1WIAA

Solution structure of mouse hypothetical ubiquitin-like protein bab25500
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
95
structure length
95
Chain Sequence
GSSGSSGINVRLKFLNDTEELAVARPEDTVGTLKSKYFPGQESQMKLIYQGRLLQDPARTLSSLNITNNCVIHCHRSPPGAAVSGPSASSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords hypothetical ubiquitin-like protein (RIKEN cDNA 2010008E23)
publication title Solution structure of mouse hypothetical ubiquitin-like protein BAB25500
rcsb
source organism Mus musculus
molecule tags Structural genomics, unknown function
total genus 12
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2004-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1wiaA01
2KDFB 4BBNC 5J2RA 1YD8U 1EUVB 1K8RB 2L00B 2ZEQA 4K81A 3X23A 1P98A 1UBIA 2KJRA 2DZMA 4MGIE 1E5WA 2L8JA 2NBWB 4IWQA 3ZO5B 3JW0X 1NBFC 2LZ6A 2M0XA 4DBGA 2KMAA 4HPLB 2MA9B 4WWOA 3JSVA 4HWIB 2V1YA 1P3QU 1SIFA 1F9JA 1V2YA 3IBEA 3L13A 4GDLB 3OAWA 1RAXA 4NQLB 2KOXA 2DX5B 2ZVNA 3PSEB 2KLGA 2NBVB 1LXDA 2J0MA 2GBRA 2XK5A 2LRUA 4HDOA 5L83A 4NJ6A 2HD5B 4IG7B 2LGXA 3P2BA 1J19A 1TBEA 4B95A 2FIDA 1GJZA 3NY5A 3RYTA 2D10A 3V6EB 3AULA 3VXWA 1ISNA 4M8MA 4AJYB 3VTWA 1Q0WB 3PGEA 2C9WB 2IO1B 3APDA 5D7GA 1WZ0A 2KK8A 2C7HA 1I42A 3RD2A 3VH3B 3A1QB 2DYMA 4GDKB 3B1LX 2R2QA 1XQQA 1UD7A 2UYZB 3M63B 5DPSA 3WA0A 2OJRA 2L7RA 3ZTCA 1Q1OA 3JVZX 3DPDA 4MSQB 5DPTA 3TJPA 3TCAA 2NVUI 3RZWC 5IA7A 2C60A 2KMCA 3Q3FA 3QHTA 5HKHA 5JHAA 2DZIA 4ANVA 5L95C 2Z59B 3B08A 4MEMA 4DHJB 2BYVE 2FCNA 1WX9A 1RFAA 5D2MB 3QA8A 2J0KA 2J7QB 2C7NB 4W9FA 2MQJA 2N9PC 4DWFA 5J17A 3NOBA 2BGFA 2DZKA 1WM2A 1EO6A 1Q5WB 3JSVB 3BINA 3HIZA 1WJUA 2MX2A 4TQ0A 1UELA 3MTNB 4TQ1A 3W1SA 3APCA 3VUYA 1KLVA 1M94A 4G50A 1OEYA 2ASQA 2LJ5A 2AWTA 2L3ZA 4MSMB 4TUUA 2KC1A 2L0FA 2N7EA 3GOEA 3KUZA 2RGFA 2CS4A 3H6NA 3W1SC 4FN2A 3VTVA 1C1YB 4HK2A 4PYZA 2EMTA 4XC2A 4PS3A 5D94A 2JZ3B 4DHZB 2XK5B 4J6IA 3Q3JA 3MJWA 1PQSA 1V5TA 1RLFA 3VHTC 4HLEA 1D3ZA 5EDSA 3DBLI 3ZTDA 3UQAA 4EUTA 3W1YA 1P9DU 3APFA 3WAPA 2D11A 3KUCB 4RM9A 2JRIB 2IBIB 3H7PB 4CHKA 3EHVA 4WJPA 1TZ1A 4N9F4 3GZNI 4II3B 2LXCA 1IP9A 1UGMA 2KWCA 3VUWA 3ZIMA 5CHWA 4F1SA 2A4ZA 1YJ1A 4IWOA 4HXDA 2GMIC 3N30A 2KLCA 4B9KA 3U8ZA 2NPTA 3A9KA 4FHKA 3AXCA 4MGYE 2MBOA 2PEAA 3I3TB 1WIAA 1WE7A 2MBEA 5KHQA 1KJTA 1WXSA 2PE9A 4A20A 4NNJB 1WRDB 3TBLD 5E6NA 1WMHB 2WX1A 2BYEA 4GMVA 5G2NA 4FLHA 5LLIA 4HJKA 1E8YA 2M17A 2J0JA 2LVOA 4EKUA 4URKA 1R4MI 1TTNA 1GG3A 1V80A 4DHZE 4KVGB 4MH0E 4K7SA 3R3MA 4MJSA 3ZDTA 2I1JA 5GMVA 1V81A 2MBHA 3ZKJC 2LGYA 5AZGA 5CHVC 4A3OA 1MG8A 4W9EA 1UZXB 2XBBC 2G4DB 3PV1A 4KIKA 2WX0A 3PREA 3ZNID 4X57B 3M95A 4NPNA 2M1MA 1H4RA 4RMAA 3SD5A 2LD9A 2LXAA 2JVCA 1V49A 1E8ZA 2LVQA 4ZYNA 1QZEA 2IO0B 1VCBA 3UIPB 2ZCBA 2N7DA 2MBQA 3SU8X 4HPMB 2IYDB 4G3XB 3V61A 2GBNA 4BVUC 3EFUA 2ZPYA 1ZW7A 3WALA 3KH0A 3KYDD 4FJZA 1WXVA 4GN1A 2KTFA 4EFOA 3LJ3A 4FULA 4ANUA 4ANWA 2OOBB 2R2OA 2FUHB 3PZDA 3UQBA 4F8CB 3TMPB 2DHZA 4K7WA 3CSTA 5LXHA 2O6VA 2ZJDA 4HCNB 2CHXA 2WYQA 2ZVOA 3A9JB 3NS8A 3UIOB 2GBJA 4HDQA 3AU5A 4GGQA 4M0WB 3KUDB 5IAAC 2NPTB 3A9KB 2KTRB 3S2AA 3ZVVA 2FIFA 4DK5A 3ZDMC 2GOWA 3O65B 2BKRB 4OVUA 3WAOA 3H1UA 1SGHA 4II2B 3VH4B 3PRZA 3AU4A 4NAWA 4NJ7A 4DXAB 4IUMB 4GB9A 3HM3A 2Z0EB 2M4NA 3M62B 4HVBA 3QJZA 5FR6A 2A5UA 2MP2A 1WYWB 1WJNA 2RD0A 1AARA 2KANA 4W9CA 3K9PB 2QHOA 1KOTA 4GIVA 3CSFA 2DAJA 2KX3A 4MJSB 3X0WA 2JF5A 2C5LC 5AEKB 3TL5A 3H7SA 5CHFA 3UINB 3N3KB 2IY0B 3SHQA 3ZUNA 3L08A 1WJ6A 3H9DA 5J18A 2REXA 1GNUA 1H8CA 3RUIB 2JY6A 2FCMA 4BKSA 3HK0A 2IZVB 4KIKB 3L0WB 4W9IA 2JXXA 4AJWA 5TR5A 1WI0A 2DENB 2DYOA 3K9OB 4FBJB 5E6PA 2KFJA 3LDZE 3UF8A 2CR5A 2RPQA 2N9EB 1JRUA 4G11A 4W9HA 2PPHA 1J0GA 2RR9A 3KYCD 3DBHI 3JYUA 2HJ8A 1UBQA 3BY4B 1P1AA 3PRMB 2L0TA 5D6JB 4XZ4A 4BOSC 3CF6E 1A5RA 2D07B 4LDTD 4EZKA 1GC6A 4I6LB 2CKHB 1LQBA 2DAFA 4KDIC 3NZSA 3ALBA 1I35A 1XD3B 4KSLC 2KFKA 4LJPB 1E7VA 2O6VB 4A3PA 4PYUA 2N1WA 2GBKA 3U7DA 4EZJA 2M8SA 2KQ7A 2KNBA 1WF9A 2MWSB 4ZRJA 2KN5A 4MELA 1OGWA 4W9GA 1WY8A 3ECIA 4ASWC 3RZFA 4I6PA 3L17A 5LXIB 2LVPA 5KHOA 3ENEA 3U30A 3IG3A 1VD2A 1WJ4A 3EC8A 3QARA 3RT3B 4E3CA 2LASA 2CHWA 2MP2B 4I6NB 2MBBB 1E7UA 3VVWB 4BOZB 2NBUA 2WWZA 1YX5B 3NHEB 3EECA 4P7IA 4W9LA 2KZRA 4IC7B 5AZFA 2CHZA 1E8WA 2JPHA 4AP4C 3L10B 4MGKE 1RRBA 3ZRCA 2JWZA 4OVVA 2KX0A 4F7ZA 1XT9B 3PS6A 2KVRA 2O6VD 4IW0A 1EF1A 2KDBA 4KZCA 2JZZA 2MCNB 3PHWB 1R4NI 1WE6A 2BF8B 4WWPA 3KW5B 2VRRB 3HHMA 3UGBB 3QCAA 3M3JA 4JL9A 2AL6A 1KM7A 3RULA 3VUXA 3VQIA 3QWZB 4KDLB 3OLMD 2JT4B 1GC7A 1U4AA 2HTHA 3V62A 3A1QA 3ML8A 3WANA 1WH3A 1YX6B 5DPWA 4GDKA 3QAQA 3ZRFA 4FJVB 3HM6X 3N32A 1L2NA 1WX8A 4IM2A 4JIOU 3T9LA 2MRPA 2NS5A 2KFKB 2LRWA 4LCDE 1Y8RC 2LI5A 2ZZPB 2KC2A 4WJQA 4KZ0A 4BKSD 1C3TA 2MW5A 4JLCA 2KKCA 1OEYJ 4ICVA 3WAMA 3DVNU 4W9DA 2ZCCA 4K7UA 2N9XA 3R66C 4GU2A 1IYFA 3AI5A 4FJYA 5JZEB 3ONSA 5C1ZA 4E74A 4GOCA 2W9NA 4NY0A 2D3GA 2KD0A 4JQWC 3A33B 3DVGY 4PS7A 1WXAA 2D2QA 1WXMA 2G4SA 1V9JA 5CTRC 4B6WA 2FAZA 2O2VA 2FCQA 2IO2B 4AUQC 4EOYA 4WQOB 2I1KA 3VAWA 3DQVA 4W9JA 3D32A 3NZUA 4EEWA 1E90A 2AYOB 5AZHA 2KJ6A 1J8CA 2FNJB 2KDEB 2L76A 3L16A 3PVLA 2N1VA 2K6DB 4LDTB 3R7QA 2ZNVC 3DCGA 4IM3A 2IY1B 2MSED 2LGDA 1ZKHA 1WGDA 1V6EA 1BT0A 5E6OA 2BWFA 3PT2B 3QQ8B 2L05A 3ZNZB 2IO3B 3H7PA 3PPAA 4JGHB 4WJNA 2Z0DB 1NDDA 3RCZA 2K6QA 3PLVA 4W9KA 1EF5A 2KHWB 5DPRA 2KWVB 4RM8A 1WGGA 1OQYA 4EZLA 1Z2MA 4BKGA 4ICUA 2JRHA 2KDIA 4G0NB 2AEHA 