1WI7A

Solution structure of the sh3 domain of sh3-domain kinase binding protein 1
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
68
structure length
68
Chain Sequence
GSSGSSGRRCQVAFSYLPQNDDELELKVGDIIEVVGEVEEGWWEGVLNGKTGMFPSNFIKELSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the SH3 domain of SH3-domain kinase binding protein 1
rcsb
source organism Mus musculus
molecule tags Protein binding
molecule keywords SH3-domain kinase binding protein 1
total genus 7
structure length 68
sequence length 68
ec nomenclature
pdb deposition date 2004-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14604 SH3_9 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1wi7A00
4HVVA 2BZXA 3M0SA 5IXBA 2EBPA 1AWJA 2GGRA 2O2OA 1WI7A 1OOTA 4RTYA 2DMOA 1AEYA 4RTTA 5HCKA 3VS1A 1UJYA 4LNPA 1TG0A 4JZ3A 3H0IA 4GBQA 2DL4A 2NUZA 1X43A 2QDLA 2DE0X 1K1ZA 3VS3A 2KXCA 2JM8A 1SPKA 2O9VA 1M3AA 1WDXA 2JTEA 2VWFA 4Z88A 5IHKA 2C0OA 1GBRA 2CH4A 1K9AA 1CKAA 4KRTA 1ABOA 1E6HA 4AFUC 1HD3A 2K7AA 3VRYA 1WXTA 2VVKA 2K79A 3REBB 3UA6A 4LN2A 4Z8AA 2DL3A 4AG1C 2J7IA 3M0UA 2BZYA 1G83A 3EHRA 2KBTA 1AVZC 1TUDA 2LJ1A 1K0XA 2ECZA 4J9CA 2JMCA 2JM9A 1HJDA 4J9FA 2K6DA 3UA7A 4HVWA 4RTUA 3ZL7C 1QKWA 1EFNA 2KEAA 3VS0A 2ED1A 1MV0B 2CT3A 4F14A 1ARKA 3IQLA 2CSQA 2J05A 4CC3A 2EYXA 2OJ2A 2KNBB 2LMJA 3REAB 2RF0A 3I9QA 2KYMA 1RUWA 2MCNA 3NMZC 1W1FA 2J6OA 2YSQA 2W10A 4M4ZA 4A63B 1VYVA 3TSZA 2A37A 2K3BA 2EGCA 2SRCA 4IIOA 1Z9ZA 2RQVA 2DL8A 1YP5A 2YDLA 5ECAA 1BU1A 2G6FX 1PRMC 1NYGA 4CC2A 4F16A 1NEGA 2J06A 3I5SA 1UGVA 2GTJA 3UF4A 3VS5A 4OMQA 1NEBA 1HSQA 2D8HA 2ENMA 2P4RA 1M8MA 2ROTA 1VYUA 3THKA 2DRKA 2RQUA 2J6FA 1PWTA 2AKKA 2F2VA 2C0IA 1KIKA 2YUNA 2LX7A 1YN8A 1WYXA 2EVRA 3RNJA 2DJQA 2KT8A 1YNZA 3VRZA 2FPFA 2KRNA 2NWMA 2CT4A 2BZ8A 2KGTA 1I07A 4AFQC 2EYYA 4HVUA 1V1CA 2KR3A 1J3TA 2FRWA 2OI3A 2KT1A 1KFZA 1JXMA 2A08A 2EGAA 2RQTA 1FMKA 2LZ6B 1BK2A 2AZVA 2EW3A 2HDAA 2RN8A 1JU5C 5I22A 2KRSA 1YWPA 3VS7A 5FWBA 3I35A 1WFWA 4WCIA 1CKBA 1E7OA 4ORZA 1W6XA 1GFDA 4Y92A 2BTTA 1UE9A 3O5ZA 2HSPA 4OMLA 1M30A 2FPDA 3M0RA 1G2BA 5FW9A 5EC7A 4RTWA 2EYWA 1UDLA 2LQNA 2CSIA 2J6KA 1PHTA 1QLYA 1JO8A 2LCSA 1U06A 4F17A 1M3CA 1X27A 5IH2A 4RTXA 2D1XA 1B07A 1WLPB 2GTOA 3NGPA 2MOXA 1Y57A 2JMAA 4J9BA 1M27C 2DA9A 2DL7A 2FPEA 2LJ3A 2L3SA 1ZBJA 2KRMA 4OMMA 1WXBA 2CUBA 1GCPA 1GCQC 2SEMA 4DEXA 1SEMA 2M51A 2DNUA 3NHNA 4J9EA 1TUCA 1UECA 2FRYA 2MIOA 3C0CA 1AZGB 2F2WA 1RI9A 2E5KA 1K76A 4E6RA 2KYBA 4HCKA 3FJ5A 3EGUA 1YCSB 1WXUA 3CQTA 2F2XA 3SHWA 1JXOA 1OV3A 2DILA 3ULRB 2V1QA 4OMOA 3TVTA 2DBMA 4HXJA 1GL5A 3RBBB 5L23A 2DLPA 2AZSA 2A28A 3PE0A 2HEQA 1PNJA 1PKSA 1ZUKA 2AK5A 2RMOA 4LUDA 1H3HA 1JQQA 1M3BA 1KJWA 2YT6A 1GBQA 3TSWA 2D8JA 2ABLA 2DBKA 1QKXA 3M0QA 1K4US 3R6NA 2X3WD 2DYBA 4K11A 4JJCA 3PVQA 3U23A 2LNHB 1X6GA 4EIKA 4QT7A 1PKTA 1ABQA 4JPBW 3M0TA 1WA7A 2JXBA 1T0HA 3UATA 1H8KA 2D0NA 1NYFA 2CREA 1OPLA 1ZUYA 2DM1A 1XOVA 1X2KA 2C0TA 4D8DA 3SEMA 2O9SA 1PRLC 1AD5A 4J9DA 4DEYA 4X1VA 3VS2A 4CC4B 1RLQC 5IHIA 1OEBA 4RTVA 3H0HA 4CC7A 5I11A 1LCKA 1B3QA 2EPDA 3M0PA 1NM7A 4GLMA 3VS4A 1SSHA 1AWOA 2OAWA 1GFCA 2EGEA 1NLOC 1VYTA 1AOJA 4JZ4A 1T3LA 1ZLMA 2DX1A 4RTZA 2EYZA 2GNCA 4FSSA 2GBQA 2RNAA 1UHCA 1AWWA 3I5RA 3GBQA 4AFSC 1X6BA 1KSWA 1FYNA 3H0FA 2GQIA 1AZEA 1BB9A 1X69A 4JJDA 1NG2A 1N5ZA 1UJ0A 1YWOA 1H92A 1SRMA 2LJ0A 4R0KA 2EKHA 4ESRA 1U5SA 5IXFA 4J9IA 5GJWB 1UFFA 2X3XD 1T3SA 1QWFA 2XMFA 1A0NB 1SHFA 2HCKA 1UTIA 5GJVB 2JT4A 1Y0MA 4Z89A 1W70A 1MUZA 2I0NA 2L3QA 1UG1A 2PTKA 1BBZA 2KE9A 2RPNA 4J9HA 2LQWA 4OMPA 1GCQA 2FO0A 3EG3A 2L0AA 3KFVA 1Z9QA 2AKLA 2ED0A 2FG0A 2JS2A 1X2QA 4AG2C 1WX6A 4IIMA 1SHGA 2V1RA 2K9GA 1OPKA 2YUPA 4OMNA 3QWYA 1T0JA 2JS0A 3H41A 1I0CA 1QCFA 3VS6A 3EG0A 2DRMA 2L2PA 2ESWA 3EG2A 4AFZC 2PNIA 3QWXX 1K0SA 1UHFA 4LE9A 2RQRA 2KROA 2M0YA 2ROLA 3EG1A 2RQWA 1GRIA 2PZ1A 1I1JA 2LP5A 2DL5A 1U3OA 3JV3A 1NLPC 2B86A 2EQIA 2W0ZA 2IIMA 2CH4W 1SRLA 4J9GA 2CUDA 1WIEA 4RUGA 3EHQA 4ZNXA 1UUEA 2VKNA 1IO6A 3NPFA 1AWXA 5FWCA 2O88A 2DF6A 2K2MA 1MV3A 1ZX6A 1CSKA 2FEIA 1S1NA 1JEGA 1VA7A 2CDTA 4JJBA 3A98A 4D8KA 2L3PA 2KXDA 1ZUUA 2YUQA 2H8HA 2A36A 2DVJA 3PVLA 3LH5A 2O31A 4LUEA 2HBWA 2YUOA 1E6GA 1QWEA 1RLPC 1ZSGA 2JW4A 5IHNA
chains in the Genus database with same CATH superfamily
2IG0A 3DLLA 3M59A 3BFMA 2FZGB 2EBPA 3Q1JA 2O2OA 1RAAB 5IT9E 1WI7A 2NUPA 1RL2A 3VS1A 3C95A 3CC2T 1PM3A 1RABB 5KYUB 1YIJQ 2LNVA 1I4K1 3QZ5B 3ZEHA 4OMFB 2DYIA 1LVKA 5KYXA 4M7DC 4MMLA 2O9VA 3QIIA 5GANg 2JTEA 1QVPA 1OU9A 3MEVA 1M9SA 4C8QB 3M5AA 5IHKA 1ZA1B 2C0OA 1GBRA 1G3YA 3WVDB 1FMVA 3I55A 1HD3A 2K79A 5CCAA 3A8OB 4II1A 4LN2A 2DL3A 1VQKQ 3QYHB 2J7IA 3M0UA 3OSSC 4LDWA 1YHQT 2BZYA 4PJOA 3CCRA 4BY6B 2ECZA 4J9CA 4JRPA 8AT1B 3I56Q 3CCRQ 5KYWB 1BCMA 4J9FA 4X9DA 4A4HA 4C8QD 4V2SA 2ED1A 4TVRA 3PGGA 5FU7C 5AT1B 4F14A 4FW1A 5EG2A 2RJFA 4M7AD 3I55Q 1IREB 4CC3A 3HFNA 2EYXA 1WHLA 2M1HA 2RF0A 4C92G 4NL2A 4F04B 2KSSA 1NPRA 2GFAA 4M78G 4CRIA 5C6SA 1VYVA 2O4XA 2SRCA 1I5LA 1YP5A 2YDLA 1JJ2A 4OB3B 2DIQA 1PRMC 1VQ4T 3VU3C 1NYGA 2EJFA 1XQHA 3M9QA 4M75A 4RCCA 2J06A 3G4SQ 3MJXA 1UGVA 2K5LA 4J7IA 2V8KA 4OMQA 1NEBA 2D8HA 5GMKe 2ENMA 1M8MA 1XNIA 2ROTA 3THKA 3OSVA 2KDSA 3CCEQ 2RQUA 2O01E 3VYGA 2R57A 2WSFE 2F69A 4A4EA 1YJWA 1K9MU 4Y91A 4B9WA 3OYKA 4GY5A 3WVEB 1YHQA 1V1CA 2MPXC 2KR3A 2DK3A 4C5IA 1H3ZA 1D09B 3J80E 1N9RA 2HMAA 1KFZA 2A08A 1VQOT 1ZSZC 4E7SA 1W2BP 1X6OA 2AZVA 2HDAA 2F1LA 5I22A 5CK9A 4E7ZA 2RHYA 5FLXE 1CKBA 1E7OA 3EG9B 3BE3A 1KQ2A 4Z02A 1P92A 3JCMd 4Y92A 2X4XA 1M90R 2FPDA 1G2BA 3CD6A 3OYIA 2EYWA 2DFUA 1EX4A 2QK0A 3HL8A 4M78F 1Q7YC 2QXFA 1JO8A 2QASA 2RO0A 1TTHB 1Y96A 4M78A 4DOVA 3NGPA 2YXYA 2OTJA 3ZBDA 3FC3A 1M27C 3V7RA 2DA9A 2LJ3A 4QQDA 4BD3A 4OMMA 1WXBA 3JCMe 1GCQC 2SEMA 4O6JA 1SEMA 3A1PA 3BDUA 1MNDA 3DKMA 4DBRA 3MO8A 1VQNA 3L2UA 2QEXQ 4M7AE 2HQXA 1W2BS 3OS0A 4KGZB 2ZCFB 3CCLT 2V26A 1K73C 1OQKA 1MNEA 4IUQA 5DLQE 4E6RA 2VXFA 1SSFA 5D6WA 3E1SA 3CMET 1WXUA 2F2XA 4B6MA 4KUDK 1OV3A 2PU9B 4IURA 2MF2A 3INZA 4HXJA 3RBBB 3CBMA 4PLIA 3VV0A 2A28A 2D6FA 1VQ4Q 3RKWA 2AK5A 2RMOA 1M3BA 2QQRA 3LGLA 2VGNA 3CCQT 5D6YA 1M1KC 1OULA 3R6NA 3CC4Q 3P8BB 5KE2A 2Y4YA 1RAEB 2OTLQ 4JRKA 3U23A 1X6GA 5CAIA 5A2QE 3CPWA 5M9OA 1ABQA 1R8OB 