1WI7A

Solution structure of the sh3 domain of sh3-domain kinase binding protein 1
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
68
structure length
68
Chain Sequence
b'GSSGSSGRRCQVAFSYLPQNDDELELKVGDIIEVVGEVEEGWWEGVLNGKTGMFPSNFIKELSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SH3-domain kinase binding protein 1
molecule tags Protein binding
source organism Mus musculus
publication title Solution structure of the SH3 domain of SH3-domain kinase binding protein 1
rcsb
total genus 7
structure length 68
sequence length 68
ec nomenclature
pdb deposition date 2004-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14604 SH3_9 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1wi7A00
2ED0A 2GBQA 1YNZA 1WLPB 2O31A 2JS0A 2YDLA 4JZ4A 1B3QA 4JJCA 2X3WD 1GCQA 2EYXA 5IXBA 2J6FA 4AG2C 1WX6A 1UECA 4J9EA 5FW9A 2DVJA 2KRSA 3CQTA 5HCKA 2IIMA 5IH2A 2DL5A 1AZEA 4F17A 1PWTA 2CUDA 2L3PA 3PE0A 2CDTA 1W6XA 2JT4A 1NYFA 1WXBA 2F2WA 4J9HA 3SHWA 3NPFA 1AWXA 1LCKA 3M0SA 1X2QA 2DNUA 1VYVA 2EQIA 1AZGB 2DL8A 1YWPA 2I0NA 2DE0X 2GNCA 3VS0A 4CC7A 3SEMA 2RQTA 2HBWA 1MV0B 5ECAA 2VWFA 3ZL7C 4A63B 2CSQA 4J9DA 1GCPA 4Z88A 2NWMA 1OV3A 1ZUUA 2C0OA 2D8HA 1UDLA 2EGEA 1V1CA 2CSIA 1AWWA 2BTTA 4ORZA 2KEAA 4AFSC 2OJ2A 2DX1A 4Y92A 1X27A 2LJ3A 2CT4A 5IXFA 4AG1C 2ROLA 3M0UA 2HCKA 3EG1A 2L2PA 3M0PA 5I22A 2PZ1A 3H0HA 4FSSA 1JU5C 1YP5A 2V1QA 2ENMA 2A08A 4J9BA 2DL3A 1GFCA 1BB9A 1YWOA 2LMJA 2YUOA 1M8MA 3FJ5A 5EC7A 1JO8A 2J06A 2F2XA 1IO6A 1Z9QA 1NM7A 2RQRA 2JTEA 1H8KA 1BK2A 2EPDA 1K0SA 2BZ8A 4M4ZA 2K2MA 3VS5A 2EYYA 2L3SA 1W1FA 4JJBA 2JM9A 2RQVA 1ABOA 1OOTA 1U5SA 4F16A 4LE9A 1M27C 2DRMA 5L23A 2EVRA 2M51A 4OMMA 2YSQA 3RBBB 4OMLA 1ZUKA 2FPFA 2NUZA 2K9GA 3THKA 1GFDA 2D8JA 1ZX6A 1U06A 2RPNA 2FG0A 2HSPA 2RMOA 4AFZC 2MIOA 4ZNXA 1FMKA 1M30A 5FWBA 5FWCA 4D8DA 1KJWA 3VS7A 1GRIA 1GCQC 1OPLA 4HVUA 3VS3A 4LNPA 4GLMA 3EG3A 5IHNA 4J9FA 4DEYA 2E5KA 3U23A 1ZSGA 2EGAA 1M3BA 1NEBA 2KNBB 2K79A 1HD3A 1T0JA 2KT1A 2AKLA 2L0AA 2MCNA 2V1RA 1S1NA 1UGVA 4IIMA 4WCIA 1UHFA 1JEGA 4JJDA 2D0NA 1E6GA 1JXOA 1UG1A 3H0FA 2KYBA 2GQIA 1QLYA 1SSHA 2LJ1A 2AZSA 1K0XA 2MOXA 1X6GA 1PHTA 1X43A 3VS1A 2CREA 1OPKA 2KXCA 1X6BA 4J9IA 1QWFA 3PVQA 2DBKA 3I35A 1PKTA 4ESRA 1QCFA 1Z9ZA 3EHQA 1RI9A 2GTJA 2F2VA 3M0QA 1HJDA 1SRMA 1T0HA 1K76A 4OMOA 1VYTA 4E6RA 1UHCA 1X2KA 2HDAA 1QKXA 2W10A 3I5RA 1SPKA 1M3CA 1XOVA 2KYMA 3EGUA 1M3AA 2YUNA 2DJQA 1AEYA 2VVKA 1GBRA 4CC3A 4Z89A 2DM1A 3A98A 2DRKA 2KE9A 5GJVB 5IHKA 3VS4A 2C0TA 1ABQA 4GBQA 2KBTA 2K7AA 2DLPA 1WXUA 1WI7A 2EYWA 2JS2A 3REAB 2LZ6B 2KROA 1TG0A 2M0YA 2H8HA 1FYNA 2A36A 2EBPA 1YCSB 2KGTA 1PRLC 1TUCA 2HEQA 4RTXA 3TSWA 3UA6A 1H3HA 3EHRA 2AKKA 4RTYA 2A28A 2J7IA 3TVTA 1WA7A 2AZVA 2VKNA 2DF6A 1X69A 2XMFA 5GJWB 3LH5A 2LNHB 2SEMA 1UTIA 2W0ZA 2PTKA 3R6NA 1E6HA 3I9QA 1I1JA 3REBB 1AD5A 2AK5A 3RNJA 1K4US 1EFNA 2DA9A 1WYXA 3UATA 1Y57A 3IQLA 1NYGA 1JXMA 1Y0MA 2DILA 1AVZC 1U3OA 4JPBW 1PNJA 1RLPC 4RTZA 2FPEA 3NGPA 4D8KA 1CKAA 4AFUC 2K3BA 2OI3A 2KR3A 3NMZC 2X3XD 1G83A 1NG2A 2C0IA 3TSZA 2LJ0A 4X1VA 4F14A 2FO0A 2KT8A 3UA7A 2JW4A 4KRTA 1T3SA 1GBQA 4RUGA 2J6KA 1UJ0A 1KFZA 1RUWA 3M0TA 2D1XA 1N5ZA 3GBQA 1NEGA 2ED1A 1G2BA 1RLQC 2O88A 1OEBA 4J9CA 2LQNA 1E7OA 1NLOC 4HCKA 4Z8AA 3ULRB 5IHIA 2DL4A 3H41A 2FRYA 1J3TA 2RN8A 1UJYA 2DYBA 1K1ZA 2GGRA 2JMAA 2SRCA 1SHFA 2JM8A 1WXTA 1JQQA 1UUEA 2KRNA 4J9GA 3VS6A 2L3QA 2K6DA 1ZUYA 4RTVA 1HSQA 1K9AA 2CH4W 2EW3A 2LP5A 2BZYA 1BU1A 2O9SA 3KFVA 4JZ3A 1AWJA 1PKSA 2EGCA 1W70A 1QWEA 1SHGA 2LX7A 2A37A 2ROTA 2RF0A 1B07A 2JMCA 2ABLA 1SRLA 1TUDA 2EYZA 1ZBJA 1GL5A 2FRWA 1AOJA 4DEXA 3VS2A 4OMPA 1QKWA 2O9VA 2J05A 1ZLMA 3M0RA 2QDLA 4HXJA 4R0KA 3EG0A 1H92A 2CUBA 4AFQC 2JXBA 3QWXX 1PRMC 1A0NB 2RNAA 1KIKA 2O2OA 4OMNA 2YUQA 1WFWA 2ESWA 4IIOA 1VA7A 1UFFA 4RTUA 4LN2A 2EKHA 5I11A 2FPDA 1AWOA 4CC4B 3JV3A 3C0CA 1MV3A 1T3LA 4HVWA 2ECZA 4RTWA 2G6FX 1CSKA 1CKBA 2YUPA 4RTTA 3VRYA 4CC2A 1I0CA 1ARKA 2CH4A 3H0IA 2RQWA 1NLPC 3UF4A 4QT7A 2KXDA 4LUEA 2YT6A 1UE9A 3QWYA 2P4RA 4LUDA 1YN8A 3EG2A 2PNIA 4K11A 2FEIA 2LCSA 3O5ZA 4OMQA 1WIEA 3I5SA 1WDXA 2B86A 2GTOA 3NHNA 2J6OA 1KSWA 2DBMA 2LQWA 2RQUA 2BZXA 3VRZA 1VYUA 2OAWA 2CT3A 1BBZA 2DL7A 2DMOA 4EIKA 2KRMA 3PVLA 1MUZA 1I07A 4HVVA 1SEMA
chains in the Genus database with same CATH superfamily
4FW2A 3CCJA 1PM3A 1YNZA 5GAN5 1VQNA 2JS0A 4M77E 3I55T 2JTMA 4J9EA 1YJ9T 2Z0WA 2ZPIB 4FCYA 3OYJA 4R56A 2CUDA 4LDXA 1W6XA 2LQKA 2LT1A 2F2WA 3RMQA 1WNLA 1LCKA 1IRXA 4E2FB 2QEXA 5FU7C 2DL8A 2DE0X 1OZ3A 2HBWA 1VQPA 3M4YA 3MCAB 5ECAA 4ZTFA 4J83A 2DTOA 4A4FA 1VQ4T 1OV3A 3CCST 2D8HA 2LT4A 1UDLA 3ZBDA 3JCMV 2BTTA 4DOVA 4KGZB 2K4YA 2OJ2A 3CXCS 1X27A 5DY9A 2HSEB 2L3RA 4EMKC 3PIPA 3OA6A 1M1KU 5FU6C 5LJ5f 1VQ5Q 1GXIE 3M0PA 3QSUA 4ZN1A 4KULA 4FSSA 1JU5C 1TSFA 4M7DG 3C12A 2WSEE 2V1QA 2ENMA 2I2LA 1Q7YC 1K73U 3TU4K 3V7RA 3BW1A 4J9BA 2DL3A 3M55A 4P5NA 1GFCA 3NTHA 1N8RU 3H8ZA 4ZGDB 3S3MA 2DXCA 5EC7A 1Q82C 1VQ8Q 3QZ5B 4B9WA 4EPCA 3CD6T 1I5OB 4M75G 5CIUA 3HTRA 4BI4A 2A0FB 3SDZA 5HK3A 3A8LB 1U5SA 4F16A 5L23A 2B8AA 2PVGB 4D6WA 1D3BB 2E10A 2YSQA 4WTOB 3RBBB 3A1PA 2K9GA 3WVEB 1VQ9T 4FYXB 2RJCA 1AHJB 2D8JA 1U06A 1H641 1VOMA 1B7TA 2RHXA 1N27A 3EG9A 1UB4A 1Y96B 1Q81R 3OYLA 2MIOA 3LX7A 3CCMA 4ZNXA 4C92B 5GMKl 5AT1B 1Q86U 3CCLA 4FIBA 2V8KA 2HZYA 4M78F 4HA8A 3RUXA 2DIQA 4E7KA 3CC7Q 1KJWA 4C8QC 3DLMA 1KHIA 4HVUA 4GLMA 5IHNA 3DB3A 3BDUA 3U23A 1WPYA 3HRSA 2EGAA 2RHIA 5KYYA 4E47A 1T0JA 2VGMA 1I4K1 1WHHA 2AKLA 1U8RA 3TEEA 3BE3A 1S1NA 4WCIA 2D0NA 5D7UA 4C0DC 3HKSA 5GMKj 1JXOA 2OTLQ 1NBEB 1Q95G 1SF9A 2RO0A 3QG1A 3CCUA 2DXTA 3MO8A 4PJOC 2RJEA 3JCMe 1X43A 5DLOA 1TTHB 2FZKB 1OPKA 3NFCA 4CI0C 4BY6B 1YIJA 1QWFA 1VQKQ 1PKTA 1YJWT 4OGCA 1KD1R 3L2VA 3EHQA 1RI9A 3CC2T 3CCQA 3JB9G 3X26B 4DOWA 1NZ9A 2MF2A 2RK1A 4E6RA 3M58A 3JB9H 1WHLA 2ZCFB 4OB0B 4E7LA 4MMLA 1OU9A 1TOVA 3CCUQ 5GAMj 4X9CA 3OSVA 1YFNA 5KYWB 5GMKh 1WJRA 1EZZB 1BYMA 2BE9B 4CC3A 4XTZA 1VQ8T 2KE9A 1NE8A 3ZFJA 5IHKA 1YHQT 1W2BP 2C0TA 2CYZB 4RCBA 2L89A 4BE2A 1ABQA 2F5KA 2GQVA 4ELZC 2C06A 1Q82U 1VIEA 2KROA 1MMGA 1K9MR 2M0YA 3DB4A 3FRNA 2A36A 1PRLC 3SFMA 1YJ9Q 1H3HA 1O75A 3OYCA 2DTIA 4M7AF 2J7IA 2CP7A 2O01E 3OYGA 3I56Q 5CO7A 1D1AA 3GNGA 3TVTA 5J3BA 2DF6A 