2KQSA 4HCPB 4MGZE 3DDCB 1NI2A 2FCSA 2N4FA 2DZJA 1YQBA 2WDTB 1FXTB 2C7MB 4GSWA 1HE8A 3MHSD 1WZ3A 1P0RA 3V60A 2JUOA 4M8NA 2K8CA 2K1FA 3PRPB 1WMHA 3VDZA 1WM3A 1LFDA 1WX7A 2BWES 3CMMB 3PLUA 2KXJA 1E8XA 1WGRA 1WGHA 4DDID 4AWJA 3DVNV 1IPGA 1SE9A 2UWQA 2K39A 3V6CB 1T0YA 4KV2A 4KSKC 4NQKE 2V4LA 2MLBA 2KJHB 2YLMA 3IHPC 2G45B 4WJOA 3SDLC 4ZDVA 2LUEA 4IWPA 3ZLZA 4BBNF 1UH6A 2BPSA 2BYFA 2NR2A 1LM8B 3IFWB 2O2VB 3B0AA 4MM3A 1ZGUB 2K8HA 4NAWB 1CMXB 1TGZB 2HE7A 2DYBA 2G3QB 2CU1A 2K8BA 2LWPA 2AL3A 2Y5BB 2ZNVB 4WAAA 4WWNA 2PE6B 4CO7A 4K1RB 4MDKE 3DOWA 5CX3A 1OTRB 4GDLA 3DVGX 4ZRIA 2B3AA 1GUAB 4DHJD 4FA6A 1G6JA 4BFRA 2GBMA 4PS8A 4FHJA 2V3SA 3ZW3A 3ZNHB 3R7RA 3DBSA 2YVCA 1WR6E 3OJ3A 5C23A 3WIMA 2PJHA 1L7YA 4XX5A 2XEWA 1WR1A 4ZRKA 4FADA 2RSUA 4BKTA 5DCNA 5JHBA 4LJOB 3ZNGC 3ML9A 4DDGD 3C0RB 3DBRI 4TV3A 4ANXA 5BO4B 1YIWA 4AOFA 3A9JA 3OJ4B 1S1QB 2NCNA 3A4RA 3IVFA 3QK0A 2EKEC 4IM0A 2KTRA 3T8MA 4TKNA 4CYEA 4E71A 2K25A 3VTUA 1V86A 3TIXA 1S3SG 2KWUB 3L54A 5JH5C 4GXBA 5G55A 2KO3A 4YL8A 1Z5SB 1WGYA 3QIJA 3VFKA 1V5OA 1WFYA 2EMSA 2BKFA 2ZPNA 3PHXB 3A4SC 1X1MA 3QX1A 3PTFC 3KVFB 3QC8B
chains in the Genus database with same CATH superfamily
1QKZA 2KDFB 2V9HA 2X38A 1FFUA 1FRDA 1P98A 3AE3B 1E0ZA 2EKIA 1TKEA 3AB5A 2L8JA 4IWQA 1ZXIA 2LZ6A 2M0XA 4DBGA 4XE0A 1FXIA 4N6EB 3IBEA 4GDLB 1V8CA 2VH2A 2DX5B 2ZVNA 1QQRA 2W3RA 4HDOA 1RYJA 4IG7B 1KRHA 3W5UB 5TSSA 2Y3AA 1MVKA 2ICIA 3VXWA 1ISNA 2RDGA 4M8MA 3VTWA 1FPYA 3AEDB 1JWUD 2IO1B 4JPSA 2QCZA 3Q3MC 2JYEA 1ZDVA 3VH3B 3GE8C 3MC0B 3A1QB 2L52A 4GDKB 1XQQA 2UYZB 3VR8B 1OQQA 2QJLA 3JVZX 3N1ZC 4D2KA 4NJCA 5IA7A 2C60A 1UWMA 3QHTA 5HKHA 2DZIA 4ANVA 4MEMA 4MH8A 1WX9A 3QA8A 5BMIA 4AQ7A 2J7QB 4W9FA 2W3SA 3NOBA 2DZKA 3ZJUA 3BINA 3HIZA 1XXGA 3MTNB 3APCA 4A90A 1KLVA 1M94A 4G50A 2JYTA 2L3ZA 4IKGA 2KC1A 5FKAC 2RGFA 3H6NA 4H2AA 4HK2A 2EMTA 4PS3A 1C76A 4J6IA 1PQSA 3VHTC 3IAS1 4HLEA 3ZTDA 3UQAA 3FC4A 1QF6A 3W1YA 4C56C 4C7ZA 3KUCB 1KTKA 2PMVA 1TZ1A 2VZKD 2LXCA 5CHWA 1CZPA 1P7EA 2GMIC 1FXAA 3A9KA 2PEAA 1NYQA 4BAXA 2MBEA 5KHQA 1KJTA 1WXSA 2EELA 4NNJB 3TBLD 2BYEA 5G2NA 4FLHA 2WNMA 4URKA 1TTNA 1J7BA 3ZDTA 4MJSA 2WLBA 3ZKJC 4LNIA 2LGYA 5CHVC 4W9EA 4XGAB 2G4DB 4LNFA 2WX0A 3HRDD 1VR9A 3NJTA 1V49A 4OZAA 3MJ5A 2N7DA 4KGSA 3SU8X 2IYDB 4G3XB 3WALA 4FJZA 1PFDA 4FULA 1PUTA 5LXHA 2ZJDA 2CHXA 3NS8A 4HDQA 2KTRB 1I4GA 2BKRB 4R3DA 1SGHA 3RNCC 3DHIC 3PRZA 5HI1A 3IAM1 1FCCC 3QJZA 5FR6A 1ACCA 2A5UA 4C4VA 2MP2A 2YEPB 3K9PB 2FBWB 2D3BA 2V4IB 4GIVA 2DAJA 2C5LC 2WGSA 3H7SA 5I4DA 3L08A 1IGDA 3GP7A 1H8CA 1GNUA 2GB1A 3RUIB 3RNFC 4KIKB 5EE0A 2KMMA 4AJWA 5TR5A 1WI0A 1CK1A 1JRUA 2XNAC 2PPHA 1T6BX 1C9FA 3KYCD 1XLQA 1FIQA 3PRMB 4LDTD 4I6LB 2CKHB 3Q2AC 4BZAA 3KLSX 1MFWA 4A3PA 2GBKA 2JX5A 2KNBA 3Q8EA 4ZRJA 3OWEB 3N20C 1OGWA 1A70A 1FNWA 4JX1C 1L5PA 4I6PA 3L17A 2LVPA 4RGTA 1VD2A 3QARA 2LASA 1E7UA 4XWWA 2J52A 1E8WA 4MGKE 5FR3A 1JQ4A 4KZCA 1FM0D 1FEHA 2MCNB 1WE6A 4WWPA 1CJEA 4JL9A 1E10A 3RFZB 2AL6A 1KM7A 3QWZB 1HTQA 3AE9B 1TY0A 3A1QA 1YX6B 5DPWA 4GDKA 2TSSA 3QAQA 4FJVB 1Q10A 3HM6X 3N32A 4PT5A 4IM2A 2NS5A 2KFKB 4WH4A 4RGOS 2LI5A 2KC2A 1I4RA 1I4PA 3HUIA 3DWGC 1YN3A 4W9DA 2N9KA 1HZ6A 3Q69A 3ZQ4A 1IYFA 1VJKA 3AE1B 1JCKB 5C1ZA 4WWMA 4E74A 1CQVA 1T5XD 1ZDXA 3SFEB 2BYTA 1WXMA 2M56B 2ONQA 2FAZA 4IDIA 2O2VA 2OJWA 1DOYA 3DQVA 4W9JA 4YT0B 1E90A 2AYOB 2KJ6A 5GXGB 2WXQA 1KF6B 2N1VA 1XF5L 3AE4B 3R7QA 3DCGA 2SAKA 5E6OA 3TSSA 1C77A 2BBCA 4WJNA 4Q2JA 4W9KA 1EF5A 3BK1A 5DPRA 4EZLA 4HRSA 2KQSA 2G1EA 3NRZA 1C79A 1B1ZA 2WDTB 1FXTB 1ZXHA 1BMLC 1HE8A 1WZ3A 2OHFA 2WDVB 4ZRQA 3V60A 1JWSD 4M8NA 3VRBB 3W2DA 1LFDA 2KXJA 2KDMA 1SE9A 2K39A 3V6CB 4KSKC 1FD6A 2MLBA 3SDLC 2LUEA 3ZLZA 3W5VB 3TEYA 2BPSA 3IFWB 1ZGUB 2K8HA 1CMXB 3P4QB 4WAAA 2ZNVB 3DWMA 2PE6B 4CO7A 1OTRB 2WXLA 5IO9A 4DHJD 4FA6A 5AUIA 4QAYA 4BFRA 2GBMA 4PS8A 2V3SA 3ZNHB 2XN9C 4C80A 4TMAB 2AQ2B 3OJ3A 3WIMA 2PJHA 3Q8FA 3L4PA 4YTNB 5DCNA 3ZNGC 3ML9A 1RWSA 3DBRI 4TV3A 4AOFA 2NCNA 3A4RA 4WAFA 3T8MA 4IM0A 2KTRA 4CYEA 3VTUA 1S3SG 5JH5C 3U7ZA 4GXBA 4YL8A 2RDHA 1X1MA 3QX1A 3B2GA 1YNTE 1YD8U 1K8RB 3X23A 3TUOA 2DZMA 4MGIE 1TYGB 1E5WA 2NBWB 1QOAA 2MA9B 4WWOA 4IOIE 1SIFA 4WQMA 3T3OA 2KOXA 1L6VA 1C78A 4JE3B 2RMMA 2XK5A 2LRUA 1T0RC 4USAA 2N7JA 2FIDA 3DHHC 1FRRA 3SEBA 3FAHA 3PGEA 3APDA 2V0GA 2KK8A 1I42A 1LGRA 2WXHA 3ZXVA 2JU6X 2R2QA 3B1LX 1UD7A 3GS2A 2OJRA 2LJIA 3ZTCA 5DPTA 2NVUI 1JMLA 3B08A 2ACZB 3KWVA 2FCNA 4DXFA 2J0KA 1YJJA 3NVZA 2C7NB 2MQJA 2N9PC 2BGFA 2ZW1A 3JSVB 1UELA 4HJGE 2VZKB 3AE8B 3VUYA 2ASQA 2AWTA 4TUUA 3ZXRA 2N7EA 4UDUC 3ZYYX 4FN2A 1YJIA 4OVZA 2YEPF 4OHJA 1N60A 2JZ3B 3KWLA 1LO5D 1V5TA 4ZHPA 3LB8C 1RLFA 1D5XC 4FXCA 3U2SC 4EUTA 1XCQL 5BYSA 2WQYB 2MHJA 2GRIA 1IP9A 1UGMA 2A4ZA 1YJ1A 2KAJA 4IWOA 4N59A 1VZ7A 4HXDA 1F77A 4MGYE 1EU4A 2MBOA 3N9YC 4L2YA 2PE9A 1IBXA 5E6NA 2K3UA 4GMVA 3SFDB 3AECB 2WXJA 4ZHOA 2J0JA 2SEBD 1V80A 4DHZE 2RPVA 4KVGB 4A9AA 3R3MA 2CU3A 1DOIA 5GMVA 1V81A 5AZGA 4A3OA 4KGRA 1N5XA 1UZXB 4MM3B 2WS3B 3PV1A 2L32A 3NVWA 4X57B 2BT6A 2WDRB 4NPNA 1H4RA 4RMAA 2LD9A 2WXNA 2JVCA 1E8ZA 1Y56A 2LVQA 4ZYNA 4EE2A 3Q8BA 2DWQA 4BVUC 3V61A 2GBNA 3EFUA 1ZW7A 3KH0A 1WXVA 2UU7A 4EFOA 3V3XA 2PIAA 1MPEA 4KGTA 3PZDA 2WU2B 4F8CB 3RMKC 2O6VA 5HHDG 3DBHB 4HCNB 1YMHE 2ZVOA 1C4AA 1STEA 3KUDB 2NPTB 2FIFA 1J7AA 3ZDMC 5LNK1 4OVUA 2INNE 1QOFA 4NAMA 4DQOC 4II2B 3Q3NC 1SF0A 1KLUD 4GB9A 3HM3A 2Z0EB 2M4NA 2I2YA 2D3CA 1WYWB 4OZBA 2RD0A 2KANA 4US9A 