1WI7A

Solution structure of the sh3 domain of sh3-domain kinase binding protein 1
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
68
structure length
68
Chain Sequence
GSSGSSGRRCQVAFSYLPQNDDELELKVGDIIEVVGEVEEGWWEGVLNGKTGMFPSNFIKELSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SH3-domain kinase binding protein 1
publication title Solution structure of the SH3 domain of SH3-domain kinase binding protein 1
rcsb
source organism Mus musculus
molecule tags Protein binding
total genus 7
structure length 68
sequence length 68
ec nomenclature
pdb deposition date 2004-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14604 SH3_9 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1wi7A00
1VYTA 1BB9A 2G6FX 1HJDA 3H0HA 4X1VA 2A28A 1AWXA 4Y92A 1SHGA 1BK2A 1H8KA 4LN2A 1PKSA 2KEAA 5FWCA 2ROLA 2QDLA 2X3WD 2EYXA 2DNUA 3H0FA 3EHQA 2EGAA 2EKHA 4ZNXA 1K9AA 1SHFA 3THKA 2L2PA 1AOJA 2L3QA 4JJCA 1RLQC 1WX6A 4JZ3A 2CUBA 1X27A 1UG1A 4HVWA 1QWEA 1NEGA 4ORZA 4DEYA 2E5KA 3PVQA 2RPNA 1X69A 1AWJA 2CH4A 4CC2A 3EG1A 2M0YA 4RTXA 3C0CA 1MUZA 2FO0A 1OOTA 4J9HA 4RUGA 2KE9A 3M0TA 3ZL7C 1U3OA 1FYNA 2B86A 2A08A 1ZBJA 1X6BA 5GJVB 4HCKA 4IIOA 4RTVA 1NYFA 2ECZA 4D8KA 1UGVA 3EGUA 1CSKA 2SEMA 2JM9A 4HVUA 5HCKA 2JT4A 3H41A 1ABQA 4OMPA 2CDTA 2EVRA 1H92A 2PNIA 2KRNA 2GBQA 4AG1C 1NEBA 2JW4A 4J9IA 1GRIA 2KT8A 1TUDA 1X6GA 1UE9A 1YWOA 2HCKA 1AWWA 2YT6A 1E6GA 3UA6A 1Z9QA 2BZXA 1ZSGA 2LMJA 2YUQA 4JJDA 1UECA 2J6KA 2W10A 1UJYA 2KXCA 2V1RA 1NG2A 2EYYA 2EYZA 2J6FA 2I0NA 4JJBA 2DYBA 1RUWA 1I1JA 1WXTA 2DL7A 3EG0A 4RTUA 1JQQA 1WXUA 1NLOC 2A37A 2DILA 2VWFA 1W1FA 4HXJA 1AEYA 1UJ0A 2NUZA 2YDLA 2K7AA 1M3AA 2PTKA 1ZLMA 2L3PA 1B3QA 2FPDA 2OI3A 4AFSC 2KXDA 2LQNA 2K79A 3M0SA 1AVZC 1NM7A 4J9EA 3TSWA 2CH4W 3I9QA 1PRLC 2AZSA 2KYMA 2LJ3A 1I0CA 1M8MA 2KBTA 2DMOA 2RQTA 1YN8A 2V1QA 1WI7A 3I5RA 4M4ZA 1PHTA 3SHWA 2D0NA 3FJ5A 4AFZC 3VS0A 1V1CA 3PVLA 3M0QA 2C0TA 2JM8A 1B07A 1BU1A 3R6NA 1FMKA 1SRLA 1GCQA 2HBWA 1SSHA 3NGPA 2RQVA 3KFVA 5I11A 1QKXA 3VS2A 4RTZA 2RQWA 5FW9A 3VRYA 1SRMA 2ABLA 2RF0A 1BBZA 3EG2A 2K2MA 2YUOA 2LQWA 3ULRB 4LE9A 1SPKA 3VS7A 2KGTA 1WLPB 2DE0X 2KT1A 2J6OA 1MV3A 4OMQA 2OJ2A 5EC7A 1K76A 2AK5A 3RBBB 3REBB 2DM1A 2J7IA 2VVKA 3EG3A 2DL3A 4J9GA 4OMMA 2O31A 1T0HA 2KYBA 2ROTA 1JEGA 4LUDA 2JMCA 1T3LA 4RTWA 1OPKA 2J05A 2LJ1A 2MOXA 1H3HA 2LX7A 2O2OA 5IHKA 1I07A 2K3BA 2KRMA 1WYXA 3VS1A 3I5SA 2DLPA 2DL5A 1GCQC 1ARKA 1G83A 1K0XA 2DA9A 1PNJA 2CT3A 1J3TA 1M27C 4KRTA 1AWOA 1PWTA 1UHCA 2YUNA 2RQUA 4RTTA 1GFCA 1E6HA 1T0JA 1X2QA 3NHNA 1QWFA 3JV3A 1KSWA 4F14A 3REAB 1WA7A 4F17A 1S1NA 2K9GA 2RNAA 2LP5A 2L0AA 3NPFA 2FG0A 5ECAA 2BZYA 2GQIA 2RQRA 3QWYA 1OEBA 1AZEA 2JMAA 2DL8A 2OAWA 2PZ1A 1GL5A 1AD5A 1E7OA 2LCSA 2YSQA 1YNZA 1TUCA 2FPFA 2IIMA 2O9SA 2EGEA 2FRWA 5IXFA 4AFQC 4OMLA 4R0KA 2FPEA 3TVTA 2LZ6B 4IIMA 1WDXA 2DX1A 2CSQA 4CC3A 3A98A 1QLYA 5IHNA 1W70A 1XOVA 4ESRA 2EQIA 2M51A 4JZ4A 2K6DA 1K4US 4RTYA 2JTEA 2BTTA 4OMNA 1CKAA 2AKKA 1JU5C 2KR3A 2EW3A 1WFWA 1QKWA 2CSIA 1IO6A 1W6XA 1OPLA 1Z9ZA 2HDAA 1HD3A 2HSPA 2C0IA 1M3CA 1ABOA 2DF6A 1UHFA 1UUEA 2DVJA 4J9FA 1G2BA 2RMOA 2LJ0A 2CREA 1EFNA 2KROA 1K0SA 1ZX6A 4EIKA 2MIOA 4K11A 3U23A 2MCNA 4Z8AA 4GBQA 1A0NB 1GFDA 1CKBA 4AG2C 1K1ZA 1ZUUA 1UTIA 1WXBA 3IQLA 4J9DA 1WIEA 1Y0MA 2J06A 2F2WA 1M30A 2LNHB 2RN8A 2C0OA 2KNBB 4FSSA 3EHRA 4OMOA 2DJQA 1JXOA 3GBQA 3CQTA 1T3SA 4Z89A 3VS4A 3PE0A 2EYWA 4A63B 2FEIA 2NWMA 1QCFA 1ZUKA 4LNPA 3SEMA 2H8HA 1HSQA 2L3SA 4JPBW 4QT7A 3VS6A 1KFZA 1N5ZA 3VS3A 2AKLA 5I22A 2W0ZA 2HEQA 5L23A 1SEMA 4J9CA 2ESWA 3M0PA 3UATA 2EGCA 3M0UA 3UA7A 3RNJA 1X2KA 3O5ZA 2FRYA 3UF4A 1PKTA 1X43A 2D1XA 2O88A 2CUDA 1M3BA 1UFFA 1RLPC 3M0RA 1KIKA 4CC7A 2JXBA 4J9BA 2SRCA 2DBMA 5IH2A 3H0IA 5IHIA 2ED1A 2P4RA 3QWXX 1NLPC 1YP5A 2VKNA 5GJWB 1AZGB 1KJWA 2DRKA 2YUPA 2EBPA 4WCIA 2X3XD 1TG0A 3VS5A 2AZVA 2JS0A 2F2XA 1JO8A 2JS2A 3LH5A 5IXBA 1VA7A 4AFUC 5FWBA 2CT4A 2EPDA 4HVVA 1Y57A 2D8HA 4E6RA 4F16A 4Z88A 4D8DA 2O9VA 3I35A 2GTJA 1ZUYA 1JXMA 2BZ8A 1NYGA 3NMZC 1YCSB 1U5SA 2ED0A 2GNCA 1UDLA 2A36A 2DBKA 3TSZA 1VYVA 4GLMA 2KRSA 1OV3A 1GBRA 2GGRA 4CC4B 1RI9A 2ENMA 2F2VA 2DL4A 1U06A 4LUEA 1PRMC 1LCKA 2GTOA 1GCPA 1GBQA 2XMFA 1VYUA 4DEXA 3VRZA 1YWPA 1MV0B 2D8JA 2DRMA
chains in the Genus database with same CATH superfamily
1Q7YU 4EDUA 3CEYA 4IUUA 1HJDA 5CKDA 2XD0A 2KY9A 2OTLA 2FL7A 2A28A 4DBHA 1AWXA 2QYZA 2RHUA 4Y92A 1KD1R 2DD5A 2YLCA 1AHJB 4LN2A 4MZMA 3LWHA 2GF7A 3M53A 3JCMW 2V26A 4PNOA 3CCMT 1OU8A 1Y96A 3ME9A 7AT1B 4HT9A 4LD9K 1D1AA 3A8GB 2HKNA 1K9AA 1SHFA 3THKA 5GANj 3HFNA 1WJSA 1X27A 1OULA 1UG1A 1VQPA 4C8QG 3OYAA 1VQLT 1AWJA 2CH4A 4MZTA 4C0DB 4CC2A 3GF5A 1VQNA 2E65A 5KYXB 3C0CA 1K8AC 4E2FB 1MUZA 2KAFA 3CPWA 3ZEHA 1M8VA 2B86A 2RD1A 2LTOA 2DXUA 3J81E 1VQMA 4IIOA 2P0KA 3VU3C 1U1TA 5D6WA 2VXEA 4JS5A 4HVUA 4C92C 1OQKA 5KE3A 3H41A 1M2VA 1Q7YC 1H92A 3HHTB 1D0YA 1V29B 2GBQA 4XTWA 4J6WA 3CCQA 4EMKC 3CPFA 1TUDA 1UE9A 4EPCA 2FZKB 2RI3A 2YT6A 1E6GA 3EFSA 1G3WA 2BZXA 3TREA 2A0FB 2QTXA 1RABB 4F7UA 2V1RA 3URGA 3DKMA 2EYYA 3JCMJ 3CC2Q 3G7ZA 1YJNQ 2H3EB 1QVPA 2DYBA 1UGRB 1KQSA 3DLMA 1JQQA 1WJQA 2EQJA 2XIDA 4FL6A 4C8QE 1WHLA 2DILA 2CP6A 3FIFA 1N27A 2HMAA 1XJWB 1W1FA 5LJ3d 4N4HA 2QA4T 2COYA 2LX9A 2F5TX 3CCEQ 1QMCA 2K7AA 2L3PA 3QSUA 5GAN5 2CP0A 5GAMd 3G4SA 3TSWA 2CH4W 4J5YA 1PRLC 2JNGA 4LDYA 3L42A 3JCMg 2KBTA 2DMOA 3CMAQ 2COZA 4BD3A 3RMQA 3LX7A 1YN8A 3E9FA 1TTHB 3SWNC 1WI7A 1VQ8A 1YHQA 2D0NA 1NJIU 3FJ5A 2QEXQ 3G6ET 4J7IA 9ATCB 4PJMA 3HSBA 3A8HB 2JM8A 4YTLA 1BU1A 3CC7Q 1FMKA 1GCQA 4E7SA 3RKWA 3KFVA 2DTOA 4RTZA 3RMSA 2HD0A 3VRYA 1BBZA 3EG2A 2K2MA 4C5IA 4M75C 1QW1A 1HYOA 1FX7A 4JDSA 2OJ2A 4C92D 2EFIA 5EC7A 2QXFA 3V7SA 2ZZDA 2DYIA 5LJ5d 2DIGA 4BE2A 1WHJA 2CP5A 3REBB 4A4EA 1R8OB 1VQ6A 2KSSA 4J9GA 1BKBA 2EYQA 4PK4A 5HY6A 2COWA 4P5NA 5CAIA 1H3HA 2KRMA 2QG9B 3I5SA 3I55T 3OS5A 4Z02A 4M77A 2BIVA 1JJ2S 4ZGJB 2L89A 5FRMA 3CBMA 1VQ5T 1HK9A 4E7JA 2RQUA 3CCUT 1GFCA 1F1BB 1FWZA 4XU3A 4XTXA 1KSWA 3GOXA 3CCSA 4F17A 2K3XA 3JB9G 1NJIC 4HCCA 2LP5A 4C8QB 3L2WA 1LNXA 3OS0A 4MMLA 2NUPA 2OAWA 5FU6C 2EKOA 2YLBA 3FC3A 1B34A 2P0QA 1UGQB 2YSQA 3JB9J 3CC4Q 1YNZA 1BI2A 3CD6Q 2O9SA 3OYKA 2PVGB 4OMLA 1BI1A 3TVTA 3MCAB 4IIMA 4PJOA 