1WIAA

Solution structure of mouse hypothetical ubiquitin-like protein bab25500
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
95
structure length
95
Chain Sequence
GSSGSSGINVRLKFLNDTEELAVARPEDTVGTLKSKYFPGQESQMKLIYQGRLLQDPARTLSSLNITNNCVIHCHRSPPGAAVSGPSASSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Solution structure of mouse hypothetical ubiquitin-like protein BAB25500
rcsb
source organism Mus musculus
molecule tags Structural genomics, unknown function
molecule keywords hypothetical ubiquitin-like protein (RIKEN cDNA 2010008E23)
total genus 12
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2004-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1wiaA01
2Z59B 3ZNGC 5IAAC 3QARA 4W9KA 1WX7A 3PT2B 4EOYA 3R3MA 4YL8A 1WGYA 4GXBA 2KWCA 2KC2A 3RZWC 1JRUA 3WAOA 4FLHA 4MGIE 5JHAA 3ZIMA 1NI2A 2K6DB 3TIXA 2KHWB 3DVGX 1RRBA 1C3TA 3OJ3A 4ANXA 2KJ6A 4EZLA 4ZYNA 3VVWB 4NJ7A 3CF6E 3L0WB 4J6IA 3PTFC 3ZDMC 1T0YA 3UIPB 2KLGA 1Z5SB 2MBHA 4A20A 2JWZA 3VUXA 2J0KA 3PRZA 3DVNV 2CHXA 3APCA 4GSWA 4M0WB 1J19A 2IZVB 4WWPA 5LLIA 1Q5WB 1LM8B 2KWUB 1WXAA 3MTNB 4W9LA 4GDKA 4CHKA 1E5WA 4IWOA 2J0MA 3VUYA 4AOFA 2ZCCA 4II2B 3TJPA 1WJ4A 3HHMA 3NY5A 1IYFA 1WE6A 3PZDA 3UIOB 4E71A 4M8NA 2MRPA 2KFJA 2KFKB 2FUHB 2N7EA 2YVCA 2QHOA 3UGBB 2XK5B 4AP4C 3V6CB 2FAZA 1ZW7A 2BWFA 4AUQC 1GUAB 3A1QA 3KYDD 2VRRB 3C0RB 5E6PA 2WDTB 1CMXB 2L7RA 2C60A 2N9EB 1WRDB 4WWOA 3NZUA 4MDKE 2LVQA 3VH3B 4DHZE 2DZJA 2KANA 2K39A 4BFRA 1WFYA 3ZNID 4ANWA 2WWZA 1D3ZA 1V86A 4ZDVA 2DYOA 2KX0A 2WX1A 3VH4B 2KDBA 2N1WA 3L08A 4GOCA 4KIKA 3BINA 2JY6A 3PSEB 1GC6A 2K1FA 3PHWB 1V49A 4NPNA 2KQSA 3RZFA 2AYOB 2JF5A 4K81A 1EF5A 3IG3A 4DBGA 4ZRJA 1YD8U 3QC8B 1WZ0A 3EFUA 2W9NA 3R7RA 2MCNB 2RPQA 2V3SA 3NOBA 1E8ZA 2KWVB 2N1VA 4MH0E 4PYUA 4NJ6A 1IP9A 4OVUA 1WIAA 4ICUA 3A9KB 3PRPB 4MGZE 4NQLB 3DDCB 2KDFB 4HCNB 5FR6A 3JSVB 1UD7A 4WJQA 3ZVVA 4I6PA 2K8BA 4FJZA 4GGQA 3ENEA 3T9LA 4AWJA 4IUMB 4BBNF 1I42A 2RR9A 1E7UA 3KUCB 3QJZA 3DQVA 4W9FA 3QCAA 4MELA 1R4NI 3AULA 2K8CA 2KTRA 2O6VD 3ZDTA 5JH5C 4FHKA 2D3GA 1KOTA 3HM6X 2O2VA 3QHTA 1AARA 1ZKHA 2BF8B 3VUWA 3Q3FA 2AWTA 5DPRA 1Q1OA 1WMHB 3CSTA 3H7PB 3L10B 4HDOA 1OEYA 3PGEA 2ZNVB 3OJ4B 4WWNA 2REXA 2M8SA 2LZ6A 1WGHA 1SIFA 2EMSA 5E6NA 4AJWA 2NS5A 4PS8A 3DBLI 3H6NA 2M0XA 2IY1B 4JL9A 4HCPB 4W9HA 4ZRKA 4HPLB 1YJ1A 1WYWB 1G6JA 1LXDA 2CKHB 3PV1A 3QIJA 2WX0A 3KH0A 4X57B 3JSVA 1P3QU 3UF8A 3DCGA 3SHQA 3ZO5B 3DBHI 3L54A 2LXCA 1V5OA 2AEHA 3Q3JA 4IW0A 4W9GA 2JXXA 2CU1A 2A5UA 3ZLZA 1TBEA 3APDA 5LXHA 2D11A 2L00B 3AU4A 3A1QB 2ZCBA 1WM2A 1E90A 4FJYA 3UINB 3WAMA 3U8ZA 2L0TA 3JVZX 2YLMA 2K8HA 3A4SC 2DX5B 3R66C 1OEYJ 4GU2A 2PPHA 4KDLB 2ZVNA 2BPSA 1P1AA 1V5TA 2ZVOA 3W1SC 4EEWA 1NBFC 4CYEA 3VTWA 2MP2B 5AZHA 2I1KA 5J17A 4IG7B 1Z2MA 1X1MA 1U4AA 2BWES 3IFWB 4IM0A 2DAFA 2L3ZA 4XZ4A 3HK0A 4ANVA 1YIWA 1UBQA 3K9OB 2C9WB 2LXAA 3SD5A 1V81A 4GIVA 3V62A 1S3SG 2KD0A 1WR1A 2R2QA 3EC8A 4F1SA 1Y8RC 2MBOA 2NR2A 4W9EA 3HM3A 4M8MA 5TR5A 4EZKA 5BO4B 1UGMA 2BYEA 2D07B 2ZJDA 3EECA 4WJOA 3U30A 4BBNC 2V1YA 4W9DA 2ZNVC 1KJTA 4GB9A 1E8XA 4DWFA 1E8YA 4MJSB 3V6EB 2V4LA 2KJRA 5GMVA 3A9JB 3OLMD 3ZW3A 2CR5A 1C1YB 2N4FA 4BKGA 3GOEA 4KSLC 3AU5A 5HKHA 4BOSC 2LGXA 3VQIA 3W1SA 2G45B 2L0FA 3LDZE 2BKFA 3B08A 4NAWA 1P0RA 2DYBA 4IM2A 5AZGA 4NAWB 4JQWC 3L16A 3L13A 4EKUA 2BYFA 2MW5A 1WZ3A 4PS3A 2LJ5A 2LVOA 2K25A 4G11A 4I6LB 3N30A 1PQSA 2IO3B 4FULA 2KXJA 1V9JA 4MEMA 2DYMA 4KZ0A 4TUUA 4LCDE 4LDTD 2JRIB 2L76A 2UYZB 5LXIB 1EUVB 3CMMB 2O2VB 1GG3A 3H9DA 3VDZA 1V2YA 1A5RA 4A3OA 2K6QA 2C7MB 3TCAA 3K9PB 3WIMA 2HTHA 4DHJD 4HDQA 1RLFA 2B3AA 2MQJA 4I6NB 3NZSA 4ZRIA 2XK5A 1P98A 3KUDB 1WY8A 4MGKE 2HE7A 2EMTA 4RMAA 3WALA 5JHBA 2MA9B 3VTVA 3EHVA 4NNJB 4PYZA 4WJNA 4E3CA 2C7NB 5J18A 2GOWA 4E74A 4RM8A 2IBIB 5DCNA 1TGZB 2DZIA 4FJVB 3KW5B 4P7IA 5L83A 1WJ6A 4ASWC 3VXWA 3ONSA 2C5LC 2CHZA 2WYQA 2ZZPB 2L8JA 3NS8A 4GDKB 4TKNA 1E7VA 3M63B 2LVPA 1WXMA 1KM7A 1UZXB 2MLBA 1V6EA 4EUTA 4GDLA 3A33B 4URKA 2MBEA 1WF9A 5E6OA 1J0GA 2PE6B 3SU8X 2AL3A 1KLVA 2KZRA 4GMVA 3P2BA 3QA8A 2BGFA 4II3B 3PHXB 4WQOB 3ZRCA 2A4ZA 2LUEA 3B0AA 2KO3A 5EDSA 4IC7B 1GC7A 2CHWA 4IWPA 2UWQA 2DENB 4K7SA 1IPGA 5DPTA 2JZZA 3X0WA 2M17A 3CSFA 3N3KB 1WH3A 4PS7A 1XQQA 4AJYB 1ZGUB 2FCQA 3O65B 3RUIB 2KTFA 1SGHA 2FCSA 2MBBB 4FBJB 4DDGD 2M1MA 1TZ1A 1BT0A 3ML9A 2PEAA 4B6WA 4BVUC 4NQKE 3JW0X 3ZNHB 1OQYA 2EKEC 2ZEQA 2G4SA 3ZRFA 1WX9A 2DHZA 5AZFA 2G4DB 4HK2A 1GJZA 2RSUA 3PRMB 5C23A 2GBKA 2Z0EB 1GNUA 4JIOU 1WXSA 1V80A 2KVRA 2GBNA 3KYCD 1YQBA 3T8MA 3X23A 4HXDA 3UQAA 3SDLC 3LJ3A 2ASQA 2Z0DB 2CS4A 1WE7A 4LJPB 5CTRC 4W9CA 3A9KA 2FCMA 4JLCA 1E8WA 2LRWA 1WGRA 1YX5B 3WANA 3QAQA 3PREA 3GZNI 2NPTA 2RD0A 2JT4B 2LWPA 4FA6A 4XX5A 2D2QA 3MHSD 4F7ZA 4ANUA 3ML8A 2MBQA 4DXAB 1WGDA 2DAJA 3ECIA 1Q0WB 1WXVA 1RFAA 3M62B 2OOBB 1ISNA 4TQ1A 2DZKA 2KOXA 2NPTB 2NVUI 1K8RB 2G3QB 3TL5A 3QK0A 3OAWA 3TBLD 3UQBA 1OTRB 3VFKA 5JZEB 3PS6A 5C1ZA 4MM3A 4JGHB 3RCZA 2HD5B 1FXTB 2IO0B 5G55A 3PPAA 4A3PA 1VCBA 4FADA 3ALBA 1R4MI 4KV2A 2NBVB 2MSED 3M3JA 3V60A 2FIFA 4BKTA 4DHJB 4FHJA 2HJ8A 4G0NB 2GBMA 4BKSA 2BYVE 2MX2A 3A9JA 4WJPA 2AL6A 5G2NA 3RULA 2PJHA 2PE9A 1P9DU 2JUOA 3DVGY 3H7SA 2ZPYA 4MJSA 5J2RA 4LDTB 2IO1B 2KMCA 3DVNU 4KZCA 2KMAA 4KIKB 2FNJB 3ZTCA 1WGGA 2ZPNA 4OVVA 4B9KA 4B95A 2IYDB 1SE9A 1TTNA 1UBIA 1QZEA 2C7HA 4N9F4 2KC1A 3BY4B 4K1RB 4KVGB 1J8CA 2O6VA 1WR6E 3DBSA 4NY0A 1EO6A 3S2AA 2LASA 3KUZA 2MWSB 2JVCA 5L95C 1WX8A 5D2MB 4EZJA 1VD2A 2O6VB 4MGYE 4HPMB 1WJNA 4MSQB 5D7GA 2MP2A 1WI0A 2KFKA 3IBEA 5KHOA 5DPWA 1WM3A 4MSMB 2KLCA 5CHWA 3WA0A 5AEKB 1H4RA 4BKSD 2LRUA 2FCNA 3PLVA 4BOZB 3QX1A 5IA7A 3DBRI 3IHPC 2XBBC 4GDLB 4KSKC 2NBWB 1EF1A 2D10A 4HVBA 2J7QB 3RT3B 1NDDA 3L17A 2IO2B 3PLUA 3TMPB 1L2NA 2KQ7A 3V61A 4K7UA 4DHZB 3PVLA 4HLEA 1MG8A 4W9IA 3HIZA 4FN2A 2KJHB 3W1YA 4EFOA 3ZTDA 1LFDA 4WAAA 2LD9A 4KDIC 1UH6A 1UELA 5KHQA 5CX3A 4XC2A 2KDEB 2NCNA 1WJUA 1I35A 5CHFA 2KK8A 4IM3A 2GBJA 1L7YA 3NHEB 4GN1A 1S1QB 3RYTA 2FIDA 3AXCA 4LJOB 4HJKA 2GMIC 3D32A 2KNBA 3QWZB 2XEWA 1HE8A 2JZ3B 2GBRA 3H7PA 3B1LX 3M95A 4IWQA 4RM9A 3U7DA 3N32A 4TV3A 1LQBA 2R2OA 5DPSA 2OJRA 1WMHA 5D6JB 3A4RA 3VAWA 3APFA 2JRHA 3RD2A 2KN5A 3VHTC 1XT9B 3ZUNA 3AI5A 2L05A 3IVFA 4G3XB 3ZKJC 1M94A 4CO7A 2KTRB 3MJWA 2JPHA 3ZNZB 4HWIB 1F9JA 4TQ0A 3I3TB 3DOWA 3DPDA 3VTUA 2I1JA 1YX6B 2LI5A 2KKCA 2M4NA 3H1UA 1XD3B 5CHVC 4DDID 2NBUA 2KDIA 3WAPA 2LGDA 2KX3A 2BKRB 2DZMA 2N7DA 2N9XA 2IY0B 3R7QA 3JYUA 2LGYA 2Y5BB 4ICVA 1H8CA 4G50A 5D94A 2N9PC 4F8CB 4K7WA 2J0JA 1RAXA 1OGWA 3KVFB 3QQ8B 4DK5A 2RGFA 4W9JA
chains in the Genus database with same CATH superfamily