2QHOA 1KOTA 1UWXA 1TS3A 3TL5A 1VRAB 3N3KB 1WGKA 3SHQA 4LLGM 5J18A 2REXA 1EWYC 3HK0A 2I38A 3L0WB 3PZ8A 2DENB 2DYOA 3K9OB 5E6PA 2KFJA 3BIID 3LDZE 4G11A 1J0GA 2HJ8A 1UBQA 4HPPA 1P1AA 3RNBC 3Q8AA 1HXYD 1GC6A 1HQRD 2WP9B 1N6ZA 4EZJA 1WY8A 1HEZE 4K3BA 4KX6B 3IG3A 4E3CA 1WJ4A 4CQNA 2CHWA 4I6NB 2NBUA 3N1XC 5EE3A 1J7CA 4P7IA 4XDCA 4IC7B 5AZFA 2CHZA 2JPHA 1L0VB 1UGJA 4OVVA 3BVMA 4IW0A 2JZZA 3AEGB 2FE8A 3PHWB 2J4XA 3QCAA 2RDBC 3VUXA 4KDLB 2HTHA 4C7YA 4KKJA 1WH3A 5G5HA 3ZRFA 4OZCA 4ACFA 3P4SB 3T9LA 2LRWA 1WYGA 1C3TA 2MW5A 1P7FA 2KKCA 3O13A 3LXFA 3DVNU 1QLBB 3BYTB 4K7UA 1K50A 1UNSA 3ONSA 4MT5A 3WCQA 4GOCA 2MJEA 1WXAA 1SE3A 2FCQA 2IO2B 2QEJC 2I1KA 4YTPB 1V1OA 3VAWA 2PTLA 3NZUA 4EEWA 5AZHA 1J8CA 1V1PB 3PVLA 1SBBB 4IM3A 2IY1B 5IP4D 3Q6BA 1F0ZA 2WHIA 2IO3B 3PPAA 2Z0DB 3RCZA 2K6QA 5IN7A 3PLVA 2KHWB 4RM8A 1SE2A 1WGGA 2PKOA 4BKGA 4ICUA 5IOIA 4G0NB 1NENB 1TJEA 1YOVB 3DDCB 2FCSA 4JWUC 2C7MB 1P0RA 2K8CA 3ZGZA 3VDZA 4B0EA 3PLUA 1MHXA 1C4CA 4AWJA 1IPGA 2UWQA 1T0YA 1VZ8A 4KV2A 1NI3A 2IJ0A 4US8A 4BBNF 2BYFA 2MJ3A 4MM3A 4NAWB 2DNFA 2CU1A 2K8BA 2LWPA 2AL3A 2PVGC 1FMAD 4K1RB 3DOWA 2KVZA 4GDLA 3J9CA 1N5WA 3ZW3A 3DBSA 2GI9A 4YTMB 1KFYB 4A8XC 1WR1A 1DOXA 4YXDB 2RSUA 4BKTA 5JHBA 1F2RI 4DDGD 3C0RB 2Y5PA 5BO4B 4C00A 1L0XB 2INPE 3OJ4B 4A55A 3NVYA 4XWTA 1QILA 1T0SC 4TKNA 2QILA 2K25A 1V86A 2J53A 2KWUB 2WXRA 4HKQA 3A4SC 3PTFC 1GOZA 1L6UA 3NS1A 1L0YB 1EUVB 2L00B 2ZEQA 2NMQA 4K81A 1UBIA 1TZOA 3ZO5B 4N58A 3JW0X 1NBFC 2KMAA 1BUIC 3N1YC 2V1YA 1P3QU 1V2YA 2L1AA 1T3QA 2HDEA 3OAWA 1RAXA 2BS2B 2W54A 1V97A 2NBVB 2Y5CA 2J0MA 2GBRA 2BB5A 1XLPA 2LGXA 4B95A 1GJZA 3NY5A 2D10A 3V6EB 1SJHD 3I63C 2QSDA 2DYMA 3Q8CA 5DPSA 3RNAC 3DPDA 1FNVA 3TCAA 3RZWC 3GZNB 3SR6A 5L95C 2Z59B 3E56A 1YQ3B 2BB6A 5J17A 1Q5WB 2MX2A 4TQ0A 3W1SA 1GPXA 1OEYA 4MACA 4MSMB 1ET6A 3KUZA 2H89B 2CS4A 3MP9A 3W1SC 1TS2A 3VTVA 4PYZA 4XC2A 1R4MB 4DHZB 3Q3JA 3MJWA 1N61A 2Q5WD 1EM7A 5EDSA 3C8YA 1P9DU 1MG4A 4JWSC 1WSPA 2IBIB 4WJPA 4N9F4 4F1SA 3N30A 2KLCA 4B9KA 1KLGD 3U8ZA 2W82A 4FHKA 3AXCA 3I3TB 1WIAA 1WE7A 3AM9A 1WRDB 5T8IA 2WX1A 2MH7A 4OW0A 3I5JC 1V1PA 4ZOHC 3UI3A 2LVOA 4EKUA 2KT7A 2WXMA 2E6XA 1TS4A 4K7SA 2I1JA 4ARCA 2MBHA 3AMZA 2LEKA 3I57A 1MG8A 4LTUA 4KIKA 3V05A 2M1MA 4K3CA 2B76B 2JWUA 3SD5A 2LXAA 2HTME 4M01A 1VCBA 2ZCBA 3NZ3A 2MBQA 2ZPYA 4GN1A 3KYDD 4L1BA 3LJ3A 1JROA 4ANWA 1L4ZB 2R2OA 2LGSA 3P4RB 3TMPB 2WYQA 4YWGG 2K22A 2GBJA 3AU5A 4GGQA 3A9KB 4DK5A 2GOWA 3O65B 1YQ4B 3AU4A 4NAWA 3U52E 4IUMB 4O1NA 1JALA 1WJNA 1AARA 4W9CA 1XLOA 2WXGA 2KX3A 1TS5A 4MJSB 2JF5A 3BZDB 1SEBD 3Q14C 5CHFA 3UINB 2IY0B 3ZUNA 1WJ6A 3E9SA 1ROEA 2K5PA 2FCMA 4BKSA 2OEDA 2IZVB 4W9IA 2JXXA 4FBJB 4P1BC 5HFYA 5HG2A 1YN5A 3OG5A 4W9HA 2RR9A 3DBHI 3BY4B 2QMTA 1R4NB 5D6JB 4XZ4A 4BOSC 1A5RA 2MJDA 3HVDA 4EZKA 2DAFA 1QOBA 4S17A 2KFKA 1E7VA 1TKYA 1DGJA 2N1WA 3U7DA 2M8SA 2KQ7A 2MWSB 2KN5A 1HA5A 3ECIA 1EWCA 3RZFA 5LXIB 3URYA 3U30A 3EC8A 4C4VB 1JW9D 2MP2B 2MBBB 2H88B 4DXGA 3EECA 4W9LA 2KZRA 3EUB2 4AP4C 1RRBA 3ZRCA 2KX0A 3PS6A 2KVRA 2O6VD 1EF1A 2KDBA 4HKZE 3ETRA 3B2FA 2VRRB 3RI7C 3HHMA 3UGBB 3RULA 2D3AA 3OLMD 1GC7A 1U4AA 1FCLA 3ML8A 3WANA 3DHGC 1ZE3D 4RNAA 5E6JA 1AW7A 4JIOU 4LCDE 1Y8RC 3MHZA 2ZZPB 2JSVX 4WJQA 5BMHA 2BS3B 1XO3A 1WRIA 1OEYJ 4ICVA 3WAMA 2NTTA 3P1MA 3VRAB 2L83A 2ZCCA 1F2RC 2N9XA 1VDVA 3R66C 3AI5A 5JZEB 2D3GA 2KD0A 1ZUD2 4ITKA 4B6WA 1I4QA 1NYRA 2HJ1A 4AUQC 4WQOB 1M4VA 3PO0A 2QIEB 2LUMA 2FNJB 2L76A 3L16A 3NVVA 4LDTB 1F1HA 5G5GA 2CJOA 2ZNVC 1F52A 2LGDA 2MSED 3AEFB 1WGDA 1V6EA 1BT0A 2BWFA 3PT2B 4JGHB 1NDDA 1FO4A 3RNEC 3IXSA 2KWVB 2K0PA 1OQYA 1Z2MA 3AEEB 2KDIA 4MGZE 3ZJTA 2LHDA 1NI2A 2N4FA 2VH1A 3TEWA 3BWUD 2GLSA 1ZOYB 4GSWA 1UUPA 3TEXA 3PRPB 4WURA 1WM3A 1WX7A 2BWES 3CMMB 1I4HA 1E8XA 3EFCA 1WGRA 2N9LA 2AQ1B 2LHEA 3AE5B 1K53A 4ARIA 1TY2A 3AE7B 4NQKE 2V4LA 2KJHB 2YLMA 3IHPC 4WJOA 1UH6A 2NR2A 1BXTA 2O2VB 2HE7A 2G3QB 4WWNA 2Y5BB 4MDKE 5CX3A 3AEAB 3FILB 2B3AA 1GUAB 1OQRA 2Z8LA 3MC8A 1G6JA 1C4PA 2WXOA 3R7RA 2YVCA 1WR6E 3ABVB 1L7YA 2XEWA 3ZJVA 4LNOA 1NEKB 1QOGA 1S1QB 3VR9B 4LK0M 3IVFA 2EKEC 4RGMA 1OFFA 4E71A 2BTEA 1D5ZC 3L54A 1L4DB 3Q3OC 1I7HA 1WGYA 2EMSA 2BKFA 2V3NA 2ZPNA 3PHXB 2M0AA 3KVFB 5BMGA 3GB1A 2J42A 4BBNC 1YN4A 5J2RA 2KJRA 5H8YE 5C3JB 3HVZA 3TEZA 5FK9C 4HPLB 3JSVA 4HWIB 1F9JA 4RCOA 2BVCA 3EA6A 3L13A 4NQLB 2IGGA 3PSEB 2KLGA 1LXDA 5L83A 4NJ6A 2HD5B 3P2BA 1J19A 1TBEA 3RYTA 3AULA 1HZ5A 4AJYB 1Q0WB 3T3NA 2AX5A 2C9WB 5D7GA 1WZ0A 1GAQB 2C7HA 3RD2A 2D5GA 4YSXB 4P1CC 1UF0A 4J3OD 3M63B 3WA0A 2L7RA 4M00A 1Q1OA 2IPKD 4MSQB 3TJPA 1D5MC 2KMCA 2WXFA 3Q3FA 5JHAA 5IKCM 4DHJB 1N62A 2FUG1 2BYVE 4B0MA 1RFAA 5D2MB 4DWFA 1KH0A 3P4PB 1WM2A 1PGBA 1EO6A 4REZA 1WJUA 4TQ1A 4YSZB 3H8HA 1XCTL 1SSNA 2LJ5A 1AN8A 2L0FA 3GOEA 3CIRB 1C1YB 3GE3C 5D94A 2XK5B 1PGAA 1D3ZA 3DBLI 4M02A 3APFA 2QC8A 3WAPA 2D11A 4RM9A 2JRIB 4CHKA 2IGDA 3H7PB 3BK2A 3EHVA 1SB3C 3GZNI 4II3B 1NVID 1VLBA 2KWCA 4HEA1 4RF0A 3VUWA 3ZIMA 1IUEA 3IT4B 2INDC 5D3DA 2NPTA 1MI0A 5H92C 3R2IA 4A20A 1JWAD 3R8BA 1RM6C 1WMHB 5LLIA 1FFVA 1SJED 1IGCA 4HJKA 1PYWD 1E8YA 2M17A 1R4MI 1GG3A 4S0RA 1AYFA 4MH0E 4P16A 1JWMD 3IT6B 1XLNA 2E3TA 2BW2A 2XBBC 3PREA 3ZNID 3M95A 2PW9A 1QZEA 2IO0B 2V3PA 3P42A 3UIPB 3AE2B 4HPMB 3BVGA 1I4XA 3MFGA 2KTFA 4ANUA 2OOBB 4ZRPA 2FUHB 3CWIA 3UQBA 2JZPA 3EGRA 2BQQA 2DHZA 3CSTA 4K7WA 1K52A 3A9JB 3UIOB 3NUHB 4M0WB 5IAAC 3S2AA 3ZVVA 2JQRB 3WAOA 3H1UA 2ON8A 3VH4B 4DXAB 1IBXB 4NJ7A 