1WIAA

Solution structure of mouse hypothetical ubiquitin-like protein bab25500
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
95
structure length
95
Chain Sequence
GSSGSSGINVRLKFLNDTEELAVARPEDTVGTLKSKYFPGQESQMKLIYQGRLLQDPARTLSSLNITNNCVIHCHRSPPGAAVSGPSASSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords hypothetical ubiquitin-like protein (RIKEN cDNA 2010008E23)
publication title Solution structure of mouse hypothetical ubiquitin-like protein BAB25500
rcsb
source organism Mus musculus
molecule tags Structural genomics, unknown function
total genus 12
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2004-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1wiaA01
3JSVA 4PYUA 5AEKB 4P7IA 5DPTA 2ZEQA 3M95A 3IFWB 4BBNC 3ML8A 3PHWB 3W1SA 4W9HA 4DK5A 1V86A 1XT9B 2O2VB 4K7UA 4EEWA 4FA6A 2M17A 2FUHB 4ANWA 1ZKHA 5L83A 2REXA 4WWPA 1UD7A 1GJZA 2O2VA 3SDLC 2K25A 4KIKB 2KDFB 5JHAA 2J0MA 2MP2B 1HE8A 1S1QB 4KIKA 2KANA 2L05A 4WJPA 2BKRB 2CU1A 4BKGA 2WX0A 4HLEA 2MP2A 5GMVA 2JF5A 1D3ZA 2LRUA 3WAMA 1WFYA 1RRBA 3HIZA 3IG3A 5AZHA 3HHMA 4IG7B 3NZUA 2IO1B 2KQ7A 1WIAA 1RAXA 3RYTA 3EFUA 2DAFA 4KV2A 4NJ7A 1L2NA 2DYMA 1UBIA 4TQ0A 1WF9A 1P9DU 2BYEA 4K81A 3PLVA 3KUZA 4FADA 4G0NB 3K9PB 1WJ6A 2C7NB 2W9NA 1RFAA 2FNJB 3HM6X 4NQLB 1WY8A 2O6VD 2L76A 3DBHI 4MJSB 2FIDA 2AWTA 2KTRB 2KOXA 2HE7A 3KYDD 3LDZE 3PVLA 4HCPB 2Z0DB 3W1YA 3X23A 2LVQA 2HTHA 2NBVB 3KYCD 1KOTA 4MJSA 1IPGA 2KTRA 1WXVA 3L10B 1VD2A 3VFKA 4LDTD 3ML9A 1TGZB 1V5TA 3QQ8B 1GG3A 2KC2A 3D32A 3PREA 1SGHA 4W9LA 4BOSC 3DQVA 2UYZB 3PSEB 1E8YA 3ZIMA 2BPSA 1E8XA 1R4NI 3VUWA 3PGEA 4AOFA 1IP9A 3PPAA 3L17A 4LJPB 2CS4A 1Z2MA 3DBLI 3VH3B 4HPLB 3GOEA 4W9CA 4I6NB 2FCSA 2ZCBA 4W9JA 4KDLB 5IA7A 4ZRIA 3U7DA 4IWQA 5JZEB 1EF1A 1KM7A 4HDOA 3QCAA 2KVRA 3M63B 5AZFA 2KDIA 1NI2A 1E5WA 4W9KA 2IY0B 3A1QB 3KVFB 4ICUA 1E8WA 1WGYA 2NR2A 4WWNA 3TL5A 2GBRA 1WE7A 5KHQA 5E6OA 2MBOA 2NCNA 3V62A 1YD8U 2MA9B 3ZUNA 4EZLA 2JVCA 2K6QA 4TV3A 4WWOA 3ZNZB 4ASWC 4FJZA 2KFKB 4MGZE 5D7GA 1VCBA 1WJUA 3RZFA 3ZNGC 4A3PA 3Q3JA 1F9JA 3JYUA 2CHXA 4W9GA 2KFKA 2KN5A 3ECIA 2KFJA 3QK0A 2FIFA 3QIJA 4G3XB 2FAZA 4JLCA 2BKFA 4FLHA 4ZRJA 1P0RA 1WZ0A 4GN1A 5E6NA 4XX5A 2LJ5A 5LXIB 2Z59B 2KJHB 4HJKA 1I35A 2LRWA 2KDEB 3MHSD 4KZ0A 3RULA 2OJRA 3H7SA 4DHJD 2WWZA 2KLGA 3PHXB 4ANVA 2PPHA 2JZZA 4GDKA 2D2QA 2I1KA 2NVUI 3DPDA 1ISNA 4KZCA 2PE6B 4M8MA 3CSTA 3DOWA 4ANXA 4NAWB 4FULA 1R4MI 2ZNVC 3PS6A 1GC7A 2YLMA 3OJ3A 3NS8A 2YVCA 4KSKC 4NAWA 2MSED 4PYZA 5J17A 4DHZE 2J7QB 2RGFA 4EOYA 4BKTA 2RPQA 1WM3A 2K1FA 5CHVC 1EO6A 3ZW3A 1OEYA 2JXXA 1TBEA 2XK5B 3H9DA 2N1WA 5LLIA 5C1ZA 3KUCB 1PQSA 2XBBC 5C23A 2CHWA 2D11A 2R2OA 3DBRI 1WZ3A 2XK5A 2G45B 2KX0A 3CMMB 2IO0B 3QA8A 2MQJA 3TCAA 1SE9A 5DPRA 1WX9A 2D10A 1V6EA 2Y5BB 1CMXB 2LD9A 1V49A 4IW0A 1WM2A 3TMPB 4ANUA 4DXAB 4GB9A 4I6PA 4MELA 3DCGA 2DZMA 2N9PC 5FR6A 2DZIA 2KWUB 3WALA 4XC2A 2JRIB 1U4AA 5CX3A 1OTRB 5CHWA 2C5LC 1V9JA 2N9XA 1GUAB 1LXDA 4E71A 3ZDMC 4IM0A 3B1LX 2IO3B 4MGKE 2BYFA 2MBHA 3WAPA 2NPTB 3HK0A 1L7YA 4A3OA 2M4NA 2EMSA 3H1UA 4BOZB 5D6JB 3V60A 3ZNID 2BYVE 4KVGB 5G2NA 3LJ3A 2IZVB 1WI0A 1WGRA 2A4ZA 3UGBB 2WX1A 3N30A 2DX5B 3SHQA 3AI5A 4NPNA 4HPMB 4GOCA 4FHKA 2EKEC 2ZJDA 4K7WA 3APDA 3M62B 1E8ZA 3OJ4B 3RZWC 2KZRA 2G4DB 1WE6A 2BGFA 3L0WB 2KQSA 2ZNVB 3RUIB 2MBBB 4B95A 5EDSA 3V6CB 1T0YA 4GMVA 4K7SA 1C1YB 3PRZA 3VUYA 3RCZA 1GC6A 1OGWA 1WX8A 3V6EB 5D2MB 2LXCA 4LDTB 4EFOA 3SU8X 2AL6A 3UIPB 2K39A 2MWSB 3B08A 2WYQA 1EF5A 2UWQA 3EHVA 1WMHB 2NBWB 4DDGD 2KMCA 1KLVA 3DBSA 2CHZA 2KKCA 2LGDA 4MSQB 2R2QA 4E74A 2BWES 1NBFC 4OVVA 3R7RA 3QC8B 4M0WB 3PV1A 1WJ4A 4GU2A 3DVGX 3CSFA 1WRDB 2K8BA 3L16A 3QWZB 4BKSA 2LI5A 4IC7B 2KHWB 4GSWA 4M8NA 1E7UA 3QARA 3A9KB 3DVNV 2DHZA 4II3B 4W9DA 1V80A 3A1QA 3W1SC 3A9KA 1H8CA 1WGGA 1UH6A 2K6DB 4HK2A 3AU4A 1A5RA 2C60A 2DAJA 4WQOB 1UELA 3HM3A 4MM3A 3VAWA 2RR9A 2HD5B 3VTUA 1SIFA 4E3CA 2KLCA 4HDQA 3CF6E 3MTNB 5CHFA 4RMAA 3ZRFA 2VRRB 2LVOA 3ZTCA 2KWCA 4HVBA 1J8CA 1MG8A 3QAQA 4TKNA 4AUQC 2PJHA 4IWPA 2AYOB 4OVUA 3PRPB 1UGMA 5J18A 4K1RB 4IUMB 4FHJA 5G55A 1IYFA 1WYWB 2BF8B 2KMAA 3EECA 2RSUA 3ONSA 4MEMA 3VHTC 3UIOB 4X57B 3WIMA 1WR6E 4GGQA 2JY6A 3QJZA 3JW0X 4EKUA 5JH5C 4FBJB 2KX3A 4AWJA 1Y8RC 1V5OA 3O65B 2MW5A 4MDKE 1YX6B 3ZO5B 3T9LA 1LM8B 2NBUA 2MRPA 2GOWA 3OAWA 4ICVA 4RM8A 4JIOU 1UZXB 4PS3A 3VDZA 3L13A 2AEHA 4NY0A 2JUOA 2JWZA 1GNUA 2CR5A 2KJRA 2RD0A 2J0KA 2QHOA 4F8CB 1WXMA 4ZDVA 1WX7A 2MCNB 3A9JB 3PLUA 4RM9A 5BO4B 1NDDA 2KJ6A 2N7DA 2CKHB 2JPHA 2C7HA 4DDID 3WANA 3ZLZA 3APCA 1P98A 2EMTA 5IAAC 3A4SC 4W9FA 3IHPC 2L3ZA 3X0WA 4CYEA 4GIVA 4YL8A 4IWOA 3MJWA 2D07B 3VUXA 2DENB 1TZ1A 4IM2A 3P2BA 4J6IA 2PE9A 5DCNA 2M8SA 4WJNA 2N7EA 2MLBA 5KHOA 3ZVVA 2NPTA 3VVWB 3DVNU 2FCMA 3RT3B 3PZDA 3IVFA 4G11A 2DYBA 3B0AA 5CTRC 4HXDA 1M94A 4ZRKA 4AP4C 3C0RB 4PS7A 1J19A 2PEAA 2LASA 1E90A 4TUUA 2MBEA 3A4RA 3KW5B 3K9OB 2GBJA 4BVUC 4LJOB 3UQBA 4WJQA 2KNBA 2BWFA 2D3GA 1JRUA 3KH0A 3PTFC 2O6VB 4HWIB 2KD0A 3H6NA 3TIXA 2FCNA 3QHTA 1ZGUB 3AU5A 4BFRA 2WDTB 2O6VA 1Q5WB 5DPSA 1J0GA 2LVPA 3SD5A 4XZ4A 4BBNF 3ZTDA 1C3TA 4F7ZA 1Z5SB 2ZCCA 3BINA 3R66C 3UF8A 1WXAA 3WA0A 3WAOA 1AARA 2JRHA 3NY5A 3KUDB 1OEYJ 1H4RA 2L8JA 1WGHA 2GBNA 4TQ1A 3ALBA 3H7PB 3I3TB 3N3KB 4DHZB 5JHBA 2A5UA 2AL3A 4JQWC 1P3QU 2DZKA 3JVZX 3H7PA 1TTNA 1WMHA 3U30A 3V61A 1EUVB 2M1MA 2FCQA 3S2AA 2KTFA 2HJ8A 3TJPA 2L0TA 2KC1A 3PT2B 2C7MB 1G6JA 4KDIC 2ZZPB 2LXAA 5E6PA 3R7QA 2JZ3B 4IM3A 3VTWA 1FXTB 2KK8A 4URKA 4MH0E 2Z0EB 4G50A 2ASQA 2MX2A 4WJOA 1KJTA 2KWVB 2ZPYA 2L7RA 3GZNI 2NS5A 3NZSA 1QZEA 2V4LA 4HCNB 3DDCB 3ZKJC 4DWFA 1YIWA 3AXCA 4II2B 2ZPNA 1I42A 2MBQA 5DPWA 3ZRCA 4WAAA 1LFDA 3AULA 2G3QB 4JGHB 3OLMD 4N9F4 4W9EA 4AJWA 1E7VA 1YQBA 2N1VA 4I6LB 4BKSD 3Q3FA 1BT0A 1S3SG 1WH3A 1WJNA 4A20A 1RLFA 2LGYA 3IBEA 3VXWA 4B9KA 2JT4B 1K8RB 2C9WB 2M0XA 4NQKE 4F1SA 5HKHA 3VTVA 2GMIC 2J0JA 4FJVB 1X1MA 4NNJB 3ZNHB 4PS8A 4GXBA 1V2YA 4EUTA 4EZJA 4EZKA 1Q1OA 3BY4B 3DVGY 5AZGA 2B3AA 3QX1A 4DHJB 2L0FA 5D94A 2KO3A 5LXHA 2GBKA 1Q0WB 4B6WA 4CHKA 4ZYNA 1LQBA 2N9EB 3L54A 4MGIE 5J2RA 4GDLB 2L00B 2IBIB 4AJYB 1OQYA 3VQIA 4FJYA 1YJ1A 4GDLA 3TBLD 5L95C 1WR1A 2KDBA 2LWPA 4CO7A 3NHEB 1ZW7A 3L08A 3UINB 4MSMB 2LGXA 3T8MA 3ENEA 2V1YA 4GDKB 2ZVOA 2GBMA 5TR5A 3ZDTA 3R3MA 2IYDB 1UBQA 2G4SA 3PRMB 4NJ6A 2DYOA 3VH4B 3UQAA 2OOBB 4W9IA 4LCDE 4DBGA 1WGDA 2LUEA 1XD3B 4MGYE 2V3SA 2N4FA 2XEWA 4JL9A 3A33B 2K8CA 2I1JA 3RD2A 1YX5B 3EC8A 4FN2A 3A9JA 3M3JA 1P1AA 3U8ZA 1V81A 2DZJA 2K8HA 3JSVB 1WXSA 2ZVNA 3N32A 2KXJA 1XQQA 2LZ6A 3NOBA 4KSLC 2IY1B 2IO2B 3APFA
chains in the Genus database with same CATH superfamily
