H A;  2UV1 A;  2PX9 A;  3PIP F;  1MMG A;  1UST A;  1YS7 A;  5HS9 A;  1YOV B;  2E2H J;  5CVI A;  3KLO A;  1OJL A;  4CCN A;  4E7Z A;  4RB3 C;  2DOA A;  3IKT A;  4C3H J;  1IUF A;  3OOU A;  2RNG A;  3OL3 A;  2HDD A;  4HF1 A;  1DGW Y;  2KHM A;  4EJO A;  3HL2 A;  3LQR A;  4AID A;  2WWY A;  3RPU D;  4GYI A;  1GHC A;  3LFU A;  4KIS A;  2ZO4 A;  1APL C;  1X4O A;  2RV8 A;  4M72 A;  2KZG A;  2KRF A;  5IP9 J;  2LTP A;  4GFB A;  4A5M A;  1MSE C;  2GAU A;  3EDP A;  2Y0S A;  3IP4 B;  4PK4 A;  3K70 D;  3J7A O;  5F0C A;  3OMY A;  3H1C A;  1O7F A;  4XK4 A;  4UUV A;  1UHS A;  4RAF A;  1ZEL A;  1XSV A;  3K0L A;  4EGZ A;  4ZYA A;  1UG2 A;  3H35 A;  2QF7 A;  1U78 A;  4U0V A;  3JCU C;  4IQJ A;  1FIP A;  2ZB9 A;  2L4A A;  1ETW A;  3GF2 A;  3HG9 A;  4B1R A;  3WTX C;  3RQI A;  3MKL A;  2X0L A;  4ITV A;  2RQQ A;  1AOY A;  4G94 A;  3C18 A;  2PMZ A;  1YS6 A;  5JVT A;  3GEZ A;  5E17 F;  2MBF A;  1TQM A;  3M9A A;  2XRL A;  1RES A;  3QOP A;  1X1D A;  4XLA A;  1J59 A;  4F91 B;  1I1S A;  2RKH A;  1JXS A;  3S3M A;  2LKS A;  3ZXS A;  1Y0U A;  1S29 A;  3JAM K;  2VQC A;  3ZP5 A;  1BC8 C;  1P7I A;  3BWG A;  2WTE A;  4XKB A;  5JR3 A;  3HKZ A;  1TNS A;  1MND A;  2O6G E;  2GXA A;  2X1E A;  4NC7 A;  1Y39 A;  1K78 B;  5HNF A;  1NH3 A;  3C2B A;  1W5S A;  1USS A;  2EWN A;  2V9K A;  5TJJ A;  1D5V A;  1IF1 A;  5ICF A;  5KAI C;  5IOY A;  2VKH A;  3QPS A;  5LGN A;  1BI0 A;  1J9I A;  1SVM A;  3F0C A;  1SVL A;  1Z05 A;  4LLL A;  4I2O A;  3GZN B;  3F8C A;  2RGV A;  3H9Q A;  3LSH A;  4M9X A;  2DAO A;  2P7V B;  1GUU A;  4CCJ A;  5TRD A;  1YW9 A;  1RKW A;  2BHZ A;  3VSL A;  3GTP J;  3BTL A;  2V4J C;  2MSY A;  4O6J A;  2R7U A;  2Y2Z A;  4MQV A;  1GXP A;  3CQZ J;  4CXF A;  3ABL H;  3GYH X;  4V19 K;  2LY2 A;  2X1D A;  4A3E J;  1ETQ A;  3D5R C;  2MLK A;  4EJW A;  2R5Z B;  1M1E B;  5CLS A;  3T8R A;  1FYK A;  1IC8 A;  4PZJ A;  1OCC H;  4V2F A;  3KYL A;  3LSJ A;  4CYC B;  4M3D A;  3KZY A;  2HXO A;  3CUQ C;  3PM1 A;  2YPR A;  1XGM A;  3R61 A;  5BOX A;  2JPC A;  3JSP A;  4FCY A;  2CSO A;  3DPT A;  3CMY A;  1IN4 A;  4PSX A;  3W2W A;  1MMD A;  1RR8 C; 