1V8CA 4W9KA 4YL8A 1WGYA 4L23A 2ZW0A 3WAOA 2KC2A 1TIFA 4KGTA 2KHWB 3DVGX 2WU5B 1RRBA 4ZYNA 2G9HD 2WDRB 1T0YA 1VZ6A 3VUXA 2J0KA 3PRZA 4M0WB 1J19A 3U4EG 5D3IB 1K51A 2KWUB 1WXAA 1YN4A 3NJTA 4GDKA 2J0MA 3EA6A 2MEKA 4II2B 2MRPA 4RNAA 2YVCA 1ZW7A 3E9SA 2BWFA 4AUQC 3A1QA 2VRRB 2WDTB 1CMXB 1FIQA 2PKOA 5AUIA 4DHZE 2DZJA 4ZHPA 1JWSD 1WFYA 3ZNID 2WWZA 4XWWA 4WAFA 3VH4B 2J53A 2KQSA 3ZGZA 1EF5A 4DBGA 1WZ0A 3MP9A 2MJDA 3R7RA 3NOBA 2KWVB 4PYUA 4OVUA 1MI0A 4YXDB 4NQLB 1AWDA 3ZVVA 2WLBA 3T9LA 1RM6C 2KDMA 2NTTA 4BBNF 4IUMB 2RR9A 1E7UA 3QJZA 1TYGB 3QCAA 4MELA 1R4NI 5JH5C 3ZDTA 1NEKB 4FHKA 2FUG1 3AV8A 1ZKHA 2NMQA 1I4PA 1PUTA 1WMHB 3CSTA 4NZLB 2KWDA 2VH1A 3BVMA 2KAJA 3DHHC 4HCPB 1YJ1A 1WYWB 2I2YA 1QLBB 1DOIA 3QIJA 2WX0A 1P3QU 5BYSA 3DCGA 3ZO5B 3DBHI 2AEHA 3AU4A 1WM2A 4RH6A 1E9MA 3U8ZA 3TSSA 2JYEA 2K8HA 2QJLA 1XCQL 1OEYJ 4GU2A 2PPHA 1F0ZA 1P1AA 3ZXRA 1NBFC 2D5GA 4LNIA 5AZHA 4R3DA 1PDXA 4IM0A 4XZ4A 4ANVA 3HK0A 3K9OB 1GB1A 4M8MA 1IGCA 3AN1A 2IDYA 3RNCC 4WJOA 1V1PB 2V1YA 2N9LA 1E8YA 2GRIA 2KJRA 4XDCA 1C1YB 1M4VA 2N4FA 2BS2B 1YOVB 1N62A 2LFIA 2BKFA 4MM3B 1TS5A 1FM0D 1VRAB 1L0XB 1F52A 4D2KA 3URYA 4N59A 1CJEA 2BYFA 4LK0M 2UU7A 2LJ5A 2INCC 1L6VA 2DNFA 1FXIA 1V9JA 3IXSA 1JQ4A 4LCDE 2HDEA 2ICIA 4WWMA 2WHIA 1V2YA 1A5RA 2JYTA 2HTHA 4HDQA 2B3AA 2BTEA 4ZRIA 1P98A 3KUDB 4ZOHC 1D5ZC 3WALA 4PYZA 4RGTA 5J18A 2GOWA 2IBIB 4LNNA 5DCNA 2DZIA 4P7IA 5L83A 5H8YE 3ONSA 2WYQA 4TKNA 1TS3A 1WXMA 1V6EA 4EUTA 1LGRA 3A33B 1J0GA 1OQRA 2PE6B 1XLOA 4A90A 3QA8A 3R2IA 3PHXB 5BYQA 3P42A 2KO3A 2ONQA 2J52A 1GC7A 1J7AA 2UWQA 5BMHA 5FR3A 4XE0A 3N3KB 4WIPA 3RUIB 1QQRA 1JWBD 1TZ1A 2PEAA 3RNFC 5IN7A 2N9KA 3I5JC 2G4SA 3ZRFA 2G4DB 4HK2A 2HJ1A 2Z0EB 2WXOA 4TSSA 3T8MA 4HXDA 3Q3MC 3SDLC 3LJ3A 2Z0DB 4W9CA 2FCMA 2LRWA 1YX5B 3WANA 3PREA 3GZNI 2RD0A 2JT4B 2WXFA 3DWGC 2LWPA 2D2QA 3MHSD 4ANUA 3ML8A 3ECIA 1Q0WB 1B1ZA 2KYWA 3M62B 4M00A 1KH0A 2ZW1A 4JPSA 1K8RB 5EE0A 3OAWA 5C1ZA 2Y5CA 3EUB2 2NBVB 3M3JA 3V60A 4HROA 5IKCM 1F1HA 5EE1A 2GBMA 1UF0A 4KKJA 2IPKD 2KMCA 3DVNU 4NAMA 3FAHA 5I4DA 1C9FA 2IYDB 1SB3C 5MPOA 1SE9A 3L4PA 2LGSA 1J8CA 3DBSA 3MHZA 2LASA 3KUZA 3RFZB 1TJEA 2KN4A 2KFKA 3IBEA 3SFDB 5CHWA 3WA0A 5AEKB 2E3TA 2LRUA 3PLVA 3SR6A 2J7QB 5G5GA 1L2NA 2KQ7A 3V61A 3FC4A 1N5WA 2K9XA 3HIZA 4A55A 4LNKA 3RNBC 1QOFA 1LFDA 1UELA 3FILB 3NRZA 1C76A 5KHQA 3NHEB 4GN1A 2GMIC 3D32A 5T8IA 4C4VB 1N6ZA 2JZ3B 2BB6A 3N32A 4TV3A 5DPSA 2R2OA 1QOGA 3A4RA 3RN9C 1XT9B 1T3QA 2Z8LA 4G3XB 3ZKJC 5HFYA 3ZXVA 3P4PB 1KRHA 3P4SB 4HWIB 3I3TB 2LI5A 3AE6B 2LGDA 2X8XX 2KX3A 2DZMA 3VRAB 3R7QA 3JYUA 3MC0B 5EE9A 3NUHB 3GP7A 3AE8B 4K7WA 2J0JA 1ENFA 2Z59B 4EOYA 1L4DB 1WX7A 5GXGB 1ZPSA 2KWCA 1L6UA 1TS4A 3U52E 3ZIMA 3KWVA 1T0RC 3VVWB 3L0WB 3UIPB 1GAQB 2KLGA 2MBHA 2JWZA 4LTUA 3DVNV 4WWPA 2IZVB 2JWUA 1GB4A 1Q5WB 1LM8B 4MH8A 2AX5A 3Q14C 3ABVB 4AOFA 2ZCCA 1WJ4A 1R4NB 2BW2A 3PZDA 3UIOB 4E71A 1D6EC 3TEWA 2KFKB 2N7EA 3VRBB 3PZ8A 3V6CB 3R2TA 3N1YC 1HXYD 1PGAA 3C0RB 3GE3C 5E6PA 2C60A 3LB8C 4WWOA 1WRDB 4MDKE 4FXCA 4BFRA 1FRDA 1PGXA 1I7HA 1YNTE 4MT5A 4ZDVA 2DYOA 2N1WA 2K1FA 3PHWB 3RZFA 1AYFA 1F2RC 1FNUA 4ZRJA 2Q5WD 2N1VA 4NJ6A 2L52A 1IP9A 3A9KB 3PRPB 4HCNB 4FJZA 4GGQA 4AWJA 1Y56A 2QILA 3DQVA 4W9FA 4H2AA 1SBBB 1HQRD 3AULA 2K8CA 2D3GA 3W5VB 3NVZA 1KOTA 1XLPA 2O2VA 3HM6X 2X38A 1SE3A 4TMAB 1YJJA 4LNFA 5BMGA 4HDOA 4C7YA 3OJ4B 2VZKD 2NS5A 4C4VA 1SJED 2IY1B 3ETRA 4JL9A 5TSSA 1OQQA 3HRDD 1G6JA 4DXFA 1WGKA 4K3BA 2KVZA 4X57B 3JSVA 1FMAD 3L54A 4KGRA 2LXCA 1V5OA 3NS1A 4IW0A 4W9GA 2CU1A 3ZLZA 2ZCBA 2KMMA 1E90A 4XWTA 3UINB 2YLMA 3A4SC 2DX5B 1FNVA 3R66C 1QKZA 3AB5A 3P4QB 2ZVNA 2BPSA 4BZAA 1MVKA 1UWMA 3W1SC 1XO3A 3AE5B 4PK1A 5J17A 3BWUD 3GB1A 3IFWB 2L3ZA 1YMHE 3PZ7A 2LXAA 4S17A 3SD5A 1V81A 1S3SG 2KD0A 4JWUC 1HTQA 4EZKA 1TY0A 1B9RA 4A6QA 1KJTA 1E8XA 5LNK1 2AQ3B 1ZDXA 4MJSB 2BQQA 3OLMD 3ZW3A 2CR5A 1EWCA 1BUIC 3ZYYX 1AN8A 4HPPA 3LXFA 4BOSC 3RNGC 2LGXA 3W1SA 5HG2A 4NAWA 5AZGA 5H92C 1JALA 4US8A 1XCTL 4JQWC 1YN3A 1V97A 2LJIA 4EKUA 4PS3A 2OEDA 2K25A 1E6EB 4G11A 4I6LB 3N30A 3DBHB 2IO3B 2KXJA 4LDTD 2L76A 2AQ1B 2QSDA 2O2VB 1GG3A 3VDZA 4RGNA 1FNWA 1N5XA 2JXTA 2C7MB 3K9PB 4DHJD 2XK5A 4MGKE 2WU2B 2HE7A 2EMTA 3VTVA 1JWAD 4HKZE 3MC8A 1YJIA 1TGZB 3KW5B 4YSXB 1WJ6A 4ZYSA 2C5LC 2L8JA 3NS8A 4GDKB 3IAS1 1E7VA 4ARCA 2Y3AA 3RNEC 2MLBA 1UZXB 4GDLA 2JU6X 2PMVA 4URKA 3MJ5A 2MBEA 2AL3A 1KLVA 3P2BA 2BGFA 1VR9A 3V3XA 1QOAA 2M19A 1IUEA 4IC7B 3AEAB 2CHWA 1MPEA 2AQ2B 1EM7A 1SXTA 4K7SA 1IPGA 1F2RI 2CJNA 1XXGA 3CSFA 4PS7A 3O65B 1SGHA 2FCSA 2M1MA 4IOIE 4B6WA 4NQKE 3AH7A 1SE4A 2EKEC 3AMZA 1XLNA 1GNUA 1A70A 1WXSA 3P4RB 1NYQA 3KYCD 4PT5A 4C80A 2CS4A 1DOXA 2LEKA 5CTRC 1WGRA 4HKQA 2NPTA 3C8YA 3EGRA 2D3BA 4F7ZA 1FPYA 4DXAB 5C3JB 2OOBB 4AQ7A 2NPTB 3TL5A 3UQBA 1OTRB 3Q8FA 4MM3A 2HD5B 1FXTB 5G55A 3RI7C 3PPAA 1VCBA 3ALBA 2FIFA 2HJ8A 3HUIA 3ZJUA 2K0PA 4BKSA 2BYVE 2MX2A 3A9JA 4OZCA 3RULA 4C56C 2H88B 2PE9A 1P9DU 2BS3B 1J7BA 2JUOA 3H7SA 4LDTB 2IO1B 1HZ6A 2KMAA 1HA5A 1I4QA 2WXQA 1UBIA 4YWGG 2O6VA 2QIEB 1EO6A 3S2AA 2IJ0A 3AE7B 4EZJA 2O6VB 5D7GA 2MP2A 1WI0A 1WSPA 3P1MA 1I4XA 5KHOA 1WM3A 1QT9A 3QX1A 2XBBC 4GDLB 4KSKC 2NBWB 1EF1A 4HVBA 1NDDA 3L17A 3PLUA 3TMPB 3B2FA 1R7SA 4DHZB 2E6XA 1MG8A 2JSVX 2KJHB 3W1YA 3ZTDA 4WAAA 2LD9A 3AEEB 4KDIC 1UH6A 5CX3A 2KDEB 1WJUA 5CHFA 4QAYA 1L7YA 3ZQ4A 3RYTA 2LUMA 3AXCA 3SEBA 1VJKA 2XEWA 1HE8A 2GBRA 1WYGA 3B1LX 3H7PA 4IWQA 2WS3B 1LQBA 2OJRA 3AE3B 5D6JB 3VAWA 1L0VB 4WQMA 2L05A 1XLQA 3MJWA 2CU3A 3ZNZB 2QCZA 1ZUD2 3AM9A 4TQ0A 3VTUA 1YX6B 2M4NA 2LHEA 4DDID 2NBUA 2KDIA 3SFEB 3WAPA 2N7DA 2WXJA 2YEPF 4ICVA 1H8CA 2LGIA 4F8CB 4K3CA 3KVFB 3QQ8B 4JE3B 1SSNA 5IAAC 3PT2B 1TZOA 3R3MA 1JRPA 4IDIA 3RPFC 4MGIE 1UGJA 3TIXA 2K6DB 1KLUD 4EZLA 1Z5SB 1TKYA 4GSWA 5LLIA 1SJHD 4UDUC 1FD6A 2RPVA 5EE3A 3MTNB 4CHKA 1E5WA 4IWOA 2EKIA 3TJPA 3HHMA 1OFFA 2WXPA 2RDHA 3UGBB 1IBXB 2XK5B 4AP4C 2WDVB 2B76B 3AECB 3HVZA 4ZHOA 2L7RA 2N9EB 1ZE3D 3NZUA 4JX1C 2M0AA 4OVZA 4XYCA 2KANA 1D5MC 1V86A 2KX0A 2WX1A 4GOCA 4YSYB 4KIKA 2INNE 3BINA 4NPNA 1V49A 4YTPB 2AYOB 1C77A 1XEEA 5C2TB 1V1OA 2WXRA 3EFUA 2MCNB 2RPQA 2V3SA 1E8ZA 4MH0E 3BVZA 1BXTA 4RFBA 4EE2A 1WIAA 4ICUA 3DDCB 2V0GA 1FEHA 1UD7A 4I6PA 2K8BA 3ENEA 1MHHE 3GE8C 3KUCB 2JX5A 1FFUA 2NTSA 1AARA 1JWMD 2VH2A 1ESFA 3T3OA 5DPRA 1RFKA 3H7PB 3L10B 1OEYA 3PGEA 2REXA 2M8SA 1SIFA 1WGHA 2EMSA 5E6NA 4W9HA 3ZJVA 2PW9A 2CKHB 3C19A 2VZKB 3KH0A 3UF8A 3SHQA 3AEDB 1C4AA 3Q8CA 4HJGE 2XNAC 2JXXA 4YT0B 2A5UA 1TBEA 4P6VF 1I4RA 2DWQA 4FJYA 3BYYB 2L0TA 4L1BA 1V5TA 1UWXA 3VTWA 2MP2B 2I1KA 5D3DA 4IG7B 2GLSA 1X1MA 2Y5PA 2BWES 2DAFA 1UBQA 4GIVA 3T3NA 3EC8A 1YN5A 4F1SA 1Y8RC 1JWUD 3MFGA 5TR5A 2J4XA 3N1XC 2BYEA 2D07B 3IAM1 3U30A 4C7ZA 2D3CA 2YEPB 4HRSA 4GB9A 4JWSC 1TKGA 3DHGC 3V6EB 2BB5A 4HEA1 2V9HA 5GMVA 3A9JB 4BKGA 3GOEA 4KSLC 3AU5A 2JQRB 1GOZA 2BBCA 3W2DA 4YTMB 2G45B 2L1AA 2L0FA 4ACFA 4REZA 2CJOA 4IM2A 4M02A 4NAWB 3L16A 2INDC 3L13A 2PLPA 4A8XC 1ACCA 2MW5A 2HTME 1C79A 1PFDA 2WXGA 3AE4B 1K53A 1PGBA 4FULA 4MEMA 2DYMA 4KZ0A 4XDDA 2UYZB 3CMMB 5HHDG 3V05A 3VR9B 2K3UA 2MJEA 3WIMA 1AW7A 1RLFA 2MQJA 2WXIA 3EFCA 4I6NB 3NZSA 4KKIA 1WY8A 4RMAA 3EHVA 4E3CA 1C4PA 4WJNA 2C7NB 4E74A 2V3NA 1QILA 4FJVB 2MH7A 3ZJTA 2CHZA 3M63B 2LVPA 1VDVA 2W3SA 2PVOD 3HVDA 1WF9A 2KZRA 4GMVA 4II3B 4LNOA 2LUEA 3B0AA 4P1BC 5EDSA 1HTOA 1P7FA 4P1CC 5DPTA 2JZZA 1K50A 3X0WA 3TEZA 2M17A 1SE2A 1WH3A 2WXNA 4WURA 4AJYB 1ZGUB 2FCQA 2MBBB 1UNSA 3N1ZC 1BT0A 1ZXIA 1D5XC 4Q2JA 3ZNHB 1OQYA 1ZDVA 2DHZA 4N6EB 1HEZE 1GJZA 2LMCA 2RSUA 3PRMB 5C23A 1CQVA 2GBKA 4JIOU 1V80A 2GBNA 3X23A 3OWEB 2ASQA 1WRIA 4LJPB 1L4ZB 3A9KA 4JLCA 1ET6A 3QAQA 1SF0A 4FA6A 4USAA 4GLSC 2MBQA 3Q6BA 4TQ1A 2KOXA 1E10A 2G3QB 1I4GA 2WXLA 3TBLD 3B2GA 5JZEB 1L0YB 4JGHB 2IO0B 3RCZA 4KX6B 2OHFA 4BAXA 1R4MI 4DHJB 3N9YC 5FK9C 4G0NB 3AEBB 4WJPA 2SEBD 2D3AA 3N20C 3O13A 1YQ4B 3DVGY 4US9A 4KZCA 4KIKB 4MACA 2FNJB 1V1PA 1WGGA 4OVVA 4B9KA 4B95A 4B0EA 1TTNA 2C7HA 4N9F4 4J3OD 2G1EA 4K1RB 2W54A 3TEYA 2IGDA 