4QVCA 1VQOQ 2QGFB 1I5LA 2F1LA 1Q95G 3HRUA 1QLYA 3RKYA 1XOVA 4KT0E 4WTOB 2M51A 4M7DA 3LW5E 1VQ4A 2WACA 4RTYA 3OYNA 4N4GA 4F7UG 4ELZC 5CKFA 4DBFA 4OMNA 2HNIA 2RB6A 1RAIB 1TUGB 1Q86R 1ZA1B 2KR3A 1JU5C 4F04B 2V8KA 2EW3A 4ZGDB 2Y4XA 1MNEA 4J7FA 4M7AC 3A1PA 2HDAA 2C0IA 1M3CA 5FU7C 5GAOn 1UHFA 1UUEA 4M75D 1RADB 2RMOA 2FVUA 2EQMA 1EFNA 4NL2A 1ZX6A 2DJZA 1UB4A 3LGFA 3U23A 8ATCB 4GBQA 3CMEQ 4FYVB 3KXTA 3IQLA 1Q81R 1G3TA 3HTRA 4C92A 2RHZA 2LNHB 2RN8A 1YJ9T 2ZPHB 2DJQA 5GANg 4KGXB 1PD0A 4C0FA 3LYIA 3MO8A 4Z89A 4FYXB 2FEIA 5CKHA 4LNPA 2RHIA 3QIIA 1BI3A 1D0ZA 2L3SA 3M56A 4F7UE 5L23A 5IT9E 3M0UA 3UA7A 3PIPA 1Q82U 4C0GA 3UF4A 2M0OA 1M3BA 2ATCB 3ER0A 1RLPC 1KIKA 2JXBA 1WHKA 1D3BA 3VJPA 1YP5A 3CXCA 1OYXA 2VKNA 5GJWB 2DETA 3OYJA 2VASA 3L2VA 2M02A 4M77G 1EIFA 2JJ9A 1Y96B 3PIOA 1VQKQ 2JS0A 2VC8A 3LH5A 4LD6A 3TQ7P 4O5VA 5FWBA 4AFUC 3OYEA 1JJ2A 2D8HA 2RK2A 5J3BA 5CR2A 3MPUB 4OVAA 2CS7A 3OSSC 3C4SA 4Z88A 4M7AD 3CCJQ 2BZ8A 1NYGA 3I56Q 1U5SA 2ED0A 1M1KU 2D0QB 1BCOA 3CCLA 2A36A 3TSZA 2KRSA 1NE8A 3MEWA 3CCEA 1GBRA 1RI9A 2DAQA 2EQUA 4M78E 2LNVA 2DL4A 3H8ZA 4BY6C 5FLXE 4LUEA 3A5ZB 1WHMA 4PJOG 3V7RA 3VRZA 2E6NA 3JCMV 2E12A 3NTIA 2DEUA 2DRMA 1Q82C 1BB9A 2X4JA 1VQLQ 4E7KA 4KULA 3A8OB 4X1VA 4BACA 4M7DG 4XK8E 4FM4B 4E7ZA 3TEEA 2KQWA 1PKSA 5KE2A 4DQ2A 4Y91A 3CC7A 3S6WA 1BI0A 4FIBA 2EYXA 4E7HA 4M77E 3EHQA 2EKHA 3PT9A 4ZNXA 3M59A 2VUBA 3X26B 2L3QA 1FMWA 4JJCA 1RLQC 1WX6A 2CUBA 2CZ6B 4N0AA 4F7UB 4HVWA 1QWEA 4ORZA 4DEYA 2ZPEB 3E1SA 1MHNA 1M90U 3BY7A 2M0YA 3L1AA 1LVKA 2Y4YA 1M1KC 5GMKl 3M0TA 1U3OA 2OTLT 1YBYA 1FYNA 2RI5A 2VYTA 3AHUA 4C92G 4M75F 1X6BA 5GJVB 2HAXA 4HCKA 4A4FA 1NYFA 3DLLA 1NPPA 1ZQ1A 4D8KA 3EGUA 1CSKA 2ZPFB 5HCKA 4LDXA 1BIAA 4PJOE 2JT4A 3LWIA 2FHDA 1K73U 1MMGA 5GMKj 2CDTA 2DZCA 3META 2KRNA 2B8AA 4AG1C 2JW4A 5FROA 4E7LA 4J9IA 1GRIA 4M7DE 5KYUA 1VQ9T 3D7SB 1VQPT 4RCBA 1OX8A 4ATOA 1W2BA 1YWOA 2XDDA 3UA6A 4ZN3A 2NUTA 1Z9QA 4HCBA 1N8RU 2LMJA 2H3JA 3DB4A 3CC4A 3CD6A 4M78B 1NG2A 2J6FA 2YRVA 5J26A 1SG5A 4OB1B 4JJBA 1I1JA 1WXTA 3EG0A 1VQOA 3L2UA 1M90C 1O9SA 1NLOC 3G6EQ 4V2SA 3JCMe 5FRNA 3S3NA 2MYSA 1I8FA 4KBMB 1UJ0A 3JCMh 2OAUA 3L2RA 4DA4A 1M3AA 3CCQT 2X35A 2K2VA 1ZLMA 1KC8R 3M57A 2M9UA 1KQ2A 1NM7A 4NS5A 2K3YA 4M77B 3CBOA 4ZTJA 2LJ3A 2EWNA 1C1AA 1I0CA 4XQ3A 1K73C 2VGMA 2FZCB 2RQTA 1NZ9A 5GAOp 2OTJT 1RAAB 4C0DC 1IHWA 3PVLA 1W4SA 3CMEA 1B07A 3R6NA 4M7AF 2CZ7B 4RMOA 1QVFA 2EJ9A 3QKJA 3I55Q 1N8RC 3X20B 1S72T 2NUPB 2ABLA 2R57A 3M55A 2YUOA 1VUBA 1SPKA 3VS7A 1B34B 2J6OA 2L5QA 3CCUQ 3QZ9B 4HCZA 4ZTFA 4PJOB 2AK5A 1SF9A 2E70A 5CCAA 2HSEB 2VVKA 2X4XA 2CYZB 2HQXA 3OSVA 5GAN3 3OY9A 1JEGA 4JLIA 4LUDA 4M7DB 3EFOA 4RTWA 1M9SA 2J05A 1X75C 3GP8A 3H6ZA 2O2OA 5IHKA 2RK1A 3OW2S 2MPXC 3L2ZA 2DLPA 1UGSB 3R6OA 1OX9A 2HQHA 2DL5A 3QJ6A 1RAGB 1G83A 1ARKA 1OI1A 2DA9A 1J3TA 2JUFA 3EAEA 3PMIA 2KDSA 3OMCA 3M4YA 1E6HA 4HT8A 5LJ3f 4F14A 2KK4A 4XAXB 2K9GA 5HKCA 2FYKA 2FB7A 2DXTA 3NPFA 2FG0A 5GAMf 3ASKA 4X9CA 2BZYA 1Y71A 3QWYA 1VQKA 2CGHA 2JMAA 2HL3A 5CK9A 1RAHB 1GL5A 3HRTA 1D0XA 3OW2P 2FPFA 4JS4A 3N5BB 2QGGA 3CCJA 2DXBA 2LT4A 1WDXA 2DX1A 2CSQA 5A0DA 5I2SA 3I56A 4CC3A 3BW1A 1M4ZA 3A98A 5IHNA 2CP2A 1VIEA 4JZ4A 2P84A 3JB9I 5IAYA 1NBEB 2JTEA 1QQJA 1WPYA 2LCCA 2BTTA 3SD4A 3S3OA 3CCST 3CCVT 3WVEB 1CKAA 2QQRA 1YI2T 3MJXA 3MKDA 1OPLA 1YJ9Q 3V7CA 5LJ5f 2HSPA 1VQLA 4VUBA 1WJRA 1D09B 4WF2A 3KBGA 2DF6A 2JVVA 2OX7A 1G2BA 3RERA 2KROA 3MEVA 5GANe 4K11A 2XG8D 3E9GA 5L8RE 3G71Q 4QKUA 5KYWB 5GANh 1QVGP 1JRIA 5LJ3j 4IKFA 1ZUUA 5CKBA 3J7AF 1WXBA 1FMVA 4J9DA 1MMDA 1WIEA 1Y0MA 1RAFB 2K57A 5C0MA 5A0LA 1JXOA 3CQTA 2PUOB 3VKIA 1UGPB 4BDYA 2EYWA 4L6V5 5AYFA 1TH7A 3SB2A 4PJNA 3RDVA 2XKOC 1MMNA 2H8HA 3BFMA 3OYLA 4MDXA 4XU2A 1ZA2B 4JPBW 4QT7A 3VS6A 2XICA 4C8QC 4RG2A 1KFZA 1N5ZA 5D7UA 3VS3A 2AKLA 2QASA 1K8AR 1ZSZA 1WGSA 4J9CA 3OYBA 3RNJA 3OYHA 5GAN4 1X43A 2O88A 1YFNA 2MMPA 2AIRB 3M0RA 2DBMA 5IHIA 2P4RA 3QWXX 5LJ5j 4JRKA 3OYMA 4J6XA 1Q7YR 1KJWA 2X51A 2DRKA 2ZGWA 3HPWA 2EBPA 3QDFA 4WCIA 1TG0A 3VS5A 1IRXA 3MEUA 3OW2A 5IXBA 1VA7A 3QDRB 2CT4A 4M78F 2EIFA 2XDPA 2XDBA 4F16A 1MNDA 2V8IA 2DTIA 2ZPGB 1KG1A 4D8DA 1N9SA 1ZUYA 2D9TA 1YCSB 2QAZA 3PNWC 2GNCA 6AT1B 2F69A 5KYXA 1R0CB 4II1A 4X9DA 3EGXA 2RI2A 2HKQB 1MMAA 3LLRA 4BDZA 1KHCA 2E4HA 2GGRA 3S3MA 1AT1B 2F2VA 1I4K1 3JCMX 1Y7XA 1LCKA 3JSCA 2DIQA 1B7TA 2YXYA 3GLXA 2ZCFB 3EGDA 5DM7R 4M77F 1VIFA 1SHGA 2Z0WA 5GAOq 1IXDA 3WVDB 5KYUB 5A2QE 5FWCA 2ROLA 4FU6A 3INZA 1YCYA 3OS1A 2DNUA 3I55A 1U8RA 3CCLT 3H0FA 2EGAA 2NUTB 3QO3A 3CCET 2L2PA 1K9MC 4C8QD 2FZGB 2QI2A 4R55A 4JZ3A 3CCUA 1NEGA 3PVQA 2RPNA 1SKUB 4EMKA 2E10A 2QQAA 4BI3A 2RH2A 3VUBA 2EJGA 3UPUA 1VQ9Q 3C12A 4B9XA 4RTXA 3MP1A 1OOTA 4RUGA 2EQKA 2KE9A 1YITQ 2A3LA 1TS9A 1WHHA 2DTHA 3VV0A 3MHXA 2QTVA 1ZBJA 1KK7A 4JRPA 2ECZA 1WNLA 1KD1U 1UGVA 3JB9H 2GCXA 5KH6A 3V8KA 3CC7T 2SEMA 2JM9A 2GQVA 4XU0A 4PLLA 4ZN1A 3JCMP 1YIJQ 2DPPB 1IREB 4MZPA 2EVRA 2PNIA 2RM4A 4A4HA 3VYGA 2NLUA 1ZHIA 2CP7A 2QK0A 2WSEE 3HKSA 4FCYA 2HCKA 1AWWA 3FLGA 5GAOm 2QQ9A 3PGGA 2WSFE 3CC2A 3JCMd 1YJNA 2YUQA 3GNFB 1NJIR 1UECA 2KXCA 2DK3A 5DLOA 3SWNA 2I0NA 3QG1A 4PJJA 2MI6A 2DL7A 1PM3A 5GAN2 4QVZA 2X4YA 1WXUA 2OTJQ 1PSFA 4FYYB 3CCMQ 1FXXA 4PKCC 1M1FA 2HBPA 4HXJA 3SDZA 4D6WA 1YJWT 5KYYA 2NUZA 3CCRT 4C5EA 2YDLA 2JTMA 1RAEB 4M75A 3EFOB 1S72Q 1N6AA 2KXDA 1TWBA 3FEOA 2HL5C 3CMAA 4XTUA 1YJ9A 1VQ7T 1KD1C 4J9EA 5DLQE 2RJCA 1M2VB 3I9QA 2AZSA 2KYMA 2AT1B 2QEXA 5AT1B 2JOYA 2V1QA 3I5RA 3SHWA 1PSEA 3VS0A 1LOJA 2O01E 1TSFA 3G71A 3CPWS 2A7YA 1MGQA 1TU0B 2HBWA 1SSHA 3PFSA 4AT1B 4C5GA 5I11A 1NPRA 3VS2A 2RQWA 5FW9A 3HP9A 4MDWA 1SRMA 1QCNA 2RF0A 4OGEA 5LJ3g 2LQWA 4LE9A 1PCXA 2DE0X 2IPOB 1MV3A 3QXEB 2E1HA 4NOYA 5GAMg 4Q5WA 4BB7A 2DL3A 2ROTA 3P8BB 2JMCA 1T3LA 2R5MA 1OPKA 2LJ1A 5CVIA 3EH2A 2LX7A 1I07A 3Q1JA 4FT2A 1WYXA 3VS1A 3CPWP 3CMET 3FRNA 1GCQC 4XTYA 5M9OA 3M5AA 4M78C 3PTAA 1PWTA 1UHCA 2YUNA 5HK3A 4RTTA 3JB9D 5D6YA 1X2QA 3NHNA 4ELYC 2QA4Q 2EAYA 1WQ7A 1KQSS 3REAB 4C8QF 1WA7A 1XNIA 1S1NA 1TXQA 2G3RA 3OYFA 1VQNT 2PUKB 1KQ1A 3OYYA 2L0AA 4DBRA 4A4GA 3CCVQ 5ECAA 5LJ5g 4M7AA 1RACB 1YI2Q 4RKUE 2RHYA 2PZ1A 1VQMT 1AD5A 2LCSA 2K5FA 4O6JA 3P8DA 5IXFA 1Y07A 4AFQC 2RJDA 4BI8B 2FPEA 4M77C 2X9HA 2VXFA 1W70A 4ESRA 4N4IA 2EQIA 