3M56A 1G3TA 3C12A 1RAHB 2DXCA 1YITQ 3EGDB 1WJRA 2EFIA 1T0HA 1X75C 3UATA 1U8RA 4XTVA 1H8KA 1IHWA 3A8MB 4FT2A 1ZUYA 3I55T 4M7DE 2D9TA 3TREA 2CZ6B 3MKDA 2C0TA 1QW1A 3SEMA 1AD5A 3VS2A 2FL7A 4CC4B 1TH7A 1WQ7A 3FJPA 3CCJQ 2COZA 1B3QA 3LH0A 2QA4A 4M78E 1QVGS 3OW2S 4GLMA 1NM7A 3X28B 1AWOA 1OX8A 5GAN8 2EGEA 4CI0C 1VYTA 2QGGA 1LPLA 4XTYA 2GBQA 4WTOB 2RNAA 1LJOA 3CMEQ 3E19A 1AWWA 1D1BA 4AFSC 2M0OA 2NUTB 4M78D 1KSWA 3V8KA 3PNWC 3H0FA 5GANh 3CCUQ 1VOMA 4J6YA 1Q82C 2EIFA 3RIRA 1UJ0A 2E3IA 1YWOA 4OB2B 4PK4A 4J6WA 2QGFB 1SRMA 1Y96B 4JLIA 2YLBA 3QHSA 1QCOA 3JCMc 1T3SA 2R58A 2RI2A 3TQ7P 2DAQA 5FROA 1UTIA 5FRMA 5GJVB 3SD4A 2HNIA 1W70A 2ZZDA 2DETA 1WHKA 1VQ6A 1GCQA 2L0AA 4M7DB 3DB3A 4XK8E 3X26B 3KBGA 1X2QA 4AG2C 1WX6A 3QSUA 1EIFA 4VUBA 4ZGEB 2YUPA 4OMNA 1YBYA 4A54A 1Q7YU 3EFSA 4C8QC 2DO3A 1VQPQ 5LL6S 1VQ9T 3EG0A 3X25B 5GAN7 3OW2P 5KH6A 3S3MA 2A7YA 4AFZC 4A53A 1KD1R 4PL6A 1O75A 1UHFA 2JUFA 4LE9A 3S3OA 3CXCS 2ROLA 1GRIA 4IUUA 5LJ3j 1GXIE 1K8AU 4BY6C 3OQ5A 1B7TA 2EQKA 2IIMA 1SRLA 1YJNT 1B34B 4E7KA 1WIEA 1VIEA 4M75G 3CC7A 3M54A 2O88A 1IO6A 1AWXA 5GAMf 2DF6A 2K2MA 1MV3A 1ZX6A 1G3SA 2FEIA 1JBMA 2HKNA 4C92C 4L5GA 1JEGA 4EMKA 3QO3A 2HZYA 3HRSA 4D8KA 2QQ9A 2L3PA 2YUQA 1ZUUA 4QKUA 2LX9A 3SWNB 2WSCE 3MHXA 1VQMQ 2PUOB 2VXEA 2YUOA 3G71A 5GAMd 2HBPA 3HRUA 2KQWA 4HVVA 2WSEE 4M7AA 3FRNA 1OOTA 2DMOA 2OTJQ 5GAN3 5HCKA 3V8JA 1UJYA 3PMIA 3UT1A 3CCLA 2ZPGB 2NUZA 1X43A 1JRIA 2DE0X 2JM8A 1SPKA 1M3AA 1WJQA 2LRQA 3EGXB 3NTKA 1WDXA 1IGUA 3MP1A 1QP2A 4PJOD 4MZMA 4LDUA 2YRDA 5GAMj 3MEUA 4JRQA 4IKFA 3LYIA 4PJOC 1WXTA 1YIJA 4EMKC 4WF2A 4E47A 2HAXA 4C8QE 3OYFA 1K73R 2DD5A 2YRCA 1G83A 2X9HA 4FYVB 3MEAA 5KYUA 2KBTA 1AVZC 2R5AA 3BW1A 1SF9A 1TUDA 2LJ1A 2KMTA 1K0XA 3JCMg 2JM9A 1HJDA 1YHQQ 4PJOB 3MP8A 1G5VA 1UGSB 4RTUA 1KD1C 1QKWA 3L2RA 2KEAA 1Q86R 2CT3A 1TWBA 2MAMA 4KT0E 4N0AA 1BCOA 1K9MC 1SKUB 5IN1A 2OJ2A 2KY9A 3REAB 5FRNA 3I9QA 1TU0B 1X01A 2KYMA 1UGQB 5GAMe 2DTHA 1I81A 5GAOn 2MCNA 2XDDA 4DBHA 1WPYA 4JJNK 4KH1B 3CCSQ 2H3JA 1VQOQ 4A63B 3TSZA 4C92D 2K3BA 2XDBA 3OMGA 2DL8A 1MMAA 5CKHA 1Q81C 2G6FX 4IUTA 4F16A 1NEGA 2DD4A 3GOXA 2Y4XA 2C06A 2K3YA 2VGMA 3I5SA 2FB7A 1SG5A 2GTJA 4OGEA 3CCET 3UF4A 3VS5A 5GAOq 2DEUA 1VYUA 1KC8R 3OYAA 1WJSA 4XTWA 3VJPA 4J6XA 2DRKA 2C0IA 2ZPEB 5HK3A 2QTVA 4EPCA 4L6V5 1M5Q1 3VRZA 1YNZA 1FMWA 2BZ8A 2CT4A 2KGTA 2LCLA 3QBYA 1HXDA 1OZ2A 4C5GA 3CCVQ 2K2VA 4XTZA 4LDVA 5LJ5j 1J3TA 2FRWA 2KT1A 2LCCA 1KQSA 2V8IA 1QQJA 3CCQA 2LZ6B 2VUBA 4RMOA 3OYMA 1NJIR 4HCCA 2RN8A 3G6EA 3VS7A 3EFOA 1KQSP 2I2LA 4WCIA 1AT1B 2VC8A 4HCZA 1W6XA 2RJDA 1GFDA 5HKCA 2BTTA 3O5ZA 2HSPA 2YRVA 3MCAB 2X51A 1UDLA 2LQNA 3CCJT 4NL3A 1OI1A 2FVUA 2F5TX 3X20B 3CCVA 3RDVA 2XHCA 1M90C 3V8LA 4KH0B 4J7FA 3J81E 1M3CA 1FWZA 3G1JA 4RTXA 7AT1B 1B07A 1M2VB 5LJ3f 1WLPB 3VKIA 2QQBA 1VUBA 2XICA 3PT9A 2COWA 2DL7A 1QVGA 1BYMA 4MDWA 3RKXA 4QQGA 5GMKi 2DNUA 3NHNA 3LLRA 3UPUA 1D1CA 3X24B 5GAOp 1KHIA 1UECA 1RI0A 1HK9A 3BY7A 4E7LA 2MIOA 1AZGB 3JCMX 3CMAA 4KGVB 3O8VA 3FIFA 1RI9A 1K76A 1KHCA 2KYBA 3QJ6A 2NLUA 1MHNA 1OZ3A 5CVIA 3R6OA 3ULRB 2V1QA 2HKQB 3L1AA 1KG1A 3PIOA 4R56A 1C0MA 1PNJA 3RKYA 3CCMA 2P0KA 1ZUKA 4ATOA 2CP7A 1YJ9T 2D0QB 1S72A 1H641 1JQQA 2CP3A 1K73U 2ABLA 1QKXA 3CCST 4PNOA 2DYBA 3CCLQ 1YJ9A 4K11A 2JNGA 3CBOA 2VB6A 3HHTB 1PKTA 4JPBW 4IUPA 4BE0A 4EMHA 5CKEA 5GMKj 1Q7YR 2JXBA 3C4SA 3D7SB 3M53A 5LJ3e 1N27A 2D0NA 3OYLA 2MI6A 1X2KA 3EG9A 1VQNT 2XDPA 4M78B 3LGFA 5J26A 2O9SA 1PRLC 4J9DA 1MGQA 5J39A 1R0BG 5IHIA 1QMCA 1OEBA 1YCYA 5I11A 4QQ6A 3OYCA 5I2MA 2CKKA 2EPDA 3M0PA 1TS9A 2OAWA 4XU0A 4OGCA 3EFOB 3NTIA 1AOJA 1V76A 1T3LA 2RI3A 4JZ4A 5D7UA 4FSSA 3GIBA 2GQVA 3L2ZA 3I5RA 3GBQA 1Q81U 2A0FB 2BKDN 2LVMA 4C0ZA 3OYBA 3HP9A 5LJ5f 4DBFA 3QKJA 2GQIA 3SB2A 4JJDA 2PUKB 3G71Q 1VQLT 1NG2A 5L8RE 1VQMA 2KK4A 2YWWA 4M77F 1N5ZA 5GAN5 3JSCA 2CYZB 4M7DD 1H92A 1NJIC 4ELZC 2LJ0A 4R0KA 2EKHA 3V7CA 1U5SA 1UFFA 3FLGA 4Q5WA 2XMFA 1M1KR 3AHUA 1SHFA 3EFRA 5FU7B 5GANf 1VQ5Q 2E70A 2RD1A 1UB4A 2JTMA 4C8QG 4EMGA 2DERA 2KE9A 4FYXB 2LQWA 2NYSA 2FO0A 2EQMA 3EG3A 5LJ3d 2QAZA 3OS2A 2E12A 3OW2A 4C8QA 3PMTA 3HTRA 3JCMP 4IIMA 4LDXA 1SHGA 1OPKA 3GNGA 1KC8U 3QWYA 3FB9A 2JS0A 2K5FA 1QCFA 4N4HA 3VS6A 1D3BB 2L2PA 3EG2A 5GAOr 3BDLA 2NUTA 2RQWA 3QZ9B 2X4JA 3RMSA 4J8OA 2DL5A 3VYHB 3JV3A 2B86A 4GLKA 3VUZA 3CCJA 2VKNA 2RA2A 1VA7A 2CDTA 1B34A 2ZPBB 3A98A 5KYWA 3NFCA 3F70A 1VQLA 2H8HA 2A36A 3JCMV 3OY9A 2PVGB 4LUEA 2LQ8A 2RI5A 1OU8A 4HKEA 1E6GA 1QWEA 1TOVA 1ZSGA 4F7UE 1BI3A 3M55A 2BZXA 2M16A 1LNXA 5IXBA 1AWJA 2GGRA 1VQ8T 3EH1A 4RTTA 1M2OA 1JJ2S 1TG0A 1VQ7T 4JZ3A 2AIRB 4GBQA 2DL4A 3CC4A 1FXXA 2QDLA 1K1ZA 1ZBXA 2KXCA 3JB9I 3EAEA 4DA4A 2QA4Q 2KVQG 3ME9A 4BE1A 4Z88A 2EWNA 3HPWA 4AT1B 2CH4A 3P8HA 4KRTA 1ABOA 3CMAT 1NZ9A 1E6HA 4M7DF 3OYEA 4FYWB 3VRYA 1VQ5A 3REBB 3UA6A 3CC2A 2K5IA 4AG1C 1ZSZA 5LJ5d 4UC4A 3A5ZB 4KGXB 1U1SA 5FU6C 3CPWP 4IUVA 1W4SA 3FEOA 2QQAA 3TU4K 1WHHA 2KAFA 2FHDA 2JMCA 2QI2A 5CO7A 1VQNQ 3UA7A 4HVWA 4C0DB 1BI1A 1EFNA 5I2SA 3VS0A 1KK7A 4PFZA 4F7UG 1ARKA 4JLGA 3ASKA 4BUGA 1M90U 2PVOB 1M8VA 5AYFA 2KNBB 1YI2A 1BI2A 4HT9A 2LMJA 1WGSA 3M57A 2ATCB 4NS5A 3LWHA 2O4XB 2EYQA 4PJOF 1D0XA 2GCXA 4PJLA 2ZPHB 1NPPA 1VQ5T 3E9FA 2J6OA 4LD6A 4XU2A 3CD6Q 2W10A 1VQKT 1VIFA 4IIOA 1Z9ZA 4M7AB 2RM4A 5CQYA 1K8AR 5GANe 3L2VA 4C92F 3JCMW 4PLLA 1BU1A 4BI4A 1VQ9Q 2CZ0B 4CC2A 3DLMA 2E5QA 3QYGB 3A8GB 3QDRB 1D0ZA 4BB7A 3EGXA 1C6VX 4OB0B 4M75E 5GAN6 2IVWA 3PTAA 1HSQA 1PSFA 1W2BA 2P4RA 3JB9D 1D3BA 3PFSA 2QEXT 2ZAEA 2J6FA 1YJWQ 4KBMB 2YUNA 1YN8A 2DJQA 2KT8A 2FPFA 2NWMA 3RERA 4AFQC 1UGRB 2EYYA 2X35A 2RK2A 3QDFA 2OI3A 4BDZA 1QVFS 1Y7XA 2EGAA 3META 1FMKA 3RESA 1BK2A 4PKCC 4X9CA 4OF1A 1YI2T 2EW3A 1K9MR 3JCMJ 1JU5C 4EMKB 1YWPA 2F5KA 2CZ7B 4MZPA 5KCOA 5LJ3h 1UE9A 4MDXA 3HSBA 3OYYA 4C0GA 3RUXA 4PJNA 3CCMQ 4M7AG 2JJ9A 4KULA 4FSXA 2CSIA 4QW2A 2DTOA 1QVGP 4PJJA 1QLYA 1OX9A 2LCSA 1U06A 3URGA 4FYYB 1X27A 2E4HA 5IH2A 4OP0A 2D1XA 2GTOA 2P4TA 2MOXA 1Y57A 4J9BA 3V7SA 2FPEA 4M78C 3FDRA 3G7ZA 1N9SA 2CUBA 3E9GA 3QJYA 1HYOA 4DEXA 1M2VA 1NE8A 1Q95G 3CEYA 2X4WA 3L42A 2M51A 1JJ2P 1V29B 3A8HB 4M75D 4J9EA 1TUCA 5J3BA 4F7UB 5LJ5h 1U1TA 3I56A 2FRYA 2RJCA 1YJNA 3C0CA 3JB9J 4M75C 3OYDA 3MP6A 4HCKA 1VQ7Q 3FJ5A 5FU6B 5CKDA 