2JVCA 5L95C 1ZXHA 2INPE 2J42A 3LYYA 4MSQB 5DPWA 4MSMB 2KLCA 1DYQA 2BS4B 4BKSD 2FCNA 4BOZB 5IA7A 3IHPC 1FXAA 3Q3OC 3RT3B 2IO2B 3PVLA 4W9IA 4FN2A 1KFYB 1N61A 3DBLB 1CK1A 1MFWA 1N60A 2IGHA 4O1NA 3E56A 3GS2A 4XC2A 2NCNA 4IM3A 3Q69A 2K22A 1FRRA 3MC9A 3Q2AC 2FIDA 4HJKA 3TEXA 4YSZB 2KNBA 3QWZB 3M95A 1Q10A 4RM9A 4P16A 1WMHA 4OHJA 3APFA 3RD2A 2KN5A 2WXKA 3VHTC 2R61A 1ZP0B 3AI5A 3IVFA 1M94A 4CO7A 2KTRB 3Q8AA 1SIJA 1T5XD 3U7ZA 3DOWA 3H1UA 2I1JA 2KKCA 1F77A 1XD3B 1P7EA 2WNMA 3BVGA 2N9XA 1ET9A 2LGYA 2Y5BB 2PIAA 4G50A 5D94A 5BYRA 1RAXA 1OGWA 2RGFA 3ZNGC 3QARA 1JMLA 4GXBA 2MHJA 3RZWC 1JRUA 2QC8A 4FLHA 5JHAA 1NI2A 2QDFA 3H8HA 3OJ3A 1C3TA 4ANXA 2KJ6A 1EU3A 4NJ7A 3CF6E 3AE9B 3RNAC 1T6BX 3PTFC 4J6IA 2QMTA 1GPXA 3ZDMC 4A20A 2RDBC 2WXMA 1T0SC 2CHXA 3APCA 1R4MB 1C4CA 3PO0A 4B0MA 4W9LA 1UUPA 3Q3NC 3BZDB 4RGOS 3VUYA 3NY5A 1IYFA 1WE6A 4M8NA 1T0QC 2KFJA 3NVYA 2FUHB 2QHOA 2FAZA 1QOBA 4M0WA 2WQYB 1GUAB 3I9V1 3KYDD 1JROA 2LVQA 3VH3B 4DQOC 2K39A 2I38A 4ANWA 1D3ZA 2WGSA 2JZPA 4NJCA 2KDBA 5AUKA 3L08A 2JY6A 3PSEB 1GC6A 4KGSA 2JF5A 4K81A 3IG3A 1YD8U 3QC8B 4DXGA 1KTKA 3DHIC 2W9NA 3RMKC 1MJDA 4MGZE 2KDFB 4ZRQA 5FR6A 3JSVB 1VZ8A 1RYJA 4WJQA 1I42A 2O6VD 2KTRA 3QHTA 3VUWA 2BF8B 3Q3FA 2AWTA 5G5HA 1KLGD 1Q1OA 2ZNVB 4WWNA 2LZ6A 2N7JA 3NG0A 4AJWA 4PS8A 3DBLI 3H6NA 2M0XA 4M01A 4ZRKA 4HPLB 1LXDA 5IP4D 3FILA 3PV1A 2PTLA 1C78A 3Q3JA 1I4HA 1JW9D 1ZOYB 3APDA 5LXHA 2D11A 2L00B 3W5UB 3A1QB 3WAMA 3JVZX 1JCKB 4KDLB 2ZVOA 4CQNA 4EEWA 4CYEA 2L32A 1Z2MA 3VR8B 1U4AA 1YIWA 1DGJA 2C9WB 3V62A 1MG4A 2DBYA 1WR1A 2R2QA 2MBOA 2NR2A 4W9EA 3HM3A 4YTNB 2EELA 5BO4B 5IO9A 1UGMA 1TS2A 2ZJDA 3EECA 1QF6A 3KQ4A 2TSSA 4BBNC 4W9DA 2ZNVC 2V3PA 1BMLC 3U2SC 4DWFA 4L2YA 4S0RA 3UI3A 2V4LA 3IT4B 2W55A 5HKHA 3FKYA 4IKGA 5IOIA 3VQIA 5JXVA 3LDZE 3B08A 1P0RA 1FCCC 2DYBA 2IGGA 4C00A 1ROEA 2WP9B 1WZ3A 2LVOA 4LLGM 1WXQA 1D4BA 1PQSA 4RF1A 4TUUA 2WDQB 2JRIB 5LXIB 2MJ3A 1EUVB 3H9DA 4A3OA 3KWLA 2K6QA 3TCAA 3KLSX 3GZNB 1NYRA 1KF6B 1HZ5A 5JHBA 2MA9B 2WXHA 4NNJB 4RM8A 4ASWC 3VXWA 2ZZPB 1CZPA 2OJWA 3DWMA 1TKEA 3BK1A 3I63C 1KM7A 2RMMA 3IT6B 1PYWD 5E6OA 1FFVA 3SU8X 4WQOB 2KQ4X 3ZRCA 2A4ZA 2M56B 4AS1A 4IWPA 1LO5D 2DENB 1VZ7A 2BT6A 2BVCA 1N63A 1XQQA 1IBXA 2KTFA 4FBJB 4DDGD 3B9JA 3ML9A 2L83A 5FKAC 4BVUC 3JW0X 1IGDA 2ZEQA 1EWYC 1WX9A 1RWSA 5AZFA 1STEA 2KVRA 1YQBA 3UQAA 1EU4A 1WE7A 2ON8A 1DOYA 1E8WA 2QEJC 3NVVA 3OG5A 1MHXA 4ARIA 3CIRB 1L5PA 4XX5A 3P63A 1WGDA 2DAJA 1FO4A 1WXVA 1RFAA 1ISNA 2DZKA 2NVUI 2GB1A 3I57A 3J9CA 3QK0A 2DLBA 1TY2A 3VFKA 3PS6A 3AEGB 1NVID 4A3PA 2W3RA 4FADA 4KV2A 4BKTA 2MSED 4FHJA 3NVWA 3BYTB 2AL6A 5G2NA 2PJHA 2RDGA 3BIID 4MJSA 2ZPYA 5J2RA 3CWIA 3ZTCA 1FCLA 2ZPNA 2W82A 2H89B 1QZEA 3Q8BA 4KVGB 2KC1A 3BY4B 1E7PB 2SAKA 1WR6E 4NY0A 1NENB 2MWSB 1WX8A 5D2MB 1VD2A 3AE2B 2KACA 4MGYE 4HPMB 1WJNA 2N0SB 4RGMA 1SEBD 2V4IB 1H4RA 3R8BA 3DBRI 1YQ3B 2FBWB 2D10A 2KT7A 5HI1A 3BK2A 4K7UA 4HLEA 1XF5L 4OZAA 3Q8EA 4EFOA 4WH4A 5BMIA 1TT5B 2K5PA 3TUOA 3NZ3A 4ZRPA 1I35A 1VLBA 2KK8A 3WCQA 2GBJA 1S1QB 4N58A 4LJOB 5E6JA 4A9AA 1J7CA 2FE8A 1K52A 2BYTA 2PVGC 2GI9A 3U7DA 2LHDA 2XN9C 3AEFB 2JRHA 3ZUNA 4RF0A 1E0ZA 1NI3A 2JPHA 4OZBA 4OW0A 1F9JA 3W9CB 3DPDA 5CHVC 1WWTA 3DBRB 2BKRB 2IY0B 2N9PC 2ACZB 4ITKA 3AE1B 4DK5A 4W9JA 4XGAB 4RCOA
chains in the Genus database with same CATH topology
2Z59B 3ZNGC 5IAAC 3QARA 4W9KA 1WX7A 3PT2B 4EOYA 3R3MA 4YL8A 1WGYA 4GXBA 2KWCA 2KC2A 3RZWC 1JRUA 3WAOA 4FLHA 4MGIE 5JHAA 3ZIMA 1NI2A 2K6DB 3TIXA 2KHWB 3DVGX 1RRBA 1C3TA 3OJ3A 4ANXA 2KJ6A 4EZLA 4ZYNA 3VVWB 4NJ7A 3CF6E 3L0WB 4J6IA 3PTFC 3ZDMC 1T0YA 3UIPB 2KLGA 1Z5SB 2MBHA 4A20A 2JWZA 3VUXA 2J0KA 3PRZA 3DVNV 2CHXA 3APCA 4GSWA 4M0WB 1J19A 2IZVB 4WWPA 5LLIA 1Q5WB 1LM8B 2KWUB 1WXAA 3MTNB 4W9LA 4GDKA 4CHKA 1E5WA 4IWOA 2J0MA 3VUYA 4AOFA 2ZCCA 4II2B 3TJPA 1WJ4A 3HHMA 3NY5A 1IYFA 1WE6A 3PZDA 3UIOB 4E71A 4M8NA 2MRPA 2KFJA 2KFKB 2FUHB 2N7EA 2YVCA 2QHOA 3UGBB 2XK5B 4AP4C 3V6CB 2FAZA 1ZW7A 2BWFA 4AUQC 1GUAB 3A1QA 3KYDD 2VRRB 3C0RB 5E6PA 2WDTB 1CMXB 2L7RA 2C60A 2N9EB 1WRDB 4WWOA 3NZUA 4MDKE 2LVQA 3VH3B 4DHZE 2DZJA 2KANA 2K39A 4BFRA 1WFYA 3ZNID 4ANWA 2WWZA 1D3ZA 1V86A 4ZDVA 2DYOA 2KX0A 2WX1A 3VH4B 2KDBA 2N1WA 3L08A 4GOCA 4KIKA 3BINA 2JY6A 3PSEB 1GC6A 2K1FA 3PHWB 1V49A 4NPNA 2KQSA 3RZFA 2AYOB 2JF5A 4K81A 1EF5A 3IG3A 4DBGA 4ZRJA 1YD8U 3QC8B 1WZ0A 3EFUA 2W9NA 3R7RA 2MCNB 2RPQA 2V3SA 3NOBA 1E8ZA 2KWVB 2N1VA 4MH0E 4PYUA 4NJ6A 1IP9A 4OVUA 1WIAA 4ICUA 3A9KB 3PRPB 4MGZE 4NQLB 3DDCB 2KDFB 4HCNB 5FR6A 3JSVB 1UD7A 4WJQA 3ZVVA 4I6PA 2K8BA 4FJZA 4GGQA 3ENEA 3T9LA 4AWJA 4IUMB 4BBNF 1I42A 2RR9A 1E7UA 3KUCB 3QJZA 3DQVA 4W9FA 3QCAA 4MELA 1R4NI 3AULA 2K8CA 2KTRA 2O6VD 3ZDTA 5JH5C 4FHKA 2D3GA 1KOTA 3HM6X 2O2VA 3QHTA 1AARA 1ZKHA 2BF8B 3VUWA 3Q3FA 2AWTA 5DPRA 1Q1OA 1WMHB 3CSTA 3H7PB 3L10B 4HDOA 1OEYA 3PGEA 2ZNVB 3OJ4B 4WWNA 2REXA 2M8SA 2LZ6A 1WGHA 1SIFA 2EMSA 5E6NA 4AJWA 2NS5A 4PS8A 3DBLI 3H6NA 2M0XA 2IY1B 4JL9A 4HCPB 4W9HA 4ZRKA 4HPLB 1YJ1A 1WYWB 1G6JA 1LXDA 2CKHB 3PV1A 3QIJA 2WX0A 3KH0A 4X57B 3JSVA 1P3QU 3UF8A 3DCGA 3SHQA 3ZO5B 3DBHI 3L54A 2LXCA 1V5OA 2AEHA 3Q3JA 4IW0A 4W9GA 2JXXA 2CU1A 2A5UA 3ZLZA 1TBEA 3APDA 5LXHA 2D11A 2L00B 3AU4A 3A1QB 2ZCBA 1WM2A 1E90A 4FJYA 3UINB 3WAMA 3U8ZA 2L0TA 3JVZX 2YLMA 2K8HA 3A4SC 2DX5B 3R66C 1OEYJ 4GU2A 2PPHA 4KDLB 2ZVNA 2BPSA 1P1AA 1V5TA 2ZVOA 3W1SC 4EEWA 1NBFC 4CYEA 3VTWA 2MP2B 5AZHA 2I1KA 5J17A 4IG7B 1Z2MA 1X1MA 1U4AA 2BWES 3IFWB 4IM0A 2DAFA 2L3ZA 4XZ4A 3HK0A 4ANVA 1YIWA 1UBQA 3K9OB 2C9WB 2LXAA 3SD5A 1V81A 4GIVA 3V62A 1S3SG 2KD0A 1WR1A 2R2QA 3EC8A 4F1SA 1Y8RC 2MBOA 2NR2A 4W9EA 3HM3A 4M8MA 5TR5A 4EZKA 5BO4B 1UGMA 2BYEA 2D07B 2ZJDA 3EECA 4WJOA 3U30A 4BBNC 2V1YA 4W9DA 2ZNVC 1KJTA 4GB9A 1E8XA 4DWFA 1E8YA 4MJSB 3V6EB 2V4LA 2KJRA 5GMVA 3A9JB 3OLMD 3ZW3A 2CR5A 1C1YB 2N4FA 4BKGA 3GOEA 4KSLC 3AU5A 5HKHA 4BOSC 2LGXA 3VQIA 3W1SA 2G45B 2L0FA 3LDZE 2BKFA 3B08A 4NAWA 1P0RA 2DYBA 4IM2A 5AZGA 4NAWB 4JQWC 3L16A 3L13A 4EKUA 2BYFA 2MW5A 1WZ3A 4PS3A 2LJ5A 2LVOA 2K25A 4G11A 4I6LB 3N30A 1PQSA 2IO3B 4FULA 2KXJA 1V9JA 4MEMA 2DYMA 4KZ0A 4TUUA 4LCDE 4LDTD 2JRIB 2L76A 2UYZB 5LXIB 1EUVB 3CMMB 2O2VB 1GG3A 3H9DA 3VDZA 1V2YA 1A5RA 4A3OA 2K6QA 2C7MB 3TCAA 3K9PB 3WIMA 2HTHA 4DHJD 4HDQA 1RLFA 2B3AA 2MQJA 4I6NB 3NZSA 4ZRIA 2XK5A 1P98A 3KUDB 1WY8A 4MGKE 2HE7A 2EMTA 4RMAA 3WALA 5JHBA 2MA9B 3VTVA 3EHVA 4NNJB 4PYZA 4WJNA 4E3CA 2C7NB 5J18A 2GOWA 4E74A 4RM8A 2IBIB 5DCNA 1TGZB 2DZIA 4FJVB 3KW5B 4P7IA 5L83A 1WJ6A 4ASWC 3VXWA 3ONSA 2C5LC 2CHZA 2WYQA 2ZZPB 2L8JA 3NS8A 4GDKB 4TKNA 1E7VA 3M63B 2LVPA 1WXMA 1KM7A 1UZXB 2MLBA 1V6EA 4EUTA 4GDLA 3A33B 4URKA 2MBEA 1WF9A 5E6OA 1J0GA 2PE6B 3SU8X 2AL3A 1KLVA 2KZRA 4GMVA 3P2BA 3QA8A 2BGFA 4II3B 3PHXB 4WQOB 3ZRCA 2A4ZA 2LUEA 3B0AA 2KO3A 5EDSA 4IC7B 1GC7A 2CHWA 4IWPA 2UWQA 2DENB 4K7SA 1IPGA 5DPTA 2JZZA 3X0WA 2M17A 3CSFA 3N3KB 1WH3A 4PS7A 1XQQA 4AJYB 1ZGUB 2FCQA 3O65B 3RUIB 2KTFA 1SGHA 2FCSA 2MBBB 4FBJB 4DDGD 2M1MA 1TZ1A 1BT0A 3ML9A 2PEAA 4B6WA 4BVUC 4NQKE 3JW0X 3ZNHB 1OQYA 2EKEC 2ZEQA 2G4SA 3ZRFA 1WX9A 2DHZA 5AZFA 2G4DB 4HK2A 1GJZA 2RSUA 3PRMB 5C23A 2GBKA 2Z0EB 1GNUA 4JIOU 1WXSA 1V80A 2KVRA 2GBNA 3KYCD 1YQBA 3T8MA 3X23A 4HXDA 3UQAA 3SDLC 3LJ3A 2ASQA 2Z0DB 2CS4A 1WE7A 4LJPB 5CTRC 4W9CA 3A9KA 2FCMA 4JLCA 1E8WA 2LRWA 1WGRA 1YX5B 3WANA 3QAQA 3PREA 