1IGDA 5AEKB 2GLSA 1V86A 4RGOS 2M17A 3BZDB 4IOIE 4ANWA 2O2VA 4WIPA 1TY0A 1HE8A 4KIKA 2L05A 4RGTA 4BKGA 2WX0A 4HLEA 2MP2A 3GE8C 3IG3A 4IG7B 3NZUA 2KQ7A 1WIAA 1RAXA 3RYTA 3EFUA 4NJ7A 3B2GA 4US8A 1MPEA 4AS1A 2BYEA 1C9FA 3PLVA 4ZHPA 2ONQA 2OHFA 2C7NB 4NQLB 1I7HA 3DBHI 3NG0A 4MJSB 1L2NA 4HKZE 2LVQA 3KYCD 2NBVB 1WXVA 1SF0A 4BZAA 3QQ8B 3NRZA 1GG3A 3D32A 4W9LA 2BPSA 1R4NI 3WCQA 3EA6A 5D3DA 2JXTA 2QC8A 4W9CA 2FCSA 2ZCBA 1XF5L 3VRBB 2PMVA 4ARIA 2KVRA 2LMCA 3A1QB 4C4VA 3KVFB 1E8WA 1WGYA 2NR2A 4WWNA 1VLBA 2GBRA 5KHQA 5E6OA 3V62A 2CJNA 1YD8U 2MA9B 2K6QA 5FR3A 4TV3A 4WWOA 3ZNZB 4ASWC 4FJZA 1YOVB 4MGZE 4HKQA 1QKZA 3RZFA 4A3PA 5MPOA 1F9JA 2KN5A 4DQOC 2KFJA 4G3XB 2FAZA 4JLCA 3P4QB 4GN1A 2DBYA 3MC9A 4XX5A 5LXIB 5E6JA 2Y3AA 2Z8LA 2IDYA 1J7CA 2OJRA 3ABVB 3PO0A 4DHJD 2WWZA 2KLGA 4ANVA 2I1KA 2H89B 1L0XB 4ANXA 4NAWB 1HEZE 2ZNVC 3PS6A 4PYZA 4DHZE 1FM0D 1ZXHA 2BYTA 4RCOA 4BKTA 2JXXA 1AW7A 5C1ZA 3H9DA 3I63C 2R61A 2CHWA 2D11A 4O1NA 3CMMB 3OWEB 2D10A 1SE4A 2LD9A 4YTPB 3GB1A 4I6PA 4R3DA 2N9PC 3DHHC 3WALA 1E7PB 4E71A 1OTRB 3ZDMC 3HK0A 4A55A 4A3OA 2M4NA 3H1UA 2GI9A 3FKYA 3BK1A 3H8HA 3DHGC 1FO4A 1R7SA 2A4ZA 1FIQA 1GAQB 3N30A 4NPNA 3RNAC 2ZJDA 2K3UA 4YTNB 3M62B 3OJ4B 3MP9A 2D5GA 1TIFA 3PRZA 3T3OA 1GC6A 4YXDB 1YN4A 2LXCA 4LDTB 4RGMA 2AL6A 3UIPB 1SJED 3TEZA 3EHVA 5C2TB 2NBWB 1KLVA 4TMAB 1CQVA 2TSSA 4E74A 2BWES 4OVVA 1QILA 3PV1A 1SB3C 3RNBC 3U52E 2WXJA 1Y56A 2KHWB 1E7UA 3DVNV 4W9DA 1QT9A 1UH6A 4YT0B 1A5RA 2KN4A 2DAJA 4MM3A 1C76A 2HD5B 3VTUA 2KLCA 1CK1A 1I4RA 4XWWA 3MTNB 4HVBA 1MG8A 4AUQC 3AEDB 4IWPA 4WQMA 4LNIA 4IUMB 4FHJA 1PGAA 3ONSA 3VHTC 1WR6E 1C78A 5H8YE 4FBJB 1XCQL 1Y8RC 1JQ4A 4ICVA 5HG2A 4JIOU 1HTOA 3VDZA 2INDC 2AEHA 2CR5A 3PLUA 2KJ6A 2N7DA 3AEGB 2EMTA 1V8CA 3AV8A 1HXYD 4IWOA 3MJWA 4YL8A 3ZXVA 1TZ1A 3KWVA 4YWGG 3C8YA 1QOFA 4L23A 3IT4B 3ZVVA 2NPTA 3VVWB 1EU3A 4P16A 3DVNU 2IJ0A 3RNCC 1YJJA 4G11A 1EU4A 2N9LA 5CTRC 1M94A 3BYTB 1J19A 2B76B 1E90A 3AEFB 3K9OB 4LJOB 3UQBA 4WJQA 1N5XA 3PTFC 1JRUA 3KH0A 2KD0A 2WNMA 1YQ4B 2KVZA 1Q5WB 4BBNF 3ZTDA 4F7ZA 3BINA 1TKEA 1AARA 2L83A 4L1BA 3Q8AA 1PUTA 3AEAB 4NJCA 1PFDA 1WMHA 2M1MA 3U4EG 4RFBA 2KC1A 5E6PA 3AN1A 3VTWA 2Z0EB 1J7BA 3AE3B 4LNNA 4WJOA 3GZNI 2WXHA 1V1PA 2WS3B 2L52A 2LEKA 3AXCA 2MBQA 1LFDA 3OLMD 1S3SG 1WH3A 1RLFA 3EFCA 3IBEA 3VXWA 2KYWA 1FFUA 4NNJB 1T3QA 4GXBA 4EUTA 3BY4B 4HJGE 2B3AA 3QX1A 2I38A 3HVZA 3RNGC 3NVVA 4B6WA 4CHKA 4ZYNA 1LQBA 2W3SA 3Q3NC 1WYGA 5J2RA 2L00B 4DXGA 3AE8B 5EE3A 4GDLA 3TBLD 1ZW7A 1CJEA 4J3OD 4GDKB 1V1OA 3R3MA 1UBQA 3VH4B 1F2RI 3P1MA 4W9IA 4LCDE 1JRPA 2M19A 1P1AA 3JSVB 2FBWB 3R8BA 2LZ6A 2IY1B 3P4SB 4WAFA 3APFA 4P7IA 3M95A 3IFWB 1ET6A 3PHWB 4FA6A 1C4PA 2REXA 1UD7A 1F0ZA 1GJZA 3IXSA 2BT6A 2KDFB 5JHAA 1JCKB 2J0MA 1I4PA 1S1QB 2LGSA 4S0RA 2JF5A 1WFYA 2ON8A 1RRBA 3CIRB 2CJOA 3SFDB 2JU6X 3ZGZA 2PTLA 2HTME 1YMHE 4KV2A 2WGSA 2KAJA 1FRDA 2DYMA 1L0VB 1P7EA 2JQRB 3PZ7A 4K81A 2MJDA 3SR6A 3V3XA 4G0NB 2K22A 3SEBA 1RFAA 2FNJB 3HM6X 2L76A 2KTRB 2KOXA 1AYFA 3LDZE 3P4RB 4HCPB 3W1YA 2Z0DB 3X23A 2HTHA 4ARCA 4MJSA 1FEHA 4KGRA 1V5TA 2KC2A 2JX5A 1NENB 2N7JA 1IP9A 3FC4A 3L17A 1E9MA 4HPLB 2WXPA 4N59A 2K5PA 3P63A 5IA7A 3U7DA 4YSYB 4XDDA 5AZFA 2KDIA 1NI2A 4W9KA 3TL5A 3CWIA 2ZW0A 4L2YA 2J53A 1VRAB 3ZUNA 1DOIA 2KFKB 3BYYB 1VCBA 3JYUA 4YSXB 4W9GA 3QK0A 4PT5A 1MVKA 1QLBB 2ACZB 2BKFA 1WZ0A 2LJ5A 1T0RC 4HJKA 2LRWA 3H7SA 3AB5A 3PHXB 2JZZA 2D2QA 4FXCA 1TKGA 2ICIA 2E3TA 3DPDA 4KZCA 1JWUD 3N1ZC 3NS8A 1I4HA 2MSED 4NAWA 5J17A 1NEKB 1TS3A 1C4AA 3DBLB 1WM3A 3ZW3A 2Y5CA 1VDVA 1TBEA 2N1WA 3I57A 1WZ3A 1NVID 2KX0A 1UGJA 2IO0B 2WLBA 2LHDA 4A8XC 2MQJA 1L6UA 3TCAA 1SE9A 1D6EC 5DPRA 5BYRA 3AEEB 1V6EA 2Y5BB 4D2KA 4IW0A 2N9KA 3TMPB 4US9A 3ZJUA 3DCGA 2IPKD 2PVGC 2I2YA 4JWSC 3Q8BA 5CX3A 1F77A 5CHWA 3OG5A 5IOIA 4IM0A 3LB8C 4MGKE 4S17A 2BYFA 2MBHA 2J4XA 1L7YA 2WXFA 3R2IA 1Q10A 4WURA 4HPPA 5D6JB 2BYVE 5G2NA 3LJ3A 1WI0A 1NI3A 4MH8A 3SHQA 2W54A 4YTMB 2WXQA 1ACCA 3RNFC 2KZRA 1WE6A 3RUIB 2KQSA 2ZNVB 1EWCA 1C1YB 3VUYA 3RCZA 3V6EB 2Q5WD 1SBBB 3SU8X 1ZOYB 3IAS1 2MWSB 1QOBA 2N0SB 2KMCA 2CHZA 2PW9A 3EUB2 1XXGA 2R2QA 1GB1A 1VZ8A 4M0WB 1YN3A 3QWZB 5IN7A 1AN8A 4GSWA 5EE9A 3A9KB 4JE3B 5FKAC 4LNOA 2KDMA 1SE2A 1FRRA 3Q8EA 2J42A 2C60A 4XYCA 1UELA 2RR9A 4YSZB 1SIFA 1FCLA 3CF6E 4RMAA 3ZRFA 2VRRB 2LVOA 4TKNA 2BVCA 2PJHA 1WXQA 4OZAA 2AYOB 2WHIA 3PRPB 4OVUA 1UGMA 1XLNA 2WDVB 4JWUC 4K1RB 5J18A 1IYFA 4USAA 2KMAA 3EECA 1TS2A 2VH2A 3WIMA 2QIEB 4GGQA 2QCZA 3QJZA 1FXIA 2AQ2B 2Y5PA 2MW5A 4MDKE 2NTSA 3AE2B 2E6XA 1YNTE 2L32A 3T9LA 3ZO5B 1LM8B 4MACA 1FXAA 2GOWA 3UI3A 1UZXB 1JALA 4PS3A 4LK0M 5BYSA 3R2TA 1LO5D 4DXFA 2INCC 4ZDVA 2MCNB 1DOYA 2CKHB 3DHIC 2C7HA 1RWSA 3A4SC 4W9FA 3EGRA 4KGSA 4RF1A 4C56C 1GPXA 3BK2A 2PE9A 2RDGA 5KHOA 1FCCC 3RT3B 1T5XD 3PZDA 4KGTA 3O13A 3B0AA 2WXOA 1BUIC 4PS7A 1T0QC 2PVOD 4BVUC 2KNBA 2D3GA 3TIXA 3H6NA 4OZBA 4WWMA 5DPSA 1FFVA 4XZ4A 1F1HA 1Z5SB 3R66C 2M56B 3WAOA 3Q3MC 1T0SC 3V05A 1OEYJ 3RI7C 2L8JA 1C77A 2WDRB 3I3TB 3N3KB 4DHZB 3J9CA 5JHBA 4JQWC 3JVZX 3NVWA 3U30A 2D3CA 3V61A 4PK1A 4LNFA 1SSNA 2C7MB 1TJEA 1FXTB 3MC0B 4G50A 3N1YC 3NZSA 2L7RA 1QOGA 1I4XA 4HCNB 4DWFA 1I42A 1V97A 1TT5B 5DPWA 4RGNA 1SE3A 3AULA 4JGHB 4W9EA 4I6LB 1FNUA 4OHJA 4A20A 3DWGC 3GE3C 1K8RB 2M0XA 4NQKE 5BMGA 5HKHA 3VTVA 4TSSA 2GMIC 1HA5A 3ZNHB 1ROEA 1N6ZA 1V2YA 3BVGA 5AZGA 1B1ZA 5LXHA 5D94A 2KO3A 2CU3A 4MGIE 2IBIB 1DYQA 4Q2JA 2JSVX 4RF0A 1N61A 3E9SA 2EKIA 2DWQA 4CO7A 4MSMB 2LGXA 1ESFA 1EWYC 3ENEA 2GBMA 3ZDTA 1RYJA 2IYDB 3PRMB 4OZCA 4A9AA 5GXGB 3UQAA 2WDQB 4DBGA 1D5ZC 3MHZA 4K3CA 2RPVA 1J7AA 2YEPB 3A33B 2RDBC 2WXGA 3A9JA 3U8ZA 1SIJA 1V81A 2ZVNA 3N32A 2KXJA 3LXFA 3NOBA 2QJLA 3TEYA 5C23A 3JSVA 3AH7A 5HI1A 5DPTA 3AECB 1B9RA 2ZEQA 1N63A 3ML8A 4DK5A 4W9HA 2WXKA 4EEWA 5L83A 1OQQA 4WWPA 3MC8A 2K25A 3T3NA 5AUKA 2AX5A 1IUEA 2KANA 4WJPA 4ZOHC 2KT7A 4A6QA 2LRUA 1D3ZA 1VR9A 1I4QA 1M4VA 3HIZA 5AZHA 1TYGB 2SAKA 3AE7B 1UBIA 1P9DU 2V3PA 4EE2A 1JWAD 1NYRA 3KUZA 4FADA 4ZRPA 1N5WA 2XN9C 1WJ6A 4XGAB 2DNFA 1WY8A 3KYDD 2AWTA 2HE7A 3PVLA 4RH6A 1IPGA 2KTRA 3VFKA 4LDTD 1DGJA 2JYEA 3PREA 1SGHA 1E8YA 3ZIMA 2VH1A 1E8XA 3SFEB 1UNSA 3PGEA 3PPAA 4LJPB 2CS4A 3DBLI 3GOEA 4I6NB 4W9JA 4KDLB 5JZEB 4IWQA 5IKCM 1EF1A 1C79A 2LFIA 4HDOA 3QCAA 1XLOA 4ICUA 4HRSA 1HTQA 1NYQA 1D4BA 2MBOA 4EZLA 2M0AA 1PDXA 3ZNGC 2BQQA 2CHXA 3FAHA 2KFKA 2SEBD 1JROA 3C19A 3U7ZA 4FLHA 1P0RA 1KH0A 1I35A 2KDEB 1K52A 2NVUI 1ISNA 4ZHOA 3DOWA 2KMMA 2RMMA 1GC7A 3U2SC 2YVCA 2J7QB 4EOYA 1OQRA 5CHVC 1EO6A 1OEYA 2XK5B 3KQ4A 3P4PB 1PQSA 3Q6BA 1JW9D 2R2OA 3TUOA 2KQ4X 1FMAD 3QA8A 1CMXB 1V49A 4DXAB 4GB9A 1E10A 4P1CC 5FR6A 2LHEA 2DZIA 2KWUB 4XC2A 2JRIB 1U4AA 1XO3A 1V9JA 2LGIA 3AE9B 2IO3B 3WAPA 2NPTB 3HRDD 5BMIA 4BOZB 1L4ZB 3IT6B 3V60A 3ZNID 3E56A 1WGRA 2WX1A 1R4MB 2DX5B 3AI5A 1XEEA 3URYA 3NZ3A 4GOCA 4FHKA 1FPYA 1ZP0B 3FILB 3N1XC 3RZWC 2WXRA 3ZYYX 2BGFA 3AE6B 3L0WB 4KX6B 4B95A 5EDSA 1T0YA 4GMVA 3DBRB 2BS2B 5D2MB 1DOXA 5G5GA 2MJEA 1EF5A 4IKGA 1WMHB 1VJKA 2WQYB 1VZ6A 1JWSD 1WSPA 2DLBA 2KKCA 2LGDA 3TEWA 3R7RA 1WJ4A 4GU2A 3DVGX 4KKJA 3CSFA 1LGRA 2K8BA 3L16A 4M0WA 4IC7B 1V1PB 4NAMA 3AE4B 2BS4B 4II3B 1V80A 3A1QA 3A9KA 1H8CA 2FE8A 1ZE3D 1IGCA 1ZPSA 4HK2A 1K53A 4WQOB 3HM3A 4HDQA 1YQ3B 3KWLA 2YEPF 1J8CA 3QAQA 3W2DA 1MHXA 3W5UB 2V4IB 5G55A 1WYWB 2BF8B 1N60A 4MEMA 5IO9A 2ZW1A 1K51A 4EKUA 5JH5C 2KX3A 4AWJA 2HJ1A 1V5OA 2V3NA 2BB5A 3O65B 3NVZA 4B0MA 1EM7A 3VR9B 4RM8A 3I5JC 4NY0A 2X8XX 2JUOA 1GNUA 2KJRA 2RD0A 2J0KA 1WXMA 1WX7A 4RM9A 1NDDA 1QOAA 4DDID 1KFYB 2PKOA 4N6EB 3WANA 3ZLZA 1P98A 3LYYA 1D5MC 4M02A 3IHPC 3N20C 3X0WA 4GIVA 2D07B 2MH7A 3VUXA 2DENB 3P2BA 1XLQA 2M8SA 4WJNA 2N7EA 2MLBA 3IVFA 1XCTL 5FK9C 2DYBA 1IBXB 4HXDA 4ZRKA 1GB4A 4AP4C 2MBEA 3NJTA 2WXNA 1ZXIA 4H2AA 3BVZA 1XLPA 2BWFA 2O6VB 4XWTA 3QHTA 1ZGUB 2WDTB 1L6VA 1RM6C 1J0GA 2AQ1B 3SD5A 2JYTA 1HZ6A 1C3TA 3KLSX 2ZCCA 3RMKC 3UF8A 1WXAA 1KLUD 1UF0A 3KUDB 1H4RA 1P7FA 1WGHA 2GBNA 4TQ1A 3H7PB 3Q8CA 2A5UA 1P3QU 4C80A 