2LQ8A 1KQSP 2K6DA 4NL3A 1K4US 2GFUA 4C92E 5GANd 2AKKA 5CIUA 3QPHA 4FT4A 2CSIA 1ZSZB 1Z9ZA 2MAMA 4XTZA 1BIBA 3JRZA 1HD3A 3DB3A 5IN1A 2RJEA 2LQKA 2E5QA 3VYHB 2DVJA 4J9FA 1IB8A 4OB3B 2R58A 1OU9A 2CREA 3T9NA 4PJOC 2MIOA 2VGNA 1Q82R 3CCJT 4M75G 4PL6A 3I56T 3RIRA 2MWOA 3C95A 2DEQA 3WXMB 4M7DC 2DFUA 1VQ5Q 1G5VA 1QP2A 2J06A 3RESA 5GAN8 2F2WA 1VOMA 1M30A 3A8LB 4DOVA 2C0OA 4FSSA 3G4ST 1T3SA 4M78D 1Q86U 1VQ9A 1VQ8T 1YITA 1YHQT 2JZ2A 4IUVA 1QCFA 2ZAEA 1ZUKA 2KMTA 4KGZB 3EGXB 4UC4A 5GMKe 2WSCE 5I22A 1M1KR 2K5IA 1SEMA 4B9WA 5GMKh 3M0PA 3UATA 2BUDA 2EGCA 1N9RA 3RKXA 4BI4A 1YIJA 3O5ZA 2FRYA 2D1XA 2CUDA 3EGDB 1UFFA 2XK0A 2DZ9A 5IH2A 3H0IA 2ED1A 3RR6A 1GXIE 4M77D 1Q81U 3LH0A 1NLPC 3M54A 5I21A 1LPLA 1D1CA 4KUIA 8AT1B 2CKKA 3NTHA 5KCOA 2YRCA 1VQ6T 2YUPA 3CBPA 4M75E 4QQGA 4ANJA 2X3XD 2AZVA 2JS2A 4C92B 2IVWA 3NTKA 1Y57A 1C6VX 4E6RA 2QDYB 3OBYA 1SSFA 1X6OA 3KUFA 2O9VA 1QVGS 4DBQA 2OTJA 3CCMA 1JXMA 2M16A 4EMKB 1Q86C 4M7AG 2DBKA 3ZBDA 1VYVA 4GLMA 2K5LA 5GAOr 2ENMA 3JB9F 4PJOD 5KCHA 1X01A 3CCLQ 1M90R 1S72A 1XTDA 1U06A 1PRMC 4KUDK 1GBQA 1VYUA 4HKEA 4XU1A 4M7DD 2D8JA 1VYTA 2BE9B 2G6FX 2XI9A 1LJOA 3H0HA 2Y90A 5CO7A 1ACMB 1D3BB 4JUVA 1BK2A 2V8JA 4DOWA 1H8KA 1Q81C 2KEAA 2P0PA 4XTVA 1WHGA 1K73R 1M1GA 2QDLA 3JCMb 2X3WD 1VQ4T 1IGQA 4TVRA 4Y28E 3M9QA 5GAMj 4F7UF 1R77A 5CQYA 5C6SA 1AOJA 4KGVB 2F5KA 3ZFJA 4M78A 3X28B 2E5KA 3P8HA 1X69A 3SWNB 1N8RR 3MEAA 4LXCA 3EG1A 3MP8A 2GFAA 2LVMA 4R56A 2FO0A 4J9HA 3HRSA 3ZL7C 4PLIA 4M7AE 3FDRA 3CXCS 5J39A 1G8XA 4FW1A 2A08A 3MP6A 2O4XA 3EG9A 4QQ6A 4RTVA 5KYYB 3TU4K 3JCMQ 2E6ZA 4M75B 3JCMc 3UT1A 2AHJB 2BE7D 3H9NA 5KYNA 3TCJA 4JRQA 1ABQA 4OMPA 4LDWA 2R5AA 4LDVA 2L3RA 1EZZB 2QA4A 4N0AC 1NEBA 2KT8A 2CZ1B 2XU8A 4IUTA 1X6GA 4ZGEB 1YJWQ 4IUQA 3CCVA 4A4KA 3CCRQ 1K9MU 4HA8A 4QVDA 1YI2A 1ZSGA 3CXCP 4RG8A 4JJDA 1VQ7Q 2J6KA 2W10A 1UJYA 2E41A 4GLKA 2LRQA 2EYZA 4FW2A 3OYIA 2C06A 3G6EA 1RUWA 3OMGA 3BE3A 3JAME 4RTUA 4JRIA 1OZ3A 1JJ2P 2A37A 3HL8A 2VWFA 4IUPA 3UWNA 2PU9B 1AEYA 2HQEA 2PTKA 5FU6B 4E7IA 1B3QA 2FPDA 2OI3A 4AFSC 2LQNA 4C0ZA 2K79A 3M0SA 1AVZC 3GNGA 4ME7A 3QUIA 3FB9A 3CC2T 1IGUA 4QW2A 1DJ7B 1YJNT 5GMKi 4X34A 1M8MA 3BDUA 5LJ3e 2OTLQ 1QVGA 4M4ZA 2K4YA 1PHTA 4EMGA 3LGLA 4L59A 5LJ3h 4JJNK 4BE1A 4AFZC 1TOVA 1RI0A 4A53A 1G3YA 3E2UA 1V1CA 4RCCA 1PC0A 4QQDA 3SFMA 2C0TA 2VV5A 5GAMe 3OYDA 1SRLA 3NGPA 2RQVA 5GAMh 1QKXA 2PQWA 1VQ5A 1H3ZA 4M7AB 3F70A 2DXCA 3ULRB 2KGTA 5FU7B 1WLPB 4PJOF 2KT1A 4IURA 4OMQA 1VQPQ 2EJFA 3CMAT 1KC8U 2NYSA 1K76A 3QZ5B 3RBBB 1VQNQ 2E3HA 2QQSA 2DM1A 2J7IA 4M7DF 3EG3A 3PMTA 4OMMA 3JCMf 2QEXT 2O31A 3BDLA 1T0HA 2KYBA 2DVEA 1W2BS 2MOXA 3M4GA 5GAN7 4KH1B 1M5Q1 3O8VA 2K3BA 4M78G 5GAOl 1VQMQ 3QYGB 1BYMA 4CI0C 3G71T 3OQ5A 2LDMA 1K0XA 1P92A 1PNJA 1I5OB 2CT3A 5LJ5e 1M27C 4KRTA 1AWOA 2MK5A 1IZ6A 3X25B 5LJ5h 1RL2A 3J80E 3E19A 1T0JA 3M58A 1QWFA 2KVQG 3JV3A 2M1HA 3CCQQ 3GPLA 4JLGA 2RNAA 2CZ0B 3QBYA 4AMCA 4PFZA 5EG2A 4KH0B 1R0BG 4EMHA 5KYWA 2GQIA 2RQRA 1OEBA 1AZEA 2DL8A 3OYGA 2LT1A 4C5HA 5CQXA 1W2BP 2JN0A 4CRIA 1E7OA 2YHTA 3FJPA 5D6XA 4C92F 1TUCA 2IIMA 2EGEA 2FRWA 3V8LA 1O75A 1OZ2A 4R0KA 1BCMA 2LZ6B 1H641 2XHCA 2P4TA 1KC8C 2E3IA 3OBWA 3HFOA 1QP3A 1WFWA 1QVFS 1QKWA 1IO6A 1W6XA 3OYCA 4GY5A 2E64A 3OB9A 3CC4T 4A54A 3G4SQ 1I81A 3C94A 4J6YA 2DKGA 3CD6T 1WZOA 2PVOB 1ABOA 3RUXA 1ZBXA 5HK0A 2DO3A 1VQOT 2LJ0A 1IHVA 5I2MA 1VQ8Q 1K0SA 1YHQQ 4EIKA 4C8QA 1XQHA 2MCNA 2MWPA 4Z8AA 2RO0A 1A0NB 1GFDA 1CKBA 4AG2C 1K1ZA 4BY6B 2VB6A 1UTIA 1EX4A 1QCOA 2LCLA 1QVFP 3X24B 2KNBB 3EHRA 4OMOA 3V8JA 1JBMA 2QQBA 1HXDA 4B6MA 3GBQA 3G1JA 3VUZA 2D6FA 3OS2A 4BUGA 1K9MR 2DD4A 3VS4A 3PE0A 4PFOA 4A63B 4OF1A 3QJYA 4OB0B 1VQ6Q 5GAN6 2NWMA 3EFRA 3SEMA 4OB2B 4E47A 1HSQA 2ZPBB 4PJLA 2I2LA 2PVDB 2YWWA 1M2OA 4OGCA 1KHIA 2W0ZA 3A8MB 2HEQA 1WQWA 2ESWA 5CKEA 5A0GA 4OP0A 4J83A 3NFCA 2BKDN 1JB0E 1X2KA 1PKTA 2LC4A 1D1BA 1UEBA 5GMKm 4CC7A 4FYWB 2DERA 4J9BA 2SRCA 3EH1A 3QHSA 3CCSQ 5GANf 1YJWA 1AZGB 1G3SA 3CCRA 2MF2A 3OA6A 2ZPIB 2YRDA 4L5GA 1YITT 1U1SA 2JTFA 1VQ7A 2F2XA 1JO8A 3L2QA 3AT1B 2RA2A 2EPDA 5LL6S 4HVVA 1ZSZC 1C0MA 2X4WA 1V76A 2L8DA 4FSXA 2HZYA 3I35A 2GTJA 2KI7A 2IG0A 3NMZC 1K8AU 1YIJT 5DY9A 1UDLA 1PD1A 3GIBA 4OMFB 2RJFA 4LDUA 4PFPA 1OV3A 4CC4B 2RHXA 1VQ4Q 4BE0A 2CP3A 1VQKT 2GTOA 1GCPA 2O4XB 2XMFA 3EG9B 4DEXA 4J8OA 4MMKA 3UDCA 1YWPA 1MV0B 1PG5B 3QYHB 3M0QA
chains in the Genus database with same CATH topology
1VYTA 1BB9A 2G6FX 1HJDA 3H0HA 4X1VA 2A28A 1AWXA 4Y92A 1SHGA 1BK2A 1H8KA 4LN2A 1PKSA 2KEAA 5FWCA 2ROLA 2QDLA 2X3WD 2EYXA 2DNUA 3H0FA 3EHQA 2EGAA 2EKHA 4ZNXA 1K9AA 1SHFA 3THKA 2L2PA 1AOJA 2L3QA 4JJCA 1RLQC 1WX6A 4JZ3A 2CUBA 1X27A 1UG1A 4HVWA 1QWEA 1NEGA 4ORZA 4DEYA 2E5KA 3PVQA 2RPNA 1X69A 1AWJA 2CH4A 4CC2A 3EG1A 2M0YA 4RTXA 3C0CA 1MUZA 2FO0A 1OOTA 4J9HA 4RUGA 2KE9A 3M0TA 3ZL7C 1U3OA 1FYNA 2B86A 2A08A 1ZBJA 1X6BA 5GJVB 4HCKA 4IIOA 4RTVA 1NYFA 2ECZA 4D8KA 1UGVA 3EGUA 1CSKA 2SEMA 2JM9A 4HVUA 5HCKA 2JT4A 3H41A 1ABQA 4OMPA 2CDTA 2EVRA 1H92A 2PNIA 2KRNA 2GBQA 4AG1C 1NEBA 2JW4A 4J9IA 1GRIA 2KT8A 1TUDA 1X6GA 1UE9A 1YWOA 2HCKA 1AWWA 2YT6A 1E6GA 3UA6A 1Z9QA 2BZXA 1ZSGA 2LMJA 2YUQA 4JJDA 1UECA 2J6KA 2W10A 1UJYA 2KXCA 2V1RA 1NG2A 2EYYA 2EYZA 2J6FA 2I0NA 4JJBA 2DYBA 1RUWA 1I1JA 1WXTA 2DL7A 3EG0A 4RTUA 1JQQA 1WXUA 1NLOC 2A37A 2DILA 2VWFA 1W1FA 4HXJA 1AEYA 1UJ0A 2NUZA 2YDLA 2K7AA 1M3AA 2PTKA 1ZLMA 2L3PA 1B3QA 2FPDA 2OI3A 4AFSC 2KXDA 2LQNA 2K79A 3M0SA 1AVZC 1NM7A 4J9EA 3TSWA 2CH4W 3I9QA 1PRLC 2AZSA 2KYMA 2LJ3A 1I0CA 1M8MA 2KBTA 2DMOA 2RQTA 1YN8A 2V1QA 1WI7A 3I5RA 4M4ZA 1PHTA 3SHWA 2D0NA 3FJ5A 4AFZC 3VS0A 1V1CA 3PVLA 3M0QA 2C0TA 2JM8A 1B07A 1BU1A 3R6NA 1FMKA 1SRLA 1GCQA 2HBWA 1SSHA 3NGPA 2RQVA 3KFVA 5I11A 1QKXA 3VS2A 4RTZA 2RQWA 5FW9A 3VRYA 1SRMA 2ABLA 2RF0A 1BBZA 3EG2A 2K2MA 2YUOA 2LQWA 3ULRB 4LE9A 1SPKA 3VS7A 2KGTA 1WLPB 2DE0X 2KT1A 2J6OA 1MV3A 4OMQA 2OJ2A 5EC7A 1K76A 2AK5A 3RBBB 3REBB 2DM1A 2J7IA 2VVKA 3EG3A 2DL3A 4J9GA 4OMMA 2O31A 1T0HA 2KYBA 2ROTA 1JEGA 4LUDA 2JMCA 1T3LA 4RTWA 1OPKA 2J05A 2LJ1A 2MOXA 1H3HA 2LX7A 2O2OA 5IHKA 1I07A 2K3BA 2KRMA 1WYXA 3VS1A 3I5SA 2DLPA 2DL5A 1GCQC 1ARKA 1G83A 1K0XA 2DA9A 1PNJA 2CT3A 1J3TA 1M27C 4KRTA 1AWOA 1PWTA 1UHCA 2YUNA 2RQUA 4RTTA 1GFCA 1E6HA 1T0JA 1X2QA 3NHNA 