3GZNI 2NPTA 2RD0A 2JT4B 2LWPA 4FA6A 4XX5A 2D2QA 3MHSD 4F7ZA 4ANUA 3ML8A 2MBQA 4DXAB 1WGDA 2DAJA 3ECIA 1Q0WB 1WXVA 1RFAA 3M62B 2OOBB 1ISNA 4TQ1A 2DZKA 2KOXA 2NPTB 2NVUI 1K8RB 2G3QB 3TL5A 3QK0A 3OAWA 3TBLD 3UQBA 1OTRB 3VFKA 5JZEB 3PS6A 5C1ZA 4MM3A 4JGHB 3RCZA 2HD5B 1FXTB 2IO0B 5G55A 3PPAA 4A3PA 1VCBA 4FADA 3ALBA 1R4MI 4KV2A 2NBVB 2MSED 3M3JA 3V60A 2FIFA 4BKTA 4DHJB 4FHJA 2HJ8A 4G0NB 2GBMA 4BKSA 2BYVE 2MX2A 3A9JA 4WJPA 2AL6A 5G2NA 3RULA 2PJHA 2PE9A 1P9DU 2JUOA 3DVGY 3H7SA 2ZPYA 4MJSA 5J2RA 4LDTB 2IO1B 2KMCA 3DVNU 4KZCA 2KMAA 4KIKB 2FNJB 3ZTCA 1WGGA 2ZPNA 4OVVA 4B9KA 4B95A 2IYDB 1SE9A 1TTNA 1UBIA 1QZEA 2C7HA 4N9F4 2KC1A 3BY4B 4K1RB 4KVGB 1J8CA 2O6VA 1WR6E 3DBSA 4NY0A 1EO6A 3S2AA 2LASA 3KUZA 2MWSB 2JVCA 5L95C 1WX8A 5D2MB 4EZJA 1VD2A 2O6VB 4MGYE 4HPMB 1WJNA 4MSQB 5D7GA 2MP2A 1WI0A 2KFKA 3IBEA 5KHOA 5DPWA 1WM3A 4MSMB 2KLCA 5CHWA 3WA0A 5AEKB 1H4RA 4BKSD 2LRUA 2FCNA 3PLVA 4BOZB 3QX1A 5IA7A 3DBRI 3IHPC 2XBBC 4GDLB 4KSKC 2NBWB 1EF1A 2D10A 4HVBA 2J7QB 3RT3B 1NDDA 3L17A 2IO2B 3PLUA 3TMPB 1L2NA 2KQ7A 3V61A 4K7UA 4DHZB 3PVLA 4HLEA 1MG8A 4W9IA 3HIZA 4FN2A 2KJHB 3W1YA 4EFOA 3ZTDA 1LFDA 4WAAA 2LD9A 4KDIC 1UH6A 1UELA 5KHQA 5CX3A 4XC2A 2KDEB 2NCNA 1WJUA 1I35A 5CHFA 2KK8A 4IM3A 2GBJA 1L7YA 3NHEB 4GN1A 1S1QB 3RYTA 2FIDA 3AXCA 4LJOB 4HJKA 2GMIC 3D32A 2KNBA 3QWZB 2XEWA 1HE8A 2JZ3B 2GBRA 3H7PA 3B1LX 3M95A 4IWQA 4RM9A 3U7DA 3N32A 4TV3A 1LQBA 2R2OA 5DPSA 2OJRA 1WMHA 5D6JB 3A4RA 3VAWA 3APFA 2JRHA 3RD2A 2KN5A 3VHTC 1XT9B 3ZUNA 3AI5A 2L05A 3IVFA 4G3XB 3ZKJC 1M94A 4CO7A 2KTRB 3MJWA 2JPHA 3ZNZB 4HWIB 1F9JA 4TQ0A 3I3TB 3DOWA 3DPDA 3VTUA 2I1JA 1YX6B 2LI5A 2KKCA 2M4NA 3H1UA 1XD3B 5CHVC 4DDID 2NBUA 2KDIA 3WAPA 2LGDA 2KX3A 2BKRB 2DZMA 2N7DA 2N9XA 2IY0B 3R7QA 3JYUA 2LGYA 2Y5BB 4ICVA 1H8CA 4G50A 5D94A 2N9PC 4F8CB 4K7WA 2J0JA 1RAXA 1OGWA 3KVFB 3QQ8B 4DK5A 2RGFA 4W9JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Z59 B;  3ZNG C;  5IAA C;  3QAR A;  4W9K A;  1WX7 A;  3PT2 B;  4EOY A;  3R3M A;  4YL8 A;  1WGY A;  4GXB A;  2KWC A;  2KC2 A;  3RZW C;  1JRU A;  3WAO A;  4FLH A;  4MGI E;  5JHA A;  3ZIM A;  1NI2 A;  2K6D B;  3TIX A;  2KHW B;  3DVG X;  1RRB A;  1C3T A;  3OJ3 A;  4ANX A;  2KJ6 A;  4EZL A;  4ZYN A;  3VVW B;  4NJ7 A;  3CF6 E;  3L0W B;  4J6I A;  3PTF C;  3ZDM C;  1T0Y A;  3UIP B;  2KLG A;  1Z5S B;  2MBH A;  4A20 A;  2JWZ A;  3VUX A;  2J0K A;  3PRZ A;  3DVN V;  2CHX A;  3APC A;  4GSW A;  4M0W B;  1J19 A;  2IZV B;  4WWP A;  5LLI A;  1Q5W B;  1LM8 B;  2KWU B;  1WXA A;  3MTN B;  4W9L A;  4GDK A;  4CHK A;  1E5W A;  4IWO A;  2J0M A;  3VUY A;  4AOF A;  2ZCC A;  4II2 B;  3TJP A;  1WJ4 A;  3HHM A;  3NY5 A;  1IYF A;  1WE6 A;  3PZD A;  3UIO B;  4E71 A;  4M8N A;  2MRP A;  2KFJ A;  2KFK B;  2FUH B;  2N7E A;  2YVC A;  2QHO A;  3UGB B;  2XK5 B;  4AP4 C;  3V6C B;  2FAZ A;  1ZW7 A;  2BWF A;  4AUQ C;  1GUA B;  3A1Q A;  3KYD D;  2VRR B;  3C0R B;  5E6P A;  2WDT B;  1CMX B;  2L7R A;  2C60 A;  2N9E B;  1WRD B;  4WWO A;  3NZU A;  4MDK E;  2LVQ A;  3VH3 B;  4DHZ E;  2DZJ A;  2KAN A;  2K39 A;  4BFR A;  1WFY A;  3ZNI D;  4ANW A;  2WWZ A;  1D3Z A;  1V86 A;  4ZDV A;  2DYO A;  2KX0 A;  2WX1 A;  3VH4 B;  2KDB A;  2N1W A;  3L08 A;  4GOC A;  4KIK A;  3BIN A;  2JY6 A;  3PSE B;  1GC6 A;  2K1F A;  3PHW B;  1V49 A;  4NPN A;  2KQS A;  3RZF A;  2AYO B;  2JF5 A;  4K81 A;  1EF5 A;  3IG3 A;  4DBG A;  4ZRJ A;  1YD8 U;  3QC8 B;  1WZ0 A;  3EFU A;  2W9N A;  3R7R A;  2MCN B;  2RPQ A;  2V3S A;  3NOB A;  1E8Z A;  2KWV B;  2N1V A;  4MH0 E;  4PYU A;  4NJ6 A;  1IP9 A;  4OVU A;  1WIA A;  4ICU A;  3A9K B;  3PRP B;  4MGZ E;  4NQL B;  3DDC B;  2KDF B;  4HCN B;  5FR6 A;  3JSV B;  1UD7 A;  4WJQ A;  3ZVV A;  4I6P A;  2K8B A;  4FJZ A;  4GGQ A;  3ENE A;  3T9L A;  4AWJ A;  4IUM B;  4BBN F;  1I42 A;  2RR9 A;  1E7U A;  3KUC B;  3QJZ A;  3DQV A;  4W9F A;  3QCA A;  4MEL A;  1R4N I;  3AUL A;  2K8C A;  2KTR A;  2O6V D;  3ZDT A;  5JH5 C;  4FHK A;  2D3G A;  1KOT A;  3HM6 X;  2O2V A;  3QHT A;  1AAR A;  1ZKH A;  2BF8 B;  3VUW A;  3Q3F A;  2AWT A;  5DPR A;  1Q1O A;  1WMH B;  3CST A;  3H7P B;  3L10 B;  4HDO A;  1OEY A;  3PGE A;  2ZNV B;  3OJ4 B;  4WWN A;  2REX A;  2M8S A;  2LZ6 A;  1WGH A;  1SIF A;  2EMS A;  5E6N A;  4AJW A;  2NS5 A;  4PS8 A;  3DBL I;  3H6N A;  2M0X A;  2IY1 B;  4JL9 A;  4HCP B;  4W9H A;  4ZRK A;  4HPL B;  1YJ1 A;  1WYW B;  1G6J A;  1LXD A;  2CKH B;  3PV1 A;  3QIJ A;  2WX0 A;  3KH0 A;  4X57 B;  3JSV A;  1P3Q U;  3UF8 A;  3DCG A;  3SHQ A;  3ZO5 B;  3DBH I;  3L54 A;  2LXC A;  1V5O A;  2AEH A;  3Q3J A;  4IW0 A;  4W9G A;  2JXX A;  2CU1 A;  2A5U A;  3ZLZ A;  1TBE A;  3APD A;  5LXH A;  2D11 A;  2L00 B;  3AU4 A;  3A1Q B;  2ZCB A;  1WM2 A;  1E90 A;  4FJY A;  3UIN B;  3WAM A;  3U8Z A;  2L0T A;  3JVZ X;  2YLM A;  2K8H A;  3A4S C;  2DX5 B;  3R66 C;  1OEY J;  4GU2 A;  2PPH A;  4KDL B;  2ZVN A;  2BPS A;  1P1A A;  1V5T A;  2ZVO A;  3W1S C;  4EEW A;  1NBF C;  4CYE A;  3VTW A;  2MP2 B;  5AZH A;  2I1K A;  5J17 A;  4IG7 B;  1Z2M A;  1X1M A;  1U4A A;  2BWE S;  3IFW B;  4IM0 A;  2DAF A;  2L3Z A;  4XZ4 A;  3HK0 A;  4ANV A;  1YIW A;  1UBQ A;  3K9O B;  2C9W B;  2LXA A;  3SD5 A;  1V81 A;  4GIV A;  3V62 A;  1S3S G;  2KD0 A;  1WR1 A;  2R2Q A;  3EC8 A;  4F1S A;  1Y8R C;  2MBO A;  2NR2 A;  4W9E A;  3HM3 A;  4M8M A;  5TR5 A;  4EZK A;  5BO4 B;  1UGM A;  2BYE A;  2D07 B;  2ZJD A;  3EEC A;  4WJO A;  3U30 A;  4BBN C;  2V1Y A;  4W9D A;  2ZNV C;  1KJT A;  4GB9 A;  1E8X A;  4DWF A;  1E8Y A;  4MJS B;  3V6E B;  2V4L A;  2KJR A;  5GMV A;  3A9J B;  3OLM D;  3ZW3 A;  2CR5 A;  1C1Y B;  2N4F A;  4BKG A;  3GOE A;  4KSL C;  3AU5 A;  5HKH A;  4BOS C;  2LGX A;  3VQI A;  3W1S A;  2G45 B;  2L0F A;  3LDZ E;  2BKF A;  3B08 A;  4NAW A;  1P0R A;  2DYB A;  4IM2 A;  5AZG A;  4NAW B;  4JQW C;  3L16 A;  3L13 A;  4EKU A;  2BYF A;  2MW5 A;  1WZ3 A;  4PS3 A;  2LJ5 A;  2LVO A;  2K25 A;  4G11 A;  4I6L B;  3N30 A;  1PQS A;  2IO3 B;  4FUL A;  2KXJ A;  1V9J A;  4MEM A;  2DYM A;  4KZ0 A;  4TUU A;  4LCD E;  4LDT D;  2JRI B;  2L76 A;  2UYZ B;  5LXI B;  1EUV B;  3CMM B;  2O2V B;  1GG3 A;  3H9D A;  3VDZ A;  1V2Y A;  1A5R A;  4A3O A;  2K6Q A;  2C7M B;  3TCA A;  3K9P B;  3WIM A;  2HTH A;  4DHJ D;  4HDQ A;  1RLF A;  2B3A A;  2MQJ A;  4I6N B;  3NZS A;  4ZRI A;  2XK5 A;  1P98 A;  3KUD B;  1WY8 A;  4MGK E;  2HE7 A;  2EMT A;  4RMA A;  3WAL A;  5JHB A;  2MA9 B;  3VTV A;  3EHV A;  4NNJ B;  4PYZ A;  4WJN A;  4E3C A;  2C7N B;  5J18 A;  2GOW A;  4E74 A;  4RM8 A;  2IBI B;  5DCN A;  1TGZ B;  2DZI A;  4FJV B;  3KW5 B;  4P7I A;  5L83 A;  1WJ6 A;  4ASW C;  3VXW A;  3ONS A;  2C5L C;  2CHZ A;  2WYQ A;  2ZZP B;  2L8J A;  3NS8 A;  4GDK B;  4TKN A;  1E7V A;  3M63 B;  2LVP A;  1WXM A;  1KM7 A;  1UZX B;  2MLB A;  1V6E A;  4EUT A;  4GDL A;  3A33 B;  4URK A;  2MBE A;  1WF9 A;  5E6O A;  1J0G A;  2PE6 B;  3SU8 X;  2AL3 A;  1KLV A;  2KZR A;  4GMV A;  3P2B A;  3QA8 A;  2BGF A;  4II3 B;  3PHX B;  4WQO B;  3ZRC A;  2A4Z A;  2LUE A;  3B0A A;  2KO3 A;  5EDS A;  4IC7 B;  1GC7 A;  2CHW A;  4IWP A;  2UWQ A;  2DEN B;  4K7S A;  1IPG A;  5DPT A;  2JZZ A;  3X0W A;  2M17 A;  3CSF A;  3N3K B;  1WH3 A;  4PS7 A;  1XQQ A;  4AJY B;  1ZGU B;  2FCQ A;  3O65 B;  3RUI B;  2KTF A;  1SGH A;  2FCS A;  2MBB