4II1A 3JB9I 1M1KC 2EYQA 2QEXQ 2LNHB 2VXEA 2GF7A 3T9NA 3JCMW 1E6HA 5CKHA 2H3JA 3I9QA 3OS0A 1VQOA 2DFUA 3REBB 2DA9A 2K2VA 3EFRA 2RM4A 1OYXA 1TU0B 5LJ3d 4XTYA 2HBPA 2E65A 1AVZC 3OYIA 1RLPC 2FPEA 4XTVA 4AFUC 1YI2Q 2KR3A 3OS1A 2X3XD 3CMET 2JVVA 4FW1A 4F14A 3MP6A 2MI6A 1UJ0A 1WZOA 4A4KA 7AT1B 1X75C 4PJOE 2ED1A 4JS4A 1Y71A 3F70A 4Z02A 1MHNA 1XQHA 3ULRB 1BIBA 2DL4A 1YHQA 3J7AF 1HYOA 1FWZA 4BUGA 4C92C 5A0DA 5L8RE 1J3TA 2BKDN 2QK0A 2DYBA 1QVFS 5GANg 2XIDA 3QO3A 4A54A 2KI7A 1HSQA 2EW3A 1G3SA 2FZGB 1BU1A 1K8AU 1SHGA 4BI8B 3NTKA 4PFPA 1K8AR 1SRLA 4M7AA 1TUDA 1BCOA 2CZ7B 3CCQT 1YBYA 2K57A 2D9TA 2WACA 3VS2A 5GANe 5CQXA 4JRIA 1KD1U 1NJIR 4C5IA 3M0RA 2VGNA 4R0KA 1H92A 3QHSA 2RJDA 2COZA 1LOJA 2JXBA 4NOYA 3HP9A 1OX9A 4RG2A 4C92G 2YUQA 3CC7A 1VQ6Q 4PJOD 1NJIC 3CC2A 2XK0A 1VA7A 1UFFA 3G71A 5I11A 3C0CA 3CCMQ 2CP6A 1MV3A 4PJOB 1U1TA 1VUBA 4RTTA 1YITT 1QW1A 4C92E 4C0FA 5FRMA 4LXCA 3UF4A 4QT7A 1Y96A 2KXDA 2HMAA 3I56T 1D1CA 3QJYA 2MMPA 2O4XA 1K8AC 3EG2A 5CKDA 3KXTA 2OTJQ 2E3IA 1WIEA 3CPFA 1BI1A 1WDXA 1ACMB 4E7ZA 4F7UG 3ME9A 3CCMT 4KUDK 4XU1A 3A8MB 3Q1JA 3OSSC 3P8DA 2DL7A 2LDMA 4EIKA 5GANj 5GAN7 2FZCB 3FB9A 3THKA 4B9XA 3HL8A 1WLPB 1I8FA 4PJJA 4JZ4A 1GCQA 5IXBA 2J6FA 4ANJA 3HPWA 1VQNQ 3LLRA 1KQSS 3OYMA 1ZA1B 3HHTB 4E7JA 1G5VA 4DBRA 1AZEA 2EWNA 1PWTA 4Y28E 1WJQA 3GIBA 2E12A 3GP8A 2CDTA 2X4WA 1NYFA 3G6EQ 4J9HA 1AWXA 2R58A 3M0SA 1KC8U 8AT1B 3GOXA 1X2QA 2DNUA 1EX4A 4FM4B 1M1FA 1YWPA 4M77A 2I0NA 4J6XA 4CC7A 3SEMA 2RQTA 2QTVA 2ATCB 1MV0B 2MK5A 2AIRB 3HFOA 3ZL7C 4J9DA 4A63B 3OW2S 4C8QF 2M0OA 2XHCA 2OTLT 1D3BA 1IGQA 3MJXA 1WGSA 4Z88A 1V76A 3M57A 1QP3A 4DBFA 2EQKA 2KQWA 1AWWA 1SG5A 4ORZA 3QKJA 5GAOp 4Y92A 2M16A 2LJ3A 2CT4A 2X9HA 2VB6A 5IXFA 1WHJA 3M0UA 2HCKA 2FL7A 5I22A 3LYIA 1OX8A 5CQYA 5GAN6 1JB0E 4C8QD 2A08A 2ZAEA 2KAFA 4EMGA 1YI2A 1LNXA 2FB7A 1YWOA 2LMJA 1M8MA 3FJ5A 2QEXT 1JO8A 2WSFE 2J06A 2F2XA 1IO6A 1Z9QA 2RQRA 2O4XB 4MZTA 2JTEA 1VQ9Q 2EPDA 4EMKB 2NUTB 5KCOA 3OS2A 2L3SA 4XU0A 4DBHA 1ABOA 4BI3A 5KE2A 2AT1B 1OU8A 1WQWA 1M27C 4JRPA 4PJMA 2CKKA 3OY9A 3MEAA 2FPFA 2NUZA 3CCLT 3N5BB 4KH1B 4YTLA 2RPNA 1ZX6A 5GMKi 2K3YA 3I55A 1TS9A 2RMOA 3QUIA 2QQAA 4HCCA 1VQ9A 1M30A 3JCMf 2CP3A 5GAN2 1QVPA 2CZ6B 4J7IA 5FWCA 2JUFA 3TQ7P 4D8DA 1VQMQ 1GRIA 3M54A 1LVKA 4JLGA 3VS3A 4LNPA 3PIOA 1QQJA 3FEOA 3M4GA 2DEQA 3META 2E5KA 2IG0A 1RAAB 2QAZA 4FYWB 2KNBB 2K79A 2KT1A 5KE3A 2EQUA 2L0AA 5GAN8 1UGVA 5CK9A 2JJ9A 1UHFA 3MEUA 3G71Q 1E6GA 1UG1A 3QXEB 2KYBA 2P0QA 1XJWB 5GAN3 1QLYA 1K0XA 2MOXA 1VQMT 2YHTA 3E1SA 1UEBA 1PHTA 1JRIA 1VQLT 4M77F 4HCZA 1LPLA 2DBKA 5M9OA 1QCFA 2GTJA 2JZ2A 4M7AE 3QYHB 1SRMA 1OQKA 1VQ4A 1PSFA 1KC8R 4OF1A 1EIFA 1RAGB 2ZPHB 4O5VA 1S72A 1QKXA 1BI0A 4OB1B 4XTUA 3RMSA 2A3LA 4PFOA 5C6SA 5J39A 1RADB 1M3CA 1OULA 1M3AA 2DJQA 2EQMA 1M90U 1I81A 3ER0A 3EAEA 1Y7XA 2QQRA 2DRKA 1QMCA 3CCEA 3OBWA 3JB9D 2DLPA 2E6ZA 1WXUA 1PD1A 1PG5B 2X35A 4BY6C 1S72Q 4M7DF 4FT2A 2EFIA 2Y4XA 3REAB 1P92A 2LZ6B 3QJ6A 3EG9B 1TG0A 2EBPA 1TUCA 4JS5A 1QVFP 1VQNT 5LJ5g 1R0CB 3TSWA 3UA6A 3CCRQ 3CCJT 4OB3B 4ZTJA 2A28A 5GAMh 1SSFA 1WA7A 1X69A 3UDCA 2ZGWA 3EGXA 4FT4A 4M7AC 4CRIA 3I56A 3OMCA 2NYSA 2QI2A 4JUVA 1AD5A 2VYTA 5GAMf 1EFNA 1N9RA 3UATA 1KQ1A 1YITA 1WQ7A 1G3WA 3V7CA 2OTJT 2K5LA 3L2WA 1ZSZA 2KDSA 3RESA 4JPBW 1VQ5T 1PNJA 1NPRA 4RTZA 3NGPA 3OW2A 1CKAA 3NMZC 5KYNA 1WHGA 3HRTA 3D7SB 2ZPFB 4PFZA 5GAN4 5LJ3f 4X1VA 2KT8A 3UA7A 1T3SA 2XDPA 1X01A 2VUBA 1GBQA 4QVZA 3JCMX 1BKBA 4RUGA 1KFZA 2XU8A 1RUWA 4N0AA 3M0TA 4M7DC 1YITQ 3CMAA 5A0LA 4M7DE 1E7OA 1NLOC 4QQDA 4Z8AA 3H41A 2FRYA 4AMCA 1UJYA 4NS5A 2JMAA 4DA4A 3OYFA 5KYWA 4C92F 2YLBA 1ZUYA 2PU9B 2YLCA 4BE0A 1K9AA 4JZ3A 3KFVA 2EGCA 3WXMB 4L6V5 2ROTA 2JMCA 1C6VX 1VQ7A 2LQ8A 4IUPA 3VJPA 1GL5A 2KY9A 3HRUA 3I55Q 3MEVA 2E5QA 1QKWA 3SB2A 8ATCB 3C95A 5GAMd 2DTHA 4L59A 2CUBA 3MKDA 3OYBA 2XDDA 3SWNA 1WFWA 2ESWA 4LN2A 2EKHA 1IHVA 3J80E 2FPDA 2RB6A 4CC4B 4J7FA 4XTWA 2ECZA 2RJFA 1VQ6A 4RTWA 1YJNT 1HXDA 3G4ST 1VQ6T 2KK4A 4M7DB 2QGGA 2E1HA 1I0CA 1ARKA 6AT1B 2CH4A 3X20B 5KYYB 3EFOB 4TVRA 1IREB 1B34A 2ZPGB 1M2VA 1YN8A 4M77C 3CCQQ 3CCJQ 2M1HA 1WJSA 3EH2A 4PJOF 2QXFA 2PNIA 5A0GA 4K11A 2IPOB 5GAOq 2FEIA 2LCSA 3OYAA 1TWBA 4N4GA 1BI2A 1KHCA 2J6OA 5EG2A 2XDBA 2DBMA 2BZXA 1O9SA 1VYUA 2YRDA 2NUPB 2DXBA 2DMOA 1ZHIA 1MUZA 3SWNB 4HVVA 1B3QA 4JJCA 4BDZA 2EYXA 3HFNA 1RAHB 4AG2C 4HT8A 1WX6A 4PJLA 1D0ZA 2DVJA 3G1JA 1M90R 3S6WA 2KRSA 2E70A 3CQTA 5HCKA 2FHDA 4AT1B 4JJNK 4F17A 3A8GB 3JCMQ 4QVCA 2QG9B 3INZA 2EAYA 1VQOQ 2XICA 4DQ2A 3S3NA 1X6OA 3JCMJ 5FU7B 1WXBA 2XG8D 4A4HA 5GAOr 1VYVA 2EQIA 1AZGB 2GNCA 3VS0A 3CCRA 1YIJT 2E41A 1RACB 1GCPA 4C8QG 4XU3A 4N4HA 2NWMA 1ZUUA 1R8OB 2C0OA 2LC4A 4NL2A 3CCUT 4E7IA 2V8IA 2EGEA 4XAXB 3EFSA 1V1CA 1XNIA 4ZN3A 4QVDA 4LDYA 2CSIA 4JLIA 4M7AG 2KEAA 4AFSC 1PSEA 3CBPA 5LL6S 2DEUA 1YJNA 4KBMB 2ROLA 1Q86C 2L2PA 3CBMA 3JCMh 2QASA 1F1BB 3ZEHA 4BB7A 4C5GA 3UWNA 2HAXA 1YP5A 1MMDA 1HK9A 2COWA 3MP1A 4M77G 4J8OA 2F5TX 3G4SA 2K5IA 4M75C 1BB9A 4M78B 3JSCA 5HY6A 2YUOA 3EGXB 1NM7A 1Q81U 2DIGA 4UC4A 1H8KA 1BK2A 2BZ8A 2D6FA 2K2MA 3VS5A 4M78D 3CCET 2EYYA 4JRQA 4JJBA 1R77A 2JM9A 3VYHB 1OOTA 1OI1A 5GMKe 2DRMA 2EVRA 2M51A 2QA4T 4F7UF 3L2ZA 4HKEA 1GFDA 3CC2Q 1S72T 3PMIA 1G3TA 3JCMg 4AFZC 3CD6A 1FMKA 2PVDB 2OX7A 3A8OB 1KQ2A 2FYKA 4C8QB 3OBYA 5FWBA 4ELYC 2DPPB 3VS7A 2X4XA 2DD4A 1GCQC 1OPLA 4PKCC 5D6XA 3EG3A 2DYIA 1VQMA 2VXFA 3DLLA 5KYXB 4IURA 5HKCA 1ZQ1A 1M3BA 4C5HA 4M77D 1HD3A 1H3ZA 4A4EA 2YRVA 2V1RA 1JBMA 2R57A 2OTJA 5CKBA 5D6YA 2DO3A 2HNIA 4M77B 5KYUB 1RAIB 4J6WA 1SSHA 2LJ1A 2AZSA 3H6ZA 3S3OA 4RMOA 2Y4YA 4M75D 3CPWS 3VS1A 4V2SA 1X6BA 3CC4Q 2XKOC 3PMTA 3MHXA 3SWNC 1N9SA 4J9IA 5I2MA 3PVQA 5FU6B 3VUBA 4JRKA 4ESRA 1WHMA 5KH6A 1HJDA 1TXQA 2K3XA 1K76A 4OMOA 2NLUA 1UHCA 2RI3A 2RK2A 3P8BB 3LH0A 3QPHA 1G3YA 2HDAA 1PCXA 1VQ4Q 2E4HA 3C94A 3I5RA 3CC4A 3CCEQ 3JCMc 4JDSA 3EGUA 1YJ9A 2YUNA 1YIJQ 2VVKA 3G6EA 1GBRA 1M2VB 1VQKA 3BDLA 4Z89A 2DM1A 3A98A 2PUKB 2HL5C 5GJVB 2EQJA 2F69A 2ZPEB 2KBTA 1TUGB 2K7AA 5GAOn 1WI7A 3X25B 2EYWA 1QCOA 2RHUA 1MMAA 4PLIA 4Q5WA 1Q81C 2LNVA 3M56A 1YCSB 1ZBXA 2KGTA 2RI5A 5GANh 3O8VA 3OYEA 3M9QA 3FDRA 1N6AA 1QVGP 3M53A 2AZVA 2VKNA 3RKYA 4OB2B 3RIRA 3V8KA 3E9GA 5GJWB 1U1SA 3LH5A 1ZSZC 2L5QA 