1JXOA 2DILA 4KUIA 5DY9A 4OMOA 2Y90A 3CCQQ 3QG1A 2DLPA 2AZSA 1PCXA 3PE0A 3NTHA 1PKSA 1IB8A 4LUDA 1H3HA 2YT6A 3TSWA 2EJGA 3T9NA 4RCBA 1K4US 2HQEA 3EH2A 3LWIA 4JS5A 1TUGB 3PVQA 3G6EQ 1BIBA 1O9SA 1VQ7A 3OYJA 4QT7A 2CZ1B 5GMKm 3M0TA 4ZGJB 1YJNQ 2DTIA 2RH2A 2L3RA 5GMKh 2CGHA 4A4GA 2XKOC 2QDYB 2CREA 2K57A 3JB9H 3EGDA 1Q81R 3WXMB 1M1FA 1BIAA 4D8DA 4LXCA 3I56T 4DEYA 4X1VA 2K4YA 4M7DA 1K8AC 1VQOA 2CP6A 4RKUE 4RTVA 3H0HA 4CC7A 3JRZA 3CCMT 3OB9A 2P0PA 1SSHA 3OBWA 1GFCA 1QCNA 2E1HA 5I21A 1NLOC 4C92E 2DX1A 1IZ6A 2GNCA 2K3XA 1N8RU 1X6BA 4JRIA 1ACMB 3CMAQ 1FYNA 1JB0E 2QTXA 1BB9A 4NOYA 5GAOm 3S3NA 3CCSA 1EZZB 4ELYC 5KCHA 3MEWA 5CIUA 1MMNA 4ESRA 1D0YA 5CKFA 4XU3A 5A0LA 1UGPB 4E7HA 2JTFA 3CPFA 2HCKA 1KQ1A 3JCMb 3TEEA 1Y0MA 4Z89A 1MUZA 4M77B 2L3QA 1IXDA 1UG1A 4A4FA 4E2FB 1PD1A 3OS5A 3CPWS 5HK0A 2L5QA 1XTDA 1Z9QA 3M58A 2AKLA 2FG0A 4QVDA 2V1RA 2NUPB 4RG8A 1G8XA 2ZPIB 2M9UA 4FT4A 3SDZA 1Y07A 4ZN1A 2XI9A 4O5VA 2ESWA 3M4YA 3QWXX 4M77D 1K0SA 2RQRA 2M0YA 2FZCB 2PZ1A 2QYZA 4FL6A 5GAMg 2ZPFB 2LP5A 1U3OA 1NLPC 2EQIA 2QG9B 2RHIA 2W0ZA 4J9GA 5DM7R 4RUGA 3EHQA 4C0DC 1UUEA 3NPFA 3AT1B 1KD1U 2E10A 5KYXB 3OS1A 4N4IA 2KXDA 5GANj 3JB9F 1TSFA 2DVJA 4JS4A 3LH5A 4L59A 5D6XA 4M7AF 3CCRT 1N6AA 2XIDA 3UDCA 4C8QF 1AHJB 2RK1A 2P0QA 3M0SA 1IHVA 4RTYA 1AEYA 3KUFA 4F7UA 4XTUA 3CD6T 2CP5A 4LNPA 1VQPA 3H0IA 4M75F 4R55A 3VS3A 2HD0A 4BE2A 2BE9B 2HL3A 4M77G 2VWFA 1QVFP 2VYTA 5LJ3g 2DXUA 1PC0A 1K9AA 2XD0A 4FU6A 1CKAA 1RADB 1WZOA 1PG5B 4AFUC 4D6WA 2K7AA 2VVKA 4M77A 4Z8AA 3JCMQ 3EHRA 3OMCA 3JCMf 4C5EA 2P84A 3G71T 1MMGA 2XG8D 3C94A 2K6DA 4C5HA 3ZL7C 1VQ9A 4J83A 4RG2A 1MV0B 5CR2A 3IQLA 1R0CB 2CSQA 2J05A 1Q82R 3L2QA 1WHMA 1N8RC 3UWNA 3OA6A 4ANJA 5A0DA 4BACA 5C0MA 2JOYA 1M1GA 3H8ZA 5KYNA 1M1KU 1VQ8A 1RUWA 2E6NA 4FIBA 2BIVA 3CC4T 3NMZC 3JCMh 1YI2Q 1W1FA 3M4GA 3CXCP 3CCUA 2YSQA 4M4ZA 2EAYA 2PVDB 6AT1B 2A37A 3CBPA 4XU1A 2EGCA 2RQVA 5ECAA 4HCBA 2KI7A 5GMKl 3CMEA 4A4KA 5CKBA 4B9XA 2E65A 5A0GA 2HQHA 2XK0A 1LOJA 1F1BB 1TXQA 2H3EB 3CC7T 4X34A 1I8FA 1PD0A 2CP0A 2RHZA 3DB4A 1YITA 2OTLT 1VQMT 1WHJA 2DEQA 2YLCA 2ZGWA 4ZN3A 3CC2Q 4C92B 1PWTA 4MMKA 2AKKA 3CC7Q 2F2VA 1KIKA 2LC4A 2DZCA 2LX7A 2EVRA 1WYXA 3RNJA 2KRNA 2VASA 1I07A 2OTJT 2MWPA 2EQJA 3QPHA 4HVUA 2RHXA 1IRXA 1QP3A 1JXMA 2RQTA 2MYSA 2LQKA 3KXTA 2MMPA 1Y71A 5GAN2 4JDSA 8ATCB 2KRSA 1ZHIA 5FWBA 3I35A 1WFWA 2DIGA 4N4GA 5HY6A 1C1AA 4ORZA 2OX7A 3HRTA 3TCJA 4OMLA 1M30A 3M0RA 4DOWA 4JUVA 5FW9A 5EC7A 4RTWA 1D1AA 2VV5A 4N0AC 2V8JA 4DBQA 2MWOA 2FYKA 1VQ6Q 9ATCB 3JAME 2J6KA 1PHTA 3CXCA 4MZTA 4F17A 4F7UF 3S6WA 2COYA 4DQ2A 1BKBA 2JMAA 3H9NA 2L3SA 4ME7A 1ZBJA 2KRMA 2MK5A 1DJ7B 1NBEB 1GCPA 2WACA 1RAFB 4QVCA 4XAXB 2QEXA 3SFMA 1MMDA 1S72T 3QXEB 2DJZA 1VQLQ 3G6ET 5LJ5g 4FM4B 2F2WA 4PJOG 1NJIU 2QA4T 2E5KA 3LX7A 2CP2A 5KYYB 3QUIA 3EGUA 1YCSB 3CQTA 1YJ9Q 4E7IA 3SHWA 4C0FA 2DKGA 3TVTA 2DBMA 1GL5A 2B8AA 3OYGA 5L23A 1VQ8Q 2OAUA 2DZ9A 3GLXA 3MPUB 4LDYA 1S72Q 2HEQA 2GFUA 3ZFJA 2JZ2A 1OYXA 1I5OB 1KJWA 1GBQA 2D8JA 2DBKA 3GF5A 3M0QA 1QVFA 2X3WD 2PQWA 2RB6A 5GAN4 2EQUA 4JJCA 4AMCA 3CCUT 2E41A 5GAMh 4PFOA 2LNHB 4EIKA 5GAOl 4FCYA 3G4ST 4M77C 4QVZA 1IGQA 4XQ3A 3L2WA 4BDYA 4ZTJA 1WA7A 2LDMA 5CQXA 3H6ZA 1WHGA 5DLOA 1Q82U 2JVVA 1KQSS 1NYFA 4HT8A 4BI3A 1OPLA 3OYHA 1YITT 2OTLA 2DM1A 1XOVA 4EDUA 3JB9G 1ZQ1A 4E7JA 1WNLA 1M4ZA 2HSEB 1WQWA 1RLQC 2AT1B 3RMQA 1VQ4A 2DXBA 1LCKA 3CCVT 1RACB 1R77A 3VS4A 3GNFB 2R5MA 4PJOE 3SWNC 2Z0WA 1ZLMA 4RTZA 4PFPA 2EYZA 2XU8A 1UHCA 2EJ9A 2L8DA 1KC8C 2JN0A 3GPLA 3J7AF 1AZEA 2E6ZA 1X69A 5IAYA 2IPOB 4OB1B 2X4YA 2L89A 2A3LA 1YIJT 5IXFA 5KE3A 2M02A 4J9IA 4FW2A 2CS7A 3OBYA 5GJWB 4M75B 2X3XD 3OYNA 1QWFA 2LT1A 1A0NB 1VQKA 1G3WA 2EKOA 3HFOA 3HKSA 3VUBA 4M7DG 3LW5E 4J5YA 2JT4A 4OVAA 2I0NA 3P8DA 4ZTFA 4XTXA 2PTKA 1BBZA 2RPNA 1ZA2B 4J9HA 4OMPA 3KFVA 3RR6A 1Q86U 2ED0A 2JS2A 4M77E 2E64A 4LD9K 2K9GA 5GANd 2FZKB 5KYYA 2RHUA 1T0JA 1RAIB 3H41A 1I0CA 4YTLA 4ZGDB 2DRMA 2G3RA 1PSEA 4M7AC 2LT4A 1FX7A 2PNIA 3PIPA 2KROA 3EG1A 3GP8A 1I1JA 1VQ6T 4BI8B 1BI0A 2DPPB 2BUDA 4PJMA 2CH4W 2CUDA 2BE7D 1Q86C 3ER0A 4HA8A 4ZNXA 1ZSZB 1YJWT 5FWCA 3A8LB 3CCEA 2DVEA 2YHTA 1CSKA 1YFNA 1S1NA 2GF7A 2RJEA 4Y28E 3SWNA 2LTOA 1XJWB 1N8RR 2DXTA 4JJBA 4C92A 3E2UA 3G4SA 1UEBA 3N5BB 3PVLA 4P5NA 2O31A 2AHJB 2HBWA 5LJ5e 1RAGB 1RLPC 2JW4A 5IHNA 2QQSA 1VQPT 2E3HA 2HL5C
chains in the Genus database with same CATH topology
4HVVA 2BZXA 3M0SA 5IXBA 2EBPA 1AWJA 2GGRA 2O2OA 1WI7A 1OOTA 4RTYA 2DMOA 1AEYA 4RTTA 5HCKA 3VS1A 1UJYA 4LNPA 1TG0A 4JZ3A 3H0IA 4GBQA 2DL4A 2NUZA 1X43A 2QDLA 2DE0X 1K1ZA 3VS3A 2KXCA 2JM8A 1SPKA 2O9VA 1M3AA 1WDXA 2JTEA 2VWFA 4Z88A 5IHKA 2C0OA 1GBRA 2CH4A 1K9AA 1CKAA 4KRTA 1ABOA 1E6HA 4AFUC 1HD3A 2K7AA 3VRYA 1WXTA 2VVKA 2K79A 3REBB 3UA6A 4LN2A 4Z8AA 2DL3A 4AG1C 2J7IA 3M0UA 2BZYA 1G83A 3EHRA 2KBTA 1AVZC 1TUDA 2LJ1A 1K0XA 2ECZA 4J9CA 2JMCA 2JM9A 1HJDA 4J9FA 2K6DA 3UA7A 4HVWA 4RTUA 3ZL7C 1QKWA 1EFNA 2KEAA 3VS0A 2ED1A 1MV0B 2CT3A 4F14A 1ARKA 3IQLA 2CSQA 2J05A 4CC3A 2EYXA 2OJ2A 2KNBB 2LMJA 3REAB 2RF0A 3I9QA 2KYMA 1RUWA 2MCNA 3NMZC 1W1FA 2J6OA 2YSQA 2W10A 4M4ZA 4A63B 1VYVA 3TSZA 2A37A 2K3BA 2EGCA 2SRCA 4IIOA 1Z9ZA 2RQVA 2DL8A 1YP5A 2YDLA 5ECAA 1BU1A 2G6FX 1PRMC 1NYGA 4CC2A 4F16A 1NEGA 2J06A 3I5SA 1UGVA 2GTJA 3UF4A 3VS5A 4OMQA 1NEBA 1HSQA 2D8HA 2ENMA 2P4RA 1M8MA 2ROTA 1VYUA 3THKA 2DRKA 2RQUA 2J6FA 1PWTA 2AKKA 2F2VA 2C0IA 1KIKA 2YUNA 2LX7A 1YN8A 1WYXA 2EVRA 3RNJA 2DJQA 2KT8A 1YNZA 3VRZA 2FPFA 2KRNA 2NWMA 2CT4A 2BZ8A 2KGTA 1I07A 4AFQC 2EYYA 4HVUA 1V1CA 2KR3A 1J3TA 2FRWA 2OI3A 2KT1A 1KFZA 1JXMA 2A08A 2EGAA 2RQTA 1FMKA 2LZ6B 1BK2A 2AZVA 2EW3A 2HDAA 2RN8A 1JU5C 5I22A 2KRSA 1YWPA 3VS7A 5FWBA 3I35A 1WFWA 4WCIA 1CKBA 1E7OA 4ORZA 1W6XA 1GFDA 4Y92A 2BTTA 1UE9A 3O5ZA 2HSPA 4OMLA 1M30A 2FPDA 3M0RA 1G2BA 5FW9A 5EC7A 4RTWA 2EYWA 1UDLA 2LQNA 2CSIA 2J6KA 1PHTA 1QLYA 1JO8A 2LCSA 1U06A 4F17A 1M3CA 1X27A 5IH2A 4RTXA 2D1XA 1B07A 1WLPB 2GTOA 3NGPA 2MOXA 1Y57A 2JMAA 4J9BA 1M27C 2DA9A 2DL7A 2FPEA 2LJ3A 2L3SA 1ZBJA 2KRMA 4OMMA 1WXBA 2CUBA 1GCPA 1GCQC 2SEMA 4DEXA 1SEMA 2M51A 2DNUA 3NHNA 4J9EA 1TUCA 1UECA 2FRYA 2MIOA 3C0CA 1AZGB 2F2WA 1RI9A 2E5KA 1K76A 4E6RA 2KYBA 4HCKA 3FJ5A 3EGUA 1YCSB 1WXUA 3CQTA 2F2XA 3SHWA 1JXOA 1OV3A 2DILA 