B;  4FBJ B;  4DDG D;  2M1M A;  1TZ1 A;  1BT0 A;  3ML9 A;  2PEA A;  4B6W A;  4BVU C;  4NQK E;  3JW0 X;  3ZNH B;  1OQY A;  2EKE C;  2ZEQ A;  2G4S A;  3ZRF A;  1WX9 A;  2DHZ A;  5AZF A;  2G4D B;  4HK2 A;  1GJZ A;  2RSU A;  3PRM B;  5C23 A;  2GBK A;  2Z0E B;  1GNU A;  4JIO U;  1WXS A;  1V80 A;  2KVR A;  2GBN A;  3KYC D;  1YQB A;  3T8M A;  3X23 A;  4HXD A;  3UQA A;  3SDL C;  3LJ3 A;  2ASQ A;  2Z0D B;  2CS4 A;  1WE7 A;  4LJP B;  5CTR C;  4W9C A;  3A9K A;  2FCM A;  4JLC A;  1E8W A;  2LRW A;  1WGR A;  1YX5 B;  3WAN A;  3QAQ A;  3PRE A;  3GZN I;  2NPT A;  2RD0 A;  2JT4 B;  2LWP A;  4FA6 A;  4XX5 A;  2D2Q A;  3MHS D;  4F7Z A;  4ANU A;  3ML8 A;  2MBQ A;  4DXA B;  1WGD A;  2DAJ A;  3ECI A;  1Q0W B;  1WXV A;  1RFA A;  3M62 B;  2OOB B;  1ISN A;  4TQ1 A;  2DZK A;  2KOX A;  2NPT B;  2NVU I;  1K8R B;  2G3Q B;  3TL5 A;  3QK0 A;  3OAW A;  3TBL D;  3UQB A;  1OTR B;  3VFK A;  5JZE B;  3PS6 A;  5C1Z A;  4MM3 A;  4JGH B;  3RCZ A;  2HD5 B;  1FXT B;  2IO0 B;  5G55 A;  3PPA A;  4A3P A;  1VCB A;  4FAD A;  3ALB A;  1R4M I;  4KV2 A;  2NBV B;  2MSE D;  3M3J A;  3V60 A;  2FIF A;  4BKT A;  4DHJ B;  4FHJ A;  2HJ8 A;  4G0N B;  2GBM A;  4BKS A;  2BYV E;  2MX2 A;  3A9J A;  4WJP A;  2AL6 A;  5G2N A;  3RUL A;  2PJH A;  2PE9 A;  1P9D U;  2JUO A;  3DVG Y;  3H7S A;  2ZPY A;  4MJS A;  5J2R A;  4LDT B;  2IO1 B;  2KMC A;  3DVN U;  4KZC A;  2KMA A;  4KIK B;  2FNJ B;  3ZTC A;  1WGG A;  2ZPN A;  4OVV A;  4B9K A;  4B95 A;  2IYD B;  1SE9 A;  1TTN A;  1UBI A;  1QZE A;  2C7H A;  4N9F 4;  2KC1 A;  3BY4 B;  4K1R B;  4KVG B;  1J8C A;  2O6V A;  1WR6 E;  3DBS A;  4NY0 A;  1EO6 A;  3S2A A;  2LAS A;  3KUZ A;  2MWS B;  2JVC A;  5L95 C;  1WX8 A;  5D2M B;  4EZJ A;  1VD2 A;  2O6V B;  4MGY E;  4HPM B;  1WJN A;  4MSQ B;  5D7G A;  2MP2 A;  1WI0 A;  2KFK A;  3IBE A;  5KHO A;  5DPW A;  1WM3 A;  4MSM B;  2KLC A;  5CHW A;  3WA0 A;  5AEK B;  1H4R A;  4BKS D;  2LRU A;  2FCN A;  3PLV A;  4BOZ B;  3QX1 A;  5IA7 A;  3DBR I;  3IHP C;  2XBB C;  4GDL B;  4KSK C;  2NBW B;  1EF1 A;  2D10 A;  4HVB A;  2J7Q B;  3RT3 B;  1NDD A;  3L17 A;  2IO2 B;  3PLU A;  3TMP B;  1L2N A;  2KQ7 A;  3V61 A;  4K7U A;  4DHZ B;  3PVL A;  4HLE A;  1MG8 A;  4W9I A;  3HIZ A;  4FN2 A;  2KJH B;  3W1Y A;  4EFO A;  3ZTD A;  1LFD A;  4WAA A;  2LD9 A;  4KDI C;  1UH6 A;  1UEL A;  5KHQ A;  5CX3 A;  4XC2 A;  2KDE B;  2NCN A;  1WJU A;  1I35 A;  5CHF A;  2KK8 A;  4IM3 A;  2GBJ A;  1L7Y A;  3NHE B;  4GN1 A;  1S1Q B;  3RYT A;  2FID A;  3AXC A;  4LJO B;  4HJK A;  2GMI C;  3D32 A;  2KNB A;  3QWZ B;  2XEW A;  1HE8 A;  2JZ3 B;  2GBR A;  3H7P A;  3B1L X;  3M95 A;  4IWQ A;  4RM9 A;  3U7D A;  3N32 A;  4TV3 A;  1LQB A;  2R2O A;  5DPS A;  2OJR A;  1WMH A;  5D6J B;  3A4R A;  3VAW A;  3APF A;  2JRH A;  3RD2 A;  2KN5 A;  3VHT C;  1XT9 B;  3ZUN A;  3AI5 A;  2L05 A;  3IVF A;  4G3X B;  3ZKJ C;  1M94 A;  4CO7 A;  2KTR B;  3MJW A;  2JPH A;  3ZNZ B;  4HWI B;  1F9J A;  4TQ0 A;  3I3T B;  3DOW A;  3DPD A;  3VTU A;  2I1J A;  1YX6 B;  2LI5 A;  2KKC A;  2M4N A;  3H1U A;  1XD3 B;  5CHV C;  4DDI D;  2NBU A;  2KDI A;  3WAP A;  2LGD A;  2KX3 A;  2BKR B;  2DZM A;  2N7D A;  2N9X A;  2IY0 B;  3R7Q A;  3JYU A;  2LGY A;  2Y5B B;  4ICV A;  1H8C A;  4G50 A;  5D94 A;  2N9P C;  4F8C B;  4K7W A;  2J0J A;  1RAX A;  1OGW A;  3KVF B;  3QQ8 B;  4DK5 A;  2RGF A;  4W9J A; 
#chains in the Genus database with same CATH topology
 1V8C A;  4W9K A;  4YL8 A;  1WGY A;  4L23 A;  2ZW0 A;  3WAO A;  2KC2 A;  1TIF A;  4KGT A;  2KHW B;  3DVG X;  2WU5 B;  1RRB A;  4ZYN A;  2G9H D;  2WDR B;  1T0Y A;  1VZ6 A;  3VUX A;  2J0K A;  3PRZ A;  4M0W B;  1J19 A;  3U4E G;  5D3I B;  1K51 A;  2KWU B;  1WXA A;  1YN4 A;  3NJT A;  4GDK A;  2J0M A;  3EA6 A;  2MEK A;  4II2 B;  2MRP A;  4RNA A;  2YVC A;  1ZW7 A;  3E9S A;  2BWF A;  4AUQ C;  3A1Q A;  2VRR B;  2WDT B;  1CMX B;  1FIQ A;  2PKO A;  5AUI A;  4DHZ E;  2DZJ A;  4ZHP A;  1JWS D;  1WFY A;  3ZNI D;  2WWZ A;  4XWW A;  4WAF A;  3VH4 B;  2J53 A;  2KQS A;  3ZGZ A;  1EF5 A;  4DBG A;  1WZ0 A;  3MP9 A;  2MJD A;  3R7R A;  3NOB A;  2KWV B;  4PYU A;  4OVU A;  1MI0 A;  4YXD B;  4NQL B;  1AWD A;  3ZVV A;  2WLB A;  3T9L A;  1RM6 C;  2KDM A;  2NTT A;  4BBN F;  4IUM B;  2RR9 A;  1E7U A;  3QJZ A;  1TYG B;  3QCA A;  4MEL A;  1R4N I;  5JH5 C;  3ZDT A;  1NEK B;  4FHK A;  2FUG 1;  3AV8 A;  1ZKH A;  2NMQ A;  1I4P A;  1PUT A;  1WMH B;  3CST A;  4NZL B;  2KWD A;  2VH1 A;  3BVM A;  2KAJ A;  3DHH C;  4HCP B;  1YJ1 A;  1WYW B;  2I2Y A;  1QLB B;  1DOI A;  3QIJ A;  2WX0 A;  1P3Q U;  5BYS A;  3DCG A;  3ZO5 B;  3DBH I;  2AEH A;  3AU4 A;  1WM2 A;  4RH6 A;  1E9M A;  3U8Z A;  3TSS A;  2JYE A;  2K8H A;  2QJL A;  1XCQ L;  1OEY J;  4GU2 A;  2PPH A;  1F0Z A;  1P1A A;  3ZXR A;  1NBF C;  2D5G A;  4LNI A;  5AZH A;  4R3D A;  1PDX A;  4IM0 A;  4XZ4 A;  4ANV A;  3HK0 A;  3K9O B;  1GB1 A;  4M8M A;  1IGC A;  3AN1 A;  2IDY A;  3RNC C;  4WJO A;  1V1P B;  2V1Y A;  2N9L A;  1E8Y A;  2GRI A;  2KJR A;  4XDC A;  1C1Y B;  1M4V A;  2N4F A;  2BS2 B;  1YOV B;  1N62 A;  2LFI A;  2BKF A;  4MM3 B;  1TS5 A;  1FM0 D;  1VRA B;  1L0X B;  1F52 A;  4D2K A;  3URY A;  4N59 A;  1CJE A;  2BYF A;  4LK0 M;  2UU7 A;  2LJ5 A;  2INC C;  1L6V A;  2DNF A;  1FXI A;  1V9J A;  3IXS A;  1JQ4 A;  4LCD E;  2HDE A;  2ICI A;  4WWM A;  2WHI A;  1V2Y A;  1A5R A;  2JYT A;  2HTH A;  4HDQ A;  2B3A A;  2BTE A;  4ZRI A;  1P98 A;  3KUD B;  4ZOH C;  1D5Z C;  3WAL A;  4PYZ A;  4RGT A;  5J18 A;  2GOW A;  2IBI B;  4LNN A;  5DCN A;  2DZI A;  4P7I A;  5L83 A;  5H8Y E;  3ONS A;  2WYQ A;  4TKN A;  1TS3 A;  1WXM A;  1V6E A;  4EUT A;  1LGR A;  3A33 B;  1J0G A;  1OQR A;  2PE6 B;  1XLO A;  4A90 A;  3QA8 A;  3R2I A;  3PHX B;  5BYQ A;  3P42 A;  2KO3 A;  2ONQ A;  2J52 A;  1GC7 A;  1J7A A;  2UWQ A;  5BMH A;  5FR3 A;  4XE0 A;  3N3K B;  4WIP A;  3RUI B;  1QQR A;  1JWB D;  1TZ1 A;  2PEA A;  3RNF C;  5IN7 A;  2N9K A;  3I5J C;  2G4S A;  3ZRF A;  2G4D B;  4HK2 A;  2HJ1 A;  2Z0E B;  2WXO A;  4TSS A;  3T8M A;  4HXD A;  3Q3M C;  3SDL C;  3LJ3 A;  2Z0D B;  4W9C A;  2FCM A;  2LRW A;  1YX5 B;  3WAN A;  3PRE A;  3GZN I;  2RD0 A;  2JT4 B;  2WXF A;  3DWG C;  2LWP A;  2D2Q A;  3MHS D;  4ANU A;  3ML8 A;  3ECI A;  1Q0W B;  1B1Z A;  2KYW A;  3M62 B;  4M00 A;  1KH0 A;  2ZW1 A;  4JPS A;  1K8R B;  5EE0 A;  3OAW A;  5C1Z A;  2Y5C A;  3EUB 2;  2NBV B;  3M3J A;  3V60 A;  4HRO A;  5IKC M;  1F1H A;  5EE1 A;  2GBM A;  1UF0 A;  4KKJ A;  2IPK D;  2KMC A;  3DVN U;  4NAM A;  3FAH A;  5I4D A;  1C9F A;  2IYD B;  1SB3 C;  5MPO A;  1SE9 A;  3L4P A;  2LGS A;  1J8C A;  3DBS A;  3MHZ A;  2LAS A;  3KUZ A;  3RFZ B;  1TJE A;  2KN4 A;  2KFK A;  3IBE A;  3SFD B;  5CHW A;  3WA0 A;  5AEK B;  2E3T A;  2LRU A;  3PLV A;  3SR6 A;  2J7Q B;  5G5G A;  1L2N A;  2KQ7 A;  3V61 A;  3FC4 A;  1N5W A;  2K9X A;  3HIZ A;  4A55 A;  4LNK A;  3RNB C;  1QOF A;  1LFD A;  1UEL A;  3FIL B;  3NRZ A;  1C76 A;  5KHQ A;  3NHE B;  4GN1 A;  2GMI C;  3D32 A;  5T8I A;  4C4V B;  1N6Z A;  2JZ3 B;  2BB6 A;  3N32 A;  4TV3 A;  5DPS A;  2R2O A;  1QOG A;  3A4R A;  3RN9 C;  1XT9 B;  1T3Q A;  2Z8L A;  4G3X B;  3ZKJ C;  5HFY A;  3ZXV A;  3P4P B;  1KRH A;  3P4S B;  4HWI B;  3I3T B;  2LI5 A;  3AE6 B;  2LGD A;  2X8X X;  2KX3 A;  