1Q86R 2W0ZA 2PTKA 3KBGA 3CEYA 2MWPA 4KT0E 1I1JA 4E7HA 1WYXA 2G3RA 1Y57A 3IQLA 1NYGA 1JXMA 3EGDA 3OYKA 3DKMA 5I2SA 3G7ZA 3PTAA 4D8KA 2FVUA 2DAQA 4M78C 1PD0A 1FMVA 1NG2A 1N8RR 2DZ9A 3QBYA 2LJ0A 4M7AB 2EJGA 2FO0A 3L2UA 2JW4A 1IB8A 2DXUA 2CP2A 1WHKA 2D1XA 4J6YA 4HT9A 3JB9J 2D0QB 3G4SQ 2O88A 1OEBA 1C0MA 4HCKA 1W4SA 5IHIA 2RN8A 4OMFB 3V8JA 1K1ZA 3G6ET 2SRCA 1W2BA 4IKFA 4BACA 1JQQA 1UUEA 5DM7R 4M7DD 2QQSA 3VS6A 2K6DA 4RTVA 3FLGA 3JB9F 3BY7A 3OQ5A 2HQXA 3TREA 1UGQB 3CCVT 5KYUA 1AWJA 1PKSA 3L1AA 1W70A 3CXCA 2RF0A 2OAUA 1B07A 4FSXA 2CS7A 2ABLA 1SKUB 5GAOl 1FX7A 1AOJA 5GANd 2O9VA 1Y07A 1Q7YU 2J05A 5GMKm 3RR6A 2QDLA 3EG0A 4QKUA 1YI2T 4AFQC 1MMNA 1PRMC 1A0NB 2RNAA 1YCYA 1D0XA 2HL3A 4ZGEB 1N8RC 4FL6A 1XTDA 1DJ7B 4WF2A 1UGRB 4FU6A 4KH0B 4PJNA 1T3LA 4GLKA 1M8VA 1CSKA 1CKBA 5CKEA 3JCMP 1JJ2S 3GF5A 3H0IA 2RQWA 2DK3A 3OW2P 2CP0A 2EKOA 4OVAA 4MDXA 2QQ9A 4A4GA 4IUTA 3OYNA 2DERA 2BE7D 4PL6A 4LUDA 4O6JA 2COYA 1UGPB 4F04B 1KC8C 3TCJA 4QW2A 3O5ZA 4OMQA 3I5SA 1W2BS 3NHNA 2B86A 2GTOA 3RKXA 2OTLA 4LD9K 3RKWA 4VUBA 2LQWA 2RQUA 3RDVA 2M02A 3VRZA 3GNFB 1BBZA 4PLLA 2HQHA 2KRMA 1KK7A 3PVLA 4M75F 1M9SA 4N4IA 2RD1A 2CGHA 2ED0A 4GY5A 2GBQA 2MWOA 2O31A 2YDLA 3QZ9B 3L2RA 4KGVB 5KCHA 3HSBA 2E3HA 2X3WD 4RCCA 4LDUA 1LJOA 4C5EA 5HK0A 1UECA 2AHJB 3E2UA 5FW9A 2KMTA 5D6WA 1PC0A 2H3EB 1MGQA 2QA4A 4OGEA 3JRZA 3AT1B 2IIMA 2QDYB 5IH2A 2DL5A 4M75E 2F1LA 2L3PA 3PE0A 1YJWQ 2XI9A 1VQKT 3BFMA 2JT4A 1RL2A 3PGGA 4PJOA 1VQPQ 3SHWA 3NPFA 3OB9A 3CMEA 2R5MA 3VUZA 1ZSZB 3CC4T 2VWFA 2CSQA 2MAMA 4C8QE 5FRNA 5CAIA 2CP5A 2JOYA 4R55A 3OYHA 2P84A 1B34B 4LD6A 2DX1A 3CMEQ 1KD1C 3LWHA 5LJ3j 4AG1C 3CCRT 3EG1A 2PZ1A 3H0HA 4PJOG 4C92D 3CC7T 4A53A 1NPPA 5LJ5e 3CMAQ 5LJ5d 2P0KA 4KUIA 2YRCA 1QCNA 2DD5A 2PQWA 4FYVB 3CPWA 3G71T 3QYGB 3AHUA 1I5LA 4NL3A 4MDWA 5J26A 1K0SA 3PT9A 4M4ZA 4QQGA 5AYFA 3E9FA 1W1FA 1VQ8A 1RAFB 4C0ZA 5LJ5h 2RQVA 1KQSP 4XU2A 4F7UB 4LE9A 3P8HA 4OMMA 4XK8E 4OMLA 1ZUKA 3SD4A 1VQ7Q 3CD6Q 2R5AA 4C0DB 4ZGJB 4M75B 1M1GA 2FG0A 2DJZA 2KVQG 2QYZA 3OMGA 2HSPA 2QTXA 3JCMb 1NJIU 5C0MA 1UGSB 3MP8A 3EGDB 4IUQA 1YHQQ 1VQLQ 2KSSA 2XD0A 3CCLQ 2WSCE 1BIAA 3LW5E 1M4ZA 3OYDA 2ZPBB 2L8DA 4J9FA 4DEYA 1OZ2A 2PUOB 1ZSGA 4L5GA 4B6MA 1NEBA 3LGFA 4Y91A 1IHWA 2A7YA 2MCNA 1D1BA 2X4JA 4IIMA 3CCSQ 1M1KR 2JN0A 4JJDA 4BE1A 2EJFA 1JEGA 4FYYB 3H0FA 1KQSA 4C0GA 4XTXA 2GQIA 4ME7A 2DVEA 5GAOm 1X6GA 2LVMA 2MYSA 2CREA 1K73R 4EDUA 2PVOB 2KXCA 4BD3A 1RABB 3QDRB 3GPLA 5CVIA 2LCCA 3L42A 3I35A 1VQOT 2LRQA 3CPWP 1Z9ZA 4X9DA 3VYGA 2F2VA 3M0QA 2DETA 4F7UE 1RAEB 1MNDA 1T0HA 3QDFA 1VQ7T 2Y90A 1VYTA 4DBQA 4M7DA 1X2KA 3EFOA 4QQ6A 2QGFB 1K9MU 3WVDB 1QP2A 2W10A 1M5Q1 4F7UA 4EMHA 4HCBA 1SPKA 1XOVA 2KYMA 3JCMd 1AEYA 2DKGA 2CZ1B 4PK4A 1FMWA 3M59A 4RG8A 3VS4A 2JNGA 3EH1A 4GBQA 3UPUA 3L2QA 3CMAT 4KGXB 2BUDA 2JS2A 4RKUE 3GLXA 3CXCP 2H8HA 1FYNA 3A5ZB 3QIIA 3UT1A 2QA4Q 2HEQA 4RTXA 1G8XA 2GCXA 2V26A 2E64A 3EHRA 5FLXE 2AKKA 4RTYA 9ATCB 3H9NA 1FXXA 2P0PA 4M78E 1IZ6A 2JTFA 2XMFA 2X4YA 2LX9A 2SEMA 1UTIA 1K9MC 3R6NA 1RI0A 2X51A 1C1AA 1TH7A 4IUVA 2K5FA 2GFUA 1MNEA 2RH2A 1YJNQ 1YJWA 3RERA 5IN1A 2AK5A 4M78A 2MPXC 3RNJA 3FC3A 1K4US 1VQ5A 2VV5A 3V7SA 1M90C 1M2OA 1D09B 5IAYA 2BIVA 1VQPT 1Y0MA 1D0YA 2DILA 2GFAA 3VU3C 1U3OA 5DLQE 2P4TA 5IT9E 4IUUA 5LJ3g 2RA2A 3PNWC 2K3BA 2OI3A 4ATOA 2EJ9A 4LDVA 1IXDA 1G83A 3TSZA 2C0IA 2IVWA 2E6NA 4J5YA 1JJ2A 4KRTA 4MZMA 2J6KA 2RHYA 1N5ZA 1ZA2B 3GBQA 5GAMg 4MZPA 1NEGA 1G2BA 1RLQC 4J9CA 1AT1B 2LQNA 3X28B 2ZZDA 1IGUA 1QVGA 3OYYA 5LJ3e 2LTOA 3NTIA 2HQEA 3CCVA 3MPUB 2GGRA 1SHFA 2JM8A 1WXTA 2KRNA 1BCMA 4J9GA 4E7SA 2L3QA 4XQ3A 1Q82R 2CH4W 2LP5A 2QQBA 2BZYA 2O9SA 2LX7A 1QWEA 2A37A 5CCAA 2VC8A 2YXYA 5LJ3h 3E19A 2EYZA 1R0BG 1QVFA 1ZBJA 2FRWA 3VV0A 4M7AD 2NUTA 4DEXA 3FIFA 3C4SA 3MEWA 2HKNA 3CCVQ 3OS5A 4OMPA 2DZCA 2RHZA 3R6OA 1ZLMA 3JAME 2YWWA 4HXJA 3KUFA 5LJ5j 5GAMe 3QWXX 2HD0A 1KIKA 1VQLA 2HKQB 2CZ0B 2O2OA 4OMNA 3X24B 1VIFA 4IIOA 2M9UA 5GANf 3M5AA 4RTUA 1AWOA 1K73C 2NUPA 3JV3A 4HVWA 2LCLA 2G6FX 5FROA 3V8LA 3CBOA 2YUPA 2RI2A 3VRYA 3PFSA 4CC2A 3A8HB 4M75A 2V8JA 5CR2A 1NLPC 5CKFA 2EIFA 1V29B 4LUEA 4M78G 4LDWA 2YT6A 5I21A 1UE9A 3QWYA 4OP0A 2P4RA 1QVGS 1BI3A 5KYXA 4X34A 1JJ2P 3LWIA 4BDYA 3LGLA 4MMKA 3ASKA 3CCSA 3J81E 3VKIA 2VASA 4C8QA 1KSWA 3URGA 4N0AC 4EMKA 4PNOA 2OAWA 1KG1A 2CT3A 3FJPA 1Q7YR 1I07A 5A2QE 1SEMA 4C92A
chains in the Genus database with same CATH topology
2ED0A 2GBQA 1YNZA 1WLPB 2O31A 2JS0A 2YDLA 4JZ4A 1B3QA 4JJCA 2X3WD 1GCQA 2EYXA 5IXBA 2J6FA 4AG2C 1WX6A 1UECA 4J9EA 5FW9A 2DVJA 2KRSA 3CQTA 5HCKA 2IIMA 5IH2A 2DL5A 1AZEA 4F17A 1PWTA 2CUDA 2L3PA 3PE0A 2CDTA 1W6XA 2JT4A 1NYFA 1WXBA 2F2WA 4J9HA 3SHWA 3NPFA 1AWXA 1LCKA 3M0SA 1X2QA 2DNUA 1VYVA 2EQIA 1AZGB 2DL8A 1YWPA 2I0NA 2DE0X 2GNCA 3VS0A 4CC7A 3SEMA 2RQTA 2HBWA 1MV0B 5ECAA 2VWFA 3ZL7C 4A63B 2CSQA 4J9DA 1GCPA 4Z88A 2NWMA 1OV3A 1ZUUA 2C0OA 2D8HA 1UDLA 2EGEA 1V1CA 2CSIA 1AWWA 2BTTA 4ORZA 2KEAA 4AFSC 2OJ2A 2DX1A 4Y92A 1X27A 2LJ3A 2CT4A 5IXFA 4AG1C 2ROLA 3M0UA 2HCKA 3EG1A 2L2PA 3M0PA 5I22A 2PZ1A 3H0HA 4FSSA 1JU5C 1YP5A 2V1QA 2ENMA 2A08A 4J9BA 2DL3A 1GFCA 1BB9A 1YWOA 2LMJA 2YUOA 1M8MA 3FJ5A 5EC7A 1JO8A 2J06A 2F2XA 1IO6A 1Z9QA 1NM7A 2RQRA 2JTEA 1H8KA 1BK2A 2EPDA 1K0SA 2BZ8A 4M4ZA 2K2MA 3VS5A 2EYYA 2L3SA 1W1FA 4JJBA 2JM9A 2RQVA 1ABOA 1OOTA 1U5SA 4F16A 4LE9A 1M27C 2DRMA 5L23A 2EVRA 2M51A 4OMMA 2YSQA 3RBBB 4OMLA 1ZUKA 2FPFA 2NUZA 2K9GA 3THKA 1GFDA 2D8JA 1ZX6A 1U06A 2RPNA 2FG0A 2HSPA 2RMOA 4AFZC 2MIOA 4ZNXA 1FMKA 1M30A 5FWBA 5FWCA 4D8DA 1KJWA 3VS7A 1GRIA 1GCQC 1OPLA 4HVUA 3VS3A 4LNPA 4GLMA 3EG3A 5IHNA 4J9FA 4DEYA 2E5KA 3U23A 1ZSGA 2EGAA 1M3BA 1NEBA 2KNBB 2K79A 1HD3A 1T0JA 2KT1A 2AKLA 2L0AA 2MCNA 2V1RA 1S1NA 1UGVA 4IIMA 4WCIA 1UHFA 1JEGA 4JJDA 2D0NA 1E6GA 1JXOA 1UG1A 3H0FA 2KYBA 2GQIA 1QLYA 1SSHA 2LJ1A 2AZSA 1K0XA 2MOXA 1X6GA 1PHTA 1X43A 3VS1A 2CREA 1OPKA 2KXCA 1X6BA 4J9IA 1QWFA 3PVQA 2DBKA 3I35A 1PKTA 4ESRA 1QCFA 1Z9ZA 3EHQA 1RI9A 2GTJA 2F2VA 3M0QA 1HJDA 1SRMA 1T0HA 1K76A 4OMOA 1VYTA 4E6RA 1UHCA 1X2KA 2HDAA 1QKXA 2W10A 3I5RA 1SPKA 1M3CA 1XOVA 2KYMA 3EGUA 1M3AA 2YUNA 2DJQA 1AEYA 2VVKA 1GBRA 4CC3A 4Z89A 2DM1A 3A98A 2DRKA 2KE9A 5GJVB 5IHKA 3VS4A 2C0TA 1ABQA 4GBQA 2KBTA 2K7AA 2DLPA 1WXUA 1WI7A 2EYWA 