3ULRB 2V1QA 4OMOA 3TVTA 2DBMA 4HXJA 1GL5A 3RBBB 5L23A 2DLPA 2AZSA 2A28A 3PE0A 2HEQA 1PNJA 1PKSA 1ZUKA 2AK5A 2RMOA 4LUDA 1H3HA 1JQQA 1M3BA 1KJWA 2YT6A 1GBQA 3TSWA 2D8JA 2ABLA 2DBKA 1QKXA 3M0QA 1K4US 3R6NA 2X3WD 2DYBA 4K11A 4JJCA 3PVQA 3U23A 2LNHB 1X6GA 4EIKA 4QT7A 1PKTA 1ABQA 4JPBW 3M0TA 1WA7A 2JXBA 1T0HA 3UATA 1H8KA 2D0NA 1NYFA 2CREA 1OPLA 1ZUYA 2DM1A 1XOVA 1X2KA 2C0TA 4D8DA 3SEMA 2O9SA 1PRLC 1AD5A 4J9DA 4DEYA 4X1VA 3VS2A 4CC4B 1RLQC 5IHIA 1OEBA 4RTVA 3H0HA 4CC7A 5I11A 1LCKA 1B3QA 2EPDA 3M0PA 1NM7A 4GLMA 3VS4A 1SSHA 1AWOA 2OAWA 1GFCA 2EGEA 1NLOC 1VYTA 1AOJA 4JZ4A 1T3LA 1ZLMA 2DX1A 4RTZA 2EYZA 2GNCA 4FSSA 2GBQA 2RNAA 1UHCA 1AWWA 3I5RA 3GBQA 4AFSC 1X6BA 1KSWA 1FYNA 3H0FA 2GQIA 1AZEA 1BB9A 1X69A 4JJDA 1NG2A 1N5ZA 1UJ0A 1YWOA 1H92A 1SRMA 2LJ0A 4R0KA 2EKHA 4ESRA 1U5SA 5IXFA 4J9IA 5GJWB 1UFFA 2X3XD 1T3SA 1QWFA 2XMFA 1A0NB 1SHFA 2HCKA 1UTIA 5GJVB 2JT4A 1Y0MA 4Z89A 1W70A 1MUZA 2I0NA 2L3QA 1UG1A 2PTKA 1BBZA 2KE9A 2RPNA 4J9HA 2LQWA 4OMPA 1GCQA 2FO0A 3EG3A 2L0AA 3KFVA 1Z9QA 2AKLA 2ED0A 2FG0A 2JS2A 1X2QA 4AG2C 1WX6A 4IIMA 1SHGA 2V1RA 2K9GA 1OPKA 2YUPA 4OMNA 3QWYA 1T0JA 2JS0A 3H41A 1I0CA 1QCFA 3VS6A 3EG0A 2DRMA 2L2PA 2ESWA 3EG2A 4AFZC 2PNIA 3QWXX 1K0SA 1UHFA 4LE9A 2RQRA 2KROA 2M0YA 2ROLA 3EG1A 2RQWA 1GRIA 2PZ1A 1I1JA 2LP5A 2DL5A 1U3OA 3JV3A 1NLPC 2B86A 2EQIA 2W0ZA 2IIMA 2CH4W 1SRLA 4J9GA 2CUDA 1WIEA 4RUGA 3EHQA 4ZNXA 1UUEA 2VKNA 1IO6A 3NPFA 1AWXA 5FWCA 2O88A 2DF6A 2K2MA 1MV3A 1ZX6A 1CSKA 2FEIA 1S1NA 1JEGA 1VA7A 2CDTA 4JJBA 3A98A 4D8KA 2L3PA 2KXDA 1ZUUA 2YUQA 2H8HA 2A36A 2DVJA 3PVLA 3LH5A 2O31A 4LUEA 2HBWA 2YUOA 1E6GA 1QWEA 1RLPC 1ZSGA 2JW4A 5IHNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HVV A;  2BZX A;  3M0S A;  5IXB A;  2EBP A;  1AWJ A;  2GGR A;  2O2O A;  1WI7 A;  1OOT A;  4RTY A;  2DMO A;  1AEY A;  4RTT A;  5HCK A;  3VS1 A;  1UJY A;  4LNP A;  1TG0 A;  4JZ3 A;  3H0I A;  4GBQ A;  2DL4 A;  2NUZ A;  1X43 A;  2QDL A;  2DE0 X;  1K1Z A;  3VS3 A;  2KXC A;  2JM8 A;  1SPK A;  2O9V A;  1M3A A;  1WDX A;  2JTE A;  2VWF A;  4Z88 A;  5IHK A;  2C0O A;  1GBR A;  2CH4 A;  1K9A A;  1CKA A;  4KRT A;  1ABO A;  1E6H A;  4AFU C;  1HD3 A;  2K7A A;  3VRY A;  1WXT A;  2VVK A;  2K79 A;  3REB B;  3UA6 A;  4LN2 A;  4Z8A A;  2DL3 A;  4AG1 C;  2J7I A;  3M0U A;  2BZY A;  1G83 A;  3EHR A;  2KBT A;  1AVZ C;  1TUD A;  2LJ1 A;  1K0X A;  2ECZ A;  4J9C A;  2JMC A;  2JM9 A;  1HJD A;  4J9F A;  2K6D A;  3UA7 A;  4HVW A;  4RTU A;  3ZL7 C;  1QKW A;  1EFN A;  2KEA A;  3VS0 A;  2ED1 A;  1MV0 B;  2CT3 A;  4F14 A;  1ARK A;  3IQL A;  2CSQ A;  2J05 A;  4CC3 A;  2EYX A;  2OJ2 A;  2KNB B;  2LMJ A;  3REA B;  2RF0 A;  3I9Q A;  2KYM A;  1RUW A;  2MCN A;  3NMZ C;  1W1F A;  2J6O A;  2YSQ A;  2W10 A;  4M4Z A;  4A63 B;  1VYV A;  3TSZ A;  2A37 A;  2K3B A;  2EGC A;  2SRC A;  4IIO A;  1Z9Z A;  2RQV A;  2DL8 A;  1YP5 A;  2YDL A;  5ECA A;  1BU1 A;  2G6F X;  1PRM C;  1NYG A;  4CC2 A;  4F16 A;  1NEG A;  2J06 A;  3I5S A;  1UGV A;  2GTJ A;  3UF4 A;  3VS5 A;  4OMQ A;  1NEB A;  1HSQ A;  2D8H A;  2ENM A;  2P4R A;  1M8M A;  2ROT A;  1VYU A;  3THK A;  2DRK A;  2RQU A;  2J6F A;  1PWT A;  2AKK A;  2F2V A;  2C0I A;  1KIK A;  2YUN A;  2LX7 A;  1YN8 A;  1WYX A;  2EVR A;  3RNJ A;  2DJQ A;  2KT8 A;  1YNZ A;  3VRZ A;  2FPF A;  2KRN A;  2NWM A;  2CT4 A;  2BZ8 A;  2KGT A;  1I07 A;  4AFQ C;  2EYY A;  4HVU A;  1V1C A;  2KR3 A;  1J3T A;  2FRW A;  2OI3 A;  2KT1 A;  1KFZ A;  1JXM A;  2A08 A;  2EGA A;  2RQT A;  1FMK A;  2LZ6 B;  1BK2 A;  2AZV A;  2EW3 A;  2HDA A;  2RN8 A;  1JU5 C;  5I22 A;  2KRS A;  1YWP A;  3VS7 A;  5FWB A;  3I35 A;  1WFW A;  4WCI A;  1CKB A;  1E7O A;  4ORZ A;  1W6X A;  1GFD A;  4Y92 A;  2BTT A;  1UE9 A;  3O5Z A;  2HSP A;  4OML A;  1M30 A;  2FPD A;  3M0R A;  1G2B A;  5FW9 A;  5EC7 A;  4RTW A;  2EYW A;  1UDL A;  2LQN A;  2CSI A;  2J6K A;  1PHT A;  1QLY A;  1JO8 A;  2LCS A;  1U06 A;  4F17 A;  1M3C A;  1X27 A;  5IH2 A;  4RTX A;  2D1X A;  1B07 A;  1WLP B;  2GTO A;  3NGP A;  2MOX A;  1Y57 A;  2JMA A;  4J9B A;  1M27 C;  2DA9 A;  2DL7 A;  2FPE A;  2LJ3 A;  2L3S A;  1ZBJ A;  2KRM A;  4OMM A;  1WXB A;  2CUB A;  1GCP A;  1GCQ C;  2SEM A;  4DEX A;  1SEM A;  2M51 A;  2DNU A;  3NHN A;  4J9E A;  1TUC A;  1UEC A;  2FRY A;  2MIO A;  3C0C A;  1AZG B;  2F2W A;  1RI9 A;  2E5K A;  1K76 A;  4E6R A;  2KYB A;  4HCK A;  3FJ5 A;  3EGU A;  1YCS B;  1WXU A;  3CQT A;  2F2X A;  3SHW A;  1JXO A;  1OV3 A;  2DIL A;  3ULR B;  2V1Q A;  4OMO A;  3TVT A;  2DBM A;  4HXJ A;  1GL5 A;  3RBB B;  5L23 A;  2DLP A;  2AZS A;  2A28 A;  3PE0 A;  2HEQ A;  1PNJ A;  1PKS A;  1ZUK A;  2AK5 A;  2RMO A;  4LUD A;  1H3H A;  1JQQ A;  1M3B A;  1KJW A;  2YT6 A;  1GBQ A;  3TSW A;  2D8J A;  2ABL A;  2DBK A;  1QKX A;  3M0Q A;  1K4U S;  3R6N A;  2X3W D;  2DYB A;  4K11 A;  4JJC A;  3PVQ A;  3U23 A;  2LNH B;  1X6G A;  4EIK A;  4QT7 A;  1PKT A;  1ABQ A;  4JPB W;  3M0T A;  1WA7 A;  2JXB A;  1T0H A;  3UAT A;  1H8K A;  2D0N A;  1NYF A;  2CRE A;  1OPL A;  1ZUY A;  2DM1 A;  1XOV A;  1X2K A;  2C0T A;  4D8D A;  3SEM A;  2O9S A;  1PRL C;  1AD5 A;  4J9D A;  4DEY A;  4X1V A;  3VS2 A;  4CC4 B;  1RLQ C;  5IHI A;  1OEB A;  4RTV A;  3H0H A;  4CC7 A;  5I11 A;  1LCK A;  1B3Q A;  2EPD A;  3M0P A;  1NM7 A;  4GLM A;  3VS4 A;  1SSH A;  1AWO A;  2OAW A;  1GFC A;  2EGE A;  1NLO C;  1VYT A;  1AOJ A;  4JZ4 A;  1T3L A;  1ZLM A;  2DX1 A;  4RTZ A;  2EYZ A;  2GNC A;  4FSS A;  2GBQ A;  2RNA A;  1UHC A;  1AWW A;  3I5R A;  3GBQ A;  4AFS C;  1X6B A;  1KSW A;  1FYN A;  3H0F A;  2GQI A;  1AZE A;  1BB9 A;  1X69 A;  4JJD A;  1NG2 A;  1N5Z A;  1UJ0 A;  1YWO A;  1H92 A;  1SRM A;  2LJ0 A;  4R0K A;  2EKH A;  4ESR A;  1U5S A;  5IXF A;  4J9I A;  5GJW B;  1UFF A;  2X3X D;  1T3S A;  1QWF A;  2XMF A;  1A0N B;  1SHF A;  2HCK A;  1UTI A;  5GJV B;  2JT4 A;  1Y0M A;  4Z89 A;  1W70 A;  1MUZ A;  2I0N A;  2L3Q A;  1UG1 A;  2PTK A;  1BBZ A;  2KE9 A;  2RPN A;  4J9H A;  2LQW A;  4OMP A;  1GCQ A;  2FO0 A;  3EG3 A;  2L0A A;  3KFV A;  1Z9Q A;  2AKL A;  2ED0 A;  2FG0 A;  2JS2 A;  1X2Q A;  4AG2 C;  1WX6 A;  4IIM A;  1SHG A;  2V1R A;  2K9G A;  1OPK A;  2YUP A;  4OMN A;  3QWY A;  1T0J A;  2JS0 A;  3H41 A;  1I0C A;  1QCF A;  3VS6 A;  3EG0 A;  2DRM A;  2L2P A;  2ESW A;  3EG2 A;  4AFZ C;  2PNI A;  3QWX X;  1K0S A;  1UHF A;  4LE9 A;  2RQR A;  2KRO A;  2M0Y A;  2ROL A;  3EG1 A;  2RQW A;  1GRI A;  2PZ1 A;  1I1J A;  2LP5 A;  2DL5 A;  1U3O A;  3JV3 A;  1NLP C;  2B86 A;  2EQI A;  2W0Z A;  2IIM A;  2CH4 W;  1SRL A;  4J9G A;  2CUD A;  1WIE A;  4RUG A;  3EHQ A;  4ZNX A;  1UUE A;  2VKN A;  1IO6 A;  3NPF A;  1AWX A;  5FWC A;  2O88 A;  2DF6 A;  2K2M A;  1MV3 A;  1ZX6 A;  1CSK A;  2FEI A;  1S1N A;  1JEG A;  1VA7 A;  2CDT A;  4JJB A;  3A98 A;  4D8K A;  2L3P A;  2KXD A;  1ZUU A;  2YUQ A;  2H8H A;  2A36 A;  2DVJ A;  3PVL A;  3LH5 A;  2O31 A;  4LUE A;  2HBW A;  2YUO A;  1E6G A;  1QWE A;  1RLP C;  1ZSG A;  2JW4 A;  5IHN A; 