2DZM A;  3VRA B;  3R7Q A;  3JYU A;  3MC0 B;  5EE9 A;  3NUH B;  3GP7 A;  3AE8 B;  4K7W A;  2J0J A;  1ENF A;  2Z59 B;  4EOY A;  1L4D B;  1WX7 A;  5GXG B;  1ZPS A;  2KWC A;  1L6U A;  1TS4 A;  3U52 E;  3ZIM A;  3KWV A;  1T0R C;  3VVW B;  3L0W B;  3UIP B;  1GAQ B;  2KLG A;  2MBH A;  2JWZ A;  4LTU A;  3DVN V;  4WWP A;  2IZV B;  2JWU A;  1GB4 A;  1Q5W B;  1LM8 B;  4MH8 A;  2AX5 A;  3Q14 C;  3ABV B;  4AOF A;  2ZCC A;  1WJ4 A;  1R4N B;  2BW2 A;  3PZD A;  3UIO B;  4E71 A;  1D6E C;  3TEW A;  2KFK B;  2N7E A;  3VRB B;  3PZ8 A;  3V6C B;  3R2T A;  3N1Y C;  1HXY D;  1PGA A;  3C0R B;  3GE3 C;  5E6P A;  2C60 A;  3LB8 C;  4WWO A;  1WRD B;  4MDK E;  4FXC A;  4BFR A;  1FRD A;  1PGX A;  1I7H A;  1YNT E;  4MT5 A;  4ZDV A;  2DYO A;  2N1W A;  2K1F A;  3PHW B;  3RZF A;  1AYF A;  1F2R C;  1FNU A;  4ZRJ A;  2Q5W D;  2N1V A;  4NJ6 A;  2L52 A;  1IP9 A;  3A9K B;  3PRP B;  4HCN B;  4FJZ A;  4GGQ A;  4AWJ A;  1Y56 A;  2QIL A;  3DQV A;  4W9F A;  4H2A A;  1SBB B;  1HQR D;  3AUL A;  2K8C A;  2D3G A;  3W5V B;  3NVZ A;  1KOT A;  1XLP A;  2O2V A;  3HM6 X;  2X38 A;  1SE3 A;  4TMA B;  1YJJ A;  4LNF A;  5BMG A;  4HDO A;  4C7Y A;  3OJ4 B;  2VZK D;  2NS5 A;  4C4V A;  1SJE D;  2IY1 B;  3ETR A;  4JL9 A;  5TSS A;  1OQQ A;  3HRD D;  1G6J A;  4DXF A;  1WGK A;  4K3B A;  2KVZ A;  4X57 B;  3JSV A;  1FMA D;  3L54 A;  4KGR A;  2LXC A;  1V5O A;  3NS1 A;  4IW0 A;  4W9G A;  2CU1 A;  3ZLZ A;  2ZCB A;  2KMM A;  1E90 A;  4XWT A;  3UIN B;  2YLM A;  3A4S C;  2DX5 B;  1FNV A;  3R66 C;  1QKZ A;  3AB5 A;  3P4Q B;  2ZVN A;  2BPS A;  4BZA A;  1MVK A;  1UWM A;  3W1S C;  1XO3 A;  3AE5 B;  4PK1 A;  5J17 A;  3BWU D;  3GB1 A;  3IFW B;  2L3Z A;  1YMH E;  3PZ7 A;  2LXA A;  4S17 A;  3SD5 A;  1V81 A;  1S3S G;  2KD0 A;  4JWU C;  1HTQ A;  4EZK A;  1TY0 A;  1B9R A;  4A6Q A;  1KJT A;  1E8X A;  5LNK 1;  2AQ3 B;  1ZDX A;  4MJS B;  2BQQ A;  3OLM D;  3ZW3 A;  2CR5 A;  1EWC A;  1BUI C;  3ZYY X;  1AN8 A;  4HPP A;  3LXF A;  4BOS C;  3RNG C;  2LGX A;  3W1S A;  5HG2 A;  4NAW A;  5AZG A;  5H92 C;  1JAL A;  4US8 A;  1XCT L;  4JQW C;  1YN3 A;  1V97 A;  2LJI A;  4EKU A;  4PS3 A;  2OED A;  2K25 A;  1E6E B;  4G11 A;  4I6L B;  3N30 A;  3DBH B;  2IO3 B;  2KXJ A;  4LDT D;  2L76 A;  2AQ1 B;  2QSD A;  2O2V B;  1GG3 A;  3VDZ A;  4RGN A;  1FNW A;  1N5X A;  2JXT A;  2C7M B;  3K9P B;  4DHJ D;  2XK5 A;  4MGK E;  2WU2 B;  2HE7 A;  2EMT A;  3VTV A;  1JWA D;  4HKZ E;  3MC8 A;  1YJI A;  1TGZ B;  3KW5 B;  4YSX B;  1WJ6 A;  4ZYS A;  2C5L C;  2L8J A;  3NS8 A;  4GDK B;  3IAS 1;  1E7V A;  4ARC A;  2Y3A A;  3RNE C;  2MLB A;  1UZX B;  4GDL A;  2JU6 X;  2PMV A;  4URK A;  3MJ5 A;  2MBE A;  2AL3 A;  1KLV A;  3P2B A;  2BGF A;  1VR9 A;  3V3X A;  1QOA A;  2M19 A;  1IUE A;  4IC7 B;  3AEA B;  2CHW A;  1MPE A;  2AQ2 B;  1EM7 A;  1SXT A;  4K7S A;  1IPG A;  1F2R I;  2CJN A;  1XXG A;  3CSF A;  4PS7 A;  3O65 B;  1SGH A;  2FCS A;  2M1M A;  4IOI E;  4B6W A;  4NQK E;  3AH7 A;  1SE4 A;  2EKE C;  3AMZ A;  1XLN A;  1GNU A;  1A70 A;  1WXS A;  3P4R B;  1NYQ A;  3KYC D;  4PT5 A;  4C80 A;  2CS4 A;  1DOX A;  2LEK A;  5CTR C;  1WGR A;  4HKQ A;  2NPT A;  3C8Y A;  3EGR A;  2D3B A;  4F7Z A;  1FPY A;  4DXA B;  5C3J B;  2OOB B;  4AQ7 A;  2NPT B;  3TL5 A;  3UQB A;  1OTR B;  3Q8F A;  4MM3 A;  2HD5 B;  1FXT B;  5G55 A;  3RI7 C;  3PPA A;  1VCB A;  3ALB A;  2FIF A;  2HJ8 A;  3HUI A;  3ZJU A;  2K0P A;  4BKS A;  2BYV E;  2MX2 A;  3A9J A;  4OZC A;  3RUL A;  4C56 C;  2H88 B;  2PE9 A;  1P9D U;  2BS3 B;  1J7B A;  2JUO A;  3H7S A;  4LDT B;  2IO1 B;  1HZ6 A;  2KMA A;  1HA5 A;  1I4Q A;  2WXQ A;  1UBI A;  4YWG G;  2O6V A;  2QIE B;  1EO6 A;  3S2A A;  2IJ0 A;  3AE7 B;  4EZJ A;  2O6V B;  5D7G A;  2MP2 A;  1WI0 A;  1WSP A;  3P1M A;  1I4X A;  5KHO A;  1WM3 A;  1QT9 A;  3QX1 A;  2XBB C;  4GDL B;  4KSK C;  2NBW B;  1EF1 A;  4HVB A;  1NDD A;  3L17 A;  3PLU A;  3TMP B;  3B2F A;  1R7S A;  4DHZ B;  2E6X A;  1MG8 A;  2JSV X;  2KJH B;  3W1Y A;  3ZTD A;  4WAA A;  2LD9 A;  3AEE B;  4KDI C;  1UH6 A;  5CX3 A;  2KDE B;  1WJU A;  5CHF A;  4QAY A;  1L7Y A;  3ZQ4 A;  3RYT A;  2LUM A;  3AXC A;  3SEB A;  1VJK A;  2XEW A;  1HE8 A;  2GBR A;  1WYG A;  3B1L X;  3H7P A;  4IWQ A;  2WS3 B;  1LQB A;  2OJR A;  3AE3 B;  5D6J B;  3VAW A;  1L0V B;  4WQM A;  2L05 A;  1XLQ A;  3MJW A;  2CU3 A;  3ZNZ B;  2QCZ A;  1ZUD 2;  3AM9 A;  4TQ0 A;  3VTU A;  1YX6 B;  2M4N A;  2LHE A;  4DDI D;  2NBU A;  2KDI A;  3SFE B;  3WAP A;  2N7D A;  2WXJ A;  2YEP F;  4ICV A;  1H8C A;  2LGI A;  4F8C B;  4K3C A;  3KVF B;  3QQ8 B;  4JE3 B;  1SSN A;  5IAA C;  3PT2 B;  1TZO A;  3R3M A;  1JRP A;  4IDI A;  3RPF C;  4MGI E;  1UGJ A;  3TIX A;  2K6D B;  1KLU D;  4EZL A;  1Z5S B;  1TKY A;  4GSW A;  5LLI A;  1SJH D;  4UDU C;  1FD6 A;  2RPV A;  5EE3 A;  3MTN B;  4CHK A;  1E5W A;  4IWO A;  2EKI A;  3TJP A;  3HHM A;  1OFF A;  2WXP A;  2RDH A;  3UGB B;  1IBX B;  2XK5 B;  4AP4 C;  2WDV B;  2B76 B;  3AEC B;  3HVZ A;  4ZHO A;  2L7R A;  2N9E B;  1ZE3 D;  3NZU A;  4JX1 C;  2M0A A;  4OVZ A;  4XYC A;  2KAN A;  1D5M C;  1V86 A;  2KX0 A;  2WX1 A;  4GOC A;  4YSY B;  4KIK A;  2INN E;  3BIN A;  4NPN A;  1V49 A;  4YTP B;  2AYO B;  1C77 A;  1XEE A;  5C2T B;  1V1O A;  2WXR A;  3EFU A;  2MCN B;  2RPQ A;  2V3S A;  1E8Z A;  4MH0 E;  3BVZ A;  1BXT A;  4RFB A;  4EE2 A;  1WIA A;  4ICU A;  3DDC B;  2V0G A;  1FEH A;  1UD7 A;  4I6P A;  2K8B A;  3ENE A;  1MHH E;  3GE8 C;  3KUC B;  2JX5 A;  1FFU A;  2NTS A;  1AAR A;  1JWM D;  2VH2 A;  1ESF A;  3T3O A;  5DPR A;  1RFK A;  3H7P B;  3L10 B;  1OEY A;  3PGE A;  2REX A;  2M8S A;  1SIF A;  1WGH A;  2EMS A;  5E6N A;  4W9H A;  3ZJV A;  2PW9 A;  2CKH B;  3C19 A;  2VZK B;  3KH0 A;  3UF8 A;  3SHQ A;  3AED B;  1C4A A;  3Q8C A;  4HJG E;  2XNA C;  2JXX A;  4YT0 B;  2A5U A;  1TBE A;  4P6V F;  1I4R A;  2DWQ A;  4FJY A;  3BYY B;  2L0T A;  4L1B A;  1V5T A;  1UWX A;  3VTW A;  2MP2 B;  2I1K A;  5D3D A;  4IG7 B;  2GLS A;  1X1M A;  2Y5P A;  2BWE S;  2DAF A;  1UBQ A;  4GIV A;  3T3N A;  3EC8 A;  1YN5 A;  4F1S A;  1Y8R C;  1JWU D;  3MFG A;  5TR5 A;  2J4X A;  3N1X C;  2BYE A;  2D07 B;  3IAM 1;  3U30 A;  4C7Z A;  2D3C A;  2YEP B;  4HRS A;  4GB9 A;  4JWS C;  1TKG A;  3DHG C;  3V6E B;  2BB5 A;  4HEA 1;  2V9H A;  5GMV A;  3A9J B;  4BKG A;  3GOE A;  4KSL C;  3AU5 A;  2JQR B;  1GOZ A;  2BBC A;  3W2D A;  4YTM B;  2G45 B;  2L1A A;  2L0F A;  4ACF A;  4REZ A;  2CJO A;  4IM2 A;  4M02 A;  4NAW B;  3L16 A;  2IND C;  3L13 A;  2PLP A;  4A8X C;  1ACC A;  2MW5 A;  2HTM E;  1C79 A;  1PFD A;  2WXG A;  3AE4 B;  1K53 A;  1PGB A;  4FUL A;  4MEM A;  2DYM A;  4KZ0 A;  4XDD A;  2UYZ B;  3CMM B;  5HHD G;  3V05 A;  3VR9 B;  2K3U A;  2MJE A;  3WIM A;  1AW7 A;  1RLF A;  2MQJ A;  2WXI A;  3EFC A;  4I6N B;  3NZS A;  4KKI A;  1WY8 A;  4RMA A;  3EHV A;  4E3C A;  1C4P A;  4WJN A;  2C7N B;  4E74 A;  2V3N A;  1QIL A;  4FJV B;  2MH7 A;  3ZJT A;  2CHZ A;  3M63 B;  2LVP A;  1VDV A;  2W3S A;  2PVO D;  3HVD A;  1WF9 A;  2KZR A;  4GMV A;  4II3 B;  4LNO A;  2LUE A;  3B0A A;  4P1B C;  5EDS A;  1HTO A;  1P7F A;  4P1C C;  5DPT A;  2JZZ A;  1K50 A;  3X0W A;  3TEZ A;  2M17 A;  1SE2 A;  1WH3 A;  2WXN A;  4WUR A;  4AJY B;  1ZGU B;  2FCQ A;  2MBB B;  1UNS A;  3N1Z C;  1BT0 A;  1ZXI