2JS2A 3REAB 2LZ6B 2KROA 1TG0A 2M0YA 2H8HA 1FYNA 2A36A 2EBPA 1YCSB 2KGTA 1PRLC 1TUCA 2HEQA 4RTXA 3TSWA 3UA6A 1H3HA 3EHRA 2AKKA 4RTYA 2A28A 2J7IA 3TVTA 1WA7A 2AZVA 2VKNA 2DF6A 1X69A 2XMFA 5GJWB 3LH5A 2LNHB 2SEMA 1UTIA 2W0ZA 2PTKA 3R6NA 1E6HA 3I9QA 1I1JA 3REBB 1AD5A 2AK5A 3RNJA 1K4US 1EFNA 2DA9A 1WYXA 3UATA 1Y57A 3IQLA 1NYGA 1JXMA 1Y0MA 2DILA 1AVZC 1U3OA 4JPBW 1PNJA 1RLPC 4RTZA 2FPEA 3NGPA 4D8KA 1CKAA 4AFUC 2K3BA 2OI3A 2KR3A 3NMZC 2X3XD 1G83A 1NG2A 2C0IA 3TSZA 2LJ0A 4X1VA 4F14A 2FO0A 2KT8A 3UA7A 2JW4A 4KRTA 1T3SA 1GBQA 4RUGA 2J6KA 1UJ0A 1KFZA 1RUWA 3M0TA 2D1XA 1N5ZA 3GBQA 1NEGA 2ED1A 1G2BA 1RLQC 2O88A 1OEBA 4J9CA 2LQNA 1E7OA 1NLOC 4HCKA 4Z8AA 3ULRB 5IHIA 2DL4A 3H41A 2FRYA 1J3TA 2RN8A 1UJYA 2DYBA 1K1ZA 2GGRA 2JMAA 2SRCA 1SHFA 2JM8A 1WXTA 1JQQA 1UUEA 2KRNA 4J9GA 3VS6A 2L3QA 2K6DA 1ZUYA 4RTVA 1HSQA 1K9AA 2CH4W 2EW3A 2LP5A 2BZYA 1BU1A 2O9SA 3KFVA 4JZ3A 1AWJA 1PKSA 2EGCA 1W70A 1QWEA 1SHGA 2LX7A 2A37A 2ROTA 2RF0A 1B07A 2JMCA 2ABLA 1SRLA 1TUDA 2EYZA 1ZBJA 1GL5A 2FRWA 1AOJA 4DEXA 3VS2A 4OMPA 1QKWA 2O9VA 2J05A 1ZLMA 3M0RA 2QDLA 4HXJA 4R0KA 3EG0A 1H92A 2CUBA 4AFQC 2JXBA 3QWXX 1PRMC 1A0NB 2RNAA 1KIKA 2O2OA 4OMNA 2YUQA 1WFWA 2ESWA 4IIOA 1VA7A 1UFFA 4RTUA 4LN2A 2EKHA 5I11A 2FPDA 1AWOA 4CC4B 3JV3A 3C0CA 1MV3A 1T3LA 4HVWA 2ECZA 4RTWA 2G6FX 1CSKA 1CKBA 2YUPA 4RTTA 3VRYA 4CC2A 1I0CA 1ARKA 2CH4A 3H0IA 2RQWA 1NLPC 3UF4A 4QT7A 2KXDA 4LUEA 2YT6A 1UE9A 3QWYA 2P4RA 4LUDA 1YN8A 3EG2A 2PNIA 4K11A 2FEIA 2LCSA 3O5ZA 4OMQA 1WIEA 3I5SA 1WDXA 2B86A 2GTOA 3NHNA 2J6OA 1KSWA 2DBMA 2LQWA 2RQUA 2BZXA 3VRZA 1VYUA 2OAWA 2CT3A 1BBZA 2DL7A 2DMOA 4EIKA 2KRMA 3PVLA 1MUZA 1I07A 4HVVA 1SEMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ED0 A;  2GBQ A;  1YNZ A;  1WLP B;  2O31 A;  2JS0 A;  2YDL A;  4JZ4 A;  1B3Q A;  4JJC A;  2X3W D;  1GCQ A;  2EYX A;  5IXB A;  2J6F A;  4AG2 C;  1WX6 A;  1UEC A;  4J9E A;  5FW9 A;  2DVJ A;  2KRS A;  3CQT A;  5HCK A;  2IIM A;  5IH2 A;  2DL5 A;  1AZE A;  4F17 A;  1PWT A;  2CUD A;  2L3P A;  3PE0 A;  2CDT A;  1W6X A;  2JT4 A;  1NYF A;  1WXB A;  2F2W A;  4J9H A;  3SHW A;  3NPF A;  1AWX A;  1LCK A;  3M0S A;  1X2Q A;  2DNU A;  1VYV A;  2EQI A;  1AZG B;  2DL8 A;  1YWP A;  2I0N A;  2DE0 X;  2GNC A;  3VS0 A;  4CC7 A;  3SEM A;  2RQT A;  2HBW A;  1MV0 B;  5ECA A;  2VWF A;  3ZL7 C;  4A63 B;  2CSQ A;  4J9D A;  1GCP A;  4Z88 A;  2NWM A;  1OV3 A;  1ZUU A;  2C0O A;  2D8H A;  1UDL A;  2EGE A;  1V1C A;  2CSI A;  1AWW A;  2BTT A;  4ORZ A;  2KEA A;  4AFS C;  2OJ2 A;  2DX1 A;  4Y92 A;  1X27 A;  2LJ3 A;  2CT4 A;  5IXF A;  4AG1 C;  2ROL A;  3M0U A;  2HCK A;  3EG1 A;  2L2P A;  3M0P A;  5I22 A;  2PZ1 A;  3H0H A;  4FSS A;  1JU5 C;  1YP5 A;  2V1Q A;  2ENM A;  2A08 A;  4J9B A;  2DL3 A;  1GFC A;  1BB9 A;  1YWO A;  2LMJ A;  2YUO A;  1M8M A;  3FJ5 A;  5EC7 A;  1JO8 A;  2J06 A;  2F2X A;  1IO6 A;  1Z9Q A;  1NM7 A;  2RQR A;  2JTE A;  1H8K A;  1BK2 A;  2EPD A;  1K0S A;  2BZ8 A;  4M4Z A;  2K2M A;  3VS5 A;  2EYY A;  2L3S A;  1W1F A;  4JJB A;  2JM9 A;  2RQV A;  1ABO A;  1OOT A;  1U5S A;  4F16 A;  4LE9 A;  1M27 C;  2DRM A;  5L23 A;  2EVR A;  2M51 A;  4OMM A;  2YSQ A;  3RBB B;  4OML A;  1ZUK A;  2FPF A;  2NUZ A;  2K9G A;  3THK A;  1GFD A;  2D8J A;  1ZX6 A;  1U06 A;  2RPN A;  2FG0 A;  2HSP A;  2RMO A;  4AFZ C;  2MIO A;  4ZNX A;  1FMK A;  1M30 A;  5FWB A;  5FWC A;  4D8D A;  1KJW A;  3VS7 A;  1GRI A;  1GCQ C;  1OPL A;  4HVU A;  3VS3 A;  4LNP A;  4GLM A;  3EG3 A;  5IHN A;  4J9F A;  4DEY A;  2E5K A;  3U23 A;  1ZSG A;  2EGA A;  1M3B A;  1NEB A;  2KNB B;  2K79 A;  1HD3 A;  1T0J A;  2KT1 A;  2AKL A;  2L0A A;  2MCN A;  2V1R A;  1S1N A;  1UGV A;  4IIM A;  4WCI A;  1UHF A;  1JEG A;  4JJD A;  2D0N A;  1E6G A;  1JXO A;  1UG1 A;  3H0F A;  2KYB A;  2GQI A;  1QLY A;  1SSH A;  2LJ1 A;  2AZS A;  1K0X A;  2MOX A;  1X6G A;  1PHT A;  1X43 A;  3VS1 A;  2CRE A;  1OPK A;  2KXC A;  1X6B A;  4J9I A;  1QWF A;  3PVQ A;  2DBK A;  3I35 A;  1PKT A;  4ESR A;  1QCF A;  1Z9Z A;  3EHQ A;  1RI9 A;  2GTJ A;  2F2V A;  3M0Q A;  1HJD A;  1SRM A;  1T0H A;  1K76 A;  4OMO A;  1VYT A;  4E6R A;  1UHC A;  1X2K A;  2HDA A;  1QKX A;  2W10 A;  3I5R A;  1SPK A;  1M3C A;  1XOV A;  2KYM A;  3EGU A;  1M3A A;  2YUN A;  2DJQ A;  1AEY A;  2VVK A;  1GBR A;  4CC3 A;  4Z89 A;  2DM1 A;  3A98 A;  2DRK A;  2KE9 A;  5GJV B;  5IHK A;  3VS4 A;  2C0T A;  1ABQ A;  4GBQ A;  2KBT A;  2K7A A;  2DLP A;  1WXU A;  1WI7 A;  2EYW A;  2JS2 A;  3REA B;  2LZ6 B;  2KRO A;  1TG0 A;  2M0Y A;  2H8H A;  1FYN A;  2A36 A;  2EBP A;  1YCS B;  2KGT A;  1PRL C;  1TUC A;  2HEQ A;  4RTX A;  3TSW A;  3UA6 A;  1H3H A;  3EHR A;  2AKK A;  4RTY A;  2A28 A;  2J7I A;  3TVT A;  1WA7 A;  2AZV A;  2VKN A;  2DF6 A;  1X69 A;  2XMF A;  5GJW B;  3LH5 A;  2LNH B;  2SEM A;  1UTI A;  2W0Z A;  2PTK A;  3R6N A;  1E6H A;  3I9Q A;  1I1J A;  3REB B;  1AD5 A;  2AK5 A;  3RNJ A;  1K4U S;  1EFN A;  2DA9 A;  1WYX A;  3UAT A;  1Y57 A;  3IQL A;  1NYG A;  1JXM A;  1Y0M A;  2DIL A;  1AVZ C;  1U3O A;  4JPB W;  1PNJ A;  1RLP C;  4RTZ A;  2FPE A;  3NGP A;  4D8K A;  1CKA A;  4AFU C;  2K3B A;  2OI3 A;  2KR3 A;  3NMZ C;  2X3X D;  1G83 A;  1NG2 A;  2C0I A;  3TSZ A;  2LJ0 A;  4X1V A;  4F14 A;  2FO0 A;  2KT8 A;  3UA7 A;  2JW4 A;  4KRT A;  1T3S A;  1GBQ A;  4RUG A;  2J6K A;  1UJ0 A;  1KFZ A;  1RUW A;  3M0T A;  2D1X A;  1N5Z A;  3GBQ A;  1NEG A;  2ED1 A;  1G2B A;  1RLQ C;  2O88 A;  1OEB A;  4J9C A;  2LQN A;  1E7O A;  1NLO C;  4HCK A;  4Z8A A;  3ULR B;  5IHI A;  2DL4 A;  3H41 A;  2FRY A;  1J3T A;  2RN8 A;  1UJY A;  2DYB A;  1K1Z A;  2GGR A;  2JMA A;  2SRC A;  1SHF A;  2JM8 A;  1WXT A;  1JQQ A;  1UUE A;  2KRN A;  4J9G A;  3VS6 A;  2L3Q A;  2K6D A;  1ZUY A;  4RTV A;  1HSQ A;  1K9A A;  2CH4 W;  2EW3 A;  2LP5 A;  2BZY A;  1BU1 A;  2O9S A;  3KFV A;  4JZ3 A;  1AWJ A;  1PKS A;  2EGC A;  1W70 A;  1QWE A;  1SHG A;  2LX7 A;  2A37 A;  2ROT A;  2RF0 A;  1B07 A;  2JMC A;  2ABL A;  1SRL A;  1TUD A;  2EYZ A;  1ZBJ A;  1GL5 A;  2FRW A;  1AOJ A;  4DEX A;  3VS2 A;  4OMP A;  1QKW A;  2O9V A;  2J05 A;  1ZLM A;  3M0R A;  2QDL A;  4HXJ A;  4R0K A;  3EG0 A;  1H92 A;  2CUB A;  4AFQ C;  2JXB A;  3QWX X;  1PRM C;  1A0N B;  2RNA A;  1KIK A;  2O2O A;  4OMN A;  2YUQ A;  1WFW A;  2ESW A;  4IIO A;  1VA7 A;  1UFF A;  4RTU A;  4LN2 A;  2EKH A;  5I11 A;  2FPD A;  1AWO A;  4CC4 B;  3JV3 A;  3C0C A;  1MV3 A;  1T3L A;  4HVW A;  2ECZ A;  4RTW A;  2G6F X;  1CSK A;  1CKB A;  2YUP A;  4RTT A;  3VRY A;  4CC2 A;  1I0C A;  1ARK A;  2CH4 A;  3H0I A;  2RQW A;  1NLP C;  3UF4 A;  4QT7 A;  2KXD A;  4LUE A;  2YT6 A;  1UE9 A;  3QWY A;  2P4R A;  4LUD A;  1YN8 A;  3EG2 A;  2PNI A;  4K11 A;  2FEI A;  2LCS A;  3O5Z A;  4OMQ A;  1WIE A;  3I5S A;  1WDX A;  2B86 A;  2GTO A;  3NHN A;  2J6O A;  1KSW A;  2DBM A;  2LQW A;  2RQU A;  2BZX A;  3VRZ A;  1VYU A;  2OAW A;  2CT3 A;  1BBZ A;  2DL7 A;  2DMO A;  4EIK A;  2KRM A;  3PVL A;  1MUZ A;  1I07 A;  4HVV A;  1SEM A; 