1ENFA 3DBLB 2MEKA 3M62B 1N63A 4HVBA 3FILA 1R7SA 5JXVA 3CSFA 1ZPSA 3X0WA 5AEKB 1QT9A 1RFKA 3BYYB 5BYQA 3H9DA 3NG0A 2JY6A 1K51A 2NTSA 4P6VF 2LMCA 1MHHE 3UF8A 2CR5A 2WXKA 2RPQA 2N9EB 1XEEA 3JYUA 3RNGC 2L0TA 1WXQA 3CF6E 2D07B 2PLPA 1GB4A 1LQBA 4KDIC 1E9MA 3NZSA 3ALBA 2INCC 1I35A 2KYWA 1XD3B 4KSLC 4LJPB 2O6VB 4PYUA 4AS1A 1WF9A 2PVOD 4MELA 4W9GA 3AEBB 4ASWC 3AH7A 5KHOA 3ENEA 3RT3B 1ET9A 1FNUA 4TSSA 3VVWB 2WWZA 2X8XX 4BOZB 1YX5B 3NHEB 4KKIA 3AE6B 4PK1A 2IGHA 1SXTA 1PDXA 3I9V1 4L23A 2W55A 3L10B 2JWZA 4F7ZA 1XT9B 1ZP0B 5BYRA 3P63A 2WU5B 1E7PB 1R4NI 5EE9A 2BF8B 2KN4A 3KW5B 3C19A 2KQ4X 3M3JA 1TIFA 2G9HD 3VQIA 4RF1A 2JT4B 5EE1A 1E6EB 3V62A 4XYCA 2WDQB 4A6QA 1WWTA 1L2NA 1WX8A 2WXIA 3FKYA 3AV8A 2LFIA 2MRPA 4RFBA 1TT5B 4BKSD 4KZ0A 4ZYSA 4YSYB 4JLCA 2R61A 4GLSC 4LNKA 3W9CB 1T0QC 1VZ6A 4GU2A 4FJYA 2M19A 2W9NA 4NY0A 4JQWC 2QDFA 2KWDA 3A33B 3DVGY 4PS7A 3RN9C 5D3IB 2D2QA 2G4SA 5CTRC 1V9JA 4HROA 4EOYA 3D32A 2BS4B 4RH6A 1D4BA 2KDEB 2K6DB 2DLBA 4XDDA 1D6EC 1ZKHA 3KQ4A 4RGNA 1TKGA 1SIJA 3ZNZB 3QQ8B 2L05A 3H7PA 3AN1A 2JRHA 5AUKA 2AEHA 1GB1A 5MPOA 4HCPB 2JXTA 2DZJA 1YQBA 2WXPA 2DBYA 3MHSD 2JUOA 1PGXA 2K1FA 3DBRB 1ESFA 1WMHA 2AQ3B 2KACA 2K9XA 1WGHA 1EU3A 4DDID 3DVNV 1DYQA 3R2TA 1B9RA 2G45B 4ZDVA 3MC9A 4IWPA 1AWDA 1LM8B 3B0AA 1TGZB 2DYBA 3PZ7A 4ZRIA 3DVGX 3BVZA 3RPFC 4FHJA 5C2TB 1MJDA 2CJNA 5C23A 3LYYA 4XX5A 4ZRKA 4WIPA 4FADA 2N0SB 4LJOB 4LNNA 2IDYA 3U4EG 4ANXA 1YIWA 3A9JA 4M0WA 3QK0A 3B9JA 2ZW0A 3TIXA 4NZLB 5G55A 2KO3A 1HTOA 1SE4A 1JWBD 2LGIA 1Z5SB 3QIJA 3VFKA 1V5OA 1JRPA 1WFYA 3QC8B
chains in the Genus database with same CATH topology
2KDFB 4BBNC 5J2RA 1YD8U 1EUVB 1K8RB 2L00B 2ZEQA 4K81A 3X23A 1P98A 1UBIA 2KJRA 2DZMA 4MGIE 1E5WA 2L8JA 2NBWB 4IWQA 3ZO5B 3JW0X 1NBFC 2LZ6A 2M0XA 4DBGA 2KMAA 4HPLB 2MA9B 4WWOA 3JSVA 4HWIB 2V1YA 1P3QU 1SIFA 1F9JA 1V2YA 3IBEA 3L13A 4GDLB 3OAWA 1RAXA 4NQLB 2KOXA 2DX5B 2ZVNA 3PSEB 2KLGA 2NBVB 1LXDA 2J0MA 2GBRA 2XK5A 2LRUA 4HDOA 5L83A 4NJ6A 2HD5B 4IG7B 2LGXA 3P2BA 1J19A 1TBEA 4B95A 2FIDA 1GJZA 3NY5A 3RYTA 2D10A 3V6EB 3AULA 3VXWA 1ISNA 4M8MA 4AJYB 3VTWA 1Q0WB 3PGEA 2C9WB 2IO1B 3APDA 5D7GA 1WZ0A 2KK8A 2C7HA 1I42A 3RD2A 3VH3B 3A1QB 2DYMA 4GDKB 3B1LX 2R2QA 1XQQA 1UD7A 2UYZB 3M63B 5DPSA 3WA0A 2OJRA 2L7RA 3ZTCA 1Q1OA 3JVZX 3DPDA 4MSQB 5DPTA 3TJPA 3TCAA 2NVUI 3RZWC 5IA7A 2C60A 2KMCA 3Q3FA 3QHTA 5HKHA 5JHAA 2DZIA 4ANVA 5L95C 2Z59B 3B08A 4MEMA 4DHJB 2BYVE 2FCNA 1WX9A 1RFAA 5D2MB 3QA8A 2J0KA 2J7QB 2C7NB 4W9FA 2MQJA 2N9PC 4DWFA 5J17A 3NOBA 2BGFA 2DZKA 1WM2A 1EO6A 1Q5WB 3JSVB 3BINA 3HIZA 1WJUA 2MX2A 4TQ0A 1UELA 3MTNB 4TQ1A 3W1SA 3APCA 3VUYA 1KLVA 1M94A 4G50A 1OEYA 2ASQA 2LJ5A 2AWTA 2L3ZA 4MSMB 4TUUA 2KC1A 2L0FA 2N7EA 3GOEA 3KUZA 2RGFA 2CS4A 3H6NA 3W1SC 4FN2A 3VTVA 1C1YB 4HK2A 4PYZA 2EMTA 4XC2A 4PS3A 5D94A 2JZ3B 4DHZB 2XK5B 4J6IA 3Q3JA 3MJWA 1PQSA 1V5TA 1RLFA 3VHTC 4HLEA 1D3ZA 5EDSA 3DBLI 3ZTDA 3UQAA 4EUTA 3W1YA 1P9DU 3APFA 3WAPA 2D11A 3KUCB 4RM9A 2JRIB 2IBIB 3H7PB 4CHKA 3EHVA 4WJPA 1TZ1A 4N9F4 3GZNI 4II3B 2LXCA 1IP9A 1UGMA 2KWCA 3VUWA 3ZIMA 5CHWA 4F1SA 2A4ZA 1YJ1A 4IWOA 4HXDA 2GMIC 3N30A 2KLCA 4B9KA 3U8ZA 2NPTA 3A9KA 4FHKA 3AXCA 4MGYE 2MBOA 2PEAA 3I3TB 1WIAA 1WE7A 2MBEA 5KHQA 1KJTA 1WXSA 2PE9A 4A20A 4NNJB 1WRDB 3TBLD 5E6NA 1WMHB 2WX1A 2BYEA 4GMVA 5G2NA 4FLHA 5LLIA 4HJKA 1E8YA 2M17A 2J0JA 2LVOA 4EKUA 4URKA 1R4MI 1TTNA 1GG3A 1V80A 4DHZE 4KVGB 4MH0E 4K7SA 3R3MA 4MJSA 3ZDTA 2I1JA 5GMVA 1V81A 2MBHA 3ZKJC 2LGYA 5AZGA 5CHVC 4A3OA 1MG8A 4W9EA 1UZXB 2XBBC 2G4DB 3PV1A 4KIKA 2WX0A 3PREA 3ZNID 4X57B 3M95A 4NPNA 2M1MA 1H4RA 4RMAA 3SD5A 2LD9A 2LXAA 2JVCA 1V49A 1E8ZA 2LVQA 4ZYNA 1QZEA 2IO0B 1VCBA 3UIPB 2ZCBA 2N7DA 2MBQA 3SU8X 4HPMB 2IYDB 4G3XB 3V61A 2GBNA 4BVUC 3EFUA 2ZPYA 1ZW7A 3WALA 3KH0A 3KYDD 4FJZA 1WXVA 4GN1A 2KTFA 4EFOA 3LJ3A 4FULA 4ANUA 4ANWA 2OOBB 2R2OA 2FUHB 3PZDA 3UQBA 4F8CB 3TMPB 2DHZA 4K7WA 3CSTA 5LXHA 2O6VA 2ZJDA 4HCNB 2CHXA 2WYQA 2ZVOA 3A9JB 3NS8A 3UIOB 2GBJA 4HDQA 3AU5A 4GGQA 4M0WB 3KUDB 5IAAC 2NPTB 3A9KB 2KTRB 3S2AA 3ZVVA 2FIFA 4DK5A 3ZDMC 2GOWA 3O65B 2BKRB 4OVUA 3WAOA 3H1UA 1SGHA 4II2B 3VH4B 3PRZA 3AU4A 4NAWA 4NJ7A 4DXAB 4IUMB 4GB9A 3HM3A 2Z0EB 2M4NA 3M62B 4HVBA 3QJZA 5FR6A 2A5UA 2MP2A 1WYWB 1WJNA 2RD0A 1AARA 2KANA 4W9CA 3K9PB 2QHOA 1KOTA 4GIVA 3CSFA 2DAJA 2KX3A 4MJSB 3X0WA 2JF5A 2C5LC 5AEKB 3TL5A 3H7SA 5CHFA 3UINB 3N3KB 2IY0B 3SHQA 3ZUNA 3L08A 1WJ6A 3H9DA 5J18A 2REXA 1GNUA 1H8CA 3RUIB 2JY6A 2FCMA 4BKSA 3HK0A 2IZVB 4KIKB 3L0WB 4W9IA 2JXXA 4AJWA 5TR5A 1WI0A 2DENB 2DYOA 3K9OB 4FBJB 5E6PA 2KFJA 3LDZE 3UF8A 2CR5A 2RPQA 2N9EB 1JRUA 4G11A 4W9HA 2PPHA 1J0GA 2RR9A 3KYCD 3DBHI 3JYUA 2HJ8A 1UBQA 3BY4B 1P1AA 3PRMB 2L0TA 5D6JB 4XZ4A 4BOSC 3CF6E 1A5RA 2D07B 4LDTD 4EZKA 1GC6A 4I6LB 2CKHB 1LQBA 2DAFA 4KDIC 3NZSA 3ALBA 1I35A 1XD3B 4KSLC 2KFKA 4LJPB 1E7VA 2O6VB 4A3PA 4PYUA 2N1WA 2GBKA 3U7DA 4EZJA 2M8SA 2KQ7A 2KNBA 1WF9A 2MWSB 4ZRJA 2KN5A 4MELA 1OGWA 4W9GA 1WY8A 3ECIA 4ASWC 3RZFA 4I6PA 3L17A 5LXIB 2LVPA 5KHOA 3ENEA 3U30A 3IG3A 1VD2A 1WJ4A 3EC8A 3QARA 3RT3B 4E3CA 2LASA 2CHWA 2MP2B 4I6NB 2MBBB 1E7UA 3VVWB 4BOZB 2NBUA 2WWZA 1YX5B 3NHEB 3EECA 4P7IA 4W9LA 2KZRA 4IC7B 5AZFA 2CHZA 1E8WA 2JPHA 4AP4C 3L10B 4MGKE 1RRBA 3ZRCA 2JWZA 4OVVA 2KX0A 4F7ZA 1XT9B 3PS6A 2KVRA 2O6VD 4IW0A 1EF1A 2KDBA 4KZCA 2JZZA 2MCNB 3PHWB 1R4NI 1WE6A 2BF8B 4WWPA 3KW5B 2VRRB 3HHMA 3UGBB 3QCAA 3M3JA 4JL9A 2AL6A 1KM7A 3RULA 3VUXA 3VQIA 3QWZB 4KDLB 3OLMD 