1QWFA 3JV3A 1KSWA 4F14A 3REAB 1WA7A 4F17A 1S1NA 2K9GA 2RNAA 2LP5A 2L0AA 3NPFA 2FG0A 5ECAA 2BZYA 2GQIA 2RQRA 3QWYA 1OEBA 1AZEA 2JMAA 2DL8A 2OAWA 2PZ1A 1GL5A 1AD5A 1E7OA 2LCSA 2YSQA 1YNZA 1TUCA 2FPFA 2IIMA 2O9SA 2EGEA 2FRWA 5IXFA 4AFQC 4OMLA 4R0KA 2FPEA 3TVTA 2LZ6B 4IIMA 1WDXA 2DX1A 2CSQA 4CC3A 3A98A 1QLYA 5IHNA 1W70A 1XOVA 4ESRA 2EQIA 2M51A 4JZ4A 2K6DA 1K4US 4RTYA 2JTEA 2BTTA 4OMNA 1CKAA 2AKKA 1JU5C 2KR3A 2EW3A 1WFWA 1QKWA 2CSIA 1IO6A 1W6XA 1OPLA 1Z9ZA 2HDAA 1HD3A 2HSPA 2C0IA 1M3CA 1ABOA 2DF6A 1UHFA 1UUEA 2DVJA 4J9FA 1G2BA 2RMOA 2LJ0A 2CREA 1EFNA 2KROA 1K0SA 1ZX6A 4EIKA 2MIOA 4K11A 3U23A 2MCNA 4Z8AA 4GBQA 1A0NB 1GFDA 1CKBA 4AG2C 1K1ZA 1ZUUA 1UTIA 1WXBA 3IQLA 4J9DA 1WIEA 1Y0MA 2J06A 2F2WA 1M30A 2LNHB 2RN8A 2C0OA 2KNBB 4FSSA 3EHRA 4OMOA 2DJQA 1JXOA 3GBQA 3CQTA 1T3SA 4Z89A 3VS4A 3PE0A 2EYWA 4A63B 2FEIA 2NWMA 1QCFA 1ZUKA 4LNPA 3SEMA 2H8HA 1HSQA 2L3SA 4JPBW 4QT7A 3VS6A 1KFZA 1N5ZA 3VS3A 2AKLA 5I22A 2W0ZA 2HEQA 5L23A 1SEMA 4J9CA 2ESWA 3M0PA 3UATA 2EGCA 3M0UA 3UA7A 3RNJA 1X2KA 3O5ZA 2FRYA 3UF4A 1PKTA 1X43A 2D1XA 2O88A 2CUDA 1M3BA 1UFFA 1RLPC 3M0RA 1KIKA 4CC7A 2JXBA 4J9BA 2SRCA 2DBMA 5IH2A 3H0IA 5IHIA 2ED1A 2P4RA 3QWXX 1NLPC 1YP5A 2VKNA 5GJWB 1AZGB 1KJWA 2DRKA 2YUPA 2EBPA 4WCIA 2X3XD 1TG0A 3VS5A 2AZVA 2JS0A 2F2XA 1JO8A 2JS2A 3LH5A 5IXBA 1VA7A 4AFUC 5FWBA 2CT4A 2EPDA 4HVVA 1Y57A 2D8HA 4E6RA 4F16A 4Z88A 4D8DA 2O9VA 3I35A 2GTJA 1ZUYA 1JXMA 2BZ8A 1NYGA 3NMZC 1YCSB 1U5SA 2ED0A 2GNCA 1UDLA 2A36A 2DBKA 3TSZA 1VYVA 4GLMA 2KRSA 1OV3A 1GBRA 2GGRA 4CC4B 1RI9A 2ENMA 2F2VA 2DL4A 1U06A 4LUEA 1PRMC 1LCKA 2GTOA 1GCPA 1GBQA 2XMFA 1VYUA 4DEXA 3VRZA 1YWPA 1MV0B 2D8JA 2DRMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VYT A;  1BB9 A;  2G6F X;  1HJD A;  3H0H A;  4X1V A;  2A28 A;  1AWX A;  4Y92 A;  1SHG A;  1BK2 A;  1H8K A;  4LN2 A;  1PKS A;  2KEA A;  5FWC A;  2ROL A;  2QDL A;  2X3W D;  2EYX A;  2DNU A;  3H0F A;  3EHQ A;  2EGA A;  2EKH A;  4ZNX A;  1K9A A;  1SHF A;  3THK A;  2L2P A;  1AOJ A;  2L3Q A;  4JJC A;  1RLQ C;  1WX6 A;  4JZ3 A;  2CUB A;  1X27 A;  1UG1 A;  4HVW A;  1QWE A;  1NEG A;  4ORZ A;  4DEY A;  2E5K A;  3PVQ A;  2RPN A;  1X69 A;  1AWJ A;  2CH4 A;  4CC2 A;  3EG1 A;  2M0Y A;  4RTX A;  3C0C A;  1MUZ A;  2FO0 A;  1OOT A;  4J9H A;  4RUG A;  2KE9 A;  3M0T A;  3ZL7 C;  1U3O A;  1FYN A;  2B86 A;  2A08 A;  1ZBJ A;  1X6B A;  5GJV B;  4HCK A;  4IIO A;  4RTV A;  1NYF A;  2ECZ A;  4D8K A;  1UGV A;  3EGU A;  1CSK A;  2SEM A;  2JM9 A;  4HVU A;  5HCK A;  2JT4 A;  3H41 A;  1ABQ A;  4OMP A;  2CDT A;  2EVR A;  1H92 A;  2PNI A;  2KRN A;  2GBQ A;  4AG1 C;  1NEB A;  2JW4 A;  4J9I A;  1GRI A;  2KT8 A;  1TUD A;  1X6G A;  1UE9 A;  1YWO A;  2HCK A;  1AWW A;  2YT6 A;  1E6G A;  3UA6 A;  1Z9Q A;  2BZX A;  1ZSG A;  2LMJ A;  2YUQ A;  4JJD A;  1UEC A;  2J6K A;  2W10 A;  1UJY A;  2KXC A;  2V1R A;  1NG2 A;  2EYY A;  2EYZ A;  2J6F A;  2I0N A;  4JJB A;  2DYB A;  1RUW A;  1I1J A;  1WXT A;  2DL7 A;  3EG0 A;  4RTU A;  1JQQ A;  1WXU A;  1NLO C;  2A37 A;  2DIL A;  2VWF A;  1W1F A;  4HXJ A;  1AEY A;  1UJ0 A;  2NUZ A;  2YDL A;  2K7A A;  1M3A A;  2PTK A;  1ZLM A;  2L3P A;  1B3Q A;  2FPD A;  2OI3 A;  4AFS C;  2KXD A;  2LQN A;  2K79 A;  3M0S A;  1AVZ C;  1NM7 A;  4J9E A;  3TSW A;  2CH4 W;  3I9Q A;  1PRL C;  2AZS A;  2KYM A;  2LJ3 A;  1I0C A;  1M8M A;  2KBT A;  2DMO A;  2RQT A;  1YN8 A;  2V1Q A;  1WI7 A;  3I5R A;  4M4Z A;  1PHT A;  3SHW A;  2D0N A;  3FJ5 A;  4AFZ C;  3VS0 A;  1V1C A;  3PVL A;  3M0Q A;  2C0T A;  2JM8 A;  1B07 A;  1BU1 A;  3R6N A;  1FMK A;  1SRL A;  1GCQ A;  2HBW A;  1SSH A;  3NGP A;  2RQV A;  3KFV A;  5I11 A;  1QKX A;  3VS2 A;  4RTZ A;  2RQW A;  5FW9 A;  3VRY A;  1SRM A;  2ABL A;  2RF0 A;  1BBZ A;  3EG2 A;  2K2M A;  2YUO A;  2LQW A;  3ULR B;  4LE9 A;  1SPK A;  3VS7 A;  2KGT A;  1WLP B;  2DE0 X;  2KT1 A;  2J6O A;  1MV3 A;  4OMQ A;  2OJ2 A;  5EC7 A;  1K76 A;  2AK5 A;  3RBB B;  3REB B;  2DM1 A;  2J7I A;  2VVK A;  3EG3 A;  2DL3 A;  4J9G A;  4OMM A;  2O31 A;  1T0H A;  2KYB A;  2ROT A;  1JEG A;  4LUD A;  2JMC A;  1T3L A;  4RTW A;  1OPK A;  2J05 A;  2LJ1 A;  2MOX A;  1H3H A;  2LX7 A;  2O2O A;  5IHK A;  1I07 A;  2K3B A;  2KRM A;  1WYX A;  3VS1 A;  3I5S A;  2DLP A;  2DL5 A;  1GCQ C;  1ARK A;  1G83 A;  1K0X A;  2DA9 A;  1PNJ A;  2CT3 A;  1J3T A;  1M27 C;  4KRT A;  1AWO A;  1PWT A;  1UHC A;  2YUN A;  2RQU A;  4RTT A;  1GFC A;  1E6H A;  1T0J A;  1X2Q A;  3NHN A;  1QWF A;  3JV3 A;  1KSW A;  4F14 A;  3REA B;  1WA7 A;  4F17 A;  1S1N A;  2K9G A;  2RNA A;  2LP5 A;  2L0A A;  3NPF A;  2FG0 A;  5ECA A;  2BZY A;  2GQI A;  2RQR A;  3QWY A;  1OEB A;  1AZE A;  2JMA A;  2DL8 A;  2OAW A;  2PZ1 A;  1GL5 A;  1AD5 A;  1E7O A;  2LCS A;  2YSQ A;  1YNZ A;  1TUC A;  2FPF A;  2IIM A;  2O9S A;  2EGE A;  2FRW A;  5IXF A;  4AFQ C;  4OML A;  4R0K A;  2FPE A;  3TVT A;  2LZ6 B;  4IIM A;  1WDX A;  2DX1 A;  2CSQ A;  4CC3 A;  3A98 A;  1QLY A;  5IHN A;  1W70 A;  1XOV A;  4ESR A;  2EQI A;  2M51 A;  4JZ4 A;  2K6D A;  1K4U S;  4RTY A;  2JTE A;  2BTT A;  4OMN A;  1CKA A;  2AKK A;  1JU5 C;  2KR3 A;  2EW3 A;  1WFW A;  1QKW A;  2CSI A;  1IO6 A;  1W6X A;  1OPL A;  1Z9Z A;  2HDA A;  1HD3 A;  2HSP A;  2C0I A;  1M3C A;  1ABO A;  2DF6 A;  1UHF A;  1UUE A;  2DVJ A;  4J9F A;  1G2B A;  2RMO A;  2LJ0 A;  2CRE A;  1EFN A;  2KRO A;  1K0S A;  1ZX6 A;  4EIK A;  2MIO A;  4K11 A;  3U23 A;  2MCN A;  4Z8A A;  4GBQ A;  1A0N B;  1GFD A;  1CKB A;  4AG2 C;  1K1Z A;  1ZUU A;  1UTI A;  1WXB A;  3IQL A;  4J9D A;  1WIE A;  1Y0M A;  2J06 A;  2F2W A;  1M30 A;  2LNH B;  2RN8 A;  2C0O A;  2KNB B;  4FSS A;  3EHR A;  4OMO A;  2DJQ A;  1JXO A;  3GBQ A;  3CQT A;  1T3S A;  4Z89 A;  3VS4 A;  3PE0 A;  2EYW A;  4A63 B;  2FEI A;  2NWM A;  1QCF A;  1ZUK A;  4LNP A;  3SEM A;  2H8H A;  1HSQ A;  2L3S A;  4JPB W;  4QT7 A;  3VS6 A;  1KFZ A;  1N5Z A;  3VS3 A;  2AKL A;  5I22 A;  2W0Z A;  2HEQ A;  5L23 A;  1SEM A;  4J9C A;  2ESW A;  3M0P A;  3UAT A;  2EGC A;  3M0U A;  3UA7 A;  3RNJ A;  1X2K A;  3O5Z A;  2FRY A;  3UF4 A;  1PKT A;  1X43 A;  2D1X A;  2O88 A;  2CUD A;  1M3B A;  1UFF A;  1RLP C;  3M0R A;  1KIK A;  4CC7 A;  2JXB A;  4J9B A;  2SRC A;  2DBM A;  5IH2 A;  3H0I A;  5IHI A;  2ED1 A;  2P4R A;  3QWX X;  1NLP C;  1YP5 A;  2VKN A;  5GJW B;  1AZG B;  1KJW A;  2DRK A;  2YUP A;  2EBP A;  4WCI A;  2X3X D;  1TG0 A;  3VS5 A;  2AZV A;  2JS0 A;  2F2X A;  1JO8 A;  2JS2 A;  3LH5 A;  5IXB A;  1VA7 A;  4AFU C;  5FWB A;  2CT4 A;  2EPD A;  4HVV A;  1Y57 A;  2D8H A;  4E6R A;  4F16 A;  4Z88 A;  4D8D A;  2O9V A;  3I35 A;  2GTJ A;  1ZUY A;  1JXM A;  2BZ8 A;  1NYG A;  3NMZ C;  1YCS B;  1U5S A;  2ED0 A;  2GNC A;  1UDL A;  2A36 A;  2DBK A;  3TSZ A;  1VYV A;  4GLM A;  2KRS A;  1OV3 A;  1GBR A;  2GGR A;  4CC4 B;  1RI9 A;  2ENM A;  2F2V A;  2DL4 A;  1U06 A;  4LUE A;  1PRM C;  1LCK A;  2GTO A;  1GCP A;  1GBQ A;  2XMF A;  1VYU A;  4DEX A;  3VRZ A;  1YWP A;  1MV0 B;  2D8J A;  2DRM A; 