#chains in the Genus database with same CATH topology
 4FW2 A;  3CCJ A;  1PM3 A;  1YNZ A;  5GAN 5;  1VQN A;  2JS0 A;  4M77 E;  3I55 T;  2JTM A;  4J9E A;  1YJ9 T;  2Z0W A;  2ZPI B;  4FCY A;  3OYJ A;  4R56 A;  2CUD A;  4LDX A;  1W6X A;  2LQK A;  2LT1 A;  2F2W A;  3RMQ A;  1WNL A;  1LCK A;  1IRX A;  4E2F B;  2QEX A;  5FU7 C;  2DL8 A;  2DE0 X;  1OZ3 A;  2HBW A;  1VQP A;  3M4Y A;  3MCA B;  5ECA A;  4ZTF A;  4J83 A;  2DTO A;  4A4F A;  1VQ4 T;  1OV3 A;  3CCS T;  2D8H A;  2LT4 A;  1UDL A;  3ZBD A;  3JCM V;  2BTT A;  4DOV A;  4KGZ B;  2K4Y A;  2OJ2 A;  3CXC S;  1X27 A;  5DY9 A;  2HSE B;  2L3R A;  4EMK C;  3PIP A;  3OA6 A;  1M1K U;  5FU6 C;  5LJ5 f;  1VQ5 Q;  1GXI E;  3M0P A;  3QSU A;  4ZN1 A;  4KUL A;  4FSS A;  1JU5 C;  1TSF A;  4M7D G;  3C12 A;  2WSE E;  2V1Q A;  2ENM A;  2I2L A;  1Q7Y C;  1K73 U;  3TU4 K;  3V7R A;  3BW1 A;  4J9B A;  2DL3 A;  3M55 A;  4P5N A;  1GFC A;  3NTH A;  1N8R U;  3H8Z A;  4ZGD B;  3S3M A;  2DXC A;  5EC7 A;  1Q82 C;  1VQ8 Q;  3QZ5 B;  4B9W A;  4EPC A;  3CD6 T;  1I5O B;  4M75 G;  5CIU A;  3HTR A;  4BI4 A;  2A0F B;  3SDZ A;  5HK3 A;  3A8L B;  1U5S A;  4F16 A;  5L23 A;  2B8A A;  2PVG B;  4D6W A;  1D3B B;  2E10 A;  2YSQ A;  4WTO B;  3RBB B;  3A1P A;  2K9G A;  3WVE B;  1VQ9 T;  4FYX B;  2RJC A;  1AHJ B;  2D8J A;  1U06 A;  1H64 1;  1VOM A;  1B7T A;  2RHX A;  1N27 A;  3EG9 A;  1UB4 A;  1Y96 B;  1Q81 R;  3OYL A;  2MIO A;  3LX7 A;  3CCM A;  4ZNX A;  4C92 B;  5GMK l;  5AT1 B;  1Q86 U;  3CCL A;  4FIB A;  2V8K A;  2HZY A;  4M78 F;  4HA8 A;  3RUX A;  2DIQ A;  4E7K A;  3CC7 Q;  1KJW A;  4C8Q C;  3DLM A;  1KHI A;  4HVU A;  4GLM A;  5IHN A;  3DB3 A;  3BDU A;  3U23 A;  1WPY A;  3HRS A;  2EGA A;  2RHI A;  5KYY A;  4E47 A;  1T0J A;  2VGM A;  1I4K 1;  1WHH A;  2AKL A;  1U8R A;  3TEE A;  3BE3 A;  1S1N A;  4WCI A;  2D0N A;  5D7U A;  4C0D C;  3HKS A;  5GMK j;  1JXO A;  2OTL Q;  1NBE B;  1Q95 G;  1SF9 A;  2RO0 A;  3QG1 A;  3CCU A;  2DXT A;  3MO8 A;  4PJO C;  2RJE A;  3JCM e;  1X43 A;  5DLO A;  1TTH B;  2FZK B;  1OPK A;  3NFC A;  4CI0 C;  4BY6 B;  1YIJ A;  1QWF A;  1VQK Q;  1PKT A;  1YJW T;  4OGC A;  1KD1 R;  3L2V A;  3EHQ A;  1RI9 A;  3CC2 T;  3CCQ A;  3JB9 G;  3X26 B;  4DOW A;  1NZ9 A;  2MF2 A;  2RK1 A;  4E6R A;  3M58 A;  3JB9 H;  1WHL A;  2ZCF B;  4OB0 B;  4E7L A;  4MML A;  1OU9 A;  1TOV A;  3CCU Q;  5GAM j;  4X9C A;  3OSV A;  1YFN A;  5KYW B;  5GMK h;  1WJR A;  1EZZ B;  1BYM A;  2BE9 B;  4CC3 A;  4XTZ A;  1VQ8 T;  2KE9 A;  1NE8 A;  3ZFJ A;  5IHK A;  1YHQ T;  1W2B P;  2C0T A;  2CYZ B;  4RCB A;  2L89 A;  4BE2 A;  1ABQ A;  2F5K A;  2GQV A;  4ELZ C;  2C06 A;  1Q82 U;  1VIE A;  2KRO A;  1MMG A;  1K9M R;  2M0Y A;  3DB4 A;  3FRN A;  2A36 A;  1PRL C;  3SFM A;  1YJ9 Q;  1H3H A;  1O75 A;  3OYC A;  2DTI A;  4M7A F;  2J7I A;  2CP7 A;  2O01 E;  3OYG A;  3I56 Q;  5CO7 A;  1D1A A;  3GNG A;  3TVT A;  5J3B A;  2DF6 A;  4II1 A;  3JB9 I;  1M1K C;  2EYQ A;  2QEX Q;  2LNH B;  2VXE A;  2GF7 A;  3T9N A;  3JCM W;  1E6H A;  5CKH A;  2H3J A;  3I9Q A;  3OS0 A;  1VQO A;  2DFU A;  3REB B;  2DA9 A;  2K2V A;  3EFR A;  2RM4 A;  1OYX A;  1TU0 B;  5LJ3 d;  4XTY A;  2HBP A;  2E65 A;  1AVZ C;  3OYI A;  1RLP C;  2FPE A;  4XTV A;  4AFU C;  1YI2 Q;  2KR3 A;  3OS1 A;  2X3X D;  3CME T;  2JVV A;  4FW1 A;  4F14 A;  3MP6 A;  2MI6 A;  1UJ0 A;  1WZO A;  4A4K A;  7AT1 B;  1X75 C;  4PJO E;  2ED1 A;  4JS4 A;  1Y71 A;  3F70 A;  4Z02 A;  1MHN A;  1XQH A;  3ULR B;  1BIB A;  2DL4 A;  1YHQ A;  3J7A F;  1HYO A;  1FWZ A;  4BUG A;  4C92 C;  5A0D A;  5L8R E;  1J3T A;  2BKD N;  2QK0 A;  2DYB A;  1QVF S;  5GAN g;  2XID A;  3QO3 A;  4A54 A;  2KI7 A;  1HSQ A;  2EW3 A;  1G3S A;  2FZG B;  1BU1 A;  1K8A U;  1SHG A;  4BI8 B;  3NTK A;  4PFP A;  1K8A R;  1SRL A;  4M7A A;  1TUD A;  1BCO A;  2CZ7 B;  3CCQ T;  1YBY A;  2K57 A;  2D9T A;  2WAC A;  3VS2 A;  5GAN e;  5CQX A;  4JRI A;  1KD1 U;  1NJI R;  4C5I A;  3M0R A;  2VGN A;  4R0K A;  1H92 A;  3QHS A;  2RJD A;  2COZ A;  1LOJ A;  2JXB A;  4NOY A;  3HP9 A;  1OX9 A;  4RG2 A;  4C92 G;  2YUQ A;  3CC7 A;  1VQ6 Q;  4PJO D;  1NJI C;  3CC2 A;  2XK0 A;  1VA7 A;  1UFF A;  3G71 A;  5I11 A;  3C0C A;  3CCM Q;  2CP6 A;  1MV3 A;  4PJO B;  1U1T A;  1VUB A;  4RTT A;  1YIT T;  1QW1 A;  4C92 E;  4C0F A;  5FRM A;  4LXC A;  3UF4 A;  4QT7 A;  1Y96 A;  2KXD A;  2HMA A;  3I56 T;  1D1C A;  3QJY A;  2MMP A;  2O4X A;  1K8A C;  3EG2 A;  5CKD A;  3KXT A;  2OTJ Q;  2E3I A;  1WIE A;  3CPF A;  1BI1 A;  1WDX A;  1ACM B;  4E7Z A;  4F7U G;  3ME9 A;  3CCM T;  4KUD K;  4XU1 A;  3A8M B;  3Q1J A;  3OSS C;  3P8D A;  2DL7 A;  2LDM A;  4EIK A;  5GAN j;  5GAN 7;  2FZC B;  3FB9 A;  3THK A;  4B9X A;  3HL8 A;  1WLP B;  1I8F A;  4PJJ A;  4JZ4 A;  1GCQ A;  5IXB A;  2J6F A;  4ANJ A;  3HPW A;  1VQN Q;  3LLR A;  1KQS S;  3OYM A;  1ZA1 B;  3HHT B;  4E7J A;  1G5V A;  4DBR A;  1AZE A;  2EWN A;  1PWT A;  4Y28 E;  1WJQ A;  3GIB A;  2E12 A;  3GP8 A;  2CDT A;  2X4W A;  1NYF A;  3G6E Q;  4J9H A;  1AWX A;  2R58 A;  3M0S A;  1KC8 U;  8AT1 B;  3GOX A;  1X2Q A;  2DNU A;  1EX4 A;  4FM4 B;  1M1F A;  1YWP A;  4M77 A;  2I0N A;  4J6X A;  4CC7 A;  3SEM A;  2RQT A;  2QTV A;  2ATC B;  1MV0 B;  2MK5 A;  2AIR B;  3HFO A;  3ZL7 C;  4J9D A;  4A63 B;  3OW2 S;  4C8Q F;  2M0O A;  2XHC A;  2OTL T;  1D3B A;  1IGQ A;  3MJX A;  1WGS A;  4Z88 A;  1V76 A;  3M57 A;  1QP3 A;  4DBF A;  2EQK A;  2KQW A;  1AWW A;  1SG5 A;  4ORZ A;  3QKJ A;  5GAO p;  