#chains in the Genus database with same CATH homology
 5C4X J;  4C3J J;  2E1O A;  5HOD A;  3A01 B;  2Y9Y A;  1B72 A;  1IGN A;  1QPI A;  2MGQ A;  2CUE A;  3TED A;  4MO7 A;  2TCT A;  2FD5 A;  3MN2 A;  1MBH A;  5GPA A;  3LSR A;  1X2M A;  1MSF C;  1K61 A;  4JX4 A;  3GTM J;  5FJ8 J;  2K9N A;  4MFD A;  1ZQ3 P;  2FJ1 A;  4JX5 A;  2B63 J;  2DMP A;  4A3L J;  2ECB A;  3GTK J;  5FKK A;  1WI3 A;  3CDL A;  1LFU P;  2QCO A;  1MBJ A;  2D5V A;  4UUS A;  4V2G A;  2PMZ N;  2CUF A;  1ZR2 A;  4X1E A;  1Q1V A;  2G0E A;  2L7F P;  5IYB J;  1X58 A;  3BTJ A;  5JLW A;  1BL0 A;  3S1M J;  2ELK A;  2JN6 A;  3M3Y J;  3Q0U A;  5K7Z A;  1ETK A;  2LD5 A;  3O8H A;  4M6V A;  2W48 A;  2ID3 A;  1EF4 A;  3HKZ N;  1JTY A;  2DMN A;  1CQT A;  3HB9 A;  1PUF B;  1AKH A;  2ME6 A;  3TP0 A;  2DA4 A;  1OCT C;  1F43 A;  5M3M J;  2AO9 A;  4XRM A;  2Y31 A;  5IPA A;  5J1Y A;  2XB5 A;  1MBK A;  3JRE A;  2GLO A;  5FLV A;  1I50 J;  3ZQI A;  3VPR A;  2AHQ A;  2CQX A;  4MFE A;  1T56 A;  3BTI A;  2RAE A;  3RZD J;  1DU0 A;  1WH7 A;  5F0F A;  2R5Y B;  4A3M J;  4FE4 A;  1U9N A;  3HOZ J;  5EDN A;  1W0T A;  3H0G J;  2XPU A;  3BT9 A;  2LLK A;  5F04 A;  2R5Z A;  3BG5 A;  1IV6 A;  1MBG A;  1SAN A;  5M5W J;  1H88 C;  4Y52 J;  2IBD A;  3K7A J;  3SDG A;  2DA6 A;  3SFI A;  1WGX A;  4IHX A;  1Z77 A;  1OCP A;  4EEF G;  4XID A;  4CYC A;  3NAU A;  2K40 A;  1RET A;  2VKE A;  2E2J J;  2FQ4 A;  1FIA A;  5F08 A;  4A3J J;  2ID6 A;  4BY1 J;  2JA8 J;  2DTZ A;  2JWT A;  4W1U A;  1JT6 A;  3S14 J;  3JRB A;  3LSG A;  1JT0 A;  2DMU A;  2VI6 A;  2Y30 A;  3A01 A;  1TWF J;  1GV2 A;  2JJ7 A;  5EG0 B;  2XB0 X;  1WH5 A;  4MIM A;  1FEX A;  2O9L A;  3S16 J;  2ECC A;  1IDY A;  1I3Q J;  2TRT A;  3O8G A;  3JRG A;  5EZH A;  1H89 C;  1ITY A;  2L9R A;  1JUM A;  2DA1 A;  3BR2 A;  4IEJ A;  3TW7 A;  2LVS A;  1P7J A;  1D5Y A;  3QQA A;  1BJZ A;  2H1K A;  3ZQF A;  1A6I A;  2NVT J;  1FJL A;  1WPK A;  3MVP A;  3GTJ J;  4A3K J;  2I10 A;  3W6V A;  2L7Z A;  3DEW A;  3BQZ A;  5EGO B;  2VPR A;  4M3G A;  2Y9Z A;  1GT0 C;  2VUM J;  2M34 A;  3FK7 A;  1F36 A;  