#chains in the Genus database with same CATH topology
 2IG0 A;  3DLL A;  3M59 A;  3BFM A;  2FZG B;  2EBP A;  3Q1J A;  2O2O A;  1RAA B;  5IT9 E;  1WI7 A;  2NUP A;  1RL2 A;  3VS1 A;  3C95 A;  3CC2 T;  1PM3 A;  1RAB B;  5KYU B;  1YIJ Q;  2LNV A;  1I4K 1;  3QZ5 B;  3ZEH A;  4OMF B;  2DYI A;  1LVK A;  5KYX A;  4M7D C;  4MML A;  2O9V A;  3QII A;  5GAN g;  2JTE A;  1QVP A;  1OU9 A;  3MEV A;  1M9S A;  4C8Q B;  3M5A A;  5IHK A;  1ZA1 B;  2C0O A;  1GBR A;  1G3Y A;  3WVD B;  1FMV A;  3I55 A;  1HD3 A;  2K79 A;  5CCA A;  3A8O B;  4II1 A;  4LN2 A;  2DL3 A;  1VQK Q;  3QYH B;  2J7I A;  3M0U A;  3OSS C;  4LDW A;  1YHQ T;  2BZY A;  4PJO A;  3CCR A;  4BY6 B;  2ECZ A;  4J9C A;  4JRP A;  8AT1 B;  3I56 Q;  3CCR Q;  5KYW B;  1BCM A;  4J9F A;  4X9D A;  4A4H A;  4C8Q D;  4V2S A;  2ED1 A;  4TVR A;  3PGG A;  5FU7 C;  5AT1 B;  4F14 A;  4FW1 A;  5EG2 A;  2RJF A;  4M7A D;  3I55 Q;  1IRE B;  4CC3 A;  3HFN A;  2EYX A;  1WHL A;  2M1H A;  2RF0 A;  4C92 G;  4NL2 A;  4F04 B;  2KSS A;  1NPR A;  2GFA A;  4M78 G;  4CRI A;  5C6S A;  1VYV A;  2O4X A;  2SRC A;  1I5L A;  1YP5 A;  2YDL A;  1JJ2 A;  4OB3 B;  2DIQ A;  1PRM C;  1VQ4 T;  3VU3 C;  1NYG A;  2EJF A;  1XQH A;  3M9Q A;  4M75 A;  4RCC A;  2J06 A;  3G4S Q;  3MJX A;  1UGV A;  2K5L A;  4J7I A;  2V8K A;  4OMQ A;  1NEB A;  2D8H A;  5GMK e;  2ENM A;  1M8M A;  1XNI A;  2ROT A;  3THK A;  3OSV A;  2KDS A;  3CCE Q;  2RQU A;  2O01 E;  3VYG A;  2R57 A;  2WSF E;  2F69 A;  4A4E A;  1YJW A;  1K9M U;  4Y91 A;  4B9W A;  3OYK A;  4GY5 A;  3WVE B;  1YHQ A;  1V1C A;  2MPX C;  2KR3 A;  2DK3 A;  4C5I A;  1H3Z A;  1D09 B;  3J80 E;  1N9R A;  2HMA A;  1KFZ A;  2A08 A;  1VQO T;  1ZSZ C;  4E7S A;  1W2B P;  1X6O A;  2AZV A;  2HDA A;  2F1L A;  5I22 A;  5CK9 A;  4E7Z A;  2RHY A;  5FLX E;  1CKB A;  1E7O A;  3EG9 B;  3BE3 A;  1KQ2 A;  4Z02 A;  1P92 A;  3JCM d;  4Y92 A;  2X4X A;  1M90 R;  2FPD A;  1G2B A;  3CD6 A;  3OYI A;  2EYW A;  2DFU A;  1EX4 A;  2QK0 A;  3HL8 A;  4M78 F;  1Q7Y C;  2QXF A;  1JO8 A;  2QAS A;  2RO0 A;  1TTH B;  1Y96 A;  4M78 A;  4DOV A;  3NGP A;  2YXY A;  2OTJ A;  3ZBD A;  3FC3 A;  1M27 C;  3V7R A;  2DA9 A;  2LJ3 A;  4QQD A;  4BD3 A;  4OMM A;  1WXB A;  3JCM e;  1GCQ C;  2SEM A;  4O6J A;  1SEM A;  3A1P A;  3BDU A;  1MND A;  3DKM A;  4DBR A;  3MO8 A;  1VQN A;  3L2U A;  2QEX Q;  4M7A E;  2HQX A;  1W2B S;  3OS0 A;  4KGZ B;  2ZCF B;  3CCL T;  2V26 A;  1K73 C;  1OQK A;  1MNE A;  4IUQ A;  5DLQ E;  4E6R A;  2VXF A;  1SSF A;  5D6W A;  3E1S A;  3CME T;  1WXU A;  2F2X A;  4B6M A;  4KUD K;  1OV3 A;  2PU9 B;  4IUR A;  2MF2 A;  3INZ A;  4HXJ A;  3RBB B;  3CBM A;  4PLI A;  3VV0 A;  2A28 A;  2D6F A;  1VQ4 Q;  3RKW A;  2AK5 A;  2RMO A;  1M3B A;  2QQR A;  3LGL A;  2VGN A;  3CCQ T;  5D6Y A;  1M1K C;  1OUL A;  3R6N A;  3CC4 Q;  3P8B B;  5KE2 A;  2Y4Y A;  1RAE B;  2OTL Q;  4JRK A;  3U23 A;  1X6G A;  5CAI A;  5A2Q E;  3CPW A;  5M9O A;  1ABQ A;  1R8O B;  3M56 A;  1G3T A;  3C12 A;  1RAH B;  2DXC A;  1YIT Q;  3EGD B;  1WJR A;  2EFI A;  1T0H A;  1X75 C;  3UAT A;  1U8R A;  4XTV A;  1H8K A;  1IHW A;  3A8M B;  4FT2 A;  1ZUY A;  3I55 T;  4M7D E;  2D9T A;  3TRE A;  2CZ6 B;  3MKD A;  2C0T A;  1QW1 A;  3SEM A;  1AD5 A;  3VS2 A;  2FL7 A;  4CC4 B;  1TH7 A;  1WQ7 A;  3FJP A;  3CCJ Q;  2COZ A;  1B3Q A;  3LH0 A;  2QA4 A;  4M78 E;  1QVG S;  3OW2 S;  4GLM A;  1NM7 A;  3X28 B;  1AWO A;  1OX8 A;  5GAN 8;  2EGE A;  4CI0 C;  1VYT A;  2QGG A;  1LPL A;  4XTY A;  2GBQ A;  4WTO B;  2RNA A;  1LJO A;  3CME Q;  3E19 A;  1AWW A;  1D1B A;  4AFS C;  2M0O A;  2NUT B;  4M78 D;  1KSW A;  3V8K A;  3PNW C;  3H0F A;  5GAN h;  3CCU Q;  1VOM A;  4J6Y A;  1Q82 C;  2EIF A;  3RIR A;  1UJ0 A;  2E3I A;  1YWO A;  4OB2 B;  4PK4 A;  4J6W A;  2QGF B;  1SRM A;  1Y96 B;  4JLI A;  2YLB A;  3QHS A;  1QCO A;  3JCM c;  1T3S A;  2R58 A;  2RI2 A;  3TQ7 P;  2DAQ A;  5FRO A;  1UTI A;  5FRM A;  5GJV B;  3SD4 A;  2HNI A;  1W70 A;  2ZZD A;  2DET A;  1WHK A;  1VQ6 A;  1GCQ A;  2L0A A;  4M7D B;  3DB3 A;  4XK8 E;  3X26 B;  3KBG A;  1X2Q A;  4AG2 C;  1WX6 A;  3QSU A;  1EIF A;  4VUB A;  4ZGE B;  2YUP A;  4OMN A;  1YBY A;  4A54 A;  1Q7Y U;  3EFS A;  4C8Q C;  2DO3 A;  1VQP Q;  5LL6 S;  1VQ9 T;  3EG0 A;  3X25 B;  5GAN 7;  3OW2 P;  5KH6 A;  3S3M A;  2A7Y A;  4AFZ C;  4A53 A;  1KD1 R;  4PL6 A;  1O75 A;  1UHF A;  2JUF A;  4LE9 A;  3S3O A;  3CXC S;  2ROL A;  1GRI A;  4IUU A;  5LJ3 j;  1GXI E;  1K8A U;  4BY6 C;  3OQ5 A;  1B7T A;  2EQK A;  2IIM A;  1SRL A;  1YJN T;  1B34 B;  4E7K A;  1WIE A;  1VIE A;  4M75 G;  3CC7 A;  3M54 A;  2O88 A;  1IO6 A;  1AWX A;  5GAM f;  2DF6 A;  2K2M A;  1MV3 A;  1ZX6 A;  1G3S A;  2FEI A;  1JBM A;  2HKN A;  4C92 C;  4L5G A;  1JEG A;  4EMK A;  3QO3 A;  2HZY A;  3HRS A;  4D8K A;  2QQ9 A;  2L3P A;  2YUQ A;  1ZUU A;  4QKU A;  2LX9 A;  3SWN B;  2WSC E;  3MHX A;  1VQM Q;  2PUO B;  2VXE A;  2YUO A;  3G71 A;  5GAM d;  2HBP A;  3HRU A;  2KQW A;  4HVV A;  2WSE E;  4M7A A;  3FRN A;  1OOT A;  2DMO A;  2OTJ Q;  5GAN 3;  5HCK A;  3V8J A;  1UJY A;  3PMI A;  3UT1 A;  3CCL A;  2ZPG B;  2NUZ A;  1X43 A;  1JRI A;  2DE0 X;  2JM8 A;  1SPK A;  1M3A A;  1WJQ A;  2LRQ A;  3EGX B;  3NTK A;  1WDX A;  1IGU A;  3MP1 A;  1QP2 A;  4PJO D;  4MZM A;  4LDU A;  2YRD A;  5GAM j;  3MEU A;  4JRQ A;  4IKF A;  3LYI A;  4PJO C;  1WXT A;  1YIJ A;  4EMK C;  4WF2 A;  4E47 A;  2HAX A;  4C8Q E;  3OYF A;  1K73 R;  2DD5 A;  2YRC A;  1G83 A;  2X9H A;  4FYV B;  