4Y92 A;  2M16 A;  2LJ3 A;  2CT4 A;  2X9H A;  2VB6 A;  5IXF A;  1WHJ A;  3M0U A;  2HCK A;  2FL7 A;  5I22 A;  3LYI A;  1OX8 A;  5CQY A;  5GAN 6;  1JB0 E;  4C8Q D;  2A08 A;  2ZAE A;  2KAF A;  4EMG A;  1YI2 A;  1LNX A;  2FB7 A;  1YWO A;  2LMJ A;  1M8M A;  3FJ5 A;  2QEX T;  1JO8 A;  2WSF E;  2J06 A;  2F2X A;  1IO6 A;  1Z9Q A;  2RQR A;  2O4X B;  4MZT A;  2JTE A;  1VQ9 Q;  2EPD A;  4EMK B;  2NUT B;  5KCO A;  3OS2 A;  2L3S A;  4XU0 A;  4DBH A;  1ABO A;  4BI3 A;  5KE2 A;  2AT1 B;  1OU8 A;  1WQW A;  1M27 C;  4JRP A;  4PJM A;  2CKK A;  3OY9 A;  3MEA A;  2FPF A;  2NUZ A;  3CCL T;  3N5B B;  4KH1 B;  4YTL A;  2RPN A;  1ZX6 A;  5GMK i;  2K3Y A;  3I55 A;  1TS9 A;  2RMO A;  3QUI A;  2QQA A;  4HCC A;  1VQ9 A;  1M30 A;  3JCM f;  2CP3 A;  5GAN 2;  1QVP A;  2CZ6 B;  4J7I A;  5FWC A;  2JUF A;  3TQ7 P;  4D8D A;  1VQM Q;  1GRI A;  3M54 A;  1LVK A;  4JLG A;  3VS3 A;  4LNP A;  3PIO A;  1QQJ A;  3FEO A;  3M4G A;  2DEQ A;  3MET A;  2E5K A;  2IG0 A;  1RAA B;  2QAZ A;  4FYW B;  2KNB B;  2K79 A;  2KT1 A;  5KE3 A;  2EQU A;  2L0A A;  5GAN 8;  1UGV A;  5CK9 A;  2JJ9 A;  1UHF A;  3MEU A;  3G71 Q;  1E6G A;  1UG1 A;  3QXE B;  2KYB A;  2P0Q A;  1XJW B;  5GAN 3;  1QLY A;  1K0X A;  2MOX A;  1VQM T;  2YHT A;  3E1S A;  1UEB A;  1PHT A;  1JRI A;  1VQL T;  4M77 F;  4HCZ A;  1LPL A;  2DBK A;  5M9O A;  1QCF A;  2GTJ A;  2JZ2 A;  4M7A E;  3QYH B;  1SRM A;  1OQK A;  1VQ4 A;  1PSF A;  1KC8 R;  4OF1 A;  1EIF A;  1RAG B;  2ZPH B;  4O5V A;  1S72 A;  1QKX A;  1BI0 A;  4OB1 B;  4XTU A;  3RMS A;  2A3L A;  4PFO A;  5C6S A;  5J39 A;  1RAD B;  1M3C A;  1OUL A;  1M3A A;  2DJQ A;  2EQM A;  1M90 U;  1I81 A;  3ER0 A;  3EAE A;  1Y7X A;  2QQR A;  2DRK A;  1QMC A;  3CCE A;  3OBW A;  3JB9 D;  2DLP A;  2E6Z A;  1WXU A;  1PD1 A;  1PG5 B;  2X35 A;  4BY6 C;  1S72 Q;  4M7D F;  4FT2 A;  2EFI A;  2Y4X A;  3REA B;  1P92 A;  2LZ6 B;  3QJ6 A;  3EG9 B;  1TG0 A;  2EBP A;  1TUC A;  4JS5 A;  1QVF P;  1VQN T;  5LJ5 g;  1R0C B;  3TSW A;  3UA6 A;  3CCR Q;  3CCJ T;  4OB3 B;  4ZTJ A;  2A28 A;  5GAM h;  1SSF A;  1WA7 A;  1X69 A;  3UDC A;  2ZGW A;  3EGX A;  4FT4 A;  4M7A C;  4CRI A;  3I56 A;  3OMC A;  2NYS A;  2QI2 A;  4JUV A;  1AD5 A;  2VYT A;  5GAM f;  1EFN A;  1N9R A;  3UAT A;  1KQ1 A;  1YIT A;  1WQ7 A;  1G3W A;  3V7C A;  2OTJ T;  2K5L A;  3L2W A;  1ZSZ A;  2KDS A;  3RES A;  4JPB W;  1VQ5 T;  1PNJ A;  1NPR A;  4RTZ A;  3NGP A;  3OW2 A;  1CKA A;  3NMZ C;  5KYN A;  1WHG A;  3HRT A;  3D7S B;  2ZPF B;  4PFZ A;  5GAN 4;  5LJ3 f;  4X1V A;  2KT8 A;  3UA7 A;  1T3S A;  2XDP A;  1X01 A;  2VUB A;  1GBQ A;  4QVZ A;  3JCM X;  1BKB A;  4RUG A;  1KFZ A;  2XU8 A;  1RUW A;  4N0A A;  3M0T A;  4M7D C;  1YIT Q;  3CMA A;  5A0L A;  4M7D E;  1E7O A;  1NLO C;  4QQD A;  4Z8A A;  3H41 A;  2FRY A;  4AMC A;  1UJY A;  4NS5 A;  2JMA A;  4DA4 A;  3OYF A;  5KYW A;  4C92 F;  2YLB A;  1ZUY A;  2PU9 B;  2YLC A;  4BE0 A;  1K9A A;  4JZ3 A;  3KFV A;  2EGC A;  3WXM B;  4L6V 5;  2ROT A;  2JMC A;  1C6V X;  1VQ7 A;  2LQ8 A;  4IUP A;  3VJP A;  1GL5 A;  2KY9 A;  3HRU A;  3I55 Q;  3MEV A;  2E5Q A;  1QKW A;  3SB2 A;  8ATC B;  3C95 A;  5GAM d;  2DTH A;  4L59 A;  2CUB A;  3MKD A;  3OYB A;  2XDD A;  3SWN A;  1WFW A;  2ESW A;  4LN2 A;  2EKH A;  1IHV A;  3J80 E;  2FPD A;  2RB6 A;  4CC4 B;  4J7F A;  4XTW A;  2ECZ A;  2RJF A;  1VQ6 A;  4RTW A;  1YJN T;  1HXD A;  3G4S T;  1VQ6 T;  2KK4 A;  4M7D B;  2QGG A;  2E1H A;  1I0C A;  1ARK A;  6AT1 B;  2CH4 A;  3X20 B;  5KYY B;  3EFO B;  4TVR A;  1IRE B;  1B34 A;  2ZPG B;  1M2V A;  1YN8 A;  4M77 C;  3CCQ Q;  3CCJ Q;  2M1H A;  1WJS A;  3EH2 A;  4PJO F;  2QXF A;  2PNI A;  5A0G A;  4K11 A;  2IPO B;  5GAO q;  2FEI A;  2LCS A;  3OYA A;  1TWB A;  4N4G A;  1BI2 A;  1KHC A;  2J6O A;  5EG2 A;  2XDB A;  2DBM A;  2BZX A;  1O9S A;  1VYU A;  2YRD A;  2NUP B;  2DXB A;  2DMO A;  1ZHI A;  1MUZ A;  3SWN B;  4HVV A;  1B3Q A;  4JJC A;  4BDZ A;  2EYX A;  3HFN A;  1RAH B;  4AG2 C;  4HT8 A;  1WX6 A;  4PJL A;  1D0Z A;  2DVJ A;  3G1J A;  1M90 R;  3S6W A;  2KRS A;  2E70 A;  3CQT A;  5HCK A;  2FHD A;  4AT1 B;  4JJN K;  4F17 A;  3A8G B;  3JCM Q;  4QVC A;  2QG9 B;  3INZ A;  2EAY A;  1VQO Q;  2XIC A;  4DQ2 A;  3S3N A;  1X6O A;  3JCM J;  5FU7 B;  1WXB A;  2XG8 D;  4A4H A;  5GAO r;  1VYV A;  2EQI A;  1AZG B;  2GNC A;  3VS0 A;  3CCR A;  1YIJ T;  2E41 A;  1RAC B;  1GCP A;  4C8Q G;  4XU3 A;  4N4H A;  2NWM A;  1ZUU A;  1R8O B;  2C0O A;  2LC4 A;  4NL2 A;  3CCU T;  4E7I A;  2V8I A;  2EGE A;  4XAX B;  3EFS A;  1V1C A;  1XNI A;  4ZN3 A;  4QVD A;  4LDY A;  2CSI A;  4JLI A;  4M7A G;  2KEA A;  4AFS C;  1PSE A;  3CBP A;  5LL6 S;  2DEU A;  1YJN A;  4KBM B;  2ROL A;  1Q86 C;  2L2P A;  3CBM A;  3JCM h;  2QAS A;  1F1B B;  3ZEH A;  4BB7 A;  4C5G A;  3UWN A;  2HAX A;  1YP5 A;  1MMD A;  1HK9 A;  2COW A;  3MP1 A;  4M77 G;  4J8O A;  2F5T X;  3G4S A;  2K5I A;  4M75 C;  1BB9 A;  4M78 B;  3JSC A;  5HY6 A;  2YUO A;  3EGX B;  1NM7 A;  1Q81 U;  2DIG A;  4UC4 A;  1H8K A;  1BK2 A;  2BZ8 A;  2D6F A;  2K2M A;  3VS5 A;  4M78 D;  3CCE T;  2EYY A;  4JRQ A;  4JJB A;  1R77 A;  2JM9 A;  3VYH B;  1OOT A;  1OI1 A;  5GMK e;  2DRM A;  2EVR A;  2M51 A;  2QA4 T;  4F7U F;  3L2Z A;  4HKE A;  1GFD A;  3CC2 Q;  1S72 T;  3PMI A;  1G3T A;  3JCM g;  4AFZ C;  3CD6 A;  1FMK A;  2PVD B;  2OX7 A;  3A8O B;  1KQ2 A;  2FYK A;  4C8Q B;  3OBY A;  5FWB A;  4ELY C;  2DPP B;  3VS7 A;  2X4X A;  2DD4 A;  1GCQ C;  1OPL A;  4PKC C;  5D6X A;  3EG3 A;  2DYI A;  1VQM A;  2VXF A;  3DLL A;  5KYX B;  4IUR A;  5HKC A;  1ZQ1 A;  1M3B A;  4C5H A;  4M77 D;  1HD3 A;  1H3Z A;  4A4E A;  2YRV A;  2V1R A;  1JBM A;  2R57 A;  2OTJ A;  5CKB A;  5D6Y A;  2DO3 A;  2HNI A;  4M77 B;  5KYU B;  1RAI B;  4J6W A;  1SSH A;  2LJ1 A;  2AZS A;  3H6Z A;  3S3O A;  4RMO A;  2Y4Y A;  4M75 D;  3CPW S;  3VS1 A;  4V2S A;  1X6B A;  3CC4 Q;  2XKO C;  3PMT A;  3MHX A;  3SWN C;  1N9S A;  4J9I A;  5I2M A;  3PVQ A;  5FU6 B;  3VUB A;  4JRK A;  4ESR A;  1WHM A;  5KH6 A;  1HJD A;  1TXQ A;  2K3X A;  1K76 A;  4OMO A;  2NLU A;  1UHC A;  2RI3 A;  2RK2 A;  3P8B B;  3LH0 A;  3QPH A;  1G3Y A;  2HDA A;  1PCX A;  1VQ4 Q;  2E4H A;  3C94 A;  3I5R A;  3CC4 A;  3CCE Q;  3JCM c;  