1TTNA 2KACA 1EUVB 2FCQA 3W9CB 2HJ8A 3TJPA 2L0TA 3PT2B 1A70A 2HDEA 2LXAA 5BYQA 4IM3A 4URKA 3AMZA 2MEKA 4MH0E 3RNEC 1L4DB 2ASQA 1KJTA 2KWVB 2ZPYA 1QZEA 2V4LA 3ZKJC 3DDCB 3NS1A 4II2B 3B9JA 1ZUD2 4WAAA 4N9F4 4AJWA 1YQBA 1SJHD 3Q3FA 4BKSD 1WJNA 4REZA 2LGYA 2IGHA 4ACFA 2VZKB 2C9WB 2WP9B 3RPFC 4JX1C 3ZQ4A 2W55A 5H92C 2WXIA 2L0FA 2GBKA 1Q0WB 3NUHB 2N9EB 3L54A 1OFFA 3AEBB 1OQYA 5IP4D 4FJYA 5HHDG 5L95C 1F2RC 1WR1A 2KDBA 2LWPA 1TS5A 3NHEB 4IDIA 1HZ5A 2V1YA 2ZVOA 5TR5A 2FUG1 2MJ3A 2G4SA 4NJ6A 1I4GA 2DYOA 2OOBB 1ENFA 2J52A 1MJDA 1YN5A 4MGYE 2V3SA 2XEWA 4JL9A 5EE1A 1ET9A 1TY2A 2I1JA 2LUMA 3RD2A 1L0YB 4FN2A 1CZPA 1SXTA 1SEBD 1WXSA 4KSLC 2IO2B 4PYUA 4K3BA 4BBNC 3W1SA 1XT9B 2O2VB 4K7UA 4N58A 4RNAA 2FUHB 1ZKHA 2W82A 4GLSC 3SDLC 1RFKA 4KIKB 1PYWD 2MP2B 2WXLA 2BKRB 2CU1A 5GMVA 1BMLC 3WAMA 3HHMA 2IO1B 5G5HA 1YJIA 1MG4A 4M01A 2BTEA 2DAFA 1STEA 4TQ0A 1WF9A 1ZDXA 4WH4A 3K9PB 3HUIA 2W9NA 1WWTA 2O6VD 3L4PA 4ZRQA 2FIDA 3BWUD 1PGXA 2JZPA 1KOTA 1KRHA 5BMHA 3L10B 1VD2A 3ML9A 1TGZB 2MHJA 4QAYA 3VR8B 4BOSC 3DQVA 2UYZB 3PSEB 2D3BA 5LNK1 3VUWA 2IGGA 4AOFA 3ZXRA 5HFYA 1Z2MA 3VH3B 4LNKA 2D3AA 2QMTA 1WGKA 4ZRIA 1E0ZA 4C4VB 3ETRA 1KM7A 3M63B 1GOZA 4P6VF 1E5WA 2IY0B 4A90A 1WE7A 4M00A 2OEDA 2NCNA 2JVCA 4HEA1 4OW0A 5D7GA 2WU5B 1WJUA 3Q3JA 2K9XA 3ECIA 2G1EA 2VZKD 2FIFA 3QIJA 4ZRJA 5E6NA 2Z59B 2KJHB 3DBHB 3MHSD 4KZ0A 3RULA 2PPHA 4GDKA 1FNWA 2GRIA 2IGDA 4M8MA 2PE6B 3CSTA 4FULA 1R4MI 2YLMA 3OJ3A 1R4NB 4KSKC 2RGFA 1WRIA 3AE5B 2INNE 2RPQA 2K1FA 4KKIA 2BS3B 5LLIA 2WU2B 3KUCB 2XBBC 3DBRI 2XK5A 2G45B 1WX9A 4ITKA 2GB1A 2UU7A 4P1BC 1WM2A 4ANUA 4MELA 2DZMA 2C5LC 2N9XA 1GUAB 1LXDA 1JWMD 3B1LX 3ZJVA 3BIID 5EE0A 2KWDA 2X38A 2EMSA 3DWMA 5I4DA 4KVGB 1KF6B 2IZVB 2BB6A 2QDFA 2XNAC 3UGBB 4HPMB 1PGBA 2EKEC 4K7WA 3APDA 2EELA 4UDUC 1QQRA 1E8ZA 4ZYSA 2G4DB 3FILA 2MBBB 1MHHE 3V6CB 4K7SA 1OGWA 1WX8A 2QSDA 4EFOA 2JWUA 2LJIA 2K39A 2NTTA 2WYQA 3B08A 2UWQA 2W3RA 4DDGD 3DBSA 4MSQB 1NBFC 3QC8B 1MFWA 3ZJTA 1ZDVA 1WRDB 4BKSA 2LI5A 3P42A 1JMLA 4M8NA 3QARA 2DHZA 2NMQA 2L1AA 4LLGM 3W1SC 1WGGA 4MM3B 2K6DB 3AU4A 3IAM1 3VAWA 3I9V1 4E3CA 5CHFA 3ZTCA 2KWCA 1TZOA 4HROA 5D3IB 3AE1B 5TSSA 4JPSA 2RSUA 5T8IA 4CQNA 2V9HA 3UIOB 4X57B 2JY6A 3JW0X 4C7ZA 1C4CA 2QEJC 3VRAB 3TSSA 1YX6B 3B2FA 2NBUA 4XE0A 2MRPA 3OAWA 3L13A 4F8CB 2JWZA 2QHOA 1D5XC 3TEXA 3A9JB 5BO4B 3W5VB 1K50A 3HVDA 2INPE 2JPHA 4XDCA 3APCA 1FD6A 5IAAC 2QILA 3MFGA 3RFZB 2L3ZA 4CYEA 5AUIA 3GP7A 1L5PA 4IM2A 4J6IA 5DCNA 2PIAA 1T6BX 2FCMA 1HQRD 1AWDA 1MI0A 3C0RB 1IBXA 2PEAA 2LASA 4TUUA 1VZ7A 3A4RA 3KW5B 1UWXA 2GBJA 1UWMA 4HWIB 2FCNA 3AU5A 4BFRA 3BVMA 2O6VA 3Q69A 2LVPA 2PLPA 3GS2A 4AQ7A 3WA0A 2JRHA 3Q3OC 3NY5A 3ALBA 2BW2A 2H88B 4MT5A 4C7YA 2AL3A 2DZKA 3Q14C 3H7PA 1KLGD 3S2AA 2KTFA 4OVZA 3RN9C 1E6EB 3Q8FA 2WXMA 1G6JA 4KDIC 2ZZPB 3R7QA 2JZ3B 2KK8A 5JXVA 2MX2A 2NS5A 1YIWA 1UUPA 2ZPNA 3ZRCA 2G3QB 1E7VA 2N1VA 1BT0A 3NVYA 4B9KA 2JT4B 4F1SA 2RDHA 2J0JA 4FJVB 1X1MA 4B0EA 4PS8A 4EZJA 4EZKA 1Q1OA 3DVGY 4DHJB 1F52A 4LTUA 2K0PA 2G9HD 4GDLB 1N62A 4AJYB 3VQIA 5C3JB 3AM9A 1YJ1A 2BBCA 3UINB 3L08A 3T8MA 2AQ3B 3MJ5A 4C00A 1TKYA 1QF6A 3N9YC 1TS4A 1WGDA 2LUEA 1XD3B 1FNVA 2V0GA 1JWBD 3GZNB 2N4FA 2K8CA 3PZ8A 1YX5B 3Q2AC 4NZLB 3EC8A 3M3JA 2OJWA 1BXTA 4BAXA 2DZJA 2K8HA 1KTKA 1XQQA
chains in the Genus database with same CATH topology
3JSVA 4PYUA 5AEKB 4P7IA 5DPTA 2ZEQA 3M95A 3IFWB 4BBNC 3ML8A 3PHWB 3W1SA 4W9HA 4DK5A 1V86A 1XT9B 2O2VB 4K7UA 4EEWA 4FA6A 2M17A 2FUHB 4ANWA 1ZKHA 5L83A 2REXA 4WWPA 1UD7A 1GJZA 2O2VA 3SDLC 2K25A 4KIKB 2KDFB 5JHAA 2J0MA 2MP2B 1HE8A 1S1QB 4KIKA 2KANA 2L05A 4WJPA 2BKRB 2CU1A 4BKGA 2WX0A 4HLEA 2MP2A 5GMVA 2JF5A 1D3ZA 2LRUA 3WAMA 1WFYA 1RRBA 3HIZA 3IG3A 5AZHA 3HHMA 4IG7B 3NZUA 2IO1B 2KQ7A 1WIAA 1RAXA 3RYTA 3EFUA 2DAFA 4KV2A 4NJ7A 1L2NA 2DYMA 1UBIA 4TQ0A 1WF9A 1P9DU 2BYEA 4K81A 3PLVA 3KUZA 4FADA 4G0NB 3K9PB 1WJ6A 2C7NB 2W9NA 1RFAA 2FNJB 3HM6X 4NQLB 1WY8A 2O6VD 2L76A 3DBHI 4MJSB 2FIDA 2AWTA 2KTRB 2KOXA 2HE7A 3KYDD 3LDZE 3PVLA 4HCPB 2Z0DB 3W1YA 3X23A 2LVQA 2HTHA 2NBVB 3KYCD 1KOTA 4MJSA 1IPGA 2KTRA 1WXVA 3L10B 1VD2A 3VFKA 4LDTD 3ML9A 1TGZB 1V5TA 3QQ8B 1GG3A 2KC2A 3D32A 3PREA 1SGHA 4W9LA 4BOSC 3DQVA 2UYZB 3PSEB 1E8YA 3ZIMA 2BPSA 1E8XA 1R4NI 3VUWA 3PGEA 4AOFA 1IP9A 3PPAA 3L17A 4LJPB 2CS4A 1Z2MA 3DBLI 3VH3B 4HPLB 3GOEA 4W9CA 4I6NB 2FCSA 2ZCBA 4W9JA 4KDLB 5IA7A 4ZRIA 3U7DA 4IWQA 5JZEB 1EF1A 1KM7A 4HDOA 3QCAA 2KVRA 3M63B 5AZFA 2KDIA 1NI2A 1E5WA 4W9KA 2IY0B 3A1QB 3KVFB 4ICUA 1E8WA 1WGYA 2NR2A 4WWNA 3TL5A 2GBRA 1WE7A 5KHQA 5E6OA 2MBOA 2NCNA 3V62A 1YD8U 2MA9B 3ZUNA 4EZLA 2JVCA 2K6QA 4TV3A 4WWOA 3ZNZB 4ASWC 4FJZA 2KFKB 4MGZE 5D7GA 1VCBA 1WJUA 3RZFA 3ZNGC 4A3PA 3Q3JA 1F9JA 3JYUA 2CHXA 4W9GA 2KFKA 2KN5A 3ECIA 2KFJA 3QK0A 2FIFA 3QIJA 4G3XB 2FAZA 4JLCA 2BKFA 4FLHA 4ZRJA 1P0RA 1WZ0A 4GN1A 5E6NA 4XX5A 2LJ5A 5LXIB 2Z59B 2KJHB 4HJKA 1I35A 2LRWA 2KDEB 3MHSD 4KZ0A 3RULA 2OJRA 3H7SA 4DHJD 2WWZA 2KLGA 3PHXB 4ANVA 2PPHA 2JZZA 4GDKA 2D2QA 2I1KA 2NVUI 3DPDA 1ISNA 4KZCA 2PE6B 4M8MA 3CSTA 3DOWA 4ANXA 4NAWB 4FULA 1R4MI 2ZNVC 3PS6A 1GC7A 2YLMA 3OJ3A 3NS8A 2YVCA 4KSKC 4NAWA 2MSED 4PYZA 5J17A 4DHZE 2J7QB 2RGFA 4EOYA 4BKTA 2RPQA 1WM3A 2K1FA 5CHVC 1EO6A 3ZW3A 1OEYA 2JXXA 1TBEA 2XK5B 3H9DA 2N1WA 5LLIA 5C1ZA 3KUCB 1PQSA 2XBBC 5C23A 2CHWA 2D11A 2R2OA 3DBRI 1WZ3A 2XK5A 2G45B 2KX0A 3CMMB 2IO0B 3QA8A 2MQJA 3TCAA 1SE9A 5DPRA 1WX9A 2D10A 1V6EA 2Y5BB 1CMXB 2LD9A 1V49A 4IW0A 1WM2A 3TMPB 4ANUA 4DXAB 4GB9A 4I6PA 4MELA 3DCGA 2DZMA 2N9PC 5FR6A 2DZIA 2KWUB 3WALA 4XC2A 2JRIB 1U4AA 5CX3A 1OTRB 5CHWA 2C5LC 1V9JA 2N9XA 1GUAB 1LXDA 4E71A 3ZDMC 4IM0A 3B1LX 2IO3B 4MGKE 2BYFA 2MBHA 3WAPA 2NPTB 3HK0A 1L7YA 4A3OA 2M4NA 2EMSA 3H1UA 4BOZB 5D6JB 3V60A 3ZNID 2BYVE 4KVGB 5G2NA 3LJ3A 2IZVB 1WI0A 1WGRA 2A4ZA 3UGBB 2WX1A 3N30A 2DX5B 3SHQA 3AI5A 4NPNA 4HPMB 4GOCA 4FHKA 2EKEC 2ZJDA 4K7WA 3APDA 3M62B 1E8ZA 3OJ4B 3RZWC 2KZRA 2G4DB 1WE6A 2BGFA 3L0WB 2KQSA 2ZNVB 3RUIB 2MBBB 4B95A 5EDSA 3V6CB 1T0YA 4GMVA 4K7SA 1C1YB 3PRZA 3VUYA 3RCZA 1GC6A 1OGWA 1WX8A 3V6EB 5D2MB 2LXCA 4LDTB 4EFOA 3SU8X 2AL6A 3UIPB 2K39A 2MWSB 3B08A 2WYQA 1EF5A 2UWQA 3EHVA 1WMHB 2NBWB 4DDGD 2KMCA 1KLVA 3DBSA 2CHZA 2KKCA 2LGDA 4MSQB 2R2QA 4E74A 2BWES 1NBFC 4OVVA 3R7RA 3QC8B 4M0WB 3PV1A 1WJ4A 4GU2A 3DVGX 3CSFA 1WRDB 2K8BA 3L16A 3QWZB 4BKSA 2LI5A 4IC7B 2KHWB 4GSWA 4M8NA 1E7UA 3QARA 3A9KB 3DVNV 2DHZA 4II3B 4W9DA 1V80A 3A1QA 3W1SC 3A9KA 1H8CA 1WGGA 1UH6A 2K6DB 4HK2A 3AU4A 1A5RA 2C60A 2DAJA 4WQOB 1UELA 3HM3A 4MM3A 3VAWA 2RR9A 2HD5B 3VTUA 1SIFA 4E3CA 2KLCA 4HDQA 3CF6E 3MTNB 5CHFA 4RMAA 3ZRFA 2VRRB 2LVOA 3ZTCA 2KWCA 4HVBA 1J8CA 1MG8A 3QAQA 4TKNA 4AUQC 2PJHA 4IWPA 2AYOB 4OVUA 3PRPB 1UGMA 5J18A 4K1RB 4IUMB 4FHJA 5G55A 1IYFA 1WYWB 2BF8B 2KMAA 3EECA 2RSUA 3ONSA 4MEMA 3VHTC 3UIOB 4X57B 3WIMA 1WR6E 4GGQA 2JY6A 3QJZA 3JW0X 4EKUA 5JH5C 4FBJB 2KX3A 4AWJA 1Y8RC 1V5OA 3O65B 2MW5A 4MDKE 1YX6B 3ZO5B 3T9LA 1LM8B 2NBUA 2MRPA 2GOWA 3OAWA 4ICVA 4RM8A 4JIOU 1UZXB 4PS3A 3VDZA 3L13A 2AEHA 4NY0A 2JUOA 2JWZA 1GNUA 2CR5A 2KJRA 2RD0A 2J0KA 2QHOA 4F8CB 1WXMA 4ZDVA 1WX7A 2MCNB 3A9JB 3PLUA 4RM9A 5BO4B 1NDDA 2KJ6A 2N7DA 2CKHB 2JPHA 2C7HA 4DDID 3WANA 3ZLZA 3APCA 1P98A 2EMTA 5IAAC 3A4SC 4W9FA 3IHPC 2L3ZA 3X0WA 4CYEA 4GIVA 4YL8A 4IWOA 3MJWA 2D07B 3VUXA 2DENB 1TZ1A 4IM2A 3P2BA 4J6IA 