2JT4B 1GC7A 1U4AA 2HTHA 3V62A 3A1QA 3ML8A 3WANA 1WH3A 1YX6B 5DPWA 4GDKA 3QAQA 3ZRFA 4FJVB 3HM6X 3N32A 1L2NA 1WX8A 4IM2A 4JIOU 3T9LA 2MRPA 2NS5A 2KFKB 2LRWA 4LCDE 1Y8RC 2LI5A 2ZZPB 2KC2A 4WJQA 4KZ0A 4BKSD 1C3TA 2MW5A 4JLCA 2KKCA 1OEYJ 4ICVA 3WAMA 3DVNU 4W9DA 2ZCCA 4K7UA 2N9XA 3R66C 4GU2A 1IYFA 3AI5A 4FJYA 5JZEB 3ONSA 5C1ZA 4E74A 4GOCA 2W9NA 4NY0A 2D3GA 2KD0A 4JQWC 3A33B 3DVGY 4PS7A 1WXAA 2D2QA 1WXMA 2G4SA 1V9JA 5CTRC 4B6WA 2FAZA 2O2VA 2FCQA 2IO2B 4AUQC 4EOYA 4WQOB 2I1KA 3VAWA 3DQVA 4W9JA 3D32A 3NZUA 4EEWA 1E90A 2AYOB 5AZHA 2KJ6A 1J8CA 2FNJB 2KDEB 2L76A 3L16A 3PVLA 2N1VA 2K6DB 4LDTB 3R7QA 2ZNVC 3DCGA 4IM3A 2IY1B 2MSED 2LGDA 1ZKHA 1WGDA 1V6EA 1BT0A 5E6OA 2BWFA 3PT2B 3QQ8B 2L05A 3ZNZB 2IO3B 3H7PA 3PPAA 4JGHB 4WJNA 2Z0DB 1NDDA 3RCZA 2K6QA 3PLVA 4W9KA 1EF5A 2KHWB 5DPRA 2KWVB 4RM8A 1WGGA 1OQYA 4EZLA 1Z2MA 4BKGA 4ICUA 2JRHA 2KDIA 4G0NB 2AEHA 2KQSA 4HCPB 4MGZE 3DDCB 1NI2A 2FCSA 2N4FA 2DZJA 1YQBA 2WDTB 1FXTB 2C7MB 4GSWA 1HE8A 3MHSD 1WZ3A 1P0RA 3V60A 2JUOA 4M8NA 2K8CA 2K1FA 3PRPB 1WMHA 3VDZA 1WM3A 1LFDA 1WX7A 2BWES 3CMMB 3PLUA 2KXJA 1E8XA 1WGRA 1WGHA 4DDID 4AWJA 3DVNV 1IPGA 1SE9A 2UWQA 2K39A 3V6CB 1T0YA 4KV2A 4KSKC 4NQKE 2V4LA 2MLBA 2KJHB 2YLMA 3IHPC 2G45B 4WJOA 3SDLC 4ZDVA 2LUEA 4IWPA 3ZLZA 4BBNF 1UH6A 2BPSA 2BYFA 2NR2A 1LM8B 3IFWB 2O2VB 3B0AA 4MM3A 1ZGUB 2K8HA 4NAWB 1CMXB 1TGZB 2HE7A 2DYBA 2G3QB 2CU1A 2K8BA 2LWPA 2AL3A 2Y5BB 2ZNVB 4WAAA 4WWNA 2PE6B 4CO7A 4K1RB 4MDKE 3DOWA 5CX3A 1OTRB 4GDLA 3DVGX 4ZRIA 2B3AA 1GUAB 4DHJD 4FA6A 1G6JA 4BFRA 2GBMA 4PS8A 4FHJA 2V3SA 3ZW3A 3ZNHB 3R7RA 3DBSA 2YVCA 1WR6E 3OJ3A 5C23A 3WIMA 2PJHA 1L7YA 4XX5A 2XEWA 1WR1A 4ZRKA 4FADA 2RSUA 4BKTA 5DCNA 5JHBA 4LJOB 3ZNGC 3ML9A 4DDGD 3C0RB 3DBRI 4TV3A 4ANXA 5BO4B 1YIWA 4AOFA 3A9JA 3OJ4B 1S1QB 2NCNA 3A4RA 3IVFA 3QK0A 2EKEC 4IM0A 2KTRA 3T8MA 4TKNA 4CYEA 4E71A 2K25A 3VTUA 1V86A 3TIXA 1S3SG 2KWUB 3L54A 5JH5C 4GXBA 5G55A 2KO3A 4YL8A 1Z5SB 1WGYA 3QIJA 3VFKA 1V5OA 1WFYA 2EMSA 2BKFA 2ZPNA 3PHXB 3A4SC 1X1MA 3QX1A 3PTFC 3KVFB 3QC8B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KDF B;  4BBN C;  5J2R A;  1YD8 U;  1EUV B;  1K8R B;  2L00 B;  2ZEQ A;  4K81 A;  3X23 A;  1P98 A;  1UBI A;  2KJR A;  2DZM A;  4MGI E;  1E5W A;  2L8J A;  2NBW B;  4IWQ A;  3ZO5 B;  3JW0 X;  1NBF C;  2LZ6 A;  2M0X A;  4DBG A;  2KMA A;  4HPL B;  2MA9 B;  4WWO A;  3JSV A;  4HWI B;  2V1Y A;  1P3Q U;  1SIF A;  1F9J A;  1V2Y A;  3IBE A;  3L13 A;  4GDL B;  3OAW A;  1RAX A;  4NQL B;  2KOX A;  2DX5 B;  2ZVN A;  3PSE B;  2KLG A;  2NBV B;  1LXD A;  2J0M A;  2GBR A;  2XK5 A;  2LRU A;  4HDO A;  5L83 A;  4NJ6 A;  2HD5 B;  4IG7 B;  2LGX A;  3P2B A;  1J19 A;  1TBE A;  4B95 A;  2FID A;  1GJZ A;  3NY5 A;  3RYT A;  2D10 A;  3V6E B;  3AUL A;  3VXW A;  1ISN A;  4M8M A;  4AJY B;  3VTW A;  1Q0W B;  3PGE A;  2C9W B;  2IO1 B;  3APD A;  5D7G A;  1WZ0 A;  2KK8 A;  2C7H A;  1I42 A;  3RD2 A;  3VH3 B;  3A1Q B;  2DYM A;  4GDK B;  3B1L X;  2R2Q A;  1XQQ A;  1UD7 A;  2UYZ B;  3M63 B;  5DPS A;  3WA0 A;  2OJR A;  2L7R A;  3ZTC A;  1Q1O A;  3JVZ X;  3DPD A;  4MSQ B;  5DPT A;  3TJP A;  3TCA A;  2NVU I;  3RZW C;  5IA7 A;  2C60 A;  2KMC A;  3Q3F A;  3QHT A;  5HKH A;  5JHA A;  2DZI A;  4ANV A;  5L95 C;  2Z59 B;  3B08 A;  4MEM A;  4DHJ B;  2BYV E;  2FCN A;  1WX9 A;  1RFA A;  5D2M B;  3QA8 A;  2J0K A;  2J7Q B;  2C7N B;  4W9F A;  2MQJ A;  2N9P C;  4DWF A;  5J17 A;  3NOB A;  2BGF A;  2DZK A;  1WM2 A;  1EO6 A;  1Q5W B;  3JSV B;  3BIN A;  3HIZ A;  1WJU A;  2MX2 A;  4TQ0 A;  1UEL A;  3MTN B;  4TQ1 A;  3W1S A;  3APC A;  3VUY A;  1KLV A;  1M94 A;  4G50 A;  1OEY A;  2ASQ A;  2LJ5 A;  2AWT A;  2L3Z A;  4MSM B;  4TUU A;  2KC1 A;  2L0F A;  2N7E A;  3GOE A;  3KUZ A;  2RGF A;  2CS4 A;  3H6N A;  3W1S C;  4FN2 A;  3VTV A;  1C1Y B;  4HK2 A;  4PYZ A;  2EMT A;  4XC2 A;  4PS3 A;  5D94 A;  2JZ3 B;  4DHZ B;  2XK5 B;  4J6I A;  3Q3J A;  3MJW A;  1PQS A;  1V5T A;  1RLF A;  3VHT C;  4HLE A;  1D3Z A;  5EDS A;  3DBL I;  3ZTD A;  3UQA A;  4EUT A;  3W1Y A;  1P9D U;  3APF A;  3WAP A;  2D11 A;  3KUC B;  4RM9 A;  2JRI B;  2IBI B;  3H7P B;  4CHK A;  3EHV A;  4WJP A;  1TZ1 A;  4N9F 4;  3GZN I;  4II3 B;  2LXC A;  1IP9 A;  1UGM A;  2KWC A;  3VUW A;  3ZIM A;  5CHW A;  4F1S A;  2A4Z A;  1YJ1 A;  4IWO A;  4HXD A;  2GMI C;  3N30 A;  2KLC A;  4B9K A;  3U8Z A;  2NPT A;  3A9K A;  4FHK A;  3AXC A;  4MGY E;  2MBO A;  2PEA A;  3I3T B;  1WIA A;  1WE7 A;  2MBE A;  5KHQ A;  1KJT A;  1WXS A;  2PE9 A;  4A20 A;  4NNJ B;  1WRD B;  3TBL D;  5E6N A;  1WMH B;  2WX1 A;  2BYE A;  4GMV A;  5G2N A;  4FLH A;  5LLI A;  4HJK A;  1E8Y A;  2M17 A;  2J0J A;  2LVO A;  4EKU A;  4URK A;  1R4M I;  1TTN A;  1GG3 A;  1V80 A;  4DHZ E;  4KVG B;  4MH0 E;  4K7S A;  3R3M A;  4MJS A;  3ZDT A;  2I1J A;  5GMV A;  1V81 A;  2MBH A;  3ZKJ C;  2LGY A;  5AZG A;  5CHV C;  4A3O A;  1MG8 A;  4W9E A;  1UZX B;  2XBB C;  2G4D B;  3PV1 A;  4KIK A;  2WX0 A;  3PRE A;  3ZNI D;  4X57 B;  3M95 A;  4NPN A;  2M1M A;  1H4R A;  4RMA A;  3SD5 A;  2LD9 A;  2LXA A;  2JVC A;  1V49 A;  1E8Z A;  2LVQ A;  4ZYN A;  1QZE A;  2IO0 B;  1VCB A;  3UIP B;  2ZCB A;  2N7D A;  2MBQ A;  3SU8 X;  4HPM B;  2IYD B;  4G3X B;  3V61 A;  2GBN A;  4BVU C;  3EFU A;  2ZPY A;  1ZW7 A;  3WAL A;  3KH0 A;  3KYD D;  4FJZ A;  1WXV A;  4GN1 A;  2KTF A;  4EFO A;  3LJ3 A;  4FUL A;  4ANU A;  4ANW A;  2OOB B;  2R2O A;  2FUH B;  3PZD A;  3UQB A;  