4JDS A;  3EGU A;  1YJ9 A;  2YUN A;  1YIJ Q;  2VVK A;  3G6E A;  1GBR A;  1M2V B;  1VQK A;  3BDL A;  4Z89 A;  2DM1 A;  3A98 A;  2PUK B;  2HL5 C;  5GJV B;  2EQJ A;  2F69 A;  2ZPE B;  2KBT A;  1TUG B;  2K7A A;  5GAO n;  1WI7 A;  3X25 B;  2EYW A;  1QCO A;  2RHU A;  1MMA A;  4PLI A;  4Q5W A;  1Q81 C;  2LNV A;  3M56 A;  1YCS B;  1ZBX A;  2KGT A;  2RI5 A;  5GAN h;  3O8V A;  3OYE A;  3M9Q A;  3FDR A;  1N6A A;  1QVG P;  3M53 A;  2AZV A;  2VKN A;  3RKY A;  4OB2 B;  3RIR A;  3V8K A;  3E9G A;  5GJW B;  1U1S A;  3LH5 A;  1ZSZ C;  2L5Q A;  1Q86 R;  2W0Z A;  2PTK A;  3KBG A;  3CEY A;  2MWP A;  4KT0 E;  1I1J A;  4E7H A;  1WYX A;  2G3R A;  1Y57 A;  3IQL A;  1NYG A;  1JXM A;  3EGD A;  3OYK A;  3DKM A;  5I2S A;  3G7Z A;  3PTA A;  4D8K A;  2FVU A;  2DAQ A;  4M78 C;  1PD0 A;  1FMV A;  1NG2 A;  1N8R R;  2DZ9 A;  3QBY A;  2LJ0 A;  4M7A B;  2EJG A;  2FO0 A;  3L2U A;  2JW4 A;  1IB8 A;  2DXU A;  2CP2 A;  1WHK A;  2D1X A;  4J6Y A;  4HT9 A;  3JB9 J;  2D0Q B;  3G4S Q;  2O88 A;  1OEB A;  1C0M A;  4HCK A;  1W4S A;  5IHI A;  2RN8 A;  4OMF B;  3V8J A;  1K1Z A;  3G6E T;  2SRC A;  1W2B A;  4IKF A;  4BAC A;  1JQQ A;  1UUE A;  5DM7 R;  4M7D D;  2QQS A;  3VS6 A;  2K6D A;  4RTV A;  3FLG A;  3JB9 F;  3BY7 A;  3OQ5 A;  2HQX A;  3TRE A;  1UGQ B;  3CCV T;  5KYU A;  1AWJ A;  1PKS A;  3L1A A;  1W70 A;  3CXC A;  2RF0 A;  2OAU A;  1B07 A;  4FSX A;  2CS7 A;  2ABL A;  1SKU B;  5GAO l;  1FX7 A;  1AOJ A;  5GAN d;  2O9V A;  1Y07 A;  1Q7Y U;  2J05 A;  5GMK m;  3RR6 A;  2QDL A;  3EG0 A;  4QKU A;  1YI2 T;  4AFQ C;  1MMN A;  1PRM C;  1A0N B;  2RNA A;  1YCY A;  1D0X A;  2HL3 A;  4ZGE B;  1N8R C;  4FL6 A;  1XTD A;  1DJ7 B;  4WF2 A;  1UGR B;  4FU6 A;  4KH0 B;  4PJN A;  1T3L A;  4GLK A;  1M8V A;  1CSK A;  1CKB A;  5CKE A;  3JCM P;  1JJ2 S;  3GF5 A;  3H0I A;  2RQW A;  2DK3 A;  3OW2 P;  2CP0 A;  2EKO A;  4OVA A;  4MDX A;  2QQ9 A;  4A4G A;  4IUT A;  3OYN A;  2DER A;  2BE7 D;  4PL6 A;  4LUD A;  4O6J A;  2COY A;  1UGP B;  4F04 B;  1KC8 C;  3TCJ A;  4QW2 A;  3O5Z A;  4OMQ A;  3I5S A;  1W2B S;  3NHN A;  2B86 A;  2GTO A;  3RKX A;  2OTL A;  4LD9 K;  3RKW A;  4VUB A;  2LQW A;  2RQU A;  3RDV A;  2M02 A;  3VRZ A;  3GNF B;  1BBZ A;  4PLL A;  2HQH A;  2KRM A;  1KK7 A;  3PVL A;  4M75 F;  1M9S A;  4N4I A;  2RD1 A;  2CGH A;  2ED0 A;  4GY5 A;  2GBQ A;  2MWO A;  2O31 A;  2YDL A;  3QZ9 B;  3L2R A;  4KGV B;  5KCH A;  3HSB A;  2E3H A;  2X3W D;  4RCC A;  4LDU A;  1LJO A;  4C5E A;  5HK0 A;  1UEC A;  2AHJ B;  3E2U A;  5FW9 A;  2KMT A;  5D6W A;  1PC0 A;  2H3E B;  1MGQ A;  2QA4 A;  4OGE A;  3JRZ A;  3AT1 B;  2IIM A;  2QDY B;  5IH2 A;  2DL5 A;  4M75 E;  2F1L A;  2L3P A;  3PE0 A;  1YJW Q;  2XI9 A;  1VQK T;  3BFM A;  2JT4 A;  1RL2 A;  3PGG A;  4PJO A;  1VQP Q;  3SHW A;  3NPF A;  3OB9 A;  3CME A;  2R5M A;  3VUZ A;  1ZSZ B;  3CC4 T;  2VWF A;  2CSQ A;  2MAM A;  4C8Q E;  5FRN A;  5CAI A;  2CP5 A;  2JOY A;  4R55 A;  3OYH A;  2P84 A;  1B34 B;  4LD6 A;  2DX1 A;  3CME Q;  1KD1 C;  3LWH A;  5LJ3 j;  4AG1 C;  3CCR T;  3EG1 A;  2PZ1 A;  3H0H A;  4PJO G;  4C92 D;  3CC7 T;  4A53 A;  1NPP A;  5LJ5 e;  3CMA Q;  5LJ5 d;  2P0K A;  4KUI A;  2YRC A;  1QCN A;  2DD5 A;  2PQW A;  4FYV B;  3CPW A;  3G71 T;  3QYG B;  3AHU A;  1I5L A;  4NL3 A;  4MDW A;  5J26 A;  1K0S A;  3PT9 A;  4M4Z A;  4QQG A;  5AYF A;  3E9F A;  1W1F A;  1VQ8 A;  1RAF B;  4C0Z A;  5LJ5 h;  2RQV A;  1KQS P;  4XU2 A;  4F7U B;  4LE9 A;  3P8H A;  4OMM A;  4XK8 E;  4OML A;  1ZUK A;  3SD4 A;  1VQ7 Q;  3CD6 Q;  2R5A A;  4C0D B;  4ZGJ B;  4M75 B;  1M1G A;  2FG0 A;  2DJZ A;  2KVQ G;  2QYZ A;  3OMG A;  2HSP A;  2QTX A;  3JCM b;  1NJI U;  5C0M A;  1UGS B;  3MP8 A;  3EGD B;  4IUQ A;  1YHQ Q;  1VQL Q;  2KSS A;  2XD0 A;  3CCL Q;  2WSC E;  1BIA A;  3LW5 E;  1M4Z A;  3OYD A;  2ZPB B;  2L8D A;  4J9F A;  4DEY A;  1OZ2 A;  2PUO B;  1ZSG A;  4L5G A;  4B6M A;  1NEB A;  3LGF A;  4Y91 A;  1IHW A;  2A7Y A;  2MCN A;  1D1B A;  2X4J A;  4IIM A;  3CCS Q;  1M1K R;  2JN0 A;  4JJD A;  4BE1 A;  2EJF A;  1JEG A;  4FYY B;  3H0F A;  1KQS A;  4C0G A;  4XTX A;  2GQI A;  4ME7 A;  2DVE A;  5GAO m;  1X6G A;  2LVM A;  2MYS A;  2CRE A;  1K73 R;  4EDU A;  2PVO B;  2KXC A;  4BD3 A;  1RAB B;  3QDR B;  3GPL A;  5CVI A;  2LCC A;  3L42 A;  3I35 A;  1VQO T;  2LRQ A;  3CPW P;  1Z9Z A;  4X9D A;  3VYG A;  2F2V A;  3M0Q A;  2DET A;  4F7U E;  1RAE B;  1MND A;  1T0H A;  3QDF A;  1VQ7 T;  2Y90 A;  1VYT A;  4DBQ A;  4M7D A;  1X2K A;  3EFO A;  4QQ6 A;  2QGF B;  1K9M U;  3WVD B;  1QP2 A;  2W10 A;  1M5Q 1;  4F7U A;  4EMH A;  4HCB A;  1SPK A;  1XOV A;  2KYM A;  3JCM d;  1AEY A;  2DKG A;  2CZ1 B;  4PK4 A;  1FMW A;  3M59 A;  4RG8 A;  3VS4 A;  2JNG A;  3EH1 A;  4GBQ A;  3UPU A;  3L2Q A;  3CMA T;  4KGX B;  2BUD A;  2JS2 A;  4RKU E;  3GLX A;  3CXC P;  2H8H A;  1FYN A;  3A5Z B;  3QII A;  3UT1 A;  2QA4 Q;  2HEQ A;  4RTX A;  1G8X A;  2GCX A;  2V26 A;  2E64 A;  3EHR A;  5FLX E;  2AKK A;  4RTY A;  9ATC B;  3H9N A;  1FXX A;  2P0P A;  4M78 E;  1IZ6 A;  2JTF A;  2XMF A;  2X4Y A;  2LX9 A;  2SEM A;  1UTI A;  1K9M C;  3R6N A;  1RI0 A;  2X51 A;  1C1A A;  1TH7 A;  4IUV A;  2K5F A;  2GFU A;  1MNE A;  2RH2 A;  1YJN Q;  1YJW A;  3RER A;  5IN1 A;  2AK5 A;  4M78 A;  2MPX C;  3RNJ A;  3FC3 A;  1K4U S;  1VQ5 A;  2VV5 A;  3V7S A;  1M90 C;  1M2O A;  1D09 B;  5IAY A;  2BIV A;  1VQP T;  1Y0M A;  1D0Y A;  2DIL A;  2GFA A;  3VU3 C;  1U3O A;  5DLQ E;  2P4T A;  5IT9 E;  4IUU A;  5LJ3 g;  2RA2 A;  3PNW C;  2K3B A;  2OI3 A;  4ATO A;  2EJ9 A;  4LDV A;  1IXD A;  1G83 A;  3TSZ A;  2C0I A;  2IVW A;  2E6N A;  4J5Y A;  1JJ2 A;  4KRT A;  4MZM A;  2J6K A;  2RHY A;  1N5Z A;  1ZA2 B;  3GBQ A;  5GAM g;  4MZP A;  1NEG A;  1G2B A;  1RLQ C;  4J9C A;  1AT1 B;  2LQN A;  3X28 B;  2ZZD A;  1IGU A;  1QVG A;  3OYY A;  5LJ3 e;  2LTO A;  3NTI A;  2HQE A;  3CCV A;  3MPU B;  2GGR A;  1SHF A;  2JM8 A;  1WXT A;  2KRN A;  1BCM A;  4J9G A;  4E7S A;  2L3Q A;  4XQ3 A;  1Q82 R;  2CH4 W;  2LP5 A;  2QQB A;  2BZY A;  2O9S A;  2LX7 A;  1QWE A;  2A37 A;  5CCA A;  2VC8 A;  2YXY A;  5LJ3 h;  3E19 A;  2EYZ A;  1R0B G;  1QVF A;  1ZBJ A;  2FRW A;  3VV0 A;  4M7A D;  2NUT A;  4DEX A;  3FIF A;  3C4S A;  3MEW A;  2HKN A;  3CCV Q;  3OS5 A;  4OMP A;  2DZC A;  2RHZ A;  3R6O A;  1ZLM A;  3JAM E;  2YWW A;  4HXJ A;  3KUF A;  5LJ5 j;  5GAM e;  3QWX X;  2HD0 A;  1KIK A;  1VQL A;  2HKQ B;  2CZ0 B;  2O2O A;  4OMN A;  3X24 B;  1VIF A;  4IIO A;  2M9U A;  5GAN f;  3M5A A;  4RTU A;  1AWO A;  1K73 C;  2NUP A;  3JV3 A;  4HVW A;  2LCL A;  2G6F X;  5FRO A;  3V8L A;  3CBO A;  2YUP A;  2RI2 A;  3VRY A;  3PFS A;  4CC2 A;  3A8H B;  4M75 A;  2V8J A;  5CR2 A;  1NLP C;  5CKF A;  2EIF A;  1V29 B;  4LUE A;  4M78 G;  4LDW A;  2YT6 A;  5I21 A;  1UE9 A;  3QWY A;  4OP0 A;  2P4R A;  1QVG S;  1BI3 A;  5KYX A;  4X34 A;  1JJ2 P;  3LWI A;  4BDY A;  3LGL A;  4MMK A;  3ASK A;  3CCS A;  3J81 E;  3VKI A;  2VAS A;  4C8Q A;  1KSW A;  3URG A;  4N0A C;  4EMK A;  4PNO A;  2OAW A;  1KG1 A;  2CT3 A;  3FJP A;  1Q7Y R;  1I07 A;  5A2Q E;  1SEM A;  4C92 A; 