#chains in the Genus database with same CATH topology
 1Q7Y U;  4EDU A;  3CEY A;  4IUU A;  1HJD A;  5CKD A;  2XD0 A;  2KY9 A;  2OTL A;  2FL7 A;  2A28 A;  4DBH A;  1AWX A;  2QYZ A;  2RHU A;  4Y92 A;  1KD1 R;  2DD5 A;  2YLC A;  1AHJ B;  4LN2 A;  4MZM A;  3LWH A;  2GF7 A;  3M53 A;  3JCM W;  2V26 A;  4PNO A;  3CCM T;  1OU8 A;  1Y96 A;  3ME9 A;  7AT1 B;  4HT9 A;  4LD9 K;  1D1A A;  3A8G B;  2HKN A;  1K9A A;  1SHF A;  3THK A;  5GAN j;  3HFN A;  1WJS A;  1X27 A;  1OUL A;  1UG1 A;  1VQP A;  4C8Q G;  3OYA A;  1VQL T;  1AWJ A;  2CH4 A;  4MZT A;  4C0D B;  4CC2 A;  3GF5 A;  1VQN A;  2E65 A;  5KYX B;  3C0C A;  1K8A C;  4E2F B;  1MUZ A;  2KAF A;  3CPW A;  3ZEH A;  1M8V A;  2B86 A;  2RD1 A;  2LTO A;  2DXU A;  3J81 E;  1VQM A;  4IIO A;  2P0K A;  3VU3 C;  1U1T A;  5D6W A;  2VXE A;  4JS5 A;  4HVU A;  4C92 C;  1OQK A;  5KE3 A;  3H41 A;  1M2V A;  1Q7Y C;  1H92 A;  3HHT B;  1D0Y A;  1V29 B;  2GBQ A;  4XTW A;  4J6W A;  3CCQ A;  4EMK C;  3CPF A;  1TUD A;  1UE9 A;  4EPC A;  2FZK B;  2RI3 A;  2YT6 A;  1E6G A;  3EFS A;  1G3W A;  2BZX A;  3TRE A;  2A0F B;  2QTX A;  1RAB B;  4F7U A;  2V1R A;  3URG A;  3DKM A;  2EYY A;  3JCM J;  3CC2 Q;  3G7Z A;  1YJN Q;  2H3E B;  1QVP A;  2DYB A;  1UGR B;  1KQS A;  3DLM A;  1JQQ A;  1WJQ A;  2EQJ A;  2XID A;  4FL6 A;  4C8Q E;  1WHL A;  2DIL A;  2CP6 A;  3FIF A;  1N27 A;  2HMA A;  1XJW B;  1W1F A;  5LJ3 d;  4N4H A;  2QA4 T;  2COY A;  2LX9 A;  2F5T X;  3CCE Q;  1QMC A;  2K7A A;  2L3P A;  3QSU A;  5GAN 5;  2CP0 A;  5GAM d;  3G4S A;  3TSW A;  2CH4 W;  4J5Y A;  1PRL C;  2JNG A;  4LDY A;  3L42 A;  3JCM g;  2KBT A;  2DMO A;  3CMA Q;  2COZ A;  4BD3 A;  3RMQ A;  3LX7 A;  1YN8 A;  3E9F A;  1TTH B;  3SWN C;  1WI7 A;  1VQ8 A;  1YHQ A;  2D0N A;  1NJI U;  3FJ5 A;  2QEX Q;  3G6E T;  4J7I A;  9ATC B;  4PJM A;  3HSB A;  3A8H B;  2JM8 A;  4YTL A;  1BU1 A;  3CC7 Q;  1FMK A;  1GCQ A;  4E7S A;  3RKW A;  3KFV A;  2DTO A;  4RTZ A;  3RMS A;  2HD0 A;  3VRY A;  1BBZ A;  3EG2 A;  2K2M A;  4C5I A;  4M75 C;  1QW1 A;  1HYO A;  1FX7 A;  4JDS A;  2OJ2 A;  4C92 D;  2EFI A;  5EC7 A;  2QXF A;  3V7S A;  2ZZD A;  2DYI A;  5LJ5 d;  2DIG A;  4BE2 A;  1WHJ A;  2CP5 A;  3REB B;  4A4E A;  1R8O B;  1VQ6 A;  2KSS A;  4J9G A;  1BKB A;  2EYQ A;  4PK4 A;  5HY6 A;  2COW A;  4P5N A;  5CAI A;  1H3H A;  2KRM A;  2QG9 B;  3I5S A;  3I55 T;  3OS5 A;  4Z02 A;  4M77 A;  2BIV A;  1JJ2 S;  4ZGJ B;  2L89 A;  5FRM A;  3CBM A;  1VQ5 T;  1HK9 A;  4E7J A;  2RQU A;  3CCU T;  1GFC A;  1F1B B;  1FWZ A;  4XU3 A;  4XTX A;  1KSW A;  3GOX A;  3CCS A;  4F17 A;  2K3X A;  3JB9 G;  1NJI C;  4HCC A;  2LP5 A;  4C8Q B;  3L2W A;  1LNX A;  3OS0 A;  4MML A;  2NUP A;  2OAW A;  5FU6 C;  2EKO A;  2YLB A;  3FC3 A;  1B34 A;  2P0Q A;  1UGQ B;  2YSQ A;  3JB9 J;  3CC4 Q;  1YNZ A;  1BI2 A;  3CD6 Q;  2O9S A;  3OYK A;  2PVG B;  4OML A;  1BI1 A;  3TVT A;  3MCA B;  4IIM A;  4PJO A;  4QVC A;  1VQO Q;  2QGF B;  1I5L A;  2F1L A;  1Q95 G;  3HRU A;  1QLY A;  3RKY A;  1XOV A;  4KT0 E;  4WTO B;  2M51 A;  4M7D A;  3LW5 E;  1VQ4 A;  2WAC A;  4RTY A;  3OYN A;  4N4G A;  4F7U G;  4ELZ C;  5CKF A;  4DBF A;  4OMN A;  2HNI A;  2RB6 A;  1RAI B;  1TUG B;  1Q86 R;  1ZA1 B;  2KR3 A;  1JU5 C;  4F04 B;  2V8K A;  2EW3 A;  4ZGD B;  2Y4X A;  1MNE A;  4J7F A;  4M7A C;  3A1P A;  2HDA A;  2C0I A;  1M3C A;  5FU7 C;  5GAO n;  1UHF A;  1UUE A;  4M75 D;  1RAD B;  2RMO A;  2FVU A;  2EQM A;  1EFN A;  4NL2 A;  1ZX6 A;  2DJZ A;  1UB4 A;  3LGF A;  3U23 A;  8ATC B;  4GBQ A;  3CME Q;  4FYV B;  3KXT A;  3IQL A;  1Q81 R;  1G3T A;  3HTR A;  4C92 A;  2RHZ A;  2LNH B;  2RN8 A;  1YJ9 T;  2ZPH B;  2DJQ A;  5GAN g;  4KGX B;  1PD0 A;  4C0F A;  3LYI A;  3MO8 A;  4Z89 A;  4FYX B;  2FEI A;  5CKH A;  4LNP A;  2RHI A;  3QII A;  1BI3 A;  1D0Z A;  2L3S A;  3M56 A;  4F7U E;  5L23 A;  5IT9 E;  3M0U A;  3UA7 A;  3PIP A;  1Q82 U;  4C0G A;  3UF4 A;  2M0O A;  1M3B A;  2ATC B;  3ER0 A;  1RLP C;  1KIK A;  2JXB A;  1WHK A;  1D3B A;  3VJP A;  1YP5 A;  3CXC A;  1OYX A;  2VKN A;  5GJW B;  2DET A;  3OYJ A;  2VAS A;  3L2V A;  2M02 A;  4M77 G;  1EIF A;  2JJ9 A;  1Y96 B;  3PIO A;  1VQK Q;  2JS0 A;  2VC8 A;  3LH5 A;  4LD6 A;  3TQ7 P;  4O5V A;  5FWB A;  4AFU C;  3OYE A;  1JJ2 A;  2D8H A;  2RK2 A;  5J3B A;  5CR2 A;  3MPU B;  4OVA A;  2CS7 A;  3OSS C;  3C4S A;  4Z88 A;  4M7A D;  3CCJ Q;  2BZ8 A;  1NYG A;  3I56 Q;  1U5S A;  2ED0 A;  1M1K U;  2D0Q B;  1BCO A;  3CCL A;  2A36 A;  3TSZ A;  2KRS A;  1NE8 A;  3MEW A;  3CCE A;  1GBR A;  1RI9 A;  2DAQ A;  2EQU A;  4M78 E;  2LNV A;  2DL4 A;  3H8Z A;  4BY6 C;  5FLX E;  4LUE A;  3A5Z B;  1WHM A;  4PJO G;  3V7R A;  3VRZ A;  2E6N A;  3JCM V;  2E12 A;  3NTI A;  2DEU A;  2DRM A;  1Q82 C;  1BB9 A;  2X4J A;  1VQL Q;  4E7K A;  4KUL A;  3A8O B;  4X1V A;  4BAC A;  4M7D G;  4XK8 E;  4FM4 B;  4E7Z A;  3TEE A;  2KQW A;  1PKS A;  5KE2 A;  4DQ2 A;  4Y91 A;  3CC7 A;  3S6W A;  1BI0 A;  4FIB A;  2EYX A;  4E7H A;  4M77 E;  3EHQ A;  2EKH A;  3PT9 A;  4ZNX A;  3M59 A;  2VUB A;  3X26 B;  2L3Q A;  1FMW A;  4JJC A;  1RLQ C;  1WX6 A;  2CUB A;  2CZ6 B;  4N0A A;  4F7U B;  4HVW A;  1QWE A;  4ORZ A;  4DEY A;  2ZPE B;  3E1S A;  1MHN A;  1M90 U;  3BY7 A;  2M0Y A;  3L1A A;  1LVK A;  2Y4Y A;  1M1K C;  5GMK l;  3M0T A;  1U3O A;  2OTL T;  1YBY A;  1FYN A;  2RI5 A;  2VYT A;  3AHU A;  4C92 G;  4M75 F;  1X6B A;  5GJV B;  2HAX A;  4HCK A;  4A4F A;  1NYF A;  3DLL A;  1NPP A;  1ZQ1 A;  4D8K A;  3EGU