2PE9A 5DCNA 2M8SA 4WJNA 2N7EA 2MLBA 5KHOA 3ZVVA 2NPTA 3VVWB 3DVNU 2FCMA 3RT3B 3PZDA 3IVFA 4G11A 2DYBA 3B0AA 5CTRC 4HXDA 1M94A 4ZRKA 4AP4C 3C0RB 4PS7A 1J19A 2PEAA 2LASA 1E90A 4TUUA 2MBEA 3A4RA 3KW5B 3K9OB 2GBJA 4BVUC 4LJOB 3UQBA 4WJQA 2KNBA 2BWFA 2D3GA 1JRUA 3KH0A 3PTFC 2O6VB 4HWIB 2KD0A 3H6NA 3TIXA 2FCNA 3QHTA 1ZGUB 3AU5A 4BFRA 2WDTB 2O6VA 1Q5WB 5DPSA 1J0GA 2LVPA 3SD5A 4XZ4A 4BBNF 3ZTDA 1C3TA 4F7ZA 1Z5SB 2ZCCA 3BINA 3R66C 3UF8A 1WXAA 3WA0A 3WAOA 1AARA 2JRHA 3NY5A 3KUDB 1OEYJ 1H4RA 2L8JA 1WGHA 2GBNA 4TQ1A 3ALBA 3H7PB 3I3TB 3N3KB 4DHZB 5JHBA 2A5UA 2AL3A 4JQWC 1P3QU 2DZKA 3JVZX 3H7PA 1TTNA 1WMHA 3U30A 3V61A 1EUVB 2M1MA 2FCQA 3S2AA 2KTFA 2HJ8A 3TJPA 2L0TA 2KC1A 3PT2B 2C7MB 1G6JA 4KDIC 2ZZPB 2LXAA 5E6PA 3R7QA 2JZ3B 4IM3A 3VTWA 1FXTB 2KK8A 4URKA 4MH0E 2Z0EB 4G50A 2ASQA 2MX2A 4WJOA 1KJTA 2KWVB 2ZPYA 2L7RA 3GZNI 2NS5A 3NZSA 1QZEA 2V4LA 4HCNB 3DDCB 3ZKJC 4DWFA 1YIWA 3AXCA 4II2B 2ZPNA 1I42A 2MBQA 5DPWA 3ZRCA 4WAAA 1LFDA 3AULA 2G3QB 4JGHB 3OLMD 4N9F4 4W9EA 4AJWA 1E7VA 1YQBA 2N1VA 4I6LB 4BKSD 3Q3FA 1BT0A 1S3SG 1WH3A 1WJNA 4A20A 1RLFA 2LGYA 3IBEA 3VXWA 4B9KA 2JT4B 1K8RB 2C9WB 2M0XA 4NQKE 4F1SA 5HKHA 3VTVA 2GMIC 2J0JA 4FJVB 1X1MA 4NNJB 3ZNHB 4PS8A 4GXBA 1V2YA 4EUTA 4EZJA 4EZKA 1Q1OA 3BY4B 3DVGY 5AZGA 2B3AA 3QX1A 4DHJB 2L0FA 5D94A 2KO3A 5LXHA 2GBKA 1Q0WB 4B6WA 4CHKA 4ZYNA 1LQBA 2N9EB 3L54A 4MGIE 5J2RA 4GDLB 2L00B 2IBIB 4AJYB 1OQYA 3VQIA 4FJYA 1YJ1A 4GDLA 3TBLD 5L95C 1WR1A 2KDBA 2LWPA 4CO7A 3NHEB 1ZW7A 3L08A 3UINB 4MSMB 2LGXA 3T8MA 3ENEA 2V1YA 4GDKB 2ZVOA 2GBMA 5TR5A 3ZDTA 3R3MA 2IYDB 1UBQA 2G4SA 3PRMB 4NJ6A 2DYOA 3VH4B 3UQAA 2OOBB 4W9IA 4LCDE 4DBGA 1WGDA 2LUEA 1XD3B 4MGYE 2V3SA 2N4FA 2XEWA 4JL9A 3A33B 2K8CA 2I1JA 3RD2A 1YX5B 3EC8A 4FN2A 3A9JA 3M3JA 1P1AA 3U8ZA 1V81A 2DZJA 2K8HA 3JSVB 1WXSA 2ZVNA 3N32A 2KXJA 1XQQA 2LZ6A 3NOBA 4KSLC 2IY1B 2IO2B 3APFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JSV A;  4PYU A;  5AEK B;  4P7I A;  5DPT A;  2ZEQ A;  3M95 A;  3IFW B;  4BBN C;  3ML8 A;  3PHW B;  3W1S A;  4W9H A;  4DK5 A;  1V86 A;  1XT9 B;  2O2V B;  4K7U A;  4EEW A;  4FA6 A;  2M17 A;  2FUH B;  4ANW A;  1ZKH A;  5L83 A;  2REX A;  4WWP A;  1UD7 A;  1GJZ A;  2O2V A;  3SDL C;  2K25 A;  4KIK B;  2KDF B;  5JHA A;  2J0M A;  2MP2 B;  1HE8 A;  1S1Q B;  4KIK A;  2KAN A;  2L05 A;  4WJP A;  2BKR B;  2CU1 A;  4BKG A;  2WX0 A;  4HLE A;  2MP2 A;  5GMV A;  2JF5 A;  1D3Z A;  2LRU A;  3WAM A;  1WFY A;  1RRB A;  3HIZ A;  3IG3 A;  5AZH A;  3HHM A;  4IG7 B;  3NZU A;  2IO1 B;  2KQ7 A;  1WIA A;  1RAX A;  3RYT A;  3EFU A;  2DAF A;  4KV2 A;  4NJ7 A;  1L2N A;  2DYM A;  1UBI A;  4TQ0 A;  1WF9 A;  1P9D U;  2BYE A;  4K81 A;  3PLV A;  3KUZ A;  4FAD A;  4G0N B;  3K9P B;  1WJ6 A;  2C7N B;  2W9N A;  1RFA A;  2FNJ B;  3HM6 X;  4NQL B;  1WY8 A;  2O6V D;  2L76 A;  3DBH I;  4MJS B;  2FID A;  2AWT A;  2KTR B;  2KOX A;  2HE7 A;  3KYD D;  3LDZ E;  3PVL A;  4HCP B;  2Z0D B;  3W1Y A;  3X23 A;  2LVQ A;  2HTH A;  2NBV B;  3KYC D;  1KOT A;  4MJS A;  1IPG A;  2KTR A;  1WXV A;  3L10 B;  1VD2 A;  3VFK A;  4LDT D;  3ML9 A;  1TGZ B;  1V5T A;  3QQ8 B;  1GG3 A;  2KC2 A;  3D32 A;  3PRE A;  1SGH A;  4W9L A;  4BOS C;  3DQV A;  2UYZ B;  3PSE B;  1E8Y A;  3ZIM A;  2BPS A;  1E8X A;  1R4N I;  3VUW A;  3PGE A;  4AOF A;  1IP9 A;  3PPA A;  3L17 A;  4LJP B;  2CS4 A;  1Z2M A;  3DBL I;  3VH3 B;  4HPL B;  3GOE A;  4W9C A;  4I6N B;  2FCS A;  2ZCB A;  4W9J A;  4KDL B;  5IA7 A;  4ZRI A;  3U7D A;  4IWQ A;  5JZE B;  1EF1 A;  1KM7 A;  4HDO A;  3QCA A;  2KVR A;  3M63 B;  5AZF A;  2KDI A;  1NI2 A;  1E5W A;  4W9K A;  2IY0 B;  3A1Q B;  3KVF B;  4ICU A;  1E8W A;  1WGY A;  2NR2 A;  4WWN A;  3TL5 A;  2GBR A;  1WE7 A;  5KHQ A;  5E6O A;  2MBO A;  2NCN A;  3V62 A;  1YD8 U;  2MA9 B;  3ZUN A;  4EZL A;  2JVC A;  2K6Q A;  4TV3 A;  4WWO A;  3ZNZ B;  4ASW C;  4FJZ A;  2KFK B;  4MGZ E;  5D7G A;  1VCB A;  1WJU A;  3RZF A;  3ZNG C;  4A3P A;  3Q3J A;  1F9J A;  3JYU A;  2CHX A;  4W9G A;  2KFK A;  2KN5 A;  3ECI A;  2KFJ A;  3QK0 A;  2FIF A;  3QIJ A;  4G3X B;  2FAZ A;  4JLC A;  2BKF A;  4FLH A;  4ZRJ A;  1P0R A;  1WZ0 A;  4GN1 A;  5E6N A;  4XX5 A;  2LJ5 A;  5LXI B;  2Z59 B;  2KJH B;  4HJK A;  1I35 A;  2LRW A;  2KDE B;  3MHS D;  4KZ0 A;  3RUL A;  2OJR A;  3H7S A;  4DHJ D;  2WWZ A;  2KLG A;  3PHX B;  4ANV A;  2PPH A;  2JZZ A;  4GDK A;  2D2Q A;  2I1K A;  2NVU I;  3DPD A;  1ISN A;  4KZC A;  2PE6 B;  4M8M A;  3CST A;  3DOW A;  4ANX A;  4NAW B;  4FUL A;  1R4M I;  2ZNV C;  3PS6 A;  1GC7 A;  2YLM A;  3OJ3 A;  3NS8 A;  2YVC A;  4KSK C;  4NAW A;  2MSE D;  4PYZ A;  5J17 A;  4DHZ E;  2J7Q B;  2RGF A;  4EOY A;  4BKT A;  2RPQ A;  1WM3 A;  2K1F A;  5CHV C;  1EO6 A;  3ZW3 A;  1OEY A;  2JXX A;  1TBE A;  2XK5 B;  3H9D A;  2N1W A;  5LLI A;  5C1Z A;  3KUC B;  1PQS A;  2XBB C;  5C23 A;  2CHW A;  2D11 A;  2R2O A;  3DBR I;  1WZ3 A;  2XK5 A;  2G45 B;  2KX0 A;  3CMM B;  2IO0 B;  3QA8 A;  2MQJ A;  3TCA A;  1SE9 A;  5DPR A;  1WX9 A;  2D10 A;  1V6E A;  2Y5B B;  1CMX B;  2LD9 A;  1V49 A;  4IW0 A;  1WM2 A;  3TMP B;  4ANU A;  4DXA B;  4GB9 A;  4I6P A;  4MEL A;  3DCG A;  2DZM A;  2N9P C;  5FR6 A;  2DZI A;  2KWU B;  3WAL A;  4XC2 A;  2JRI B;  1U4A A;  5CX3 A;  1OTR B;  5CHW A;  2C5L C;  1V9J A;  2N9X A;  1GUA B;  1LXD A;  4E71 A;  3ZDM C;  4IM0 A;  3B1L X;  2IO3 B;  4MGK E;  2BYF A;  2MBH A;  3WAP A;  2NPT B;  3HK0 A;  1L7Y A;  4A3O A;  2M4N A;  2EMS A;  3H1U A;  4BOZ B;  5D6J B;  3V60 A;  3ZNI D;  2BYV E;  4KVG B;  5G2N A;  3LJ3 A;  2IZV B;  1WI0 A;  1WGR A;  2A4Z A;  3UGB B;  2WX1 A;  3N30 A;  2DX5 B;  3SHQ A;  3AI5 A;  4NPN A;  4HPM B;  4GOC A;  4FHK A;  2EKE C;  2ZJD A;  4K7W A;  3APD A;  3M62 B;  1E8Z A;  3OJ4 B;  3RZW C;  2KZR A;  2G4D B;  1WE6 A;  2BGF A;  3L0W B;  2KQS A;  2ZNV B;  3RUI B;  2MBB B;  4B95 A;  5EDS A;  3V6C B;  1T0Y A;  4GMV A;  4K7S A;  1C1Y B;  3PRZ A;  3VUY A;  3RCZ A;  1GC6 A;  1OGW A;  1WX8 A;  3V6E B;  5D2M B;  2LXC A;  4LDT B;  4EFO A;  3SU8 X;  2AL6 A;  3UIP B;  2K39 A;  2MWS B;  3B08 A;  2WYQ A;  1EF5 A;  2UWQ A;  3EHV A;  1WMH B;  2NBW B;  4DDG D;  2KMC A;  1KLV A;  3DBS A;  2CHZ A;  2KKC A;  2LGD A;  4MSQ B;  2R2Q A;  4E74 A;  2BWE S;  1NBF C;  4OVV A;  3R7R A;  3QC8 B;  4M0W B;  3PV1 A;  1WJ4 A;  4GU2 A;  3DVG X;  3CSF A;  1WRD B;  2K8B A;  3L16 A;  3QWZ B;  4BKS A;  2LI5 A;  4IC7 B;  2KHW B;  4GSW A;  4M8N A;  1E7U A;  3QAR A;  3A9K B;  3DVN V;  2DHZ A;  4II3 B;  4W9D A;  1V80 A;  3A1Q A;  3W1S C;  3A9K A;  1H8C A;  1WGG A;  1UH6 A;  2K6D B;  4HK2 A;  3AU4 A;  1A5R A;  2C60 A;  2DAJ A;  4WQO B;  1UEL A;  3HM3 A;  4MM3 A;  3VAW A;  2RR9 A;  2HD5 B;  3VTU A;  1SIF A;  4E3C A;  2KLC A;  4HDQ A;  3CF6 E;  3MTN B;  5CHF A;  4RMA A;  3ZRF A;  2VRR B;  2LVO A;  3ZTC A;  2KWC A;  4HVB A;  1J8C A;  1MG8 A;  3QAQ A;  4TKN A;  4AUQ C;  2PJH A;  4IWP A;  2AYO B;  4OVU A;  3PRP B;  1UGM A;  5J18 A;  4K1R B;  4IUM B;  4FHJ A;  5G55 A;  1IYF A;  1WYW B;  2BF8 B;  2KMA A;  3EEC A;  2RSU A;  3ONS A;  4MEM A;  3VHT C;  3UIO B;  4X57 B;  3WIM A;  1WR6 E;  4GGQ A;  2JY6 A;  3QJZ A;  3JW0 X;  4EKU A;  5JH5 C;  4FBJ B;  2KX3 A;  4AWJ A;  1Y8R C;  1V5O A;  3O65 B;  2MW5 A;  4MDK E;  1YX6 B;  3ZO5 B;  3T9L A;  1LM8 B;  2NBU A;  2MRP