A;  1D5X C;  4Q2J A;  3ZNH B;  1OQY A;  1ZDV A;  2DHZ A;  4N6E B;  1HEZ E;  1GJZ A;  2LMC A;  2RSU A;  3PRM B;  5C23 A;  1CQV A;  2GBK A;  4JIO U;  1V80 A;  2GBN A;  3X23 A;  3OWE B;  2ASQ A;  1WRI A;  4LJP B;  1L4Z B;  3A9K A;  4JLC A;  1ET6 A;  3QAQ A;  1SF0 A;  4FA6 A;  4USA A;  4GLS C;  2MBQ A;  3Q6B A;  4TQ1 A;  2KOX A;  1E10 A;  2G3Q B;  1I4G A;  2WXL A;  3TBL D;  3B2G A;  5JZE B;  1L0Y B;  4JGH B;  2IO0 B;  3RCZ A;  4KX6 B;  2OHF A;  4BAX A;  1R4M I;  4DHJ B;  3N9Y C;  5FK9 C;  4G0N B;  3AEB B;  4WJP A;  2SEB D;  2D3A A;  3N20 C;  3O13 A;  1YQ4 B;  3DVG Y;  4US9 A;  4KZC A;  4KIK B;  4MAC A;  2FNJ B;  1V1P A;  1WGG A;  4OVV A;  4B9K A;  4B95 A;  4B0E A;  1TTN A;  2C7H A;  4N9F 4;  4J3O D;  2G1E A;  4K1R B;  2W54 A;  3TEY A;  2IGD A;  2JVC A;  5L95 C;  1ZXH A;  2INP E;  2J42 A;  3LYY A;  4MSQ B;  5DPW A;  4MSM B;  2KLC A;  1DYQ A;  2BS4 B;  4BKS D;  2FCN A;  4BOZ B;  5IA7 A;  3IHP C;  1FXA A;  3Q3O C;  3RT3 B;  2IO2 B;  3PVL A;  4W9I A;  4FN2 A;  1KFY B;  1N61 A;  3DBL B;  1CK1 A;  1MFW A;  1N60 A;  2IGH A;  4O1N A;  3E56 A;  3GS2 A;  4XC2 A;  2NCN A;  4IM3 A;  3Q69 A;  2K22 A;  1FRR A;  3MC9 A;  3Q2A C;  2FID A;  4HJK A;  3TEX A;  4YSZ B;  2KNB A;  3QWZ B;  3M95 A;  1Q10 A;  4RM9 A;  4P16 A;  1WMH A;  4OHJ A;  3APF A;  3RD2 A;  2KN5 A;  2WXK A;  3VHT C;  2R61 A;  1ZP0 B;  3AI5 A;  3IVF A;  1M94 A;  4CO7 A;  2KTR B;  3Q8A A;  1SIJ A;  1T5X D;  3U7Z A;  3DOW A;  3H1U A;  2I1J A;  2KKC A;  1F77 A;  1XD3 B;  1P7E A;  2WNM A;  3BVG A;  2N9X A;  1ET9 A;  2LGY A;  2Y5B B;  2PIA A;  4G50 A;  5D94 A;  5BYR A;  1RAX A;  1OGW A;  2RGF A;  3ZNG C;  3QAR A;  1JML A;  4GXB A;  2MHJ A;  3RZW C;  1JRU A;  2QC8 A;  4FLH A;  5JHA A;  1NI2 A;  2QDF A;  3H8H A;  3OJ3 A;  1C3T A;  4ANX A;  2KJ6 A;  1EU3 A;  4NJ7 A;  3CF6 E;  3AE9 B;  3RNA C;  1T6B X;  3PTF C;  4J6I A;  2QMT A;  1GPX A;  3ZDM C;  4A20 A;  2RDB C;  2WXM A;  1T0S C;  2CHX A;  3APC A;  1R4M B;  1C4C A;  3PO0 A;  4B0M A;  4W9L A;  1UUP A;  3Q3N C;  3BZD B;  4RGO S;  3VUY A;  3NY5 A;  1IYF A;  1WE6 A;  4M8N A;  1T0Q C;  2KFJ A;  3NVY A;  2FUH B;  2QHO A;  2FAZ A;  1QOB A;  4M0W A;  2WQY B;  1GUA B;  3I9V 1;  3KYD D;  1JRO A;  2LVQ A;  3VH3 B;  4DQO C;  2K39 A;  2I38 A;  4ANW A;  1D3Z A;  2WGS A;  2JZP A;  4NJC A;  2KDB A;  5AUK A;  3L08 A;  2JY6 A;  3PSE B;  1GC6 A;  4KGS A;  2JF5 A;  4K81 A;  3IG3 A;  1YD8 U;  3QC8 B;  4DXG A;  1KTK A;  3DHI C;  2W9N A;  3RMK C;  1MJD A;  4MGZ E;  2KDF B;  4ZRQ A;  5FR6 A;  3JSV B;  1VZ8 A;  1RYJ A;  4WJQ A;  1I42 A;  2O6V D;  2KTR A;  3QHT A;  3VUW A;  2BF8 B;  3Q3F A;  2AWT A;  5G5H A;  1KLG D;  1Q1O A;  2ZNV B;  4WWN A;  2LZ6 A;  2N7J A;  3NG0 A;  4AJW A;  4PS8 A;  3DBL I;  3H6N A;  2M0X A;  4M01 A;  4ZRK A;  4HPL B;  1LXD A;  5IP4 D;  3FIL A;  3PV1 A;  2PTL A;  1C78 A;  3Q3J A;  1I4H A;  1JW9 D;  1ZOY B;  3APD A;  5LXH A;  2D11 A;  2L00 B;  3W5U B;  3A1Q B;  3WAM A;  3JVZ X;  1JCK B;  4KDL B;  2ZVO A;  4CQN A;  4EEW A;  4CYE A;  2L32 A;  1Z2M A;  3VR8 B;  1U4A A;  1YIW A;  1DGJ A;  2C9W B;  3V62 A;  1MG4 A;  2DBY A;  1WR1 A;  2R2Q A;  2MBO A;  2NR2 A;  4W9E A;  3HM3 A;  4YTN B;  2EEL A;  5BO4 B;  5IO9 A;  1UGM A;  1TS2 A;  2ZJD A;  3EEC A;  1QF6 A;  3KQ4 A;  2TSS A;  4BBN C;  4W9D A;  2ZNV C;  2V3P A;  1BML C;  3U2S C;  4DWF A;  4L2Y A;  4S0R A;  3UI3 A;  2V4L A;  3IT4 B;  2W55 A;  5HKH A;  3FKY A;  4IKG A;  5IOI A;  3VQI A;  5JXV A;  3LDZ E;  3B08 A;  1P0R A;  1FCC C;  2DYB A;  2IGG A;  4C00 A;  1ROE A;  2WP9 B;  1WZ3 A;  2LVO A;  4LLG M;  1WXQ A;  1D4B A;  1PQS A;  4RF1 A;  4TUU A;  2WDQ B;  2JRI B;  5LXI B;  2MJ3 A;  1EUV B;  3H9D A;  4A3O A;  3KWL A;  2K6Q A;  3TCA A;  3KLS X;  3GZN B;  1NYR A;  1KF6 B;  1HZ5 A;  5JHB A;  2MA9 B;  2WXH A;  4NNJ B;  4RM8 A;  4ASW C;  3VXW A;  2ZZP B;  1CZP A;  2OJW A;  3DWM A;  1TKE A;  3BK1 A;  3I63 C;  1KM7 A;  2RMM A;  3IT6 B;  1PYW D;  5E6O A;  1FFV A;  3SU8 X;  4WQO B;  2KQ4 X;  3ZRC A;  2A4Z A;  2M56 B;  4AS1 A;  4IWP A;  1LO5 D;  2DEN B;  1VZ7 A;  2BT6 A;  2BVC A;  1N63 A;  1XQQ A;  1IBX A;  2KTF A;  4FBJ B;  4DDG D;  3B9J A;  3ML9 A;  2L83 A;  5FKA C;  4BVU C;  3JW0 X;  1IGD A;  2ZEQ A;  1EWY C;  1WX9 A;  1RWS A;  5AZF A;  1STE A;  2KVR A;  1YQB A;  3UQA A;  1EU4 A;  1WE7 A;  2ON8 A;  1DOY A;  1E8W A;  2QEJ C;  3NVV A;  3OG5 A;  1MHX A;  4ARI A;  3CIR B;  1L5P A;  4XX5 A;  3P63 A;  1WGD A;  2DAJ A;  1FO4 A;  1WXV A;  1RFA A;  1ISN A;  2DZK A;  2NVU I;  2GB1 A;  3I57 A;  3J9C A;  3QK0 A;  2DLB A;  1TY2 A;  3VFK A;  3PS6 A;  3AEG B;  1NVI D;  4A3P A;  2W3R A;  4FAD A;  4KV2 A;  4BKT A;  2MSE D;  4FHJ A;  3NVW A;  3BYT B;  2AL6 A;  5G2N A;  2PJH A;  2RDG A;  3BII D;  4MJS A;  2ZPY A;  5J2R A;  3CWI A;  3ZTC A;  1FCL A;  2ZPN A;  2W82 A;  2H89 B;  1QZE A;  3Q8B A;  4KVG B;  2KC1 A;  3BY4 B;  1E7P B;  2SAK A;  1WR6 E;  4NY0 A;  1NEN B;  2MWS B;  1WX8 A;  5D2M B;  1VD2 A;  3AE2 B;  2KAC A;  4MGY E;  4HPM B;  1WJN A;  2N0S B;  4RGM A;  1SEB D;  2V4I B;  1H4R A;  3R8B A;  3DBR I;  1YQ3 B;  2FBW B;  2D10 A;  2KT7 A;  5HI1 A;  3BK2 A;  4K7U A;  4HLE A;  1XF5 L;  4OZA A;  3Q8E A;  4EFO A;  4WH4 A;  5BMI A;  1TT5 B;  2K5P A;  3TUO A;  3NZ3 A;  4ZRP A;  1I35 A;  1VLB A;  2KK8 A;  3WCQ A;  2GBJ A;  1S1Q B;  4N58 A;  4LJO B;  5E6J A;  4A9A A;  1J7C A;  2FE8 A;  1K52 A;  2BYT A;  2PVG C;  2GI9 A;  3U7D A;  2LHD A;  2XN9 C;  3AEF B;  2JRH A;  3ZUN A;  4RF0 A;  1E0Z A;  1NI3 A;  2JPH A;  4OZB A;  4OW0 A;  1F9J A;  3W9C B;  3DPD A;  5CHV C;  1WWT A;  3DBR B;  2BKR B;  2IY0 B;  2N9P C;  2ACZ B;  4ITK A;  3AE1 B;  4DK5 A;  4W9J A;  4XGA B;  4RCO A; 
#chains in the Genus database with same CATH homology
 2Z59 B;  3ZNG C;  5IAA C;  3QAR A;  4W9K A;  1WX7 A;  3PT2 B;  4EOY A;  3R3M A;  4YL8 A;  1WGY A;  4GXB A;  2KWC A;  2KC2 A;  3RZW C;  1JRU A;  3WAO A;  4FLH A;  4MGI E;  5JHA A;  3ZIM A;  1NI2 A;  2K6D B;  3TIX A;  2KHW B;  3DVG X;  1RRB A;  1C3T A;  3OJ3 A;  4ANX A;  2KJ6 A;  4EZL A;  4ZYN A;  3VVW B;  4NJ7 A;  3CF6 E;  3L0W B;  4J6I A;  3PTF C;  3ZDM C;  1T0Y A;  3UIP B;  2KLG A;  1Z5S B;  2MBH A;  4A20 A;  2JWZ A;  3VUX A;  2J0K A;  3PRZ A;  3DVN V;  2CHX A;  3APC A;  4GSW A;  4M0W B;  1J19 A;  2IZV B;  4WWP A;  5LLI A;  1Q5W B;  1LM8 B;  2KWU B;  1WXA A;  3MTN B;  4W9L A;  4GDK A;  4CHK A;  1E5W A;  4IWO A;  2J0M A;  3VUY A;  4AOF A;  2ZCC A;  4II2 B;  3TJP A;  1WJ4 A;  3HHM A;  3NY5 A;  1IYF A;  1WE6 A;  3PZD A;  3UIO B;  4E71 A;  4M8N A;  2MRP A;  2KFJ A;  2KFK B;  2FUH B;  2N7E A;  2YVC A;  2QHO A;  3UGB B;  2XK5 B;  4AP4 C;  3V6C B;  2FAZ A;  1ZW7 A;  2BWF A;  4AUQ C;  1GUA B;  3A1Q A;  3KYD D;  2VRR B;  3C0R B;  5E6P A;  2WDT B;  1CMX B;  2L7R A;  2C60 A;  2N9E B;  1WRD B;  4WWO A;  3NZU A;  4MDK E;  2LVQ A;  3VH3 B;  4DHZ E;  2DZJ A;  2KAN A;  2K39 A;  4BFR A;  1WFY A;  3ZNI D;  4ANW A;  2WWZ A;  1D3Z A;  1V86 A;  4ZDV A;  2DYO A;  2KX0 A;  2WX1 A;  3VH4 B;  2KDB A;  2N1W A;  3L08 A;  4GOC A;  4KIK A;  3BIN A;  2JY6 A;  3PSE B;  1GC6 A;  2K1F A;  3PHW B;  1V49 A;  4NPN A;  2KQS A;  3RZF A;  2AYO B;  2JF5 A;  4K81 A;  1EF5 A;  3IG3 A;  4DBG A;  4ZRJ A;  1YD8 U;  3QC8 B;  1WZ0 A;  