A;  1CSK A;  2ZPF B;  5HCK A;  4LDX A;  1BIA A;  4PJO E;  2JT4 A;  3LWI A;  2FHD A;  1K73 U;  1MMG A;  5GMK j;  2CDT A;  2DZC A;  3MET A;  2KRN A;  2B8A A;  4AG1 C;  2JW4 A;  5FRO A;  4E7L A;  4J9I A;  1GRI A;  4M7D E;  5KYU A;  1VQ9 T;  3D7S B;  1VQP T;  4RCB A;  1OX8 A;  4ATO A;  1W2B A;  1YWO A;  2XDD A;  3UA6 A;  4ZN3 A;  2NUT A;  1Z9Q A;  4HCB A;  1N8R U;  2LMJ A;  2H3J A;  3DB4 A;  3CC4 A;  3CD6 A;  4M78 B;  1NG2 A;  2J6F A;  2YRV A;  5J26 A;  1SG5 A;  4OB1 B;  4JJB A;  1I1J A;  1WXT A;  3EG0 A;  1VQO A;  3L2U A;  1M90 C;  1O9S A;  1NLO C;  3G6E Q;  4V2S A;  3JCM e;  5FRN A;  3S3N A;  2MYS A;  1I8F A;  4KBM B;  1UJ0 A;  3JCM h;  2OAU A;  3L2R A;  4DA4 A;  1M3A A;  3CCQ T;  2X35 A;  2K2V A;  1ZLM A;  1KC8 R;  3M57 A;  2M9U A;  1KQ2 A;  1NM7 A;  4NS5 A;  2K3Y A;  4M77 B;  3CBO A;  4ZTJ A;  2LJ3 A;  2EWN A;  1C1A A;  1I0C A;  4XQ3 A;  1K73 C;  2VGM A;  2FZC B;  2RQT A;  1NZ9 A;  5GAO p;  2OTJ T;  1RAA B;  4C0D C;  1IHW A;  3PVL A;  1W4S A;  3CME A;  1B07 A;  3R6N A;  4M7A F;  2CZ7 B;  4RMO A;  1QVF A;  2EJ9 A;  3QKJ A;  3I55 Q;  1N8R C;  3X20 B;  1S72 T;  2NUP B;  2ABL A;  2R57 A;  3M55 A;  2YUO A;  1VUB A;  1SPK A;  3VS7 A;  1B34 B;  2J6O A;  2L5Q A;  3CCU Q;  3QZ9 B;  4HCZ A;  4ZTF A;  4PJO B;  2AK5 A;  1SF9 A;  2E70 A;  5CCA A;  2HSE B;  2VVK A;  2X4X A;  2CYZ B;  2HQX A;  3OSV A;  5GAN 3;  3OY9 A;  1JEG A;  4JLI A;  4LUD A;  4M7D B;  3EFO A;  4RTW A;  1M9S A;  2J05 A;  1X75 C;  3GP8 A;  3H6Z A;  2O2O A;  5IHK A;  2RK1 A;  3OW2 S;  2MPX C;  3L2Z A;  2DLP A;  1UGS B;  3R6O A;  1OX9 A;  2HQH A;  2DL5 A;  3QJ6 A;  1RAG B;  1G83 A;  1ARK A;  1OI1 A;  2DA9 A;  1J3T A;  2JUF A;  3EAE A;  3PMI A;  2KDS A;  3OMC A;  3M4Y A;  1E6H A;  4HT8 A;  5LJ3 f;  4F14 A;  2KK4 A;  4XAX B;  2K9G A;  5HKC A;  2FYK A;  2FB7 A;  2DXT A;  3NPF A;  2FG0 A;  5GAM f;  3ASK A;  4X9C A;  2BZY A;  1Y71 A;  3QWY A;  1VQK A;  2CGH A;  2JMA A;  2HL3 A;  5CK9 A;  1RAH B;  1GL5 A;  3HRT A;  1D0X A;  3OW2 P;  2FPF A;  4JS4 A;  3N5B B;  2QGG A;  3CCJ A;  2DXB A;  2LT4 A;  1WDX A;  2DX1 A;  2CSQ A;  5A0D A;  5I2S A;  3I56 A;  4CC3 A;  3BW1 A;  1M4Z A;  3A98 A;  5IHN A;  2CP2 A;  1VIE A;  4JZ4 A;  2P84 A;  3JB9 I;  5IAY A;  1NBE B;  2JTE A;  1QQJ A;  1WPY A;  2LCC A;  2BTT A;  3SD4 A;  3S3O A;  3CCS T;  3CCV T;  3WVE B;  1CKA A;  2QQR A;  1YI2 T;  3MJX A;  3MKD A;  1OPL A;  1YJ9 Q;  3V7C A;  5LJ5 f;  2HSP A;  1VQL A;  4VUB A;  1WJR A;  1D09 B;  4WF2 A;  3KBG A;  2DF6 A;  2JVV A;  2OX7 A;  1G2B A;  3RER A;  2KRO A;  3MEV A;  5GAN e;  4K11 A;  2XG8 D;  3E9G A;  5L8R E;  3G71 Q;  4QKU A;  5KYW B;  5GAN h;  1QVG P;  1JRI A;  5LJ3 j;  4IKF A;  1ZUU A;  5CKB A;  3J7A F;  1WXB A;  1FMV A;  4J9D A;  1MMD A;  1WIE A;  1Y0M A;  1RAF B;  2K57 A;  5C0M A;  5A0L A;  1JXO A;  3CQT A;  2PUO B;  3VKI A;  1UGP B;  4BDY A;  2EYW A;  4L6V 5;  5AYF A;  1TH7 A;  3SB2 A;  4PJN A;  3RDV A;  2XKO C;  1MMN A;  2H8H A;  3BFM A;  3OYL A;  4MDX A;  4XU2 A;  1ZA2 B;  4JPB W;  4QT7 A;  3VS6 A;  2XIC A;  4C8Q C;  4RG2 A;  1KFZ A;  1N5Z A;  5D7U A;  3VS3 A;  2AKL A;  2QAS A;  1K8A R;  1ZSZ A;  1WGS A;  4J9C A;  3OYB A;  3RNJ A;  3OYH A;  5GAN 4;  1X43 A;  2O88 A;  1YFN A;  2MMP A;  2AIR B;  3M0R A;  2DBM A;  5IHI A;  2P4R A;  3QWX X;  5LJ5 j;  4JRK A;  3OYM A;  4J6X A;  1Q7Y R;  1KJW A;  2X51 A;  2DRK A;  2ZGW A;  3HPW A;  2EBP A;  3QDF A;  4WCI A;  1TG0 A;  3VS5 A;  1IRX A;  3MEU A;  3OW2 A;  5IXB A;  1VA7 A;  3QDR B;  2CT4 A;  4M78 F;  2EIF A;  2XDP A;  2XDB A;  4F16 A;  1MND A;  2V8I A;  2DTI A;  2ZPG B;  1KG1 A;  4D8D A;  1N9S A;  1ZUY A;  2D9T A;  1YCS B;  2QAZ A;  3PNW C;  2GNC A;  6AT1 B;  2F69 A;  5KYX A;  1R0C B;  4II1 A;  4X9D A;  3EGX A;  2RI2 A;  2HKQ B;  1MMA A;  3LLR A;  4BDZ A;  1KHC A;  2E4H A;  2GGR A;  3S3M A;  1AT1 B;  2F2V A;  1I4K 1;  3JCM X;  1Y7X A;  1LCK A;  3JSC A;  2DIQ A;  1B7T A;  2YXY A;  3GLX A;  2ZCF B;  3EGD A;  5DM7 R;  4M77 F;  1VIF A;  1SHG A;  2Z0W A;  5GAO q;  1IXD A;  3WVD B;  5KYU B;  5A2Q E;  5FWC A;  2ROL A;  4FU6 A;  3INZ A;  1YCY A;  3OS1 A;  2DNU A;  3I55 A;  1U8R A;  3CCL T;  3H0F A;  2EGA A;  2NUT B;  3QO3 A;  3CCE T;  2L2P A;  1K9M C;  4C8Q D;  2FZG B;  2QI2 A;  4R55 A;  4JZ3 A;  3CCU A;  1NEG A;  3PVQ A;  2RPN A;  1SKU B;  4EMK A;  2E10 A;  2QQA A;  4BI3 A;  2RH2 A;  3VUB A;  2EJG A;  3UPU A;  1VQ9 Q;  3C12 A;  4B9X A;  4RTX A;  3MP1 A;  1OOT A;  4RUG A;  2EQK A;  2KE9 A;  1YIT Q;  2A3L A;  1TS9 A;  1WHH A;  2DTH A;  3VV0 A;  3MHX A;  2QTV A;  1ZBJ A;  1KK7 A;  4JRP A;  2ECZ A;  1WNL A;  1KD1 U;  1UGV A;  3JB9 H;  2GCX A;  5KH6 A;  3V8K A;  3CC7 T;  2SEM A;  2JM9 A;  2GQV A;  4XU0 A;  4PLL A;  4ZN1 A;  3JCM P;  1YIJ Q;  2DPP B;  1IRE B;  4MZP A;  2EVR A;  2PNI A;  2RM4 A;  4A4H A;  3VYG A;  2NLU A;  1ZHI A;  2CP7 A;  2QK0 A;  2WSE E;  3HKS A;  4FCY A;  2HCK A;  1AWW A;  3FLG A;  5GAO m;  2QQ9 A;  3PGG A;  2WSF E;  3CC2 A;  3JCM d;  1YJN A;  2YUQ A;  3GNF B;  1NJI R;  1UEC A;  2KXC A;  2DK3 A;  5DLO A;  3SWN A;  2I0N A;  3QG1 A;  4PJJ A;  2MI6 A;  2DL7 A;  1PM3 A;  5GAN 2;  4QVZ A;  2X4Y A;  1WXU A;  2OTJ Q;  1PSF A;  4FYY B;  3CCM Q;  1FXX A;  4PKC C;  1M1F A;  2HBP A;  4HXJ A;  3SDZ A;  4D6W A;  1YJW T;  5KYY A;  2NUZ A;  3CCR T;  4C5E A;  2YDL A;  2JTM A;  1RAE B;  4M75 A;  3EFO B;  1S72 Q;  1N6A A;  2KXD A;  1TWB A;  3FEO A;  2HL5 C;  3CMA A;  4XTU A;  1YJ9 A;  1VQ7 T;  1KD1 C;  4J9E A;  5DLQ E;  2RJC A;  1M2V B;  3I9Q A;  2AZS A;  2KYM A;  2AT1 B;  2QEX A;  5AT1 B;  2JOY A;  2V1Q A;  3I5R A;  3SHW A;  1PSE A;  3VS0 A;  1LOJ A;  2O01 E;  1TSF A;  3G71 A;  3CPW S;  2A7Y A;  1MGQ A;  1TU0 B;  2HBW A;  1SSH A;  3PFS A;  4AT1 B;  4C5G A;  5I11 A;  1NPR A;  3VS2 A;  2RQW A;  5FW9 A;  3HP9 A;  4MDW A;  1SRM A;  1QCN A;  2RF0 A;  4OGE A;  5LJ3 g;  2LQW A;  4LE9 A;  1PCX A;  2DE0 X;  2IPO B;  1MV3 A;  3QXE B;  2E1H A;  4NOY A;  5GAM g;  4Q5W A;  4BB7 A;  2DL3 A;  2ROT A;  3P8B B;  2JMC A;  1T3L A;  2R5M A;  1OPK A;  2LJ1 A;  5CVI A;  3EH2 A;  2LX7 A;  1I07 A;  3Q1J A;  4FT2 A;  1WYX A;  3VS1 A;  3CPW P;  3CME T;  3FRN A;  1GCQ C;  4XTY A;  5M9O A;  