A;  2GOW A;  3OAW A;  4ICV A;  4RM8 A;  4JIO U;  1UZX B;  4PS3 A;  3VDZ A;  3L13 A;  2AEH A;  4NY0 A;  2JUO A;  2JWZ A;  1GNU A;  2CR5 A;  2KJR A;  2RD0 A;  2J0K A;  2QHO A;  4F8C B;  1WXM A;  4ZDV A;  1WX7 A;  2MCN B;  3A9J B;  3PLU A;  4RM9 A;  5BO4 B;  1NDD A;  2KJ6 A;  2N7D A;  2CKH B;  2JPH A;  2C7H A;  4DDI D;  3WAN A;  3ZLZ A;  3APC A;  1P98 A;  2EMT A;  5IAA C;  3A4S C;  4W9F A;  3IHP C;  2L3Z A;  3X0W A;  4CYE A;  4GIV A;  4YL8 A;  4IWO A;  3MJW A;  2D07 B;  3VUX A;  2DEN B;  1TZ1 A;  4IM2 A;  3P2B A;  4J6I A;  2PE9 A;  5DCN A;  2M8S A;  4WJN A;  2N7E A;  2MLB A;  5KHO A;  3ZVV A;  2NPT A;  3VVW B;  3DVN U;  2FCM A;  3RT3 B;  3PZD A;  3IVF A;  4G11 A;  2DYB A;  3B0A A;  5CTR C;  4HXD A;  1M94 A;  4ZRK A;  4AP4 C;  3C0R B;  4PS7 A;  1J19 A;  2PEA A;  2LAS A;  1E90 A;  4TUU A;  2MBE A;  3A4R A;  3KW5 B;  3K9O B;  2GBJ A;  4BVU C;  4LJO B;  3UQB A;  4WJQ A;  2KNB A;  2BWF A;  2D3G A;  1JRU A;  3KH0 A;  3PTF C;  2O6V B;  4HWI B;  2KD0 A;  3H6N A;  3TIX A;  2FCN A;  3QHT A;  1ZGU B;  3AU5 A;  4BFR A;  2WDT B;  2O6V A;  1Q5W B;  5DPS A;  1J0G A;  2LVP A;  3SD5 A;  4XZ4 A;  4BBN F;  3ZTD A;  1C3T A;  4F7Z A;  1Z5S B;  2ZCC A;  3BIN A;  3R66 C;  3UF8 A;  1WXA A;  3WA0 A;  3WAO A;  1AAR A;  2JRH A;  3NY5 A;  3KUD B;  1OEY J;  1H4R A;  2L8J A;  1WGH A;  2GBN A;  4TQ1 A;  3ALB A;  3H7P B;  3I3T B;  3N3K B;  4DHZ B;  5JHB A;  2A5U A;  2AL3 A;  4JQW C;  1P3Q U;  2DZK A;  3JVZ X;  3H7P A;  1TTN A;  1WMH A;  3U30 A;  3V61 A;  1EUV B;  2M1M A;  2FCQ A;  3S2A A;  2KTF A;  2HJ8 A;  3TJP A;  2L0T A;  2KC1 A;  3PT2 B;  2C7M B;  1G6J A;  4KDI C;  2ZZP B;  2LXA A;  5E6P A;  3R7Q A;  2JZ3 B;  4IM3 A;  3VTW A;  1FXT B;  2KK8 A;  4URK A;  4MH0 E;  2Z0E B;  4G50 A;  2ASQ A;  2MX2 A;  4WJO A;  1KJT A;  2KWV B;  2ZPY A;  2L7R A;  3GZN I;  2NS5 A;  3NZS A;  1QZE A;  2V4L A;  4HCN B;  3DDC B;  3ZKJ C;  4DWF A;  1YIW A;  3AXC A;  4II2 B;  2ZPN A;  1I42 A;  2MBQ A;  5DPW A;  3ZRC A;  4WAA A;  1LFD A;  3AUL A;  2G3Q B;  4JGH B;  3OLM D;  4N9F 4;  4W9E A;  4AJW A;  1E7V A;  1YQB A;  2N1V A;  4I6L B;  4BKS D;  3Q3F A;  1BT0 A;  1S3S G;  1WH3 A;  1WJN A;  4A20 A;  1RLF A;  2LGY A;  3IBE A;  3VXW A;  4B9K A;  2JT4 B;  1K8R B;  2C9W B;  2M0X A;  4NQK E;  4F1S A;  5HKH A;  3VTV A;  2GMI C;  2J0J A;  4FJV B;  1X1M A;  4NNJ B;  3ZNH B;  4PS8 A;  4GXB A;  1V2Y A;  4EUT A;  4EZJ A;  4EZK A;  1Q1O A;  3BY4 B;  3DVG Y;  5AZG A;  2B3A A;  3QX1 A;  4DHJ B;  2L0F A;  5D94 A;  2KO3 A;  5LXH A;  2GBK A;  1Q0W B;  4B6W A;  4CHK A;  4ZYN A;  1LQB A;  2N9E B;  3L54 A;  4MGI E;  5J2R A;  4GDL B;  2L00 B;  2IBI B;  4AJY B;  1OQY A;  3VQI A;  4FJY A;  1YJ1 A;  4GDL A;  3TBL D;  5L95 C;  1WR1 A;  2KDB A;  2LWP A;  4CO7 A;  3NHE B;  1ZW7 A;  3L08 A;  3UIN B;  4MSM B;  2LGX A;  3T8M A;  3ENE A;  2V1Y A;  4GDK B;  2ZVO A;  2GBM A;  5TR5 A;  3ZDT A;  3R3M A;  2IYD B;  1UBQ A;  2G4S A;  3PRM B;  4NJ6 A;  2DYO A;  3VH4 B;  3UQA A;  2OOB B;  4W9I A;  4LCD E;  4DBG A;  1WGD A;  2LUE A;  1XD3 B;  4MGY E;  2V3S A;  2N4F A;  2XEW A;  4JL9 A;  3A33 B;  2K8C A;  2I1J A;  3RD2 A;  1YX5 B;  3EC8 A;  4FN2 A;  3A9J A;  3M3J A;  1P1A A;  3U8Z A;  1V81 A;  2DZJ A;  2K8H A;  3JSV B;  1WXS A;  2ZVN A;  3N32 A;  2KXJ A;  1XQQ A;  2LZ6 A;  3NOB A;  4KSL C;  2IY1 B;  2IO2 B;  3APF A; 
#chains in the Genus database with same CATH topology
 1IGD A;  5AEK B;  2GLS A;  1V86 A;  4RGO S;  2M17 A;  3BZD B;  4IOI E;  4ANW A;  2O2V A;  4WIP A;  1TY0 A;  1HE8 A;  4KIK A;  2L05 A;  4RGT A;  4BKG A;  2WX0 A;  4HLE A;  2MP2 A;  3GE8 C;  3IG3 A;  4IG7 B;  3NZU A;  2KQ7 A;  1WIA A;  1RAX A;  3RYT A;  3EFU A;  4NJ7 A;  3B2G A;  4US8 A;  1MPE A;  4AS1 A;  2BYE A;  1C9F A;  3PLV A;  4ZHP A;  2ONQ A;  2OHF A;  2C7N B;  4NQL B;  1I7H A;  3DBH I;  3NG0 A;  4MJS B;  1L2N A;  4HKZ E;  2LVQ A;  3KYC D;  2NBV B;  1WXV A;  1SF0 A;  4BZA A;  3QQ8 B;  3NRZ A;  1GG3 A;  3D32 A;  4W9L A;  2BPS A;  1R4N I;  3WCQ A;  3EA6 A;  5D3D A;  2JXT A;  2QC8 A;  4W9C A;  2FCS A;  2ZCB A;  1XF5 L;  3VRB B;  2PMV A;  4ARI A;  2KVR A;  2LMC A;  3A1Q B;  4C4V A;  3KVF B;  1E8W A;  1WGY A;  2NR2 A;  4WWN A;  1VLB A;  2GBR A;  5KHQ A;  5E6O A;  3V62 A;  2CJN A;  1YD8 U;  2MA9 B;  2K6Q A;  5FR3 A;  4TV3 A;  4WWO A;  3ZNZ B;  4ASW C;  4FJZ A;  1YOV B;  4MGZ E;  4HKQ A;  1QKZ A;  3RZF A;  4A3P A;  5MPO A;  1F9J A;  2KN5 A;  4DQO C;  2KFJ A;  4G3X B;  2FAZ A;  4JLC A;  3P4Q B;  4GN1 A;  2DBY A;  3MC9 A;  4XX5 A;  5LXI B;  5E6J A;  2Y3A A;  2Z8L A;  2IDY A;  1J7C A;  2OJR A;  3ABV B;  3PO0 A;  4DHJ D;  2WWZ A;  2KLG A;  4ANV A;  2I1K A;  2H89 B;  1L0X B;  4ANX A;  4NAW B;  1HEZ E;  2ZNV C;  3PS6 A;  4PYZ A;  4DHZ E;  1FM0 D;  1ZXH A;  2BYT A;  4RCO A;  4BKT A;  2JXX A;  1AW7 A;  5C1Z A;  3H9D A;  3I63 C;  2R61 A;  2CHW A;  2D11 A;  4O1N A;  3CMM B;  3OWE B;  2D10 A;  1SE4 A;  2LD9 A;  4YTP B;  3GB1 A;  4I6P A;  4R3D A;  2N9P C;  3DHH C;  3WAL A;  1E7P B;  4E71 A;  1OTR B;  3ZDM C;  3HK0 A;  4A55 A;  4A3O A;  2M4N A;  3H1U A;  2GI9 A;  3FKY A;  3BK1 A;  3H8H A;  3DHG C;  1FO4 A;  1R7S A;  2A4Z A;  1FIQ A;  1GAQ B;  3N30 A;  4NPN A;  3RNA C;  2ZJD A;  2K3U A;  4YTN B;  3M62 B;  3OJ4 B;  3MP9 A;  2D5G A;  1TIF A;  3PRZ A;  3T3O A;  1GC6 A;  4YXD B;  1YN4 A;  2LXC A;  4LDT B;  4RGM A;  2AL6 A;  3UIP B;  1SJE D;  3TEZ A;  3EHV A;  5C2T B;  2NBW B;  1KLV A;  4TMA B;  1CQV A;  2TSS A;  4E74 A;  2BWE S;  4OVV A;  1QIL A;  3PV1 A;  1SB3 C;  3RNB C;  3U52 E;  2WXJ A;  1Y56 A;  2KHW B;  1E7U A;  3DVN V;  4W9D A;  1QT9 A;  1UH6 A;  4YT0 B;  1A5R A;  2KN4 A;  2DAJ A;  4MM3 A;  1C76 A;  2HD5 B;  3VTU A;  2KLC A;  1CK1 A;  1I4R A;  4XWW A;  3MTN B;  4HVB A;  1MG8 A;  4AUQ C;  3AED B;  4IWP A;  4WQM A;  4LNI A;  4IUM B;  4FHJ A;  1PGA A;  3ONS A;  3VHT C;  1WR6 E;  1C78 A;  5H8Y E;  4FBJ B;  1XCQ L;  1Y8R C;  1JQ4 A;  4ICV A;  5HG2 A;  4JIO U;  1HTO A;  3VDZ A;  2IND C;  2AEH A;  2CR5 A;  3PLU A;  2KJ6 A;  2N7D A;  3AEG B;  2EMT A;  1V8C A;  3AV8 A;  1HXY D;  4IWO A;  3MJW A;  4YL8 A;  3ZXV A;  1TZ1 A;  3KWV A;  4YWG G;  3C8Y A;  1QOF A;  4L23 A;  3IT4 B;  3ZVV A;  2NPT A;  3VVW B;  1EU3 A;  4P16 A;  3DVN U;  2IJ0 A;  3RNC C;  1YJJ A;  4G11 A;  1EU4 A;  2N9L A;  5CTR C;  1M94 A;  3BYT B;  1J19 A;  2B76 B;  1E90 A;  3AEF B;  3K9O B;  4LJO B;  3UQB A;  4WJQ A;  1N5X A;  3PTF C;  1JRU A;  3KH0 A;  2KD0 A;  2WNM A;  1YQ4 B;  2KVZ A;  1Q5W B;  4BBN F;  3ZTD A;  4F7Z A;  3BIN A;  1TKE A;  1AAR A;  2L83 A;  4L1B A;  3Q8A A;  1PUT A;  3AEA B;  4NJC A;  1PFD A;  1WMH A;  2M1M A;  3U4E G;  4RFB A;  2KC1 A;  5E6P A;  3AN1 A;  3VTW A;  2Z0E B;  1J7B A;  3AE3 B;  4LNN A;  4WJO A;  3GZN I;  2WXH A;  1V1P A;  2WS3 B;  2L52 A;  2LEK A;  3AXC A;  2MBQ A;  1LFD A;  3OLM D;  1S3S G;  1WH3 A;  1RLF A;  3EFC A;  3IBE A;  3VXW A;  2KYW A;  1FFU A;  4NNJ B;  1T3Q A;  4GXB A;  4EUT A;  3BY4 B;  4HJG E;  2B3A A;  3QX1 A;  2I38 A;  3HVZ A;  3RNG C;  3NVV A;  4B6W A;  4CHK A;  4ZYN A;  1LQB A;  2W3S A;  3Q3N C;  1WYG A;  5J2R A;  2L00 B;  4DXG A;  3AE8 B;  5EE3 A;  4GDL A;  3TBL D;  1ZW7 A;  1CJE A;  4J3O D;  4GDK B;  1V1O A;  3R3M A;  1UBQ A;  3VH4 B;  1F2R I;  