4F8C B;  3TMP B;  2DHZ A;  4K7W A;  3CST A;  5LXH A;  2O6V A;  2ZJD A;  4HCN B;  2CHX A;  2WYQ A;  2ZVO A;  3A9J B;  3NS8 A;  3UIO B;  2GBJ A;  4HDQ A;  3AU5 A;  4GGQ A;  4M0W B;  3KUD B;  5IAA C;  2NPT B;  3A9K B;  2KTR B;  3S2A A;  3ZVV A;  2FIF A;  4DK5 A;  3ZDM C;  2GOW A;  3O65 B;  2BKR B;  4OVU A;  3WAO A;  3H1U A;  1SGH A;  4II2 B;  3VH4 B;  3PRZ A;  3AU4 A;  4NAW A;  4NJ7 A;  4DXA B;  4IUM B;  4GB9 A;  3HM3 A;  2Z0E B;  2M4N A;  3M62 B;  4HVB A;  3QJZ A;  5FR6 A;  2A5U A;  2MP2 A;  1WYW B;  1WJN A;  2RD0 A;  1AAR A;  2KAN A;  4W9C A;  3K9P B;  2QHO A;  1KOT A;  4GIV A;  3CSF A;  2DAJ A;  2KX3 A;  4MJS B;  3X0W A;  2JF5 A;  2C5L C;  5AEK B;  3TL5 A;  3H7S A;  5CHF A;  3UIN B;  3N3K B;  2IY0 B;  3SHQ A;  3ZUN A;  3L08 A;  1WJ6 A;  3H9D A;  5J18 A;  2REX A;  1GNU A;  1H8C A;  3RUI B;  2JY6 A;  2FCM A;  4BKS A;  3HK0 A;  2IZV B;  4KIK B;  3L0W B;  4W9I A;  2JXX A;  4AJW A;  5TR5 A;  1WI0 A;  2DEN B;  2DYO A;  3K9O B;  4FBJ B;  5E6P A;  2KFJ A;  3LDZ E;  3UF8 A;  2CR5 A;  2RPQ A;  2N9E B;  1JRU A;  4G11 A;  4W9H A;  2PPH A;  1J0G A;  2RR9 A;  3KYC D;  3DBH I;  3JYU A;  2HJ8 A;  1UBQ A;  3BY4 B;  1P1A A;  3PRM B;  2L0T A;  5D6J B;  4XZ4 A;  4BOS C;  3CF6 E;  1A5R A;  2D07 B;  4LDT D;  4EZK A;  1GC6 A;  4I6L B;  2CKH B;  1LQB A;  2DAF A;  4KDI C;  3NZS A;  3ALB A;  1I35 A;  1XD3 B;  4KSL C;  2KFK A;  4LJP B;  1E7V A;  2O6V B;  4A3P A;  4PYU A;  2N1W A;  2GBK A;  3U7D A;  4EZJ A;  2M8S A;  2KQ7 A;  2KNB A;  1WF9 A;  2MWS B;  4ZRJ A;  2KN5 A;  4MEL A;  1OGW A;  4W9G A;  1WY8 A;  3ECI A;  4ASW C;  3RZF A;  4I6P A;  3L17 A;  5LXI B;  2LVP A;  5KHO A;  3ENE A;  3U30 A;  3IG3 A;  1VD2 A;  1WJ4 A;  3EC8 A;  3QAR A;  3RT3 B;  4E3C A;  2LAS A;  2CHW A;  2MP2 B;  4I6N B;  2MBB B;  1E7U A;  3VVW B;  4BOZ B;  2NBU A;  2WWZ A;  1YX5 B;  3NHE B;  3EEC A;  4P7I A;  4W9L A;  2KZR A;  4IC7 B;  5AZF A;  2CHZ A;  1E8W A;  2JPH A;  4AP4 C;  3L10 B;  4MGK E;  1RRB A;  3ZRC A;  2JWZ A;  4OVV A;  2KX0 A;  4F7Z A;  1XT9 B;  3PS6 A;  2KVR A;  2O6V D;  4IW0 A;  1EF1 A;  2KDB A;  4KZC A;  2JZZ A;  2MCN B;  3PHW B;  1R4N I;  1WE6 A;  2BF8 B;  4WWP A;  3KW5 B;  2VRR B;  3HHM A;  3UGB B;  3QCA A;  3M3J A;  4JL9 A;  2AL6 A;  1KM7 A;  3RUL A;  3VUX A;  3VQI A;  3QWZ B;  4KDL B;  3OLM D;  2JT4 B;  1GC7 A;  1U4A A;  2HTH A;  3V62 A;  3A1Q A;  3ML8 A;  3WAN A;  1WH3 A;  1YX6 B;  5DPW A;  4GDK A;  3QAQ A;  3ZRF A;  4FJV B;  3HM6 X;  3N32 A;  1L2N A;  1WX8 A;  4IM2 A;  4JIO U;  3T9L A;  2MRP A;  2NS5 A;  2KFK B;  2LRW A;  4LCD E;  1Y8R C;  2LI5 A;  2ZZP B;  2KC2 A;  4WJQ A;  4KZ0 A;  4BKS D;  1C3T A;  2MW5 A;  4JLC A;  2KKC A;  1OEY J;  4ICV A;  3WAM A;  3DVN U;  4W9D A;  2ZCC A;  4K7U A;  2N9X A;  3R66 C;  4GU2 A;  1IYF A;  3AI5 A;  4FJY A;  5JZE B;  3ONS A;  5C1Z A;  4E74 A;  4GOC A;  2W9N A;  4NY0 A;  2D3G A;  2KD0 A;  4JQW C;  3A33 B;  3DVG Y;  4PS7 A;  1WXA A;  2D2Q A;  1WXM A;  2G4S A;  1V9J A;  5CTR C;  4B6W A;  2FAZ A;  2O2V A;  2FCQ A;  2IO2 B;  4AUQ C;  4EOY A;  4WQO B;  2I1K A;  3VAW A;  3DQV A;  4W9J A;  3D32 A;  3NZU A;  4EEW A;  1E90 A;  2AYO B;  5AZH A;  2KJ6 A;  1J8C A;  2FNJ B;  2KDE B;  2L76 A;  3L16 A;  3PVL A;  2N1V A;  2K6D B;  4LDT B;  3R7Q A;  2ZNV C;  3DCG A;  4IM3 A;  2IY1 B;  2MSE D;  2LGD A;  1ZKH A;  1WGD A;  1V6E A;  1BT0 A;  5E6O A;  2BWF A;  3PT2 B;  3QQ8 B;  2L05 A;  3ZNZ B;  2IO3 B;  3H7P A;  3PPA A;  4JGH B;  4WJN A;  2Z0D B;  1NDD A;  3RCZ A;  2K6Q A;  3PLV A;  4W9K A;  1EF5 A;  2KHW B;  5DPR A;  2KWV B;  4RM8 A;  1WGG A;  1OQY A;  4EZL A;  1Z2M A;  4BKG A;  4ICU A;  2JRH A;  2KDI A;  4G0N B;  2AEH A;  2KQS A;  4HCP B;  4MGZ E;  3DDC B;  1NI2 A;  2FCS A;  2N4F A;  2DZJ A;  1YQB A;  2WDT B;  1FXT B;  2C7M B;  4GSW A;  1HE8 A;  3MHS D;  1WZ3 A;  1P0R A;  3V60 A;  2JUO A;  4M8N A;  2K8C A;  2K1F A;  3PRP B;  1WMH A;  3VDZ A;  1WM3 A;  1LFD A;  1WX7 A;  2BWE S;  3CMM B;  3PLU A;  2KXJ A;  1E8X A;  1WGR A;  1WGH A;  4DDI D;  4AWJ A;  3DVN V;  1IPG A;  1SE9 A;  2UWQ A;  2K39 A;  3V6C B;  1T0Y A;  4KV2 A;  4KSK C;  4NQK E;  2V4L A;  2MLB A;  2KJH B;  2YLM A;  3IHP C;  2G45 B;  4WJO A;  3SDL C;  4ZDV A;  2LUE A;  4IWP A;  3ZLZ A;  4BBN F;  1UH6 A;  2BPS A;  2BYF A;  2NR2 A;  1LM8 B;  3IFW B;  2O2V B;  3B0A A;  4MM3 A;  1ZGU B;  2K8H A;  4NAW B;  1CMX B;  1TGZ B;  2HE7 A;  2DYB A;  2G3Q B;  2CU1 A;  2K8B A;  2LWP A;  2AL3 A;  2Y5B B;  2ZNV B;  4WAA A;  4WWN A;  2PE6 B;  4CO7 A;  4K1R B;  4MDK E;  3DOW A;  5CX3 A;  1OTR B;  4GDL A;  3DVG X;  4ZRI A;  2B3A A;  1GUA B;  4DHJ D;  4FA6 A;  1G6J A;  4BFR A;  2GBM A;  4PS8 A;  4FHJ A;  2V3S A;  3ZW3 A;  3ZNH B;  3R7R A;  3DBS A;  2YVC A;  1WR6 E;  3OJ3 A;  5C23 A;  3WIM A;  2PJH A;  1L7Y A;  4XX5 A;  2XEW A;  1WR1 A;  4ZRK A;  4FAD A;  2RSU A;  4BKT A;  5DCN A;  5JHB A;  4LJO B;  3ZNG C;  3ML9 A;  4DDG D;  3C0R B;  3DBR I;  4TV3 A;  4ANX A;  5BO4 B;  1YIW A;  4AOF A;  3A9J A;  3OJ4 B;  1S1Q B;  2NCN A;  3A4R A;  3IVF A;  3QK0 A;  2EKE C;  4IM0 A;  2KTR A;  3T8M A;  4TKN A;  4CYE A;  4E71 A;  2K25 A;  3VTU A;  1V86 A;  3TIX A;  1S3S G;  2KWU B;  3L54 A;  5JH5 C;  4GXB A;  5G55 A;  2KO3 A;  4YL8 A;  1Z5S B;  1WGY A;  3QIJ A;  3VFK A;  1V5O A;  1WFY A;  2EMS A;  2BKF A;  2ZPN A;  3PHX B;  3A4S C;  1X1M A;  3QX1 A;  3PTF C;  3KVF B;  3QC8 B; 