3M5A A;  4M78 C;  3PTA A;  1PWT A;  1UHC A;  2YUN A;  5HK3 A;  4RTT A;  3JB9 D;  5D6Y A;  1X2Q A;  3NHN A;  4ELY C;  2QA4 Q;  2EAY A;  1WQ7 A;  1KQS S;  3REA B;  4C8Q F;  1WA7 A;  1XNI A;  1S1N A;  1TXQ A;  2G3R A;  3OYF A;  1VQN T;  2PUK B;  1KQ1 A;  3OYY A;  2L0A A;  4DBR A;  4A4G A;  3CCV Q;  5ECA A;  5LJ5 g;  4M7A A;  1RAC B;  1YI2 Q;  4RKU E;  2RHY A;  2PZ1 A;  1VQM T;  1AD5 A;  2LCS A;  2K5F A;  4O6J A;  3P8D A;  5IXF A;  1Y07 A;  4AFQ C;  2RJD A;  4BI8 B;  2FPE A;  4M77 C;  2X9H A;  2VXF A;  1W70 A;  4ESR A;  4N4I A;  2EQI A;  2LQ8 A;  1KQS P;  2K6D A;  4NL3 A;  1K4U S;  2GFU A;  4C92 E;  5GAN d;  2AKK A;  5CIU A;  3QPH A;  4FT4 A;  2CSI A;  1ZSZ B;  1Z9Z A;  2MAM A;  4XTZ A;  1BIB A;  3JRZ A;  1HD3 A;  3DB3 A;  5IN1 A;  2RJE A;  2LQK A;  2E5Q A;  3VYH B;  2DVJ A;  4J9F A;  1IB8 A;  4OB3 B;  2R58 A;  1OU9 A;  2CRE A;  3T9N A;  4PJO C;  2MIO A;  2VGN A;  1Q82 R;  3CCJ T;  4M75 G;  4PL6 A;  3I56 T;  3RIR A;  2MWO A;  3C95 A;  2DEQ A;  3WXM B;  4M7D C;  2DFU A;  1VQ5 Q;  1G5V A;  1QP2 A;  2J06 A;  3RES A;  5GAN 8;  2F2W A;  1VOM A;  1M30 A;  3A8L B;  4DOV A;  2C0O A;  4FSS A;  3G4S T;  1T3S A;  4M78 D;  1Q86 U;  1VQ9 A;  1VQ8 T;  1YIT A;  1YHQ T;  2JZ2 A;  4IUV A;  1QCF A;  2ZAE A;  1ZUK A;  2KMT A;  4KGZ B;  3EGX B;  4UC4 A;  5GMK e;  2WSC E;  5I22 A;  1M1K R;  2K5I A;  1SEM A;  4B9W A;  5GMK h;  3M0P A;  3UAT A;  2BUD A;  2EGC A;  1N9R A;  3RKX A;  4BI4 A;  1YIJ A;  3O5Z A;  2FRY A;  2D1X A;  2CUD A;  3EGD B;  1UFF A;  2XK0 A;  2DZ9 A;  5IH2 A;  3H0I A;  2ED1 A;  3RR6 A;  1GXI E;  4M77 D;  1Q81 U;  3LH0 A;  1NLP C;  3M54 A;  5I21 A;  1LPL A;  1D1C A;  4KUI A;  8AT1 B;  2CKK A;  3NTH A;  5KCO A;  2YRC A;  1VQ6 T;  2YUP A;  3CBP A;  4M75 E;  4QQG A;  4ANJ A;  2X3X D;  2AZV A;  2JS2 A;  4C92 B;  2IVW A;  3NTK A;  1Y57 A;  1C6V X;  4E6R A;  2QDY B;  3OBY A;  1SSF A;  1X6O A;  3KUF A;  2O9V A;  1QVG S;  4DBQ A;  2OTJ A;  3CCM A;  1JXM A;  2M16 A;  4EMK B;  1Q86 C;  4M7A G;  2DBK A;  3ZBD A;  1VYV A;  4GLM A;  2K5L A;  5GAO r;  2ENM A;  3JB9 F;  4PJO D;  5KCH A;  1X01 A;  3CCL Q;  1M90 R;  1S72 A;  1XTD A;  1U06 A;  1PRM C;  4KUD K;  1GBQ A;  1VYU A;  4HKE A;  4XU1 A;  4M7D D;  2D8J A;  1VYT A;  2BE9 B;  2G6F X;  2XI9 A;  1LJO A;  3H0H A;  2Y90 A;  5CO7 A;  1ACM B;  1D3B B;  4JUV A;  1BK2 A;  2V8J A;  4DOW A;  1H8K A;  1Q81 C;  2KEA A;  2P0P A;  4XTV A;  1WHG A;  1K73 R;  1M1G A;  2QDL A;  3JCM b;  2X3W D;  1VQ4 T;  1IGQ A;  4TVR A;  4Y28 E;  3M9Q A;  5GAM j;  4F7U F;  1R77 A;  5CQY A;  5C6S A;  1AOJ A;  4KGV B;  2F5K A;  3ZFJ A;  4M78 A;  3X28 B;  2E5K A;  3P8H A;  1X69 A;  3SWN B;  1N8R R;  3MEA A;  4LXC A;  3EG1 A;  3MP8 A;  2GFA A;  2LVM A;  4R56 A;  2FO0 A;  4J9H A;  3HRS A;  3ZL7 C;  4PLI A;  4M7A E;  3FDR A;  3CXC S;  5J39 A;  1G8X A;  4FW1 A;  2A08 A;  3MP6 A;  2O4X A;  3EG9 A;  4QQ6 A;  4RTV A;  5KYY B;  3TU4 K;  3JCM Q;  2E6Z A;  4M75 B;  3JCM c;  3UT1 A;  2AHJ B;  2BE7 D;  3H9N A;  5KYN A;  3TCJ A;  4JRQ A;  1ABQ A;  4OMP A;  4LDW A;  2R5A A;  4LDV A;  2L3R A;  1EZZ B;  2QA4 A;  4N0A C;  1NEB A;  2KT8 A;  2CZ1 B;  2XU8 A;  4IUT A;  1X6G A;  4ZGE B;  1YJW Q;  4IUQ A;  3CCV A;  4A4K A;  3CCR Q;  1K9M U;  4HA8 A;  4QVD A;  1YI2 A;  1ZSG A;  3CXC P;  4RG8 A;  4JJD A;  1VQ7 Q;  2J6K A;  2W10 A;  1UJY A;  2E41 A;  4GLK A;  2LRQ A;  2EYZ A;  4FW2 A;  3OYI A;  2C06 A;  3G6E A;  1RUW A;  3OMG A;  3BE3 A;  3JAM E;  4RTU A;  4JRI A;  1OZ3 A;  1JJ2 P;  2A37 A;  3HL8 A;  2VWF A;  4IUP A;  3UWN A;  2PU9 B;  1AEY A;  2HQE A;  2PTK A;  5FU6 B;  4E7I A;  1B3Q A;  2FPD A;  2OI3 A;  4AFS C;  2LQN A;  4C0Z A;  2K79 A;  3M0S A;  1AVZ C;  3GNG A;  4ME7 A;  3QUI A;  3FB9 A;  3CC2 T;  1IGU A;  4QW2 A;  1DJ7 B;  1YJN T;  5GMK i;  4X34 A;  1M8M A;  3BDU A;  5LJ3 e;  2OTL Q;  1QVG A;  4M4Z A;  2K4Y A;  1PHT A;  4EMG A;  3LGL A;  4L59 A;  5LJ3 h;  4JJN K;  4BE1 A;  4AFZ C;  1TOV A;  1RI0 A;  4A53 A;  1G3Y A;  3E2U A;  1V1C A;  4RCC A;  1PC0 A;  4QQD A;  3SFM A;  2C0T A;  2VV5 A;  5GAM e;  3OYD A;  1SRL A;  3NGP A;  2RQV A;  5GAM h;  1QKX A;  2PQW A;  1VQ5 A;  1H3Z A;  4M7A B;  3F70 A;  2DXC A;  3ULR B;  2KGT A;  5FU7 B;  1WLP B;  4PJO F;  2KT1 A;  4IUR A;  4OMQ A;  1VQP Q;  2EJF A;  3CMA T;  1KC8 U;  2NYS A;  1K76 A;  3QZ5 B;  3RBB B;  1VQN Q;  2E3H A;  2QQS A;  2DM1 A;  2J7I A;  4M7D F;  3EG3 A;  3PMT A;  4OMM A;  3JCM f;  2QEX T;  2O31 A;  3BDL A;  1T0H A;  2KYB A;  2DVE A;  1W2B S;  2MOX A;  3M4G A;  5GAN 7;  4KH1 B;  1M5Q 1;  3O8V A;  2K3B A;  4M78 G;  5GAO l;  1VQM Q;  3QYG B;  1BYM A;  4CI0 C;  3G71 T;  3OQ5 A;  2LDM A;  1K0X A;  1P92 A;  1PNJ A;  1I5O B;  2CT3 A;  5LJ5 e;  1M27 C;  4KRT A;  1AWO A;  2MK5 A;  1IZ6 A;  3X25 B;  5LJ5 h;  1RL2 A;  3J80 E;  3E19 A;  1T0J A;  3M58 A;  1QWF A;  2KVQ G;  3JV3 A;  2M1H A;  3CCQ Q;  3GPL A;  4JLG A;  2RNA A;  2CZ0 B;  3QBY A;  4AMC A;  4PFZ A;  5EG2 A;  4KH0 B;  1R0B G;  4EMH A;  5KYW A;  2GQI A;  2RQR A;  1OEB A;  1AZE A;  2DL8 A;  3OYG A;  2LT1 A;  4C5H A;  5CQX A;  1W2B P;  2JN0 A;  4CRI A;  1E7O A;  2YHT A;  3FJP A;  5D6X A;  4C92 F;  1TUC A;  2IIM A;  2EGE A;  2FRW A;  3V8L A;  1O75 A;  1OZ2 A;  4R0K A;  1BCM A;  2LZ6 B;  1H64 1;  2XHC A;  2P4T A;  1KC8 C;  2E3I A;  3OBW A;  3HFO A;  1QP3 A;  1WFW A;  1QVF S;  1QKW A;  1IO6 A;  1W6X A;  3OYC A;  4GY5 A;  2E64 A;  3OB9 A;  3CC4 T;  4A54 A;  3G4S Q;  1I81 A;  3C94 A;  4J6Y A;  2DKG A;  3CD6 T;  1WZO A;  2PVO B;  1ABO A;  3RUX A;  1ZBX A;  5HK0 A;  2DO3 A;  1VQO T;  2LJ0 A;  1IHV A;  5I2M A;  1VQ8 Q;  1K0S A;  1YHQ Q;  4EIK A;  4C8Q A;  1XQH A;  2MCN A;  2MWP A;  4Z8A A;  2RO0 A;  1A0N B;  1GFD A;  1CKB A;  4AG2 C;  1K1Z A;  4BY6 B;  2VB6 A;  1UTI A;  1EX4 A;  1QCO A;  2LCL A;  1QVF P;  3X24 B;  2KNB B;  3EHR A;  4OMO A;  3V8J A;  1JBM A;  2QQB A;  1HXD A;  4B6M A;  3GBQ A;  3G1J A;  3VUZ A;  2D6F A;  3OS2 A;  4BUG A;  1K9M R;  2DD4 A;  3VS4 A;  3PE0 A;  4PFO A;  4A63 B;  4OF1 A;  3QJY A;  4OB0 B;  1VQ6 Q;  5GAN 6;  2NWM A;  3EFR A;  3SEM A;  4OB2 B;  4E47 A;  1HSQ A;  2ZPB B;  4PJL A;  2I2L A;  2PVD B;  2YWW A;  1M2O A;  4OGC A;  1KHI A;  2W0Z A;  3A8M B;  2HEQ A;  1WQW A;  2ESW A;  5CKE A;  5A0G A;  4OP0 A;  4J83 A;  3NFC A;  2BKD N;  1JB0 E;  1X2K A;  1PKT A;  2LC4 A;  1D1B A;  1UEB A;  5GMK m;  4CC7 A;  4FYW B;  2DER A;  4J9B A;  2SRC A;  3EH1 A;  3QHS A;  3CCS Q;  5GAN f;  1YJW A;  1AZG B;  1G3S A;  3CCR A;  2MF2 A;  3OA6 A;  2ZPI B;  2YRD A;  4L5G A;  1YIT T;  1U1S A;  2JTF A;  1VQ7 A;  2F2X A;  1JO8 A;  3L2Q A;  3AT1 B;  2RA2 A;  2EPD A;  5LL6 S;  4HVV A;  1ZSZ C;  1C0M A;  2X4W A;  1V76 A;  2L8D A;  4FSX A;  2HZY A;  3I35 A;  2GTJ A;  2KI7 A;  2IG0 A;  3NMZ C;  1K8A U;  1YIJ T;  5DY9 A;  1UDL A;  1PD1 A;  3GIB A;  4OMF B;  2RJF A;  4LDU A;  4PFP A;  1OV3 A;  4CC4 B;  2RHX A;  1VQ4 Q;  4BE0 A;  2CP3 A;  1VQK T;  2GTO A;  1GCP A;  2O4X B;  2XMF A;  3EG9 B;  4DEX A;  4J8O A;  4MMK A;  3UDC A;  1YWP A;  1MV0 B;  1PG5 B;  3QYH B;  3M0Q A; 