3MEA A;  5KYU A;  2KBT A;  1AVZ C;  2R5A A;  3BW1 A;  1SF9 A;  1TUD A;  2LJ1 A;  2KMT A;  1K0X A;  3JCM g;  2JM9 A;  1HJD A;  1YHQ Q;  4PJO B;  3MP8 A;  1G5V A;  1UGS B;  4RTU A;  1KD1 C;  1QKW A;  3L2R A;  2KEA A;  1Q86 R;  2CT3 A;  1TWB A;  2MAM A;  4KT0 E;  4N0A A;  1BCO A;  1K9M C;  1SKU B;  5IN1 A;  2OJ2 A;  2KY9 A;  3REA B;  5FRN A;  3I9Q A;  1TU0 B;  1X01 A;  2KYM A;  1UGQ B;  5GAM e;  2DTH A;  1I81 A;  5GAO n;  2MCN A;  2XDD A;  4DBH A;  1WPY A;  4JJN K;  4KH1 B;  3CCS Q;  2H3J A;  1VQO Q;  4A63 B;  3TSZ A;  4C92 D;  2K3B A;  2XDB A;  3OMG A;  2DL8 A;  1MMA A;  5CKH A;  1Q81 C;  2G6F X;  4IUT A;  4F16 A;  1NEG A;  2DD4 A;  3GOX A;  2Y4X A;  2C06 A;  2K3Y A;  2VGM A;  3I5S A;  2FB7 A;  1SG5 A;  2GTJ A;  4OGE A;  3CCE T;  3UF4 A;  3VS5 A;  5GAO q;  2DEU A;  1VYU A;  1KC8 R;  3OYA A;  1WJS A;  4XTW A;  3VJP A;  4J6X A;  2DRK A;  2C0I A;  2ZPE B;  5HK3 A;  2QTV A;  4EPC A;  4L6V 5;  1M5Q 1;  3VRZ A;  1YNZ A;  1FMW A;  2BZ8 A;  2CT4 A;  2KGT A;  2LCL A;  3QBY A;  1HXD A;  1OZ2 A;  4C5G A;  3CCV Q;  2K2V A;  4XTZ A;  4LDV A;  5LJ5 j;  1J3T A;  2FRW A;  2KT1 A;  2LCC A;  1KQS A;  2V8I A;  1QQJ A;  3CCQ A;  2LZ6 B;  2VUB A;  4RMO A;  3OYM A;  1NJI R;  4HCC A;  2RN8 A;  3G6E A;  3VS7 A;  3EFO A;  1KQS P;  2I2L A;  4WCI A;  1AT1 B;  2VC8 A;  4HCZ A;  1W6X A;  2RJD A;  1GFD A;  5HKC A;  2BTT A;  3O5Z A;  2HSP A;  2YRV A;  3MCA B;  2X51 A;  1UDL A;  2LQN A;  3CCJ T;  4NL3 A;  1OI1 A;  2FVU A;  2F5T X;  3X20 B;  3CCV A;  3RDV A;  2XHC A;  1M90 C;  3V8L A;  4KH0 B;  4J7F A;  3J81 E;  1M3C A;  1FWZ A;  3G1J A;  4RTX A;  7AT1 B;  1B07 A;  1M2V B;  5LJ3 f;  1WLP B;  3VKI A;  2QQB A;  1VUB A;  2XIC A;  3PT9 A;  2COW A;  2DL7 A;  1QVG A;  1BYM A;  4MDW A;  3RKX A;  4QQG A;  5GMK i;  2DNU A;  3NHN A;  3LLR A;  3UPU A;  1D1C A;  3X24 B;  5GAO p;  1KHI A;  1UEC A;  1RI0 A;  1HK9 A;  3BY7 A;  4E7L A;  2MIO A;  1AZG B;  3JCM X;  3CMA A;  4KGV B;  3O8V A;  3FIF A;  1RI9 A;  1K76 A;  1KHC A;  2KYB A;  3QJ6 A;  2NLU A;  1MHN A;  1OZ3 A;  5CVI A;  3R6O A;  3ULR B;  2V1Q A;  2HKQ B;  3L1A A;  1KG1 A;  3PIO A;  4R56 A;  1C0M A;  1PNJ A;  3RKY A;  3CCM A;  2P0K A;  1ZUK A;  4ATO A;  2CP7 A;  1YJ9 T;  2D0Q B;  1S72 A;  1H64 1;  1JQQ A;  2CP3 A;  1K73 U;  2ABL A;  1QKX A;  3CCS T;  4PNO A;  2DYB A;  3CCL Q;  1YJ9 A;  4K11 A;  2JNG A;  3CBO A;  2VB6 A;  3HHT B;  1PKT A;  4JPB W;  4IUP A;  4BE0 A;  4EMH A;  5CKE A;  5GMK j;  1Q7Y R;  2JXB A;  3C4S A;  3D7S B;  3M53 A;  5LJ3 e;  1N27 A;  2D0N A;  3OYL A;  2MI6 A;  1X2K A;  3EG9 A;  1VQN T;  2XDP A;  4M78 B;  3LGF A;  5J26 A;  2O9S A;  1PRL C;  4J9D A;  1MGQ A;  5J39 A;  1R0B G;  5IHI A;  1QMC A;  1OEB A;  1YCY A;  5I11 A;  4QQ6 A;  3OYC A;  5I2M A;  2CKK A;  2EPD A;  3M0P A;  1TS9 A;  2OAW A;  4XU0 A;  4OGC A;  3EFO B;  3NTI A;  1AOJ A;  1V76 A;  1T3L A;  2RI3 A;  4JZ4 A;  5D7U A;  4FSS A;  3GIB A;  2GQV A;  3L2Z A;  3I5R A;  3GBQ A;  1Q81 U;  2A0F B;  2BKD N;  2LVM A;  4C0Z A;  3OYB A;  3HP9 A;  5LJ5 f;  4DBF A;  3QKJ A;  2GQI A;  3SB2 A;  4JJD A;  2PUK B;  3G71 Q;  1VQL T;  1NG2 A;  5L8R E;  1VQM A;  2KK4 A;  2YWW A;  4M77 F;  1N5Z A;  5GAN 5;  3JSC A;  2CYZ B;  4M7D D;  1H92 A;  1NJI C;  4ELZ C;  2LJ0 A;  4R0K A;  2EKH A;  3V7C A;  1U5S A;  1UFF A;  3FLG A;  4Q5W A;  2XMF A;  1M1K R;  3AHU A;  1SHF A;  3EFR A;  5FU7 B;  5GAN f;  1VQ5 Q;  2E70 A;  2RD1 A;  1UB4 A;  2JTM A;  4C8Q G;  4EMG A;  2DER A;  2KE9 A;  4FYX B;  2LQW A;  2NYS A;  2FO0 A;  2EQM A;  3EG3 A;  5LJ3 d;  2QAZ A;  3OS2 A;  2E12 A;  3OW2 A;  4C8Q A;  3PMT A;  3HTR A;  3JCM P;  4IIM A;  4LDX A;  1SHG A;  1OPK A;  3GNG A;  1KC8 U;  3QWY A;  3FB9 A;  2JS0 A;  2K5F A;  1QCF A;  4N4H A;  3VS6 A;  1D3B B;  2L2P A;  3EG2 A;  5GAO r;  3BDL A;  2NUT A;  2RQW A;  3QZ9 B;  2X4J A;  3RMS A;  4J8O A;  2DL5 A;  3VYH B;  3JV3 A;  2B86 A;  4GLK A;  3VUZ A;  3CCJ A;  2VKN A;  2RA2 A;  1VA7 A;  2CDT A;  1B34 A;  2ZPB B;  3A98 A;  5KYW A;  3NFC A;  3F70 A;  1VQL A;  2H8H A;  2A36 A;  3JCM V;  3OY9 A;  2PVG B;  4LUE A;  2LQ8 A;  2RI5 A;  1OU8 A;  4HKE A;  1E6G A;  1QWE A;  1TOV A;  1ZSG A;  4F7U E;  1BI3 A;  3M55 A;  2BZX A;  2M16 A;  1LNX A;  5IXB A;  1AWJ A;  2GGR A;  1VQ8 T;  3EH1 A;  4RTT A;  1M2O A;  1JJ2 S;  1TG0 A;  1VQ7 T;  4JZ3 A;  2AIR B;  4GBQ A;  2DL4 A;  3CC4 A;  1FXX A;  2QDL A;  1K1Z A;  1ZBX A;  2KXC A;  3JB9 I;  3EAE A;  4DA4 A;  2QA4 Q;  2KVQ G;  3ME9 A;  4BE1 A;  4Z88 A;  2EWN A;  3HPW A;  4AT1 B;  2CH4 A;  3P8H A;  4KRT A;  1ABO A;  3CMA T;  1NZ9 A;  1E6H A;  4M7D F;  3OYE A;  4FYW B;  3VRY A;  1VQ5 A;  3REB B;  3UA6 A;  3CC2 A;  2K5I A;  4AG1 C;  1ZSZ A;  5LJ5 d;  4UC4 A;  3A5Z B;  4KGX B;  1U1S A;  5FU6 C;  3CPW P;  4IUV A;  1W4S A;  3FEO A;  2QQA A;  3TU4 K;  1WHH A;  2KAF A;  2FHD A;  2JMC A;  2QI2 A;  5CO7 A;  1VQN Q;  3UA7 A;  4HVW A;  4C0D B;  1BI1 A;  1EFN A;  5I2S A;  3VS0 A;  1KK7 A;  4PFZ A;  4F7U G;  1ARK A;  4JLG A;  3ASK A;  4BUG A;  1M90 U;  2PVO B;  1M8V A;  5AYF A;  2KNB B;  1YI2 A;  1BI2 A;  4HT9 A;  2LMJ A;  1WGS A;  3M57 A;  2ATC B;  4NS5 A;  3LWH A;  2O4X B;  2EYQ A;  4PJO F;  1D0X A;  2GCX A;  4PJL A;  2ZPH B;  1NPP A;  1VQ5 T;  3E9F A;  2J6O A;  4LD6 A;  4XU2 A;  3CD6 Q;  2W10 A;  1VQK T;  1VIF A;  4IIO A;  1Z9Z A;  4M7A B;  2RM4 A;  5CQY A;  1K8A R;  5GAN e;  3L2V A;  4C92 F;  3JCM W;  4PLL A;  1BU1 A;  4BI4 A;  1VQ9 Q;  2CZ0 B;  4CC2 A;  3DLM A;  2E5Q A;  3QYG B;  3A8G B;  3QDR B;  1D0Z A;  4BB7 A;  3EGX A;  1C6V X;  4OB0 B;  4M75 E;  5GAN 6;  2IVW A;  3PTA A;  1HSQ A;  1PSF A;  1W2B A;  2P4R A;  3JB9 D;  1D3B A;  3PFS A;  2QEX T;  2ZAE A;  2J6F A;  1YJW Q;  4KBM B;  2YUN A;  1YN8 A;  2DJQ A;  2KT8 A;  2FPF A;  2NWM A;  3RER A;  4AFQ C;  1UGR B;  2EYY A;  2X35 A;  2RK2 A;  3QDF A;  2OI3 A;  4BDZ A;  1QVF S;  1Y7X A;  2EGA A;  3MET A;  1FMK A;  3RES A;  1BK2 A;  4PKC C;  4X9C A;  4OF1 A;  1YI2 T;  2EW3 A;  1K9M R;  3JCM J;  1JU5 C;  4EMK B;  1YWP A;  2F5K A;  2CZ7 B;  4MZP A;  5KCO A;  5LJ3 h;  1UE9 A;  4MDX A;  3HSB A;  3OYY A;  4C0G A;  3RUX A;  4PJN A;  3CCM Q;  4M7A G;  2JJ9 A;  4KUL A;  4FSX A;  2CSI A;  4QW2 