4DZP A;  3FK6 A;  4XRS G;  1IDZ A;  4D7M A;  2MW8 A;  1PUF A;  4AUX A;  3PO2 J;  2K9S A;  3BG3 A;  1LE8 B;  1MBF A;  3FKI J;  2LY9 A;  4FIS A;  4L5E A;  1TC3 C;  2GM4 A;  3WHC A;  1T33 A;  2COB A;  2EQR A;  4DYR A;  4XRS A;  2M2E A;  5J3L A;  1ETX A;  3L1P A;  3HOX J;  1ETV A;  2CU7 A;  2IEK A;  3HM5 A;  4A3I J;  1GV5 A;  1H8A C;  2R5Y A;  4QSH A;  3TW6 A;  1FTT A;  3Q3S A;  2JA5 J;  3GBG A;  3DCF A;  1SFO J;  4A3F J;  4J19 A;  5IYD J;  4S0H B;  1JJ6 C;  3GTQ J;  4D5F A;  1GVD A;  3IH4 A;  2GBY A;  5JLX A;  3FIS A;  1HF0 A;  2CRG A;  2WB1 N;  2O8K A;  2HOA A;  3HEF A;  3HBL A;  1ZKG A;  4I76 A;  2NS7 A;  1R9T J;  1QVT A;  1JTX A;  1K83 J;  5E3O A;  4C2M J;  2HI3 A;  3LOC A;  2WV1 A;  2M9H A;  3BG9 A;  1G2H A;  1QVU A;  4AYB N;  1ZR4 A;  2EZK A;  1Y1W J;  3OSG A;  4DYC A;  5EG0 A;  3NAR A;  3ZQC A;  5M5X J;  1VF9 A;  4IHW A;  2EH3 A;  3BR5 A;  1LFB A;  1BW6 A;  3G1M A;  3JRC A;  4A3D J;  3IH3 A;  5EEA A;  2NOG A;  3GTO J;  5C4J J;  4X6A J;  2R93 J;  1JUP A;  3S1Q J;  5FKM A;  3S1N J;  1XG1 A;  2XGD A;  3QPL A;  4QTR A;  4RDU A;  4B3A A;  1RR7 A;  1ETY A;  4W97 A;  3ZQG A;  3BR3 A;  4B4C A;  5J1R A;  1JJ8 C;  2R7Z J;  5DTD A;  1S7E A;  2EBI A;  3HOU J;  2EZI A;  3OIO A;  1TWH J;  4A3B J;  2FX0 A;  4JX6 A;  4Y7N J;  3Q0W A;  3LNQ A;  5BNG A;  2N8G A;  2K9Q A;  3JRA A;  3BR1 A;  3RZO J;  1I6H J;  3CCY A;  3FIW A;  1MNM C;  5EGO A;  1JKQ C;  4QIW N;  4DYQ A;  1TWC J;  4BBR J;  2R0Q C;  5C3E J;  2DA5 A;  3Q0V A;  2OF7 A;  2XSD C;  4RBO A;  1E3O C;  4MLO A;  1BA5 A;  3BR0 A;  1LE8 A;  1TWA J;  4NDL A;  2IAI A;  3JRF A;  3K2A A;  3GTL J;  3E7L A;  5FKO A;  5J1U A;  4FE7 A;  5E3M A;  2NVY J;  3HGG A;  4BKX A;  5F1J A;  3A03 A;  3I4N J;  3S2H J;  1A5J A;  1NK2 P;  2E2I J;  3S17 J;  1ZGW A;  2DMT A;  5FKL A;  1WCM J;  1NK3 P;  2NVQ J;  5IOZ A;  1ENH A;  2KT0 A;  1W0U A;  1B8I B;  2DMQ A;  4BXX J;  3H3V K;  4AC0 A;  2DJN A;  1VND A;  3BTC A;  1HDD C;  2CQQ A;  1GDT A;  1POG A;  2O7O A;  2HYJ A;  3WHB A;  3HOY J;  4M3F A;  1ZK8 A;  1ETO A;  9ANT A;  2YS9 A;  2HQ5 A;  5K7H A;  2LFB