#chains in the Genus database with same CATH homology
 1VYT A;  1BB9 A;  2G6F X;  1HJD A;  3H0H A;  4X1V A;  2A28 A;  1AWX A;  4Y92 A;  1SHG A;  1BK2 A;  1H8K A;  4LN2 A;  1PKS A;  2KEA A;  5FWC A;  2ROL A;  2QDL A;  2X3W D;  2EYX A;  2DNU A;  3H0F A;  3EHQ A;  2EGA A;  2EKH A;  4ZNX A;  1K9A A;  1SHF A;  3THK A;  2L2P A;  1AOJ A;  2L3Q A;  4JJC A;  1RLQ C;  1WX6 A;  4JZ3 A;  2CUB A;  1X27 A;  1UG1 A;  4HVW A;  1QWE A;  1NEG A;  4ORZ A;  4DEY A;  2E5K A;  3PVQ A;  2RPN A;  1X69 A;  1AWJ A;  2CH4 A;  4CC2 A;  3EG1 A;  2M0Y A;  4RTX A;  3C0C A;  1MUZ A;  2FO0 A;  1OOT A;  4J9H A;  4RUG A;  2KE9 A;  3M0T A;  3ZL7 C;  1U3O A;  1FYN A;  2B86 A;  2A08 A;  1ZBJ A;  1X6B A;  5GJV B;  4HCK A;  4IIO A;  4RTV A;  1NYF A;  2ECZ A;  4D8K A;  1UGV A;  3EGU A;  1CSK A;  2SEM A;  2JM9 A;  4HVU A;  5HCK A;  2JT4 A;  3H41 A;  1ABQ A;  4OMP A;  2CDT A;  2EVR A;  1H92 A;  2PNI A;  2KRN A;  2GBQ A;  4AG1 C;  1NEB A;  2JW4 A;  4J9I A;  1GRI A;  2KT8 A;  1TUD A;  1X6G A;  1UE9 A;  1YWO A;  2HCK A;  1AWW A;  2YT6 A;  1E6G A;  3UA6 A;  1Z9Q A;  2BZX A;  1ZSG A;  2LMJ A;  2YUQ A;  4JJD A;  1UEC A;  2J6K A;  2W10 A;  1UJY A;  2KXC A;  2V1R A;  1NG2 A;  2EYY A;  2EYZ A;  2J6F A;  2I0N A;  4JJB A;  2DYB A;  1RUW A;  1I1J A;  1WXT A;  2DL7 A;  3EG0 A;  4RTU A;  1JQQ A;  1WXU A;  1NLO C;  2A37 A;  2DIL A;  2VWF A;  1W1F A;  4HXJ A;  1AEY A;  1UJ0 A;  2NUZ A;  2YDL A;  2K7A A;  1M3A A;  2PTK A;  1ZLM A;  2L3P A;  1B3Q A;  2FPD A;  2OI3 A;  4AFS C;  2KXD A;  2LQN A;  2K79 A;  3M0S A;  1AVZ C;  1NM7 A;  4J9E A;  3TSW A;  2CH4 W;  3I9Q A;  1PRL C;  2AZS A;  2KYM A;  2LJ3 A;  1I0C A;  1M8M A;  2KBT A;  2DMO A;  2RQT A;  1YN8 A;  2V1Q A;  1WI7 A;  3I5R A;  4M4Z A;  1PHT A;  3SHW A;  2D0N A;  3FJ5 A;  4AFZ C;  3VS0 A;  1V1C A;  3PVL A;  3M0Q A;  2C0T A;  2JM8 A;  1B07 A;  1BU1 A;  3R6N A;  1FMK A;  1SRL A;  1GCQ A;  2HBW A;  1SSH A;  3NGP A;  2RQV A;  3KFV A;  5I11 A;  1QKX A;  3VS2 A;  4RTZ A;  2RQW A;  5FW9 A;  3VRY A;  1SRM A;  2ABL A;  2RF0 A;  1BBZ A;  3EG2 A;  2K2M A;  2YUO A;  2LQW A;  3ULR B;  4LE9 A;  1SPK A;  3VS7 A;  2KGT A;  1WLP B;  2DE0 X;  2KT1 A;  2J6O A;  1MV3 A;  4OMQ A;  2OJ2 A;  5EC7 A;  1K76 A;  2AK5 A;  3RBB B;  3REB B;  2DM1 A;  2J7I A;  2VVK A;  3EG3 A;  2DL3 A;  4J9G A;  4OMM A;  2O31 A;  1T0H A;  2KYB A;  2ROT A;  1JEG A;  4LUD A;  2JMC A;  1T3L A;  4RTW A;  1OPK A;  2J05 A;  2LJ1 A;  2MOX A;  1H3H A;  2LX7 A;  2O2O A;  5IHK A;  1I07 A;  2K3B A;  2KRM A;  1WYX A;  3VS1 A;  3I5S A;  2DLP A;  2DL5 A;  1GCQ C;  1ARK A;  1G83 A;  1K0X A;  2DA9 A;  1PNJ A;  2CT3 A;  1J3T A;  1M27 C;  4KRT A;  1AWO A;  1PWT A;  1UHC A;  2YUN A;  2RQU A;  4RTT A;  1GFC A;  1E6H A;  1T0J A;  1X2Q A;  3NHN A;  1QWF A;  3JV3 A;  1KSW A;  4F14 A;  3REA B;  1WA7 A;  4F17 A;  1S1N A;  2K9G A;  2RNA A;  2LP5 A;  2L0A A;  3NPF A;  2FG0 A;  5ECA A;  2BZY A;  2GQI A;  2RQR A;  3QWY A;  1OEB A;  1AZE A;  2JMA A;  2DL8 A;  2OAW A;  2PZ1 A;  1GL5 A;  1AD5 A;  1E7O A;  2LCS A;  2YSQ A;  1YNZ A;  1TUC A;  2FPF A;  2IIM A;  2O9S A;  2EGE A;  2FRW A;  5IXF A;  4AFQ C;  4OML A;  4R0K A;  2FPE A;  3TVT A;  2LZ6 B;  4IIM A;  1WDX A;  2DX1 A;  2CSQ A;  4CC3 A;  3A98 A;  1QLY A;  5IHN A;  1W70 A;  1XOV A;  4ESR A;  2EQI A;  2M51 A;  4JZ4 A;  2K6D A;  1K4U S;  4RTY A;  2JTE A;  2BTT A;  4OMN A;  1CKA A;  2AKK A;  1JU5 C;  2KR3 A;  2EW3 A;  1WFW A;  1QKW A;  2CSI A;  1IO6 A;  1W6X A;  1OPL A;  1Z9Z A;  2HDA A;  1HD3 A;  2HSP A;  2C0I A;  1M3C A;  1ABO A;  2DF6 A;  1UHF A;  1UUE A;  2DVJ A;  4J9F A;  1G2B A;  2RMO A;  2LJ0 A;  2CRE A;  1EFN A;  2KRO A;  1K0S A;  1ZX6 A;  4EIK A;  2MIO A;  4K11 A;  3U23 A;  2MCN A;  4Z8A A;  4GBQ A;  1A0N B;  1GFD A;  1CKB A;  4AG2 C;  1K1Z A;  1ZUU A;  1UTI A;  1WXB A;  3IQL A;  4J9D A;  1WIE A;  1Y0M A;  2J06 A;  2F2W A;  1M30 A;  2LNH B;  2RN8 A;  2C0O A;  2KNB B;  4FSS A;  3EHR A;  4OMO A;  2DJQ A;  1JXO A;  3GBQ A;  3CQT A;  1T3S A;  4Z89 A;  3VS4 A;  3PE0 A;  2EYW A;  4A63 B;  2FEI A;  2NWM A;  1QCF A;  1ZUK A;  4LNP A;  3SEM A;  2H8H A;  1HSQ A;  2L3S A;  4JPB W;  4QT7 A;  3VS6 A;  1KFZ A;  1N5Z A;  3VS3 A;  2AKL A;  5I22 A;  2W0Z A;  2HEQ A;  5L23 A;  1SEM A;  4J9C A;  2ESW A;  3M0P A;  3UAT A;  2EGC A;  3M0U A;  3UA7 A;  3RNJ A;  1X2K A;  3O5Z A;  2FRY A;  3UF4 A;  1PKT A;  1X43 A;  2D1X A;  2O88 A;  2CUD A;  1M3B A;  1UFF A;  1RLP C;  3M0R A;  1KIK A;  4CC7 A;  2JXB A;  4J9B A;  2SRC A;  2DBM A;  5IH2 A;  3H0I A;  5IHI A;  2ED1 A;  2P4R A;  3QWX X;  1NLP C;  1YP5 A;  2VKN A;  5GJW B;  1AZG B;  1KJW A;  2DRK A;  2YUP A;  2EBP A;  4WCI A;  2X3X D;  1TG0 A;  3VS5 A;  2AZV A;  2JS0 A;  2F2X A;  1JO8 A;  2JS2 A;  3LH5 A;  5IXB A;  1VA7 A;  4AFU C;  5FWB A;  2CT4 A;  2EPD A;  4HVV A;  1Y57 A;  2D8H A;  4E6R A;  4F16 A;  4Z88 A;  4D8D A;  2O9V A;  3I35 A;  2GTJ A;  1ZUY A;  1JXM A;  2BZ8 A;  1NYG A;  3NMZ C;  1YCS B;  1U5S A;  2ED0 A;  2GNC A;  1UDL A;  2A36 A;  2DBK A;  3TSZ A;  1VYV A;  4GLM A;  2KRS A;  1OV3 A;  1GBR A;  2GGR A;  4CC4 B;  1RI9 A;  2ENM A;  2F2V A;  2DL4 A;  1U06 A;  4LUE A;  1PRM C;  1LCK A;  2GTO A;  1GCP A;  1GBQ A;  2XMF A;  1VYU A;  4DEX A;  3VRZ A;  1YWP A;  1MV0 B;  2D8J A;  2DRM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...