#chains in the Genus database with same CATH topology
 1QKZ A;  2KDF B;  2V9H A;  2X38 A;  1FFU A;  1FRD A;  1P98 A;  3AE3 B;  1E0Z A;  2EKI A;  1TKE A;  3AB5 A;  2L8J A;  4IWQ A;  1ZXI A;  2LZ6 A;  2M0X A;  4DBG A;  4XE0 A;  1FXI A;  4N6E B;  3IBE A;  4GDL B;  1V8C A;  2VH2 A;  2DX5 B;  2ZVN A;  1QQR A;  2W3R A;  4HDO A;  1RYJ A;  4IG7 B;  1KRH A;  3W5U B;  5TSS A;  2Y3A A;  1MVK A;  2ICI A;  3VXW A;  1ISN A;  2RDG A;  4M8M A;  3VTW A;  1FPY A;  3AED B;  1JWU D;  2IO1 B;  4JPS A;  2QCZ A;  3Q3M C;  2JYE A;  1ZDV A;  3VH3 B;  3GE8 C;  3MC0 B;  3A1Q B;  2L52 A;  4GDK B;  1XQQ A;  2UYZ B;  3VR8 B;  1OQQ A;  2QJL A;  3JVZ X;  3N1Z C;  4D2K A;  4NJC A;  5IA7 A;  2C60 A;  1UWM A;  3QHT A;  5HKH A;  2DZI A;  4ANV A;  4MEM A;  4MH8 A;  1WX9 A;  3QA8 A;  5BMI A;  4AQ7 A;  2J7Q B;  4W9F A;  2W3S A;  3NOB A;  2DZK A;  3ZJU A;  3BIN A;  3HIZ A;  1XXG A;  3MTN B;  3APC A;  4A90 A;  1KLV A;  1M94 A;  4G50 A;  2JYT A;  2L3Z A;  4IKG A;  2KC1 A;  5FKA C;  2RGF A;  3H6N A;  4H2A A;  4HK2 A;  2EMT A;  4PS3 A;  1C76 A;  4J6I A;  1PQS A;  3VHT C;  3IAS 1;  4HLE A;  3ZTD A;  3UQA A;  3FC4 A;  1QF6 A;  3W1Y A;  4C56 C;  4C7Z A;  3KUC B;  1KTK A;  2PMV A;  1TZ1 A;  2VZK D;  2LXC A;  5CHW A;  1CZP A;  1P7E A;  2GMI C;  1FXA A;  3A9K A;  2PEA A;  1NYQ A;  4BAX A;  2MBE A;  5KHQ A;  1KJT A;  1WXS A;  2EEL A;  4NNJ B;  3TBL D;  2BYE A;  5G2N A;  4FLH A;  2WNM A;  4URK A;  1TTN A;  1J7B A;  3ZDT A;  4MJS A;  2WLB A;  3ZKJ C;  4LNI A;  2LGY A;  5CHV C;  4W9E A;  4XGA B;  2G4D B;  4LNF A;  2WX0 A;  3HRD D;  1VR9 A;  3NJT A;  1V49 A;  4OZA A;  3MJ5 A;  2N7D A;  4KGS A;  3SU8 X;  2IYD B;  4G3X B;  3WAL A;  4FJZ A;  1PFD A;  4FUL A;  1PUT A;  5LXH A;  2ZJD A;  2CHX A;  3NS8 A;  4HDQ A;  2KTR B;  1I4G A;  2BKR B;  4R3D A;  1SGH A;  3RNC C;  3DHI C;  3PRZ A;  5HI1 A;  3IAM 1;  1FCC C;  3QJZ A;  5FR6 A;  1ACC A;  2A5U A;  4C4V A;  2MP2 A;  2YEP B;  3K9P B;  2FBW B;  2D3B A;  2V4I B;  4GIV A;  2DAJ A;  2C5L C;  2WGS A;  3H7S A;  5I4D A;  3L08 A;  1IGD A;  3GP7 A;  1H8C A;  1GNU A;  2GB1 A;  3RUI B;  3RNF C;  4KIK B;  5EE0 A;  2KMM A;  4AJW A;  5TR5 A;  1WI0 A;  1CK1 A;  1JRU A;  2XNA C;  2PPH A;  1T6B X;  1C9F A;  3KYC D;  1XLQ A;  1FIQ A;  3PRM B;  4LDT D;  4I6L B;  2CKH B;  3Q2A C;  4BZA A;  3KLS X;  1MFW A;  4A3P A;  2GBK A;  2JX5 A;  2KNB A;  3Q8E A;  4ZRJ A;  3OWE B;  3N20 C;  1OGW A;  1A70 A;  1FNW A;  4JX1 C;  1L5P A;  4I6P A;  3L17 A;  2LVP A;  4RGT A;  1VD2 A;  3QAR A;  2LAS A;  1E7U A;  4XWW A;  2J52 A;  1E8W A;  4MGK E;  5FR3 A;  1JQ4 A;  4KZC A;  1FM0 D;  1FEH A;  2MCN B;  1WE6 A;  4WWP A;  1CJE A;  4JL9 A;  1E10 A;  3RFZ B;  2AL6 A;  1KM7 A;  3QWZ B;  1HTQ A;  3AE9 B;  1TY0 A;  3A1Q A;  1YX6 B;  5DPW A;  4GDK A;  2TSS A;  3QAQ A;  4FJV B;  1Q10 A;  3HM6 X;  3N32 A;  4PT5 A;  4IM2 A;  2NS5 A;  2KFK B;  4WH4 A;  4RGO S;  2LI5 A;  2KC2 A;  1I4R A;  1I4P A;  3HUI A;  3DWG C;  1YN3 A;  4W9D A;  2N9K A;  1HZ6 A;  3Q69 A;  3ZQ4 A;  1IYF A;  1VJK A;  3AE1 B;  1JCK B;  5C1Z A;  4WWM A;  4E74 A;  1CQV A;  1T5X D;  1ZDX A;  3SFE B;  2BYT A;  1WXM A;  2M56 B;  2ONQ A;  2FAZ A;  4IDI A;  2O2V A;  2OJW A;  1DOY A;  3DQV A;  4W9J A;  4YT0 B;  1E90 A;  2AYO B;  2KJ6 A;  5GXG B;  2WXQ A;  1KF6 B;  2N1V A;  1XF5 L;  3AE4 B;  3R7Q A;  3DCG A;  2SAK A;  5E6O A;  3TSS A;  1C77 A;  2BBC A;  4WJN A;  4Q2J A;  4W9K A;  1EF5 A;  3BK1 A;  5DPR A;  4EZL A;  4HRS A;  2KQS A;  2G1E A;  3NRZ A;  1C79 A;  1B1Z A;  2WDT B;  1FXT B;  1ZXH A;  1BML C;  1HE8 A;  1WZ3 A;  2OHF A;  2WDV B;  4ZRQ A;  3V60 A;  1JWS D;  4M8N A;  3VRB B;  3W2D A;  1LFD A;  2KXJ A;  2KDM A;  1SE9 A;  2K39 A;  3V6C B;  4KSK C;  1FD6 A;  2MLB A;  3SDL C;  2LUE A;  3ZLZ A;  3W5V B;  3TEY A;  2BPS A;  3IFW B;  1ZGU B;  2K8H A;  1CMX B;  3P4Q B;  4WAA A;  2ZNV B;  3DWM A;  2PE6 B;  4CO7 A;  1OTR B;  2WXL A;  5IO9 A;  4DHJ D;  4FA6 A;  5AUI A;  4QAY A;  4BFR A;  2GBM A;  4PS8 A;  2V3S A;  3ZNH B;  2XN9 C;  4C80 A;  4TMA B;  2AQ2 B;  3OJ3 A;  3WIM A;  2PJH A;  3Q8F A;  3L4P A;  4YTN B;  5DCN A;  3ZNG C;  3ML9 A;  1RWS A;  3DBR I;  4TV3 A;  4AOF A;  2NCN A;  3A4R A;  4WAF A;  3T8M A;  4IM0 A;  2KTR A;  4CYE A;  3VTU A;  1S3S G;  5JH5 C;  3U7Z A;  4GXB A;  4YL8 A;  2RDH A;  1X1M A;  3QX1 A;  3B2G A;  1YNT E;  1YD8 U;  1K8R B;  3X23 A;  3TUO A;  2DZM A;  4MGI E;  1TYG B;  1E5W A;  2NBW B;  1QOA A;  2MA9 B;  4WWO A;  4IOI E;  1SIF A;  4WQM A;  3T3O A;  2KOX A;  1L6V A;  1C78 A;  4JE3 B;  2RMM A;  2XK5 A;  2LRU A;  1T0R C;  4USA A;  2N7J A;  2FID A;  3DHH C;  1FRR A;  3SEB A;  3FAH A;  3PGE A;  3APD A;  2V0G A;  2KK8 A;  1I42 A;  1LGR A;  2WXH A;  3ZXV A;  2JU6 X;  2R2Q A;  3B1L X;  1UD7 A;  3GS2 A;  2OJR A;  2LJI A;  3ZTC A;  5DPT A;  2NVU I;  1JML A;  3B08 A;  2ACZ B;  3KWV A;  2FCN A;  4DXF A;  2J0K A;  1YJJ A;  3NVZ A;  2C7N B;  2MQJ A;  2N9P C;  2BGF A;  2ZW1 A;  3JSV B;  1UEL A;  4HJG E;  2VZK B;  3AE8 B;  3VUY A;  2ASQ A;  2AWT A;  4TUU A;  3ZXR A;  2N7E A;  4UDU C;  3ZYY X;  4FN2 A;  1YJI A;  4OVZ A;  2YEP F;  4OHJ A;  1N60 A;  2JZ3 B;  3KWL A;  1LO5 D;  1V5T A;  4ZHP A;  3LB8 C;  1RLF A;  1D5X C;  4FXC A;  3U2S C;  4EUT A;  1XCQ L;  5BYS A;  2WQY B;  2MHJ A;  2GRI A;  1IP9 A;  1UGM A;  2A4Z A;  1YJ1 A;  2KAJ A;  4IWO A;  4N59 A;  1VZ7 A;  4HXD A;  1F77 A;  4MGY E;  1EU4 A;  2MBO A;  3N9Y