A;  2DTO A;  1QVG P;  4PJJ A;  1QLY A;  1OX9 A;  2LCS A;  1U06 A;  3URG A;  4FYY B;  1X27 A;  2E4H A;  5IH2 A;  4OP0 A;  2D1X A;  2GTO A;  2P4T A;  2MOX A;  1Y57 A;  4J9B A;  3V7S A;  2FPE A;  4M78 C;  3FDR A;  3G7Z A;  1N9S A;  2CUB A;  3E9G A;  3QJY A;  1HYO A;  4DEX A;  1M2V A;  1NE8 A;  1Q95 G;  3CEY A;  2X4W A;  3L42 A;  2M51 A;  1JJ2 P;  1V29 B;  3A8H B;  4M75 D;  4J9E A;  1TUC A;  5J3B A;  4F7U B;  5LJ5 h;  1U1T A;  3I56 A;  2FRY A;  2RJC A;  1YJN A;  3C0C A;  3JB9 J;  4M75 C;  3OYD A;  3MP6 A;  4HCK A;  1VQ7 Q;  3FJ5 A;  5FU6 B;  5CKD A;  1JXO A;  2DIL A;  4KUI A;  5DY9 A;  4OMO A;  2Y90 A;  3CCQ Q;  3QG1 A;  2DLP A;  2AZS A;  1PCX A;  3PE0 A;  3NTH A;  1PKS A;  1IB8 A;  4LUD A;  1H3H A;  2YT6 A;  3TSW A;  2EJG A;  3T9N A;  4RCB A;  1K4U S;  2HQE A;  3EH2 A;  3LWI A;  4JS5 A;  1TUG B;  3PVQ A;  3G6E Q;  1BIB A;  1O9S A;  1VQ7 A;  3OYJ A;  4QT7 A;  2CZ1 B;  5GMK m;  3M0T A;  4ZGJ B;  1YJN Q;  2DTI A;  2RH2 A;  2L3R A;  5GMK h;  2CGH A;  4A4G A;  2XKO C;  2QDY B;  2CRE A;  2K57 A;  3JB9 H;  3EGD A;  1Q81 R;  3WXM B;  1M1F A;  1BIA A;  4D8D A;  4LXC A;  3I56 T;  4DEY A;  4X1V A;  2K4Y A;  4M7D A;  1K8A C;  1VQO A;  2CP6 A;  4RKU E;  4RTV A;  3H0H A;  4CC7 A;  3JRZ A;  3CCM T;  3OB9 A;  2P0P A;  1SSH A;  3OBW A;  1GFC A;  1QCN A;  2E1H A;  5I21 A;  1NLO C;  4C92 E;  2DX1 A;  1IZ6 A;  2GNC A;  2K3X A;  1N8R U;  1X6B A;  4JRI A;  1ACM B;  3CMA Q;  1FYN A;  1JB0 E;  2QTX A;  1BB9 A;  4NOY A;  5GAO m;  3S3N A;  3CCS A;  1EZZ B;  4ELY C;  5KCH A;  3MEW A;  5CIU A;  1MMN A;  4ESR A;  1D0Y A;  5CKF A;  4XU3 A;  5A0L A;  1UGP B;  4E7H A;  2JTF A;  3CPF A;  2HCK A;  1KQ1 A;  3JCM b;  3TEE A;  1Y0M A;  4Z89 A;  1MUZ A;  4M77 B;  2L3Q A;  1IXD A;  1UG1 A;  4A4F A;  4E2F B;  1PD1 A;  3OS5 A;  3CPW S;  5HK0 A;  2L5Q A;  1XTD A;  1Z9Q A;  3M58 A;  2AKL A;  2FG0 A;  4QVD A;  2V1R A;  2NUP B;  4RG8 A;  1G8X A;  2ZPI B;  2M9U A;  4FT4 A;  3SDZ A;  1Y07 A;  4ZN1 A;  2XI9 A;  4O5V A;  2ESW A;  3M4Y A;  3QWX X;  4M77 D;  1K0S A;  2RQR A;  2M0Y A;  2FZC B;  2PZ1 A;  2QYZ A;  4FL6 A;  5GAM g;  2ZPF B;  2LP5 A;  1U3O A;  1NLP C;  2EQI A;  2QG9 B;  2RHI A;  2W0Z A;  4J9G A;  5DM7 R;  4RUG A;  3EHQ A;  4C0D C;  1UUE A;  3NPF A;  3AT1 B;  1KD1 U;  2E10 A;  5KYX B;  3OS1 A;  4N4I A;  2KXD A;  5GAN j;  3JB9 F;  1TSF A;  2DVJ A;  4JS4 A;  3LH5 A;  4L59 A;  5D6X A;  4M7A F;  3CCR T;  1N6A A;  2XID A;  3UDC A;  4C8Q F;  1AHJ B;  2RK1 A;  2P0Q A;  3M0S A;  1IHV A;  4RTY A;  1AEY A;  3KUF A;  4F7U A;  4XTU A;  3CD6 T;  2CP5 A;  4LNP A;  1VQP A;  3H0I A;  4M75 F;  4R55 A;  3VS3 A;  2HD0 A;  4BE2 A;  2BE9 B;  2HL3 A;  4M77 G;  2VWF A;  1QVF P;  2VYT A;  5LJ3 g;  2DXU A;  1PC0 A;  1K9A A;  2XD0 A;  4FU6 A;  1CKA A;  1RAD B;  1WZO A;  1PG5 B;  4AFU C;  4D6W A;  2K7A A;  2VVK A;  4M77 A;  4Z8A A;  3JCM Q;  3EHR A;  3OMC A;  3JCM f;  4C5E A;  2P84 A;  3G71 T;  1MMG A;  2XG8 D;  3C94 A;  2K6D A;  4C5H A;  3ZL7 C;  1VQ9 A;  4J83 A;  4RG2 A;  1MV0 B;  5CR2 A;  3IQL A;  1R0C B;  2CSQ A;  2J05 A;  1Q82 R;  3L2Q A;  1WHM A;  1N8R C;  3UWN A;  3OA6 A;  4ANJ A;  5A0D A;  4BAC A;  5C0M A;  2JOY A;  1M1G A;  3H8Z A;  5KYN A;  1M1K U;  1VQ8 A;  1RUW A;  2E6N A;  4FIB A;  2BIV A;  3CC4 T;  3NMZ C;  3JCM h;  1YI2 Q;  1W1F A;  3M4G A;  3CXC P;  3CCU A;  2YSQ A;  4M4Z A;  2EAY A;  2PVD B;  6AT1 B;  2A37 A;  3CBP A;  4XU1 A;  2EGC A;  2RQV A;  5ECA A;  4HCB A;  2KI7 A;  5GMK l;  3CME A;  4A4K A;  5CKB A;  4B9X A;  2E65 A;  5A0G A;  2HQH A;  2XK0 A;  1LOJ A;  1F1B B;  1TXQ A;  2H3E B;  3CC7 T;  4X34 A;  1I8F A;  1PD0 A;  2CP0 A;  2RHZ A;  3DB4 A;  1YIT A;  2OTL T;  1VQM T;  1WHJ A;  2DEQ A;  2YLC A;  2ZGW A;  4ZN3 A;  3CC2 Q;  4C92 B;  1PWT A;  4MMK A;  2AKK A;  3CC7 Q;  2F2V A;  1KIK A;  2LC4 A;  2DZC A;  2LX7 A;  2EVR A;  1WYX A;  3RNJ A;  2KRN A;  2VAS A;  1I07 A;  2OTJ T;  2MWP A;  2EQJ A;  3QPH A;  4HVU A;  2RHX A;  1IRX A;  1QP3 A;  1JXM A;  2RQT A;  2MYS A;  2LQK A;  3KXT A;  2MMP A;  1Y71 A;  5GAN 2;  4JDS A;  8ATC B;  2KRS A;  1ZHI A;  5FWB A;  3I35 A;  1WFW A;  2DIG A;  4N4G A;  5HY6 A;  1C1A A;  4ORZ A;  2OX7 A;  3HRT A;  3TCJ A;  4OML A;  1M30 A;  3M0R A;  4DOW A;  4JUV A;  5FW9 A;  5EC7 A;  4RTW A;  1D1A A;  2VV5 A;  4N0A C;  2V8J A;  4DBQ A;  2MWO A;  2FYK A;  1VQ6 Q;  9ATC B;  3JAM E;  2J6K A;  1PHT A;  3CXC A;  4MZT A;  4F17 A;  4F7U F;  3S6W A;  2COY A;  4DQ2 A;  1BKB A;  2JMA A;  3H9N A;  2L3S A;  4ME7 A;  1ZBJ A;  2KRM A;  2MK5 A;  1DJ7 B;  1NBE B;  1GCP A;  2WAC A;  1RAF B;  4QVC A;  4XAX B;  2QEX A;  3SFM A;  1MMD A;  1S72 T;  3QXE B;  2DJZ A;  1VQL Q;  3G6E T;  5LJ5 g;  4FM4 B;  2F2W A;  4PJO G;  1NJI U;  2QA4 T;  2E5K A;  3LX7 A;  2CP2 A;  5KYY B;  3QUI A;  3EGU A;  1YCS B;  3CQT A;  1YJ9 Q;  4E7I A;  3SHW A;  4C0F A;  2DKG A;  3TVT A;  2DBM A;  1GL5 A;  2B8A A;  3OYG A;  5L23 A;  1VQ8 Q;  2OAU A;  2DZ9 A;  3GLX A;  3MPU B;  4LDY A;  1S72 Q;  2HEQ A;  2GFU A;  3ZFJ A;  2JZ2 A;  1OYX A;  1I5O B;  1KJW A;  1GBQ A;  2D8J A;  2DBK A;  3GF5 A;  3M0Q A;  1QVF A;  2X3W D;  2PQW A;  2RB6 A;  5GAN 4;  2EQU A;  4JJC A;  4AMC A;  3CCU T;  2E41 A;  5GAM h;  4PFO A;  2LNH B;  4EIK A;  5GAO l;  4FCY A;  3G4S T;  4M77 C;  4QVZ A;  1IGQ A;  4XQ3 A;  3L2W A;  4BDY A;  4ZTJ A;  1WA7 A;  2LDM A;  5CQX A;  3H6Z A;  1WHG A;  5DLO A;  1Q82 U;  2JVV A;  1KQS S;  1NYF A;  4HT8 A;  4BI3 A;  1OPL A;  3OYH A;  1YIT T;  2OTL A;  2DM1 A;  1XOV A;  4EDU A;  3JB9 G;  1ZQ1 A;  4E7J A;  1WNL A;  1M4Z A;  2HSE B;  1WQW A;  1RLQ C;  2AT1 B;  3RMQ A;  1VQ4 A;  2DXB A;  1LCK A;  3CCV T;  1RAC B;  1R77 A;  3VS4 A;  3GNF B;  2R5M A;  4PJO E;  3SWN C;  2Z0W A;  1ZLM A;  4RTZ A;  4PFP A;  2EYZ A;  2XU8 A;  1UHC A;  2EJ9 A;  2L8D A;  1KC8 C;  2JN0 A;  3GPL A;  3J7A F;  1AZE A;  2E6Z A;  1X69 A;  5IAY A;  2IPO B;  4OB1 B;  2X4Y A;  2L89 A;  2A3L A;  1YIJ T;  5IXF A;  5KE3 A;  2M02 A;  4J9I A;  4FW2 A;  2CS7 A;  3OBY A;  5GJW B;  4M75 B;  2X3X D;  3OYN A;  1QWF A;  2LT1 A;  1A0N B;  1VQK A;  1G3W A;  2EKO A;  3HFO A;  3HKS A;  3VUB A;  4M7D G;  3LW5 E;  4J5Y A;  2JT4 A;  4OVA A;  2I0N A;  3P8D A;  4ZTF A;  4XTX A;  2PTK A;  1BBZ A;  2RPN A;  1ZA2 B;  4J9H A;  4OMP A;  3KFV A;  3RR6 A;  1Q86 U;  2ED0 A;  2JS2 A;  4M77 E;  2E64 A;  4LD9 K;  2K9G A;  5GAN d;  2FZK B;  5KYY A;  2RHU A;  1T0J A;  1RAI B;  3H41 A;  1I0C A;  4YTL A;  4ZGD B;  2DRM A;  2G3R A;  1PSE A;  4M7A C;  2LT4 A;  1FX7 A;  2PNI A;  3PIP A;  2KRO A;  3EG1 A;  3GP8 A;  1I1J A;  1VQ6 T;  4BI8 B;  1BI0 A;  2DPP B;  2BUD A;  4PJM A;  2CH4 W;  2CUD A;  2BE7 D;  1Q86 C;  3ER0 A;  4HA8 A;  4ZNX A;  1ZSZ B;  1YJW T;  5FWC A;  3A8L B;  3CCE A;  2DVE A;  2YHT A;  1CSK A;  1YFN A;  1S1N A;  2GF7 A;  2RJE A;  4Y28 E;  3SWN A;  2LTO A;  1XJW B;  1N8R R;  2DXT A;  4JJB A;  4C92 A;  3E2U A;  3G4S A;  1UEB A;  3N5B B;  3PVL A;  4P5N A;  2O31 A;  2AHJ B;  2HBW A;  5LJ5 e;  1RAG B;  1RLP C;  2JW4 A;  5IHN A;  2QQS A;  1VQP T;  2E3H A;  2HL5 C; 