3P1M A;  4W9I A;  4LCD E;  1JRP A;  2M19 A;  1P1A A;  3JSV B;  2FBW B;  3R8B A;  2LZ6 A;  2IY1 B;  3P4S B;  4WAF A;  3APF A;  4P7I A;  3M95 A;  3IFW B;  1ET6 A;  3PHW B;  4FA6 A;  1C4P A;  2REX A;  1UD7 A;  1F0Z A;  1GJZ A;  3IXS A;  2BT6 A;  2KDF B;  5JHA A;  1JCK B;  2J0M A;  1I4P A;  1S1Q B;  2LGS A;  4S0R A;  2JF5 A;  1WFY A;  2ON8 A;  1RRB A;  3CIR B;  2CJO A;  3SFD B;  2JU6 X;  3ZGZ A;  2PTL A;  2HTM E;  1YMH E;  4KV2 A;  2WGS A;  2KAJ A;  1FRD A;  2DYM A;  1L0V B;  1P7E A;  2JQR B;  3PZ7 A;  4K81 A;  2MJD A;  3SR6 A;  3V3X A;  4G0N B;  2K22 A;  3SEB A;  1RFA A;  2FNJ B;  3HM6 X;  2L76 A;  2KTR B;  2KOX A;  1AYF A;  3LDZ E;  3P4R B;  4HCP B;  3W1Y A;  2Z0D B;  3X23 A;  2HTH A;  4ARC A;  4MJS A;  1FEH A;  4KGR A;  1V5T A;  2KC2 A;  2JX5 A;  1NEN B;  2N7J A;  1IP9 A;  3FC4 A;  3L17 A;  1E9M A;  4HPL B;  2WXP A;  4N59 A;  2K5P A;  3P63 A;  5IA7 A;  3U7D A;  4YSY B;  4XDD A;  5AZF A;  2KDI A;  1NI2 A;  4W9K A;  3TL5 A;  3CWI A;  2ZW0 A;  4L2Y A;  2J53 A;  1VRA B;  3ZUN A;  1DOI A;  2KFK B;  3BYY B;  1VCB A;  3JYU A;  4YSX B;  4W9G A;  3QK0 A;  4PT5 A;  1MVK A;  1QLB B;  2ACZ B;  2BKF A;  1WZ0 A;  2LJ5 A;  1T0R C;  4HJK A;  2LRW A;  3H7S A;  3AB5 A;  3PHX B;  2JZZ A;  2D2Q A;  4FXC A;  1TKG A;  2ICI A;  2E3T A;  3DPD A;  4KZC A;  1JWU D;  3N1Z C;  3NS8 A;  1I4H A;  2MSE D;  4NAW A;  5J17 A;  1NEK B;  1TS3 A;  1C4A A;  3DBL B;  1WM3 A;  3ZW3 A;  2Y5C A;  1VDV A;  1TBE A;  2N1W A;  3I57 A;  1WZ3 A;  1NVI D;  2KX0 A;  1UGJ A;  2IO0 B;  2WLB A;  2LHD A;  4A8X C;  2MQJ A;  1L6U A;  3TCA A;  1SE9 A;  1D6E C;  5DPR A;  5BYR A;  3AEE B;  1V6E A;  2Y5B B;  4D2K A;  4IW0 A;  2N9K A;  3TMP B;  4US9 A;  3ZJU A;  3DCG A;  2IPK D;  2PVG C;  2I2Y A;  4JWS C;  3Q8B A;  5CX3 A;  1F77 A;  5CHW A;  3OG5 A;  5IOI A;  4IM0 A;  3LB8 C;  4MGK E;  4S17 A;  2BYF A;  2MBH A;  2J4X A;  1L7Y A;  2WXF A;  3R2I A;  1Q10 A;  4WUR A;  4HPP A;  5D6J B;  2BYV E;  5G2N A;  3LJ3 A;  1WI0 A;  1NI3 A;  4MH8 A;  3SHQ A;  2W54 A;  4YTM B;  2WXQ A;  1ACC A;  3RNF C;  2KZR A;  1WE6 A;  3RUI B;  2KQS A;  2ZNV B;  1EWC A;  1C1Y B;  3VUY A;  3RCZ A;  3V6E B;  2Q5W D;  1SBB B;  3SU8 X;  1ZOY B;  3IAS 1;  2MWS B;  1QOB A;  2N0S B;  2KMC A;  2CHZ A;  2PW9 A;  3EUB 2;  1XXG A;  2R2Q A;  1GB1 A;  1VZ8 A;  4M0W B;  1YN3 A;  3QWZ B;  5IN7 A;  1AN8 A;  4GSW A;  5EE9 A;  3A9K B;  4JE3 B;  5FKA C;  4LNO A;  2KDM A;  1SE2 A;  1FRR A;  3Q8E A;  2J42 A;  2C60 A;  4XYC A;  1UEL A;  2RR9 A;  4YSZ B;  1SIF A;  1FCL A;  3CF6 E;  4RMA A;  3ZRF A;  2VRR B;  2LVO A;  4TKN A;  2BVC A;  2PJH A;  1WXQ A;  4OZA A;  2AYO B;  2WHI A;  3PRP B;  4OVU A;  1UGM A;  1XLN A;  2WDV B;  4JWU C;  4K1R B;  5J18 A;  1IYF A;  4USA A;  2KMA A;  3EEC A;  1TS2 A;  2VH2 A;  3WIM A;  2QIE B;  4GGQ A;  2QCZ A;  3QJZ A;  1FXI A;  2AQ2 B;  2Y5P A;  2MW5 A;  4MDK E;  2NTS A;  3AE2 B;  2E6X A;  1YNT E;  2L32 A;  3T9L A;  3ZO5 B;  1LM8 B;  4MAC A;  1FXA A;  2GOW A;  3UI3 A;  1UZX B;  1JAL A;  4PS3 A;  4LK0 M;  5BYS A;  3R2T A;  1LO5 D;  4DXF A;  2INC C;  4ZDV A;  2MCN B;  1DOY A;  2CKH B;  3DHI C;  2C7H A;  1RWS A;  3A4S C;  4W9F A;  3EGR A;  4KGS A;  4RF1 A;  4C56 C;  1GPX A;  3BK2 A;  2PE9 A;  2RDG A;  5KHO A;  1FCC C;  3RT3 B;  1T5X D;  3PZD A;  4KGT A;  3O13 A;  3B0A A;  2WXO A;  1BUI C;  4PS7 A;  1T0Q C;  2PVO D;  4BVU C;  2KNB A;  2D3G A;  3TIX A;  3H6N A;  4OZB A;  4WWM A;  5DPS A;  1FFV A;  4XZ4 A;  1F1H A;  1Z5S B;  3R66 C;  2M56 B;  3WAO A;  3Q3M C;  1T0S C;  3V05 A;  1OEY J;  3RI7 C;  2L8J A;  1C77 A;  2WDR B;  3I3T B;  3N3K B;  4DHZ B;  3J9C A;  5JHB A;  4JQW C;  3JVZ X;  3NVW A;  3U30 A;  2D3C A;  3V61 A;  4PK1 A;  4LNF A;  1SSN A;  2C7M B;  1TJE A;  1FXT B;  3MC0 B;  4G50 A;  3N1Y C;  3NZS A;  2L7R A;  1QOG A;  1I4X A;  4HCN B;  4DWF A;  1I42 A;  1V97 A;  1TT5 B;  5DPW A;  4RGN A;  1SE3 A;  3AUL A;  4JGH B;  4W9E A;  4I6L B;  1FNU A;  4OHJ A;  4A20 A;  3DWG C;  3GE3 C;  1K8R B;  2M0X A;  4NQK E;  5BMG A;  5HKH A;  3VTV A;  4TSS A;  2GMI C;  1HA5 A;  3ZNH B;  1ROE A;  1N6Z A;  1V2Y A;  3BVG A;  5AZG A;  1B1Z A;  5LXH A;  5D94 A;  2KO3 A;  2CU3 A;  4MGI E;  2IBI B;  1DYQ A;  4Q2J A;  2JSV X;  4RF0 A;  1N61 A;  3E9S A;  2EKI A;  2DWQ A;  4CO7 A;  4MSM B;  2LGX A;  1ESF A;  1EWY C;  3ENE A;  2GBM A;  3ZDT A;  1RYJ A;  2IYD B;  3PRM B;  4OZC A;  4A9A A;  5GXG B;  3UQA A;  2WDQ B;  4DBG A;  1D5Z C;  3MHZ A;  4K3C A;  2RPV A;  1J7A A;  2YEP B;  3A33 B;  2RDB C;  2WXG A;  3A9J A;  3U8Z A;  1SIJ A;  1V81 A;  2ZVN A;  3N32 A;  2KXJ A;  3LXF A;  3NOB A;  2QJL A;  3TEY A;  5C23 A;  3JSV A;  3AH7 A;  5HI1 A;  5DPT A;  3AEC B;  1B9R A;  2ZEQ A;  1N63 A;  3ML8 A;  4DK5 A;  4W9H A;  2WXK A;  4EEW A;  5L83 A;  1OQQ A;  4WWP A;  3MC8 A;  2K25 A;  3T3N A;  5AUK A;  2AX5 A;  1IUE A;  2KAN A;  4WJP A;  4ZOH C;  2KT7 A;  4A6Q A;  2LRU A;  1D3Z A;  1VR9 A;  1I4Q A;  1M4V A;  3HIZ A;  5AZH A;  1TYG B;  2SAK A;  3AE7 B;  1UBI A;  1P9D U;  2V3P A;  4EE2 A;  1JWA D;  1NYR A;  3KUZ A;  4FAD A;  4ZRP A;  1N5W A;  2XN9 C;  1WJ6 A;  4XGA B;  2DNF A;  1WY8 A;  3KYD D;  2AWT A;  2HE7 A;  3PVL A;  4RH6 A;  1IPG A;  2KTR A;  3VFK A;  4LDT D;  1DGJ A;  2JYE A;  3PRE A;  1SGH A;  1E8Y A;  3ZIM A;  2VH1 A;  1E8X A;  3SFE B;  1UNS A;  3PGE A;  3PPA A;  4LJP B;  2CS4 A;  3DBL I;  3GOE A;  4I6N B;  4W9J A;  4KDL B;  5JZE B;  4IWQ A;  5IKC M;  1EF1 A;  1C79 A;  2LFI A;  4HDO A;  3QCA A;  1XLO A;  4ICU A;  4HRS A;  1HTQ A;  1NYQ A;  1D4B A;  2MBO A;  4EZL A;  2M0A A;  1PDX A;  3ZNG C;  2BQQ A;  2CHX A;  3FAH A;  2KFK A;  2SEB D;  1JRO A;  3C19 A;  3U7Z A;  4FLH A;  1P0R A;  1KH0 A;  1I35 A;  2KDE B;  1K52 A;  2NVU I;  1ISN A;  4ZHO A;  3DOW A;  2KMM A;  2RMM A;  1GC7 A;  3U2S C;  2YVC A;  2J7Q B;  4EOY A;  1OQR A;  5CHV C;  1EO6 A;  1OEY A;  2XK5 B;  3KQ4 A;  3P4P B;  1PQS A;  3Q6B A;  1JW9 D;  2R2O A;  3TUO A;  2KQ4 X;  1FMA D;  3QA8 A;  1CMX B;  1V49 A;  4DXA B;  4GB9 A;  1E10 A;  4P1C C;  5FR6 A;  2LHE A;  2DZI A;  2KWU B;  4XC2 A;  2JRI B;  1U4A A;  1XO3 A;  1V9J A;  2LGI A;  3AE9 B;  2IO3 B;  3WAP A;  2NPT B;  3HRD D;  5BMI A;  4BOZ B;  1L4Z B;  3IT6 B;  3V60 A;  3ZNI D;  3E56 A;  1WGR A;  2WX1 A;  1R4M B;  2DX5 B;  3AI5 A;  1XEE A;  3URY A;  3NZ3 A;  4GOC A;  4FHK A;  1FPY A;  1ZP0 B;  3FIL B;  3N1X C;  3RZW C;  2WXR A;  3ZYY X;  2BGF A;  3AE6 B;  3L0W B;  4KX6 B;  4B95 A;  5EDS A;  1T0Y A;  4GMV A;  3DBR B;  2BS2 B;  5D2M B;  1DOX A;  5G5G A;  2MJE A;  1EF5 A;  4IKG A;  1WMH B;  1VJK A;  2WQY B;  1VZ6 A;  1JWS D;  1WSP A;  2DLB A;  2KKC A;  2LGD A;  3TEW A;  3R7R A;  1WJ4 A;  4GU2 A;  3DVG X;  4KKJ A;  3CSF A;  1LGR A;  2K8B A;  3L16 A;  4M0W A;  4IC7 B;  1V1P B;  4NAM A;  3AE4 B;  2BS4 B;  4II3 B;  1V80 A;  3A1Q A;  3A9K A;  1H8C A;  2FE8 A;  1ZE3 D;  1IGC A;  1ZPS A;  4HK2 A;  1K53 A;  4WQO B;  3HM3 A;  4HDQ A;  1YQ3 B;  3KWL A;  2YEP F;  1J8C A;  3QAQ A;  3W2D A;  1MHX A;  3W5U B;  2V4I B;  5G55 A;  1WYW B;  2BF8 B;  1N60 A;  4MEM A;  5IO9 A;  2ZW1 A;  1K51 A;  4EKU A;  5JH5 C;  2KX3 A;  4AWJ A;  2HJ1 A;  1V5O A;  2V3N A;  2BB5 A;  3O65 B;  3NVZ A;  4B0M A;  1EM7 A;  3VR9 B;  4RM8 A;  3I5J C;  4NY0 A;  2X8X