3EFU A;  2W9N A;  3R7R A;  2MCN B;  2RPQ A;  2V3S A;  3NOB A;  1E8Z A;  2KWV B;  2N1V A;  4MH0 E;  4PYU A;  4NJ6 A;  1IP9 A;  4OVU A;  1WIA A;  4ICU A;  3A9K B;  3PRP B;  4MGZ E;  4NQL B;  3DDC B;  2KDF B;  4HCN B;  5FR6 A;  3JSV B;  1UD7 A;  4WJQ A;  3ZVV A;  4I6P A;  2K8B A;  4FJZ A;  4GGQ A;  3ENE A;  3T9L A;  4AWJ A;  4IUM B;  4BBN F;  1I42 A;  2RR9 A;  1E7U A;  3KUC B;  3QJZ A;  3DQV A;  4W9F A;  3QCA A;  4MEL A;  1R4N I;  3AUL A;  2K8C A;  2KTR A;  2O6V D;  3ZDT A;  5JH5 C;  4FHK A;  2D3G A;  1KOT A;  3HM6 X;  2O2V A;  3QHT A;  1AAR A;  1ZKH A;  2BF8 B;  3VUW A;  3Q3F A;  2AWT A;  5DPR A;  1Q1O A;  1WMH B;  3CST A;  3H7P B;  3L10 B;  4HDO A;  1OEY A;  3PGE A;  2ZNV B;  3OJ4 B;  4WWN A;  2REX A;  2M8S A;  2LZ6 A;  1WGH A;  1SIF A;  2EMS A;  5E6N A;  4AJW A;  2NS5 A;  4PS8 A;  3DBL I;  3H6N A;  2M0X A;  2IY1 B;  4JL9 A;  4HCP B;  4W9H A;  4ZRK A;  4HPL B;  1YJ1 A;  1WYW B;  1G6J A;  1LXD A;  2CKH B;  3PV1 A;  3QIJ A;  2WX0 A;  3KH0 A;  4X57 B;  3JSV A;  1P3Q U;  3UF8 A;  3DCG A;  3SHQ A;  3ZO5 B;  3DBH I;  3L54 A;  2LXC A;  1V5O A;  2AEH A;  3Q3J A;  4IW0 A;  4W9G A;  2JXX A;  2CU1 A;  2A5U A;  3ZLZ A;  1TBE A;  3APD A;  5LXH A;  2D11 A;  2L00 B;  3AU4 A;  3A1Q B;  2ZCB A;  1WM2 A;  1E90 A;  4FJY A;  3UIN B;  3WAM A;  3U8Z A;  2L0T A;  3JVZ X;  2YLM A;  2K8H A;  3A4S C;  2DX5 B;  3R66 C;  1OEY J;  4GU2 A;  2PPH A;  4KDL B;  2ZVN A;  2BPS A;  1P1A A;  1V5T A;  2ZVO A;  3W1S C;  4EEW A;  1NBF C;  4CYE A;  3VTW A;  2MP2 B;  5AZH A;  2I1K A;  5J17 A;  4IG7 B;  1Z2M A;  1X1M A;  1U4A A;  2BWE S;  3IFW B;  4IM0 A;  2DAF A;  2L3Z A;  4XZ4 A;  3HK0 A;  4ANV A;  1YIW A;  1UBQ A;  3K9O B;  2C9W B;  2LXA A;  3SD5 A;  1V81 A;  4GIV A;  3V62 A;  1S3S G;  2KD0 A;  1WR1 A;  2R2Q A;  3EC8 A;  4F1S A;  1Y8R C;  2MBO A;  2NR2 A;  4W9E A;  3HM3 A;  4M8M A;  5TR5 A;  4EZK A;  5BO4 B;  1UGM A;  2BYE A;  2D07 B;  2ZJD A;  3EEC A;  4WJO A;  3U30 A;  4BBN C;  2V1Y A;  4W9D A;  2ZNV C;  1KJT A;  4GB9 A;  1E8X A;  4DWF A;  1E8Y A;  4MJS B;  3V6E B;  2V4L A;  2KJR A;  5GMV A;  3A9J B;  3OLM D;  3ZW3 A;  2CR5 A;  1C1Y B;  2N4F A;  4BKG A;  3GOE A;  4KSL C;  3AU5 A;  5HKH A;  4BOS C;  2LGX A;  3VQI A;  3W1S A;  2G45 B;  2L0F A;  3LDZ E;  2BKF A;  3B08 A;  4NAW A;  1P0R A;  2DYB A;  4IM2 A;  5AZG A;  4NAW B;  4JQW C;  3L16 A;  3L13 A;  4EKU A;  2BYF A;  2MW5 A;  1WZ3 A;  4PS3 A;  2LJ5 A;  2LVO A;  2K25 A;  4G11 A;  4I6L B;  3N30 A;  1PQS A;  2IO3 B;  4FUL A;  2KXJ A;  1V9J A;  4MEM A;  2DYM A;  4KZ0 A;  4TUU A;  4LCD E;  4LDT D;  2JRI B;  2L76 A;  2UYZ B;  5LXI B;  1EUV B;  3CMM B;  2O2V B;  1GG3 A;  3H9D A;  3VDZ A;  1V2Y A;  1A5R A;  4A3O A;  2K6Q A;  2C7M B;  3TCA A;  3K9P B;  3WIM A;  2HTH A;  4DHJ D;  4HDQ A;  1RLF A;  2B3A A;  2MQJ A;  4I6N B;  3NZS A;  4ZRI A;  2XK5 A;  1P98 A;  3KUD B;  1WY8 A;  4MGK E;  2HE7 A;  2EMT A;  4RMA A;  3WAL A;  5JHB A;  2MA9 B;  3VTV A;  3EHV A;  4NNJ B;  4PYZ A;  4WJN A;  4E3C A;  2C7N B;  5J18 A;  2GOW A;  4E74 A;  4RM8 A;  2IBI B;  5DCN A;  1TGZ B;  2DZI A;  4FJV B;  3KW5 B;  4P7I A;  5L83 A;  1WJ6 A;  4ASW C;  3VXW A;  3ONS A;  2C5L C;  2CHZ A;  2WYQ A;  2ZZP B;  2L8J A;  3NS8 A;  4GDK B;  4TKN A;  1E7V A;  3M63 B;  2LVP A;  1WXM A;  1KM7 A;  1UZX B;  2MLB A;  1V6E A;  4EUT A;  4GDL A;  3A33 B;  4URK A;  2MBE A;  1WF9 A;  5E6O A;  1J0G A;  2PE6 B;  3SU8 X;  2AL3 A;  1KLV A;  2KZR A;  4GMV A;  3P2B A;  3QA8 A;  2BGF A;  4II3 B;  3PHX B;  4WQO B;  3ZRC A;  2A4Z A;  2LUE A;  3B0A A;  2KO3 A;  5EDS A;  4IC7 B;  1GC7 A;  2CHW A;  4IWP A;  2UWQ A;  2DEN B;  4K7S A;  1IPG A;  5DPT A;  2JZZ A;  3X0W A;  2M17 A;  3CSF A;  3N3K B;  1WH3 A;  4PS7 A;  1XQQ A;  4AJY B;  1ZGU B;  2FCQ A;  3O65 B;  3RUI B;  2KTF A;  1SGH A;  2FCS A;  2MBB B;  4FBJ B;  4DDG D;  2M1M A;  1TZ1 A;  1BT0 A;  3ML9 A;  2PEA A;  4B6W A;  4BVU C;  4NQK E;  3JW0 X;  3ZNH B;  1OQY A;  2EKE C;  2ZEQ A;  2G4S A;  3ZRF A;  1WX9 A;  2DHZ A;  5AZF A;  2G4D B;  4HK2 A;  1GJZ A;  2RSU A;  3PRM B;  5C23 A;  2GBK A;  2Z0E B;  1GNU A;  4JIO U;  1WXS A;  1V80 A;  2KVR A;  2GBN A;  3KYC D;  1YQB A;  3T8M A;  3X23 A;  4HXD A;  3UQA A;  3SDL C;  3LJ3 A;  2ASQ A;  2Z0D B;  2CS4 A;  1WE7 A;  4LJP B;  5CTR C;  4W9C A;  3A9K A;  2FCM A;  4JLC A;  1E8W A;  2LRW A;  1WGR A;  1YX5 B;  3WAN A;  3QAQ A;  3PRE A;  3GZN I;  2NPT A;  2RD0 A;  2JT4 B;  2LWP A;  4FA6 A;  4XX5 A;  2D2Q A;  3MHS D;  4F7Z A;  4ANU A;  3ML8 A;  2MBQ A;  4DXA B;  1WGD A;  2DAJ A;  3ECI A;  1Q0W B;  1WXV A;  1RFA A;  3M62 B;  2OOB B;  1ISN A;  4TQ1 A;  2DZK A;  2KOX A;  2NPT B;  2NVU I;  1K8R B;  2G3Q B;  3TL5 A;  3QK0 A;  3OAW A;  3TBL D;  3UQB A;  1OTR B;  3VFK A;  5JZE B;  3PS6 A;  5C1Z A;  4MM3 A;  4JGH B;  3RCZ A;  2HD5 B;  1FXT B;  2IO0 B;  5G55 A;  3PPA A;  4A3P A;  1VCB A;  4FAD A;  3ALB A;  1R4M I;  4KV2 A;  2NBV B;  2MSE D;  3M3J A;  3V60 A;  2FIF A;  4BKT A;  4DHJ B;  4FHJ A;  2HJ8 A;  4G0N B;  2GBM A;  4BKS A;  2BYV E;  2MX2 A;  3A9J A;  4WJP A;  2AL6 A;  5G2N A;  3RUL A;  2PJH A;  2PE9 A;  1P9D U;  2JUO A;  3DVG Y;  3H7S A;  2ZPY A;  4MJS A;  5J2R A;  4LDT B;  2IO1 B;  2KMC A;  3DVN U;  4KZC A;  2KMA A;  4KIK B;  2FNJ B;  3ZTC A;  1WGG A;  2ZPN A;  4OVV A;  4B9K A;  4B95 A;  2IYD B;  1SE9 A;  1TTN A;  1UBI A;  1QZE A;  2C7H A;  4N9F 4;  2KC1 A;  3BY4 B;  4K1R B;  4KVG B;  1J8C A;  2O6V A;  1WR6 E;  3DBS A;  4NY0 A;  1EO6 A;  3S2A A;  2LAS A;  3KUZ A;  2MWS B;  2JVC A;  5L95 C;  1WX8 A;  5D2M B;  4EZJ A;  1VD2 A;  2O6V B;  4MGY E;  4HPM B;  1WJN A;  4MSQ B;  5D7G A;  2MP2 A;  1WI0 A;  2KFK A;  3IBE A;  5KHO A;  5DPW A;  1WM3 A;  4MSM B;  2KLC A;  5CHW A;  3WA0 A;  5AEK B;  1H4R A;  4BKS D;  2LRU A;  2FCN A;  3PLV A;  4BOZ B;  3QX1 A;  5IA7 A;  3DBR I;  3IHP C;  2XBB C;  4GDL B;  4KSK C;  2NBW B;  1EF1 A;  2D10 A;  4HVB A;  2J7Q B;  3RT3 B;  1NDD A;  3L17 A;  2IO2 B;  3PLU A;  3TMP B;  1L2N A;  2KQ7 A;  3V61 A;  4K7U A;  4DHZ B;  3PVL A;  4HLE A;  1MG8 A;  4W9I A;  3HIZ A;  4FN2 A;  2KJH B;  3W1Y A;  4EFO A;  3ZTD A;  1LFD A;  4WAA A;  2LD9 A;  4KDI C;  1UH6 A;  1UEL A;  5KHQ A;  5CX3 A;  4XC2 A;  2KDE B;  2NCN A;  1WJU A;  1I35 A;  5CHF A;  2KK8 A;  4IM3 A;  2GBJ A;  1L7Y A;  3NHE B;  4GN1 A;  1S1Q B;  3RYT A;  2FID A;  3AXC A;  4LJO B;  4HJK A;  2GMI C;  3D32 A;  2KNB A;  3QWZ B;  2XEW A;  1HE8 A;  2JZ3 B;  2GBR A;  3H7P A;  3B1L X;  3M95 A;  4IWQ A;  4RM9 A;  3U7D A;  3N32 A;  4TV3 A;  1LQB A;  2R2O A;  5DPS A;  2OJR A;  1WMH A;  5D6J B;  3A4R A;  3VAW A;  3APF A;  2JRH A;  3RD2 A;  2KN5 A;  3VHT C;  1XT9 B;  3ZUN A;  3AI5 A;  2L05 A;  3IVF A;  4G3X B;  3ZKJ C;  1M94 A;  4CO7 A;  2KTR B;  3MJW A;  2JPH A;  3ZNZ B;  4HWI B;  1F9J A;  4TQ0 A;  3I3T B;  3DOW A;  3DPD A;  3VTU A;  2I1J A;  1YX6 B;  2LI5 A;  2KKC A;  2M4N A;  3H1U A;  1XD3 B;  5CHV C;  4DDI D;  2NBU A;  2KDI A;  3WAP A;  2LGD A;  2KX3 A;  2BKR B;  2DZM A;  2N7D A;  2N9X A;  2IY0 B;  3R7Q A;  3JYU A;  2LGY A;  2Y5B B;  4ICV A;  1H8C A;  4G50 A;  5D94 A;  2N9P C;  4F8C B;  4K7W A;  2J0J A;  1RAX A;  1OGW A;  3KVF B;  3QQ8 B;  4DK5 A;  2RGF A;  4W9J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...