#chains in the Genus database with same CATH homology
 4HVV A;  2BZX A;  3M0S A;  5IXB A;  2EBP A;  1AWJ A;  2GGR A;  2O2O A;  1WI7 A;  1OOT A;  4RTY A;  2DMO A;  1AEY A;  4RTT A;  5HCK A;  3VS1 A;  1UJY A;  4LNP A;  1TG0 A;  4JZ3 A;  3H0I A;  4GBQ A;  2DL4 A;  2NUZ A;  1X43 A;  2QDL A;  2DE0 X;  1K1Z A;  3VS3 A;  2KXC A;  2JM8 A;  1SPK A;  2O9V A;  1M3A A;  1WDX A;  2JTE A;  2VWF A;  4Z88 A;  5IHK A;  2C0O A;  1GBR A;  2CH4 A;  1K9A A;  1CKA A;  4KRT A;  1ABO A;  1E6H A;  4AFU C;  1HD3 A;  2K7A A;  3VRY A;  1WXT A;  2VVK A;  2K79 A;  3REB B;  3UA6 A;  4LN2 A;  4Z8A A;  2DL3 A;  4AG1 C;  2J7I A;  3M0U A;  2BZY A;  1G83 A;  3EHR A;  2KBT A;  1AVZ C;  1TUD A;  2LJ1 A;  1K0X A;  2ECZ A;  4J9C A;  2JMC A;  2JM9 A;  1HJD A;  4J9F A;  2K6D A;  3UA7 A;  4HVW A;  4RTU A;  3ZL7 C;  1QKW A;  1EFN A;  2KEA A;  3VS0 A;  2ED1 A;  1MV0 B;  2CT3 A;  4F14 A;  1ARK A;  3IQL A;  2CSQ A;  2J05 A;  4CC3 A;  2EYX A;  2OJ2 A;  2KNB B;  2LMJ A;  3REA B;  2RF0 A;  3I9Q A;  2KYM A;  1RUW A;  2MCN A;  3NMZ C;  1W1F A;  2J6O A;  2YSQ A;  2W10 A;  4M4Z A;  4A63 B;  1VYV A;  3TSZ A;  2A37 A;  2K3B A;  2EGC A;  2SRC A;  4IIO A;  1Z9Z A;  2RQV A;  2DL8 A;  1YP5 A;  2YDL A;  5ECA A;  1BU1 A;  2G6F X;  1PRM C;  1NYG A;  4CC2 A;  4F16 A;  1NEG A;  2J06 A;  3I5S A;  1UGV A;  2GTJ A;  3UF4 A;  3VS5 A;  4OMQ A;  1NEB A;  1HSQ A;  2D8H A;  2ENM A;  2P4R A;  1M8M A;  2ROT A;  1VYU A;  3THK A;  2DRK A;  2RQU A;  2J6F A;  1PWT A;  2AKK A;  2F2V A;  2C0I A;  1KIK A;  2YUN A;  2LX7 A;  1YN8 A;  1WYX A;  2EVR A;  3RNJ A;  2DJQ A;  2KT8 A;  1YNZ A;  3VRZ A;  2FPF A;  2KRN A;  2NWM A;  2CT4 A;  2BZ8 A;  2KGT A;  1I07 A;  4AFQ C;  2EYY A;  4HVU A;  1V1C A;  2KR3 A;  1J3T A;  2FRW A;  2OI3 A;  2KT1 A;  1KFZ A;  1JXM A;  2A08 A;  2EGA A;  2RQT A;  1FMK A;  2LZ6 B;  1BK2 A;  2AZV A;  2EW3 A;  2HDA A;  2RN8 A;  1JU5 C;  5I22 A;  2KRS A;  1YWP A;  3VS7 A;  5FWB A;  3I35 A;  1WFW A;  4WCI A;  1CKB A;  1E7O A;  4ORZ A;  1W6X A;  1GFD A;  4Y92 A;  2BTT A;  1UE9 A;  3O5Z A;  2HSP A;  4OML A;  1M30 A;  2FPD A;  3M0R A;  1G2B A;  5FW9 A;  5EC7 A;  4RTW A;  2EYW A;  1UDL A;  2LQN A;  2CSI A;  2J6K A;  1PHT A;  1QLY A;  1JO8 A;  2LCS A;  1U06 A;  4F17 A;  1M3C A;  1X27 A;  5IH2 A;  4RTX A;  2D1X A;  1B07 A;  1WLP B;  2GTO A;  3NGP A;  2MOX A;  1Y57 A;  2JMA A;  4J9B A;  1M27 C;  2DA9 A;  2DL7 A;  2FPE A;  2LJ3 A;  2L3S A;  1ZBJ A;  2KRM A;  4OMM A;  1WXB A;  2CUB A;  1GCP A;  1GCQ C;  2SEM A;  4DEX A;  1SEM A;  2M51 A;  2DNU A;  3NHN A;  4J9E A;  1TUC A;  1UEC A;  2FRY A;  2MIO A;  3C0C A;  1AZG B;  2F2W A;  1RI9 A;  2E5K A;  1K76 A;  4E6R A;  2KYB A;  4HCK A;  3FJ5 A;  3EGU A;  1YCS B;  1WXU A;  3CQT A;  2F2X A;  3SHW A;  1JXO A;  1OV3 A;  2DIL A;  3ULR B;  2V1Q A;  4OMO A;  3TVT A;  2DBM A;  4HXJ A;  1GL5 A;  3RBB B;  5L23 A;  2DLP A;  2AZS A;  2A28 A;  3PE0 A;  2HEQ A;  1PNJ A;  1PKS A;  1ZUK A;  2AK5 A;  2RMO A;  4LUD A;  1H3H A;  1JQQ A;  1M3B A;  1KJW A;  2YT6 A;  1GBQ A;  3TSW A;  2D8J A;  2ABL A;  2DBK A;  1QKX A;  3M0Q A;  1K4U S;  3R6N A;  2X3W D;  2DYB A;  4K11 A;  4JJC A;  3PVQ A;  3U23 A;  2LNH B;  1X6G A;  4EIK A;  4QT7 A;  1PKT A;  1ABQ A;  4JPB W;  3M0T A;  1WA7 A;  2JXB A;  1T0H A;  3UAT A;  1H8K A;  2D0N A;  1NYF A;  2CRE A;  1OPL A;  1ZUY A;  2DM1 A;  1XOV A;  1X2K A;  2C0T A;  4D8D A;  3SEM A;  2O9S A;  1PRL C;  1AD5 A;  4J9D A;  4DEY A;  4X1V A;  3VS2 A;  4CC4 B;  1RLQ C;  5IHI A;  1OEB A;  4RTV A;  3H0H A;  4CC7 A;  5I11 A;  1LCK A;  1B3Q A;  2EPD A;  3M0P A;  1NM7 A;  4GLM A;  3VS4 A;  1SSH A;  1AWO A;  2OAW A;  1GFC A;  2EGE A;  1NLO C;  1VYT A;  1AOJ A;  4JZ4 A;  1T3L A;  1ZLM A;  2DX1 A;  4RTZ A;  2EYZ A;  2GNC A;  4FSS A;  2GBQ A;  2RNA A;  1UHC A;  1AWW A;  3I5R A;  3GBQ A;  4AFS C;  1X6B A;  1KSW A;  1FYN A;  3H0F A;  2GQI A;  1AZE A;  1BB9 A;  1X69 A;  4JJD A;  1NG2 A;  1N5Z A;  1UJ0 A;  1YWO A;  1H92 A;  1SRM A;  2LJ0 A;  4R0K A;  2EKH A;  4ESR A;  1U5S A;  5IXF A;  4J9I A;  5GJW B;  1UFF A;  2X3X D;  1T3S A;  1QWF A;  2XMF A;  1A0N B;  1SHF A;  2HCK A;  1UTI A;  5GJV B;  2JT4 A;  1Y0M A;  4Z89 A;  1W70 A;  1MUZ A;  2I0N A;  2L3Q A;  1UG1 A;  2PTK A;  1BBZ A;  2KE9 A;  2RPN A;  4J9H A;  2LQW A;  4OMP A;  1GCQ A;  2FO0 A;  3EG3 A;  2L0A A;  3KFV A;  1Z9Q A;  2AKL A;  2ED0 A;  2FG0 A;  2JS2 A;  1X2Q A;  4AG2 C;  1WX6 A;  4IIM A;  1SHG A;  2V1R A;  2K9G A;  1OPK A;  2YUP A;  4OMN A;  3QWY A;  1T0J A;  2JS0 A;  3H41 A;  1I0C A;  1QCF A;  3VS6 A;  3EG0 A;  2DRM A;  2L2P A;  2ESW A;  3EG2 A;  4AFZ C;  2PNI A;  3QWX X;  1K0S A;  1UHF A;  4LE9 A;  2RQR A;  2KRO A;  2M0Y A;  2ROL A;  3EG1 A;  2RQW A;  1GRI A;  2PZ1 A;  1I1J A;  2LP5 A;  2DL5 A;  1U3O A;  3JV3 A;  1NLP C;  2B86 A;  2EQI A;  2W0Z A;  2IIM A;  2CH4 W;  1SRL A;  4J9G A;  2CUD A;  1WIE A;  4RUG A;  3EHQ A;  4ZNX A;  1UUE A;  2VKN A;  1IO6 A;  3NPF A;  1AWX A;  5FWC A;  2O88 A;  2DF6 A;  2K2M A;  1MV3 A;  1ZX6 A;  1CSK A;  2FEI A;  1S1N A;  1JEG A;  1VA7 A;  2CDT A;  4JJB A;  3A98 A;  4D8K A;  2L3P A;  2KXD A;  1ZUU A;  2YUQ A;  2H8H A;  2A36 A;  2DVJ A;  3PVL A;  3LH5 A;  2O31 A;  4LUE A;  2HBW A;  2YUO A;  1E6G A;  1QWE A;  1RLP C;  1ZSG A;  2JW4 A;  5IHN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...