X;  2JUO A;  1GNU A;  2KJR A;  2RD0 A;  2J0K A;  1WXM A;  1WX7 A;  4RM9 A;  1NDD A;  1QOA A;  4DDI D;  1KFY B;  2PKO A;  4N6E B;  3WAN A;  3ZLZ A;  1P98 A;  3LYY A;  1D5M C;  4M02 A;  3IHP C;  3N20 C;  3X0W A;  4GIV A;  2D07 B;  2MH7 A;  3VUX A;  2DEN B;  3P2B A;  1XLQ A;  2M8S A;  4WJN A;  2N7E A;  2MLB A;  3IVF A;  1XCT L;  5FK9 C;  2DYB A;  1IBX B;  4HXD A;  4ZRK A;  1GB4 A;  4AP4 C;  2MBE A;  3NJT A;  2WXN A;  1ZXI A;  4H2A A;  3BVZ A;  1XLP A;  2BWF A;  2O6V B;  4XWT A;  3QHT A;  1ZGU B;  2WDT B;  1L6V A;  1RM6 C;  1J0G A;  2AQ1 B;  3SD5 A;  2JYT A;  1HZ6 A;  1C3T A;  3KLS X;  2ZCC A;  3RMK C;  3UF8 A;  1WXA A;  1KLU D;  1UF0 A;  3KUD B;  1H4R A;  1P7F A;  1WGH A;  2GBN A;  4TQ1 A;  3H7P B;  3Q8C A;  2A5U A;  1P3Q U;  4C80 A;  1TTN A;  2KAC A;  1EUV B;  2FCQ A;  3W9C B;  2HJ8 A;  3TJP A;  2L0T A;  3PT2 B;  1A70 A;  2HDE A;  2LXA A;  5BYQ A;  4IM3 A;  4URK A;  3AMZ A;  2MEK A;  4MH0 E;  3RNE C;  1L4D B;  2ASQ A;  1KJT A;  2KWV B;  2ZPY A;  1QZE A;  2V4L A;  3ZKJ C;  3DDC B;  3NS1 A;  4II2 B;  3B9J A;  1ZUD 2;  4WAA A;  4N9F 4;  4AJW A;  1YQB A;  1SJH D;  3Q3F A;  4BKS D;  1WJN A;  4REZ A;  2LGY A;  2IGH A;  4ACF A;  2VZK B;  2C9W B;  2WP9 B;  3RPF C;  4JX1 C;  3ZQ4 A;  2W55 A;  5H92 C;  2WXI A;  2L0F A;  2GBK A;  1Q0W B;  3NUH B;  2N9E B;  3L54 A;  1OFF A;  3AEB B;  1OQY A;  5IP4 D;  4FJY A;  5HHD G;  5L95 C;  1F2R C;  1WR1 A;  2KDB A;  2LWP A;  1TS5 A;  3NHE B;  4IDI A;  1HZ5 A;  2V1Y A;  2ZVO A;  5TR5 A;  2FUG 1;  2MJ3 A;  2G4S A;  4NJ6 A;  1I4G A;  2DYO A;  2OOB B;  1ENF A;  2J52 A;  1MJD A;  1YN5 A;  4MGY E;  2V3S A;  2XEW A;  4JL9 A;  5EE1 A;  1ET9 A;  1TY2 A;  2I1J A;  2LUM A;  3RD2 A;  1L0Y B;  4FN2 A;  1CZP A;  1SXT A;  1SEB D;  1WXS A;  4KSL C;  2IO2 B;  4PYU A;  4K3B A;  4BBN C;  3W1S A;  1XT9 B;  2O2V B;  4K7U A;  4N58 A;  4RNA A;  2FUH B;  1ZKH A;  2W82 A;  4GLS C;  3SDL C;  1RFK A;  4KIK B;  1PYW D;  2MP2 B;  2WXL A;  2BKR B;  2CU1 A;  5GMV A;  1BML C;  3WAM A;  3HHM A;  2IO1 B;  5G5H A;  1YJI A;  1MG4 A;  4M01 A;  2BTE A;  2DAF A;  1STE A;  4TQ0 A;  1WF9 A;  1ZDX A;  4WH4 A;  3K9P B;  3HUI A;  2W9N A;  1WWT A;  2O6V D;  3L4P A;  4ZRQ A;  2FID A;  3BWU D;  1PGX A;  2JZP A;  1KOT A;  1KRH A;  5BMH A;  3L10 B;  1VD2 A;  3ML9 A;  1TGZ B;  2MHJ A;  4QAY A;  3VR8 B;  4BOS C;  3DQV A;  2UYZ B;  3PSE B;  2D3B A;  5LNK 1;  3VUW A;  2IGG A;  4AOF A;  3ZXR A;  5HFY A;  1Z2M A;  3VH3 B;  4LNK A;  2D3A A;  2QMT A;  1WGK A;  4ZRI A;  1E0Z A;  4C4V B;  3ETR A;  1KM7 A;  3M63 B;  1GOZ A;  4P6V F;  1E5W A;  2IY0 B;  4A90 A;  1WE7 A;  4M00 A;  2OED A;  2NCN A;  2JVC A;  4HEA 1;  4OW0 A;  5D7G A;  2WU5 B;  1WJU A;  3Q3J A;  2K9X A;  3ECI A;  2G1E A;  2VZK D;  2FIF A;  3QIJ A;  4ZRJ A;  5E6N A;  2Z59 B;  2KJH B;  3DBH B;  3MHS D;  4KZ0 A;  3RUL A;  2PPH A;  4GDK A;  1FNW A;  2GRI A;  2IGD A;  4M8M A;  2PE6 B;  3CST A;  4FUL A;  1R4M I;  2YLM A;  3OJ3 A;  1R4N B;  4KSK C;  2RGF A;  1WRI A;  3AE5 B;  2INN E;  2RPQ A;  2K1F A;  4KKI A;  2BS3 B;  5LLI A;  2WU2 B;  3KUC B;  2XBB C;  3DBR I;  2XK5 A;  2G45 B;  1WX9 A;  4ITK A;  2GB1 A;  2UU7 A;  4P1B C;  1WM2 A;  4ANU A;  4MEL A;  2DZM A;  2C5L C;  2N9X A;  1GUA B;  1LXD A;  1JWM D;  3B1L X;  3ZJV A;  3BII D;  5EE0 A;  2KWD A;  2X38 A;  2EMS A;  3DWM A;  5I4D A;  4KVG B;  1KF6 B;  2IZV B;  2BB6 A;  2QDF A;  2XNA C;  3UGB B;  4HPM B;  1PGB A;  2EKE C;  4K7W A;  3APD A;  2EEL A;  4UDU C;  1QQR A;  1E8Z A;  4ZYS A;  2G4D B;  3FIL A;  2MBB B;  1MHH E;  3V6C B;  4K7S A;  1OGW A;  1WX8 A;  2QSD A;  4EFO A;  2JWU A;  2LJI A;  2K39 A;  2NTT A;  2WYQ A;  3B08 A;  2UWQ A;  2W3R A;  4DDG D;  3DBS A;  4MSQ B;  1NBF C;  3QC8 B;  1MFW A;  3ZJT A;  1ZDV A;  1WRD B;  4BKS A;  2LI5 A;  3P42 A;  1JML A;  4M8N A;  3QAR A;  2DHZ A;  2NMQ A;  2L1A A;  4LLG M;  3W1S C;  1WGG A;  4MM3 B;  2K6D B;  3AU4 A;  3IAM 1;  3VAW A;  3I9V 1;  4E3C A;  5CHF A;  3ZTC A;  2KWC A;  1TZO A;  4HRO A;  5D3I B;  3AE1 B;  5TSS A;  4JPS A;  2RSU A;  5T8I A;  4CQN A;  2V9H A;  3UIO B;  4X57 B;  2JY6 A;  3JW0 X;  4C7Z A;  1C4C A;  2QEJ C;  3VRA B;  3TSS A;  1YX6 B;  3B2F A;  2NBU A;  4XE0 A;  2MRP A;  3OAW A;  3L13 A;  4F8C B;  2JWZ A;  2QHO A;  1D5X C;  3TEX A;  3A9J B;  5BO4 B;  3W5V B;  1K50 A;  3HVD A;  2INP E;  2JPH A;  4XDC A;  3APC A;  1FD6 A;  5IAA C;  2QIL A;  3MFG A;  3RFZ B;  2L3Z A;  4CYE A;  5AUI A;  3GP7 A;  1L5P A;  4IM2 A;  4J6I A;  5DCN A;  2PIA A;  1T6B X;  2FCM A;  1HQR D;  1AWD A;  1MI0 A;  3C0R B;  1IBX A;  2PEA A;  2LAS A;  4TUU A;  1VZ7 A;  3A4R A;  3KW5 B;  1UWX A;  2GBJ A;  1UWM A;  4HWI B;  2FCN A;  3AU5 A;  4BFR A;  3BVM A;  2O6V A;  3Q69 A;  2LVP A;  2PLP A;  3GS2 A;  4AQ7 A;  3WA0 A;  2JRH A;  3Q3O C;  3NY5 A;  3ALB A;  2BW2 A;  2H88 B;  4MT5 A;  4C7Y A;  2AL3 A;  2DZK A;  3Q14 C;  3H7P A;  1KLG D;  3S2A A;  2KTF A;  4OVZ A;  3RN9 C;  1E6E B;  3Q8F A;  2WXM A;  1G6J A;  4KDI C;  2ZZP B;  3R7Q A;  2JZ3 B;  2KK8 A;  5JXV A;  2MX2 A;  2NS5 A;  1YIW A;  1UUP A;  2ZPN A;  3ZRC A;  2G3Q B;  1E7V A;  2N1V A;  1BT0 A;  3NVY A;  4B9K A;  2JT4 B;  4F1S A;  2RDH A;  2J0J A;  4FJV B;  1X1M A;  4B0E A;  4PS8 A;  4EZJ A;  4EZK A;  1Q1O A;  3DVG Y;  4DHJ B;  1F52 A;  4LTU A;  2K0P A;  2G9H D;  4GDL B;  1N62 A;  4AJY B;  3VQI A;  5C3J B;  3AM9 A;  1YJ1 A;  2BBC A;  3UIN B;  3L08 A;  3T8M A;  2AQ3 B;  3MJ5 A;  4C00 A;  1TKY A;  1QF6 A;  3N9Y C;  1TS4 A;  1WGD A;  2LUE A;  1XD3 B;  1FNV A;  2V0G A;  1JWB D;  3GZN B;  2N4F A;  2K8C A;  3PZ8 A;  1YX5 B;  3Q2A C;  4NZL B;  3EC8 A;  3M3J A;  2OJW A;  1BXT A;  4BAX A;  2DZJ A;  2K8H A;  1KTK A;  1XQQ A; 
#chains in the Genus database with same CATH homology
 3JSV A;  4PYU A;  5AEK B;  4P7I A;  5DPT A;  2ZEQ A;  3M95 A;  3IFW B;  4BBN C;  3ML8 A;  3PHW B;  3W1S A;  4W9H A;  4DK5 A;  1V86 A;  1XT9 B;  2O2V B;  4K7U A;  4EEW A;  4FA6 A;  2M17 A;  2FUH B;  4ANW A;  1ZKH A;  5L83 A;  2REX A;  4WWP A;  1UD7 A;  1GJZ A;  2O2V A;  3SDL C;  2K25 A;  4KIK B;  2KDF B;  5JHA A;  2J0M A;  2MP2 B;  1HE8 A;  1S1Q B;  4KIK A;  2KAN A;  2L05 A;  4WJP A;  2BKR B;  2CU1 A;  4BKG A;  2WX0 A;  4HLE A;  2MP2 A;  5GMV A;  2JF5 A;  1D3Z A;  2LRU A;  3WAM A;  1WFY A;  1RRB A;  3HIZ A;  3IG3 A;  5AZH A;  3HHM A;  4IG7 B;  3NZU A;  2IO1 B;  2KQ7 A;  1WIA A;  1RAX A;  3RYT A;  3EFU A;  2DAF A;  4KV2 A;  4NJ7 A;  1L2N A;  2DYM A;  1UBI A;  4TQ0 A;  1WF9 A;  1P9D U;  2BYE A;  4K81 A;  3PLV A;  3KUZ A;  4FAD A;  4G0N B;  3K9P B;  1WJ6 A;  2C7N B;  2W9N A;  1RFA A;  2FNJ B;  3HM6 X;  4NQL B;  1WY8 A;  2O6V D;  2L76 A;  3DBH I;  4MJS B;  2FID A;  2AWT A;  2KTR B;  2KOX A;  2HE7 A;  3KYD D;  3LDZ E;  3PVL A;  4HCP B;  2Z0D B;  3W1Y A;  3X23 A;  2LVQ A;  2HTH A;  2NBV B;  3KYC D;  1KOT A;  4MJS A;  1IPG A;  2KTR A;  1WXV A;  3L10 B;  1VD2 A;  3VFK A;  4LDT D;  3ML9 A;  1TGZ B;  1V5T A;  3QQ8 B;  1GG3 A;  2KC2 A;  3D32 A;  3PRE A;  1SGH A;  4W9L A;  4BOS C;  3DQV A;  2UYZ B;  3PSE B;  1E8Y A;  3ZIM A;  2BPS A;  1E8X A;  1R4N I;  3VUW A;  3PGE A;  4AOF A;  1IP9 A;  3PPA A;  3L17 A;  4LJP B;  2CS4 A;  1Z2M A;  3DBL I;  3VH3 B;  4HPL B;  3GOE A;  4W9C A;  4I6N B;  2FCS A;  2ZCB A;  