A;  1Y1V J;  2YUS A;  3RKQ A;  2E2H J;  5M5Y J;  2M0C A;  4D7N A;  1OJL A;  2HXI A;  3BQY A;  5K7F A;  3JRI A;  5DS9 A;  2KDZ A;  4M3E A;  4C3H J;  4JP0 A;  5FLM J;  2X48 A;  2XPW A;  4I6Z A;  1IUF A;  3OOU A;  1AU7 A;  1JUS A;  5F27 A;  2DA3 A;  2HDD A;  2JK3 A;  5M3F J;  2L0K A;  1JGG A;  3JRD A;  1ZTR A;  1U8B A;  1VFC A;  3G1O A;  1BW5 A;  1XC5 A;  2YU9 J;  1APL C;  4BY7 J;  5IP9 J;  3IH2 A;  2LTP A;  5EZG A;  4GFB A;  1MSE C;  3JRH A;  4DW6 A;  4HNV A;  3HOV J;  4A69 C;  5F0C A;  3M4O J;  1XS9 A;  1MH4 A;  4ABZ A;  1VI0 A;  4XK4 A;  4IHV A;  1RPW A;  5EF6 A;  4A93 J;  1UHS A;  1Z0X A;  5IP7 J;  1UG2 A;  4C3I J;  2QF7 A;  1B72 B;  1U78 A;  4LOC A;  5GP9 A;  4G12 A;  1FIP A;  1NTC A;  2ZB9 A;  2H8R A;  3OSF A;  1ETW A;  3JR9 A;  2DA2 A;  4B1R A;  1O4X A;  1HLV A;  3RQI A;  3MKL A;  2L7M P;  2EZH A;  2R92 J;  3I4M J;  2HOS A;  1OFC X;  4D5C A;  3SJM A;  2WAQ N;  3GTG J;  3G1L A;  2XRL A;  4DZJ A;  2NS8 A;  2LKX A;  1RES A;  3LSP A;  1DU6 A;  2E19 A;  4UUT A;  4UUS B;  1B8I A;  5C44 J;  3HGY A;  2EZL A;  5F0H A;  4JYK A;  1IRZ A;  2DA7 A;  5IYC J;  1MBE A;  1MH3 A;  1P7I A;  2DN0 A;  2ME0 A;  3B6C A;  2CJJ A;  5E3L A;  3A02 A;  3B6A A;  3C2B A;  4M3B A;  1AHD P;  1JKR C;  2JA7 J;  4XIC A;  5IOY A;  1YRN A;  3QPS A;  1HOM A;  1JKP C;  3D1N I;  1IJW C;  3ZOB A;  1JKO C;  1AKH B;  3F0C A;  1HCR A;  2MG4 A;  2LP0 A;  2OPT A;  1UMQ A;  3PO3 J;  4A3C J;  4BBS J;  3S2D J;  5IP6 A;  3HDD A;  1GUU A;  2X9D A;  4IHY A;  1RKW A;  3GTP J;  1X2N A;  1HDP A;  3BTL A;  2MSY A;  3ZQL A;  2Y2Z A;  3ZQH A;  3HOW J;  4FTH A;  3CQZ J;  5FKN A;  1U9O A;  5EYR A;  1TWG J;  5E3N A;  2HOT A;  4A3E J;  5GPC A;  1ETQ A;  3TP3 A;  2R5Z B;  2M8G X;  1ORK A;  2X6O A;  3BR6 A;  3IV5 A;  2LK2 A;  1IC8 A;  1RKT A;  2XPV A;  2VKV A;  4V2F A;  3S1R J;  2JA6 J;  2LR8 A;  3S15 J;  2JMW A;  3LSJ A;  3UKG A;  1YRN B;  4CYC B;  4M3D A;  1FTZ A;  2HXO A;  2NVX J;  4A3G J;  3PM1 A;  2P81 A;  2XGC A;  4FCY A;  1IG7 A;  3CMY A;  2Y0S N;  1QRY A;  2XGE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...