#chains in the Genus database with same CATH homology
 2ED0 A;  2GBQ A;  1YNZ A;  1WLP B;  2O31 A;  2JS0 A;  2YDL A;  4JZ4 A;  1B3Q A;  4JJC A;  2X3W D;  1GCQ A;  2EYX A;  5IXB A;  2J6F A;  4AG2 C;  1WX6 A;  1UEC A;  4J9E A;  5FW9 A;  2DVJ A;  2KRS A;  3CQT A;  5HCK A;  2IIM A;  5IH2 A;  2DL5 A;  1AZE A;  4F17 A;  1PWT A;  2CUD A;  2L3P A;  3PE0 A;  2CDT A;  1W6X A;  2JT4 A;  1NYF A;  1WXB A;  2F2W A;  4J9H A;  3SHW A;  3NPF A;  1AWX A;  1LCK A;  3M0S A;  1X2Q A;  2DNU A;  1VYV A;  2EQI A;  1AZG B;  2DL8 A;  1YWP A;  2I0N A;  2DE0 X;  2GNC A;  3VS0 A;  4CC7 A;  3SEM A;  2RQT A;  2HBW A;  1MV0 B;  5ECA A;  2VWF A;  3ZL7 C;  4A63 B;  2CSQ A;  4J9D A;  1GCP A;  4Z88 A;  2NWM A;  1OV3 A;  1ZUU A;  2C0O A;  2D8H A;  1UDL A;  2EGE A;  1V1C A;  2CSI A;  1AWW A;  2BTT A;  4ORZ A;  2KEA A;  4AFS C;  2OJ2 A;  2DX1 A;  4Y92 A;  1X27 A;  2LJ3 A;  2CT4 A;  5IXF A;  4AG1 C;  2ROL A;  3M0U A;  2HCK A;  3EG1 A;  2L2P A;  3M0P A;  5I22 A;  2PZ1 A;  3H0H A;  4FSS A;  1JU5 C;  1YP5 A;  2V1Q A;  2ENM A;  2A08 A;  4J9B A;  2DL3 A;  1GFC A;  1BB9 A;  1YWO A;  2LMJ A;  2YUO A;  1M8M A;  3FJ5 A;  5EC7 A;  1JO8 A;  2J06 A;  2F2X A;  1IO6 A;  1Z9Q A;  1NM7 A;  2RQR A;  2JTE A;  1H8K A;  1BK2 A;  2EPD A;  1K0S A;  2BZ8 A;  4M4Z A;  2K2M A;  3VS5 A;  2EYY A;  2L3S A;  1W1F A;  4JJB A;  2JM9 A;  2RQV A;  1ABO A;  1OOT A;  1U5S A;  4F16 A;  4LE9 A;  1M27 C;  2DRM A;  5L23 A;  2EVR A;  2M51 A;  4OMM A;  2YSQ A;  3RBB B;  4OML A;  1ZUK A;  2FPF A;  2NUZ A;  2K9G A;  3THK A;  1GFD A;  2D8J A;  1ZX6 A;  1U06 A;  2RPN A;  2FG0 A;  2HSP A;  2RMO A;  4AFZ C;  2MIO A;  4ZNX A;  1FMK A;  1M30 A;  5FWB A;  5FWC A;  4D8D A;  1KJW A;  3VS7 A;  1GRI A;  1GCQ C;  1OPL A;  4HVU A;  3VS3 A;  4LNP A;  4GLM A;  3EG3 A;  5IHN A;  4J9F A;  4DEY A;  2E5K A;  3U23 A;  1ZSG A;  2EGA A;  1M3B A;  1NEB A;  2KNB B;  2K79 A;  1HD3 A;  1T0J A;  2KT1 A;  2AKL A;  2L0A A;  2MCN A;  2V1R A;  1S1N A;  1UGV A;  4IIM A;  4WCI A;  1UHF A;  1JEG A;  4JJD A;  2D0N A;  1E6G A;  1JXO A;  1UG1 A;  3H0F A;  2KYB A;  2GQI A;  1QLY A;  1SSH A;  2LJ1 A;  2AZS A;  1K0X A;  2MOX A;  1X6G A;  1PHT A;  1X43 A;  3VS1 A;  2CRE A;  1OPK A;  2KXC A;  1X6B A;  4J9I A;  1QWF A;  3PVQ A;  2DBK A;  3I35 A;  1PKT A;  4ESR A;  1QCF A;  1Z9Z A;  3EHQ A;  1RI9 A;  2GTJ A;  2F2V A;  3M0Q A;  1HJD A;  1SRM A;  1T0H A;  1K76 A;  4OMO A;  1VYT A;  4E6R A;  1UHC A;  1X2K A;  2HDA A;  1QKX A;  2W10 A;  3I5R A;  1SPK A;  1M3C A;  1XOV A;  2KYM A;  3EGU A;  1M3A A;  2YUN A;  2DJQ A;  1AEY A;  2VVK A;  1GBR A;  4CC3 A;  4Z89 A;  2DM1 A;  3A98 A;  2DRK A;  2KE9 A;  5GJV B;  5IHK A;  3VS4 A;  2C0T A;  1ABQ A;  4GBQ A;  2KBT A;  2K7A A;  2DLP A;  1WXU A;  1WI7 A;  2EYW A;  2JS2 A;  3REA B;  2LZ6 B;  2KRO A;  1TG0 A;  2M0Y A;  2H8H A;  1FYN A;  2A36 A;  2EBP A;  1YCS B;  2KGT A;  1PRL C;  1TUC A;  2HEQ A;  4RTX A;  3TSW A;  3UA6 A;  1H3H A;  3EHR A;  2AKK A;  4RTY A;  2A28 A;  2J7I A;  3TVT A;  1WA7 A;  2AZV A;  2VKN A;  2DF6 A;  1X69 A;  2XMF A;  5GJW B;  3LH5 A;  2LNH B;  2SEM A;  1UTI A;  2W0Z A;  2PTK A;  3R6N A;  1E6H A;  3I9Q A;  1I1J A;  3REB B;  1AD5 A;  2AK5 A;  3RNJ A;  1K4U S;  1EFN A;  2DA9 A;  1WYX A;  3UAT A;  1Y57 A;  3IQL A;  1NYG A;  1JXM A;  1Y0M A;  2DIL A;  1AVZ C;  1U3O A;  4JPB W;  1PNJ A;  1RLP C;  4RTZ A;  2FPE A;  3NGP A;  4D8K A;  1CKA A;  4AFU C;  2K3B A;  2OI3 A;  2KR3 A;  3NMZ C;  2X3X D;  1G83 A;  1NG2 A;  2C0I A;  3TSZ A;  2LJ0 A;  4X1V A;  4F14 A;  2FO0 A;  2KT8 A;  3UA7 A;  2JW4 A;  4KRT A;  1T3S A;  1GBQ A;  4RUG A;  2J6K A;  1UJ0 A;  1KFZ A;  1RUW A;  3M0T A;  2D1X A;  1N5Z A;  3GBQ A;  1NEG A;  2ED1 A;  1G2B A;  1RLQ C;  2O88 A;  1OEB A;  4J9C A;  2LQN A;  1E7O A;  1NLO C;  4HCK A;  4Z8A A;  3ULR B;  5IHI A;  2DL4 A;  3H41 A;  2FRY A;  1J3T A;  2RN8 A;  1UJY A;  2DYB A;  1K1Z A;  2GGR A;  2JMA A;  2SRC A;  1SHF A;  2JM8 A;  1WXT A;  1JQQ A;  1UUE A;  2KRN A;  4J9G A;  3VS6 A;  2L3Q A;  2K6D A;  1ZUY A;  4RTV A;  1HSQ A;  1K9A A;  2CH4 W;  2EW3 A;  2LP5 A;  2BZY A;  1BU1 A;  2O9S A;  3KFV A;  4JZ3 A;  1AWJ A;  1PKS A;  2EGC A;  1W70 A;  1QWE A;  1SHG A;  2LX7 A;  2A37 A;  2ROT A;  2RF0 A;  1B07 A;  2JMC A;  2ABL A;  1SRL A;  1TUD A;  2EYZ A;  1ZBJ A;  1GL5 A;  2FRW A;  1AOJ A;  4DEX A;  3VS2 A;  4OMP A;  1QKW A;  2O9V A;  2J05 A;  1ZLM A;  3M0R A;  2QDL A;  4HXJ A;  4R0K A;  3EG0 A;  1H92 A;  2CUB A;  4AFQ C;  2JXB A;  3QWX X;  1PRM C;  1A0N B;  2RNA A;  1KIK A;  2O2O A;  4OMN A;  2YUQ A;  1WFW A;  2ESW A;  4IIO A;  1VA7 A;  1UFF A;  4RTU A;  4LN2 A;  2EKH A;  5I11 A;  2FPD A;  1AWO A;  4CC4 B;  3JV3 A;  3C0C A;  1MV3 A;  1T3L A;  4HVW A;  2ECZ A;  4RTW A;  2G6F X;  1CSK A;  1CKB A;  2YUP A;  4RTT A;  3VRY A;  4CC2 A;  1I0C A;  1ARK A;  2CH4 A;  3H0I A;  2RQW A;  1NLP C;  3UF4 A;  4QT7 A;  2KXD A;  4LUE A;  2YT6 A;  1UE9 A;  3QWY A;  2P4R A;  4LUD A;  1YN8 A;  3EG2 A;  2PNI A;  4K11 A;  2FEI A;  2LCS A;  3O5Z A;  4OMQ A;  1WIE A;  3I5S A;  1WDX A;  2B86 A;  2GTO A;  3NHN A;  2J6O A;  1KSW A;  2DBM A;  2LQW A;  2RQU A;  2BZX A;  3VRZ A;  1VYU A;  2OAW A;  2CT3 A;  1BBZ A;  2DL7 A;  2DMO A;  4EIK A;  2KRM A;  3PVL A;  1MUZ A;  1I07 A;  4HVV A;  1SEM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...