4W9J A;  4KDL B;  5IA7 A;  4ZRI A;  3U7D A;  4IWQ A;  5JZE B;  1EF1 A;  1KM7 A;  4HDO A;  3QCA A;  2KVR A;  3M63 B;  5AZF A;  2KDI A;  1NI2 A;  1E5W A;  4W9K A;  2IY0 B;  3A1Q B;  3KVF B;  4ICU A;  1E8W A;  1WGY A;  2NR2 A;  4WWN A;  3TL5 A;  2GBR A;  1WE7 A;  5KHQ A;  5E6O A;  2MBO A;  2NCN A;  3V62 A;  1YD8 U;  2MA9 B;  3ZUN A;  4EZL A;  2JVC A;  2K6Q A;  4TV3 A;  4WWO A;  3ZNZ B;  4ASW C;  4FJZ A;  2KFK B;  4MGZ E;  5D7G A;  1VCB A;  1WJU A;  3RZF A;  3ZNG C;  4A3P A;  3Q3J A;  1F9J A;  3JYU A;  2CHX A;  4W9G A;  2KFK A;  2KN5 A;  3ECI A;  2KFJ A;  3QK0 A;  2FIF A;  3QIJ A;  4G3X B;  2FAZ A;  4JLC A;  2BKF A;  4FLH A;  4ZRJ A;  1P0R A;  1WZ0 A;  4GN1 A;  5E6N A;  4XX5 A;  2LJ5 A;  5LXI B;  2Z59 B;  2KJH B;  4HJK A;  1I35 A;  2LRW A;  2KDE B;  3MHS D;  4KZ0 A;  3RUL A;  2OJR A;  3H7S A;  4DHJ D;  2WWZ A;  2KLG A;  3PHX B;  4ANV A;  2PPH A;  2JZZ A;  4GDK A;  2D2Q A;  2I1K A;  2NVU I;  3DPD A;  1ISN A;  4KZC A;  2PE6 B;  4M8M A;  3CST A;  3DOW A;  4ANX A;  4NAW B;  4FUL A;  1R4M I;  2ZNV C;  3PS6 A;  1GC7 A;  2YLM A;  3OJ3 A;  3NS8 A;  2YVC A;  4KSK C;  4NAW A;  2MSE D;  4PYZ A;  5J17 A;  4DHZ E;  2J7Q B;  2RGF A;  4EOY A;  4BKT A;  2RPQ A;  1WM3 A;  2K1F A;  5CHV C;  1EO6 A;  3ZW3 A;  1OEY A;  2JXX A;  1TBE A;  2XK5 B;  3H9D A;  2N1W A;  5LLI A;  5C1Z A;  3KUC B;  1PQS A;  2XBB C;  5C23 A;  2CHW A;  2D11 A;  2R2O A;  3DBR I;  1WZ3 A;  2XK5 A;  2G45 B;  2KX0 A;  3CMM B;  2IO0 B;  3QA8 A;  2MQJ A;  3TCA A;  1SE9 A;  5DPR A;  1WX9 A;  2D10 A;  1V6E A;  2Y5B B;  1CMX B;  2LD9 A;  1V49 A;  4IW0 A;  1WM2 A;  3TMP B;  4ANU A;  4DXA B;  4GB9 A;  4I6P A;  4MEL A;  3DCG A;  2DZM A;  2N9P C;  5FR6 A;  2DZI A;  2KWU B;  3WAL A;  4XC2 A;  2JRI B;  1U4A A;  5CX3 A;  1OTR B;  5CHW A;  2C5L C;  1V9J A;  2N9X A;  1GUA B;  1LXD A;  4E71 A;  3ZDM C;  4IM0 A;  3B1L X;  2IO3 B;  4MGK E;  2BYF A;  2MBH A;  3WAP A;  2NPT B;  3HK0 A;  1L7Y A;  4A3O A;  2M4N A;  2EMS A;  3H1U A;  4BOZ B;  5D6J B;  3V60 A;  3ZNI D;  2BYV E;  4KVG B;  5G2N A;  3LJ3 A;  2IZV B;  1WI0 A;  1WGR A;  2A4Z A;  3UGB B;  2WX1 A;  3N30 A;  2DX5 B;  3SHQ A;  3AI5 A;  4NPN A;  4HPM B;  4GOC A;  4FHK A;  2EKE C;  2ZJD A;  4K7W A;  3APD A;  3M62 B;  1E8Z A;  3OJ4 B;  3RZW C;  2KZR A;  2G4D B;  1WE6 A;  2BGF A;  3L0W B;  2KQS A;  2ZNV B;  3RUI B;  2MBB B;  4B95 A;  5EDS A;  3V6C B;  1T0Y A;  4GMV A;  4K7S A;  1C1Y B;  3PRZ A;  3VUY A;  3RCZ A;  1GC6 A;  1OGW A;  1WX8 A;  3V6E B;  5D2M B;  2LXC A;  4LDT B;  4EFO A;  3SU8 X;  2AL6 A;  3UIP B;  2K39 A;  2MWS B;  3B08 A;  2WYQ A;  1EF5 A;  2UWQ A;  3EHV A;  1WMH B;  2NBW B;  4DDG D;  2KMC A;  1KLV A;  3DBS A;  2CHZ A;  2KKC A;  2LGD A;  4MSQ B;  2R2Q A;  4E74 A;  2BWE S;  1NBF C;  4OVV A;  3R7R A;  3QC8 B;  4M0W B;  3PV1 A;  1WJ4 A;  4GU2 A;  3DVG X;  3CSF A;  1WRD B;  2K8B A;  3L16 A;  3QWZ B;  4BKS A;  2LI5 A;  4IC7 B;  2KHW B;  4GSW A;  4M8N A;  1E7U A;  3QAR A;  3A9K B;  3DVN V;  2DHZ A;  4II3 B;  4W9D A;  1V80 A;  3A1Q A;  3W1S C;  3A9K A;  1H8C A;  1WGG A;  1UH6 A;  2K6D B;  4HK2 A;  3AU4 A;  1A5R A;  2C60 A;  2DAJ A;  4WQO B;  1UEL A;  3HM3 A;  4MM3 A;  3VAW A;  2RR9 A;  2HD5 B;  3VTU A;  1SIF A;  4E3C A;  2KLC A;  4HDQ A;  3CF6 E;  3MTN B;  5CHF A;  4RMA A;  3ZRF A;  2VRR B;  2LVO A;  3ZTC A;  2KWC A;  4HVB A;  1J8C A;  1MG8 A;  3QAQ A;  4TKN A;  4AUQ C;  2PJH A;  4IWP A;  2AYO B;  4OVU A;  3PRP B;  1UGM A;  5J18 A;  4K1R B;  4IUM B;  4FHJ A;  5G55 A;  1IYF A;  1WYW B;  2BF8 B;  2KMA A;  3EEC A;  2RSU A;  3ONS A;  4MEM A;  3VHT C;  3UIO B;  4X57 B;  3WIM A;  1WR6 E;  4GGQ A;  2JY6 A;  3QJZ A;  3JW0 X;  4EKU A;  5JH5 C;  4FBJ B;  2KX3 A;  4AWJ A;  1Y8R C;  1V5O A;  3O65 B;  2MW5 A;  4MDK E;  1YX6 B;  3ZO5 B;  3T9L A;  1LM8 B;  2NBU A;  2MRP A;  2GOW A;  3OAW A;  4ICV A;  4RM8 A;  4JIO U;  1UZX B;  4PS3 A;  3VDZ A;  3L13 A;  2AEH A;  4NY0 A;  2JUO A;  2JWZ A;  1GNU A;  2CR5 A;  2KJR A;  2RD0 A;  2J0K A;  2QHO A;  4F8C B;  1WXM A;  4ZDV A;  1WX7 A;  2MCN B;  3A9J B;  3PLU A;  4RM9 A;  5BO4 B;  1NDD A;  2KJ6 A;  2N7D A;  2CKH B;  2JPH A;  2C7H A;  4DDI D;  3WAN A;  3ZLZ A;  3APC A;  1P98 A;  2EMT A;  5IAA C;  3A4S C;  4W9F A;  3IHP C;  2L3Z A;  3X0W A;  4CYE A;  4GIV A;  4YL8 A;  4IWO A;  3MJW A;  2D07 B;  3VUX A;  2DEN B;  1TZ1 A;  4IM2 A;  3P2B A;  4J6I A;  2PE9 A;  5DCN A;  2M8S A;  4WJN A;  2N7E A;  2MLB A;  5KHO A;  3ZVV A;  2NPT A;  3VVW B;  3DVN U;  2FCM A;  3RT3 B;  3PZD A;  3IVF A;  4G11 A;  2DYB A;  3B0A A;  5CTR C;  4HXD A;  1M94 A;  4ZRK A;  4AP4 C;  3C0R B;  4PS7 A;  1J19 A;  2PEA A;  2LAS A;  1E90 A;  4TUU A;  2MBE A;  3A4R A;  3KW5 B;  3K9O B;  2GBJ A;  4BVU C;  4LJO B;  3UQB A;  4WJQ A;  2KNB A;  2BWF A;  2D3G A;  1JRU A;  3KH0 A;  3PTF C;  2O6V B;  4HWI B;  2KD0 A;  3H6N A;  3TIX A;  2FCN A;  3QHT A;  1ZGU B;  3AU5 A;  4BFR A;  2WDT B;  2O6V A;  1Q5W B;  5DPS A;  1J0G A;  2LVP A;  3SD5 A;  4XZ4 A;  4BBN F;  3ZTD A;  1C3T A;  4F7Z A;  1Z5S B;  2ZCC A;  3BIN A;  3R66 C;  3UF8 A;  1WXA A;  3WA0 A;  3WAO A;  1AAR A;  2JRH A;  3NY5 A;  3KUD B;  1OEY J;  1H4R A;  2L8J A;  1WGH A;  2GBN A;  4TQ1 A;  3ALB A;  3H7P B;  3I3T B;  3N3K B;  4DHZ B;  5JHB A;  2A5U A;  2AL3 A;  4JQW C;  1P3Q U;  2DZK A;  3JVZ X;  3H7P A;  1TTN A;  1WMH A;  3U30 A;  3V61 A;  1EUV B;  2M1M A;  2FCQ A;  3S2A A;  2KTF A;  2HJ8 A;  3TJP A;  2L0T A;  2KC1 A;  3PT2 B;  2C7M B;  1G6J A;  4KDI C;  2ZZP B;  2LXA A;  5E6P A;  3R7Q A;  2JZ3 B;  4IM3 A;  3VTW A;  1FXT B;  2KK8 A;  4URK A;  4MH0 E;  2Z0E B;  4G50 A;  2ASQ A;  2MX2 A;  4WJO A;  1KJT A;  2KWV B;  2ZPY A;  2L7R A;  3GZN I;  2NS5 A;  3NZS A;  1QZE A;  2V4L A;  4HCN B;  3DDC B;  3ZKJ C;  4DWF A;  1YIW A;  3AXC A;  4II2 B;  2ZPN A;  1I42 A;  2MBQ A;  5DPW A;  3ZRC A;  4WAA A;  1LFD A;  3AUL A;  2G3Q B;  4JGH B;  3OLM D;  4N9F 4;  4W9E A;  4AJW A;  1E7V A;  1YQB A;  2N1V A;  4I6L B;  4BKS D;  3Q3F A;  1BT0 A;  1S3S G;  1WH3 A;  1WJN A;  4A20 A;  1RLF A;  2LGY A;  3IBE A;  3VXW A;  4B9K A;  2JT4 B;  1K8R B;  2C9W B;  2M0X A;  4NQK E;  4F1S A;  5HKH A;  3VTV A;  2GMI C;  2J0J A;  4FJV B;  1X1M A;  4NNJ B;  3ZNH B;  4PS8 A;  4GXB A;  1V2Y A;  4EUT A;  4EZJ A;  4EZK A;  1Q1O A;  3BY4 B;  3DVG Y;  5AZG A;  2B3A A;  3QX1 A;  4DHJ B;  2L0F A;  5D94 A;  2KO3 A;  5LXH A;  2GBK A;  1Q0W B;  4B6W A;  4CHK A;  4ZYN A;  1LQB A;  2N9E B;  3L54 A;  4MGI E;  5J2R A;  4GDL B;  2L00 B;  2IBI B;  4AJY B;  1OQY A;  3VQI A;  4FJY A;  1YJ1 A;  4GDL A;  3TBL D;  5L95 C;  1WR1 A;  2KDB A;  2LWP A;  4CO7 A;  3NHE B;  1ZW7 A;  3L08 A;  3UIN B;  4MSM B;  2LGX A;  3T8M A;  3ENE A;  2V1Y A;  4GDK B;  2ZVO A;  2GBM A;  5TR5 A;  3ZDT A;  3R3M A;  2IYD B;  1UBQ A;  2G4S A;  3PRM B;  4NJ6 A;  2DYO A;  3VH4 B;  3UQA A;  2OOB B;  4W9I A;  4LCD E;  4DBG A;  1WGD A;  2LUE A;  1XD3 B;  4MGY E;  2V3S A;  2N4F A;  2XEW A;  4JL9 A;  3A33 B;  2K8C A;  2I1J A;  3RD2 A;  1YX5 B;  3EC8 A;  4FN2 A;  3A9J A;  3M3J A;  1P1A A;  3U8Z A;  1V81 A;  2DZJ A;  2K8H A;  3JSV B;  1WXS A;  2ZVN A;  3N32 A;  2KXJ A;  1XQQ A;  2LZ6 A;  3NOB A;  4KSL C;  2IY1 B;  2IO2 B;  3APF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...