C;  4L2Y A;  2PE9 A;  1IBX A;  5E6N A;  2K3U A;  4GMV A;  3SFD B;  3AEC B;  2WXJ A;  4ZHO A;  2J0J A;  2SEB D;  1V80 A;  4DHZ E;  2RPV A;  4KVG B;  4A9A A;  3R3M A;  2CU3 A;  1DOI A;  5GMV A;  1V81 A;  5AZG A;  4A3O A;  4KGR A;  1N5X A;  1UZX B;  4MM3 B;  2WS3 B;  3PV1 A;  2L32 A;  3NVW A;  4X57 B;  2BT6 A;  2WDR B;  4NPN A;  1H4R A;  4RMA A;  2LD9 A;  2WXN A;  2JVC A;  1E8Z A;  1Y56 A;  2LVQ A;  4ZYN A;  4EE2 A;  3Q8B A;  2DWQ A;  4BVU C;  3V61 A;  2GBN A;  3EFU A;  1ZW7 A;  3KH0 A;  1WXV A;  2UU7 A;  4EFO A;  3V3X A;  2PIA A;  1MPE A;  4KGT A;  3PZD A;  2WU2 B;  4F8C B;  3RMK C;  2O6V A;  5HHD G;  3DBH B;  4HCN B;  1YMH E;  2ZVO A;  1C4A A;  1STE A;  3KUD B;  2NPT B;  2FIF A;  1J7A A;  3ZDM C;  5LNK 1;  4OVU A;  2INN E;  1QOF A;  4NAM A;  4DQO C;  4II2 B;  3Q3N C;  1SF0 A;  1KLU D;  4GB9 A;  3HM3 A;  2Z0E B;  2M4N A;  2I2Y A;  2D3C A;  1WYW B;  4OZB A;  2RD0 A;  2KAN A;  4US9 A;  2QHO A;  1KOT A;  1UWX A;  1TS3 A;  3TL5 A;  1VRA B;  3N3K B;  1WGK A;  3SHQ A;  4LLG M;  5J18 A;  2REX A;  1EWY C;  3HK0 A;  2I38 A;  3L0W B;  3PZ8 A;  2DEN B;  2DYO A;  3K9O B;  5E6P A;  2KFJ A;  3BII D;  3LDZ E;  4G11 A;  1J0G A;  2HJ8 A;  1UBQ A;  4HPP A;  1P1A A;  3RNB C;  3Q8A A;  1HXY D;  1GC6 A;  1HQR D;  2WP9 B;  1N6Z A;  4EZJ A;  1WY8 A;  1HEZ E;  4K3B A;  4KX6 B;  3IG3 A;  4E3C A;  1WJ4 A;  4CQN A;  2CHW A;  4I6N B;  2NBU A;  3N1X C;  5EE3 A;  1J7C A;  4P7I A;  4XDC A;  4IC7 B;  5AZF A;  2CHZ A;  2JPH A;  1L0V B;  1UGJ A;  4OVV A;  3BVM A;  4IW0 A;  2JZZ A;  3AEG B;  2FE8 A;  3PHW B;  2J4X A;  3QCA A;  2RDB C;  3VUX A;  4KDL B;  2HTH A;  4C7Y A;  4KKJ A;  1WH3 A;  5G5H A;  3ZRF A;  4OZC A;  4ACF A;  3P4S B;  3T9L A;  2LRW A;  1WYG A;  1C3T A;  2MW5 A;  1P7F A;  2KKC A;  3O13 A;  3LXF A;  3DVN U;  1QLB B;  3BYT B;  4K7U A;  1K50 A;  1UNS A;  3ONS A;  4MT5 A;  3WCQ A;  4GOC A;  2MJE A;  1WXA A;  1SE3 A;  2FCQ A;  2IO2 B;  2QEJ C;  2I1K A;  4YTP B;  1V1O A;  3VAW A;  2PTL A;  3NZU A;  4EEW A;  5AZH A;  1J8C A;  1V1P B;  3PVL A;  1SBB B;  4IM3 A;  2IY1 B;  5IP4 D;  3Q6B A;  1F0Z A;  2WHI A;  2IO3 B;  3PPA A;  2Z0D B;  3RCZ A;  2K6Q A;  5IN7 A;  3PLV A;  2KHW B;  4RM8 A;  1SE2 A;  1WGG A;  2PKO A;  4BKG A;  4ICU A;  5IOI A;  4G0N B;  1NEN B;  1TJE A;  1YOV B;  3DDC B;  2FCS A;  4JWU C;  2C7M B;  1P0R A;  2K8C A;  3ZGZ A;  3VDZ A;  4B0E A;  3PLU A;  1MHX A;  1C4C A;  4AWJ A;  1IPG A;  2UWQ A;  1T0Y A;  1VZ8 A;  4KV2 A;  1NI3 A;  2IJ0 A;  4US8 A;  4BBN F;  2BYF A;  2MJ3 A;  4MM3 A;  4NAW B;  2DNF A;  2CU1 A;  2K8B A;  2LWP A;  2AL3 A;  2PVG C;  1FMA D;  4K1R B;  3DOW A;  2KVZ A;  4GDL A;  3J9C A;  1N5W A;  3ZW3 A;  3DBS A;  2GI9 A;  4YTM B;  1KFY B;  4A8X C;  1WR1 A;  1DOX A;  4YXD B;  2RSU A;  4BKT A;  5JHB A;  1F2R I;  4DDG D;  3C0R B;  2Y5P A;  5BO4 B;  4C00 A;  1L0X B;  2INP E;  3OJ4 B;  4A55 A;  3NVY A;  4XWT A;  1QIL A;  1T0S C;  4TKN A;  2QIL A;  2K25 A;  1V86 A;  2J53 A;  2KWU B;  2WXR A;  4HKQ A;  3A4S C;  3PTF C;  1GOZ A;  1L6U A;  3NS1 A;  1L0Y B;  1EUV B;  2L00 B;  2ZEQ A;  2NMQ A;  4K81 A;  1UBI A;  1TZO A;  3ZO5 B;  4N58 A;  3JW0 X;  1NBF C;  2KMA A;  1BUI C;  3N1Y C;  2V1Y A;  1P3Q U;  1V2Y A;  2L1A A;  1T3Q A;  2HDE A;  3OAW A;  1RAX A;  2BS2 B;  2W54 A;  1V97 A;  2NBV B;  2Y5C A;  2J0M A;  2GBR A;  2BB5 A;  1XLP A;  2LGX A;  4B95 A;  1GJZ A;  3NY5 A;  2D10 A;  3V6E B;  1SJH D;  3I63 C;  2QSD A;  2DYM A;  3Q8C A;  5DPS A;  3RNA C;  3DPD A;  1FNV A;  3TCA A;  3RZW C;  3GZN B;  3SR6 A;  5L95 C;  2Z59 B;  3E56 A;  1YQ3 B;  2BB6 A;  5J17 A;  1Q5W B;  2MX2 A;  4TQ0 A;  3W1S A;  1GPX A;  1OEY A;  4MAC A;  4MSM B;  1ET6 A;  3KUZ A;  2H89 B;  2CS4 A;  3MP9 A;  3W1S C;  1TS2 A;  3VTV A;  4PYZ A;  4XC2 A;  1R4M B;  4DHZ B;  3Q3J A;  3MJW A;  1N61 A;  2Q5W D;  1EM7 A;  5EDS A;  3C8Y A;  1P9D U;  1MG4 A;  4JWS C;  1WSP A;  2IBI B;  4WJP A;  4N9F 4;  4F1S A;  3N30 A;  2KLC A;  4B9K A;  1KLG D;  3U8Z A;  2W82 A;  4FHK A;  3AXC A;  3I3T B;  1WIA A;  1WE7 A;  3AM9 A;  1WRD B;  5T8I A;  2WX1 A;  2MH7 A;  4OW0 A;  3I5J C;  1V1P A;  4ZOH C;  3UI3 A;  2LVO A;  4EKU A;  2KT7 A;  2WXM A;  2E6X A;  1TS4 A;  4K7S A;  2I1J A;  4ARC A;  2MBH A;  3AMZ A;  2LEK A;  3I57 A;  1MG8 A;  4LTU A;  4KIK A;  3V05 A;  2M1M A;  4K3C A;  2B76 B;  2JWU A;  3SD5 A;  2LXA A;  2HTM E;  4M01 A;  1VCB A;  2ZCB A;  3NZ3 A;  2MBQ A;  2ZPY A;  4GN1 A;  3KYD D;  4L1B A;  3LJ3 A;  1JRO A;  4ANW A;  1L4Z B;  2R2O A;  2LGS A;  3P4R B;  3TMP B;  2WYQ A;  4YWG G;  2K22 A;  2GBJ A;  3AU5 A;  4GGQ A;  3A9K B;  4DK5 A;  2GOW A;  3O65 B;  1YQ4 B;  3AU4 A;  4NAW A;  3U52 E;  4IUM B;  4O1N A;  1JAL A;  1WJN A;  1AAR A;  4W9C A;  1XLO A;  2WXG A;  2KX3 A;  1TS5 A;  4MJS B;  2JF5 A;  3BZD B;  1SEB D;  3Q14 C;  5CHF A;  3UIN B;  2IY0 B;  3ZUN A;  1WJ6 A;  3E9S A;  1ROE A;  2K5P A;  2FCM A;  4BKS A;  2OED A;  2IZV B;  4W9I A;  2JXX A;  4FBJ B;  4P1B C;  5HFY A;  5HG2 A;  1YN5 A;  3OG5 A;  4W9H A;  2RR9 A;  3DBH I;  3BY4 B;  2QMT A;  1R4N B;  5D6J B;  4XZ4 A;  4BOS C;  1A5R A;  2MJD A;  3HVD A;  4EZK A;  2DAF A;  1QOB A;  4S17 A;  2KFK A;  1E7V A;  1TKY A;  1DGJ A;  2N1W A;  3U7D A;  2M8S A;  2KQ7 A;  2MWS B;  2KN5 A;  1HA5 A;  3ECI A;  1EWC A;  3RZF A;  5LXI B;  3URY A;  3U30 A;  3EC8 A;  4C4V B;  1JW9 D;  2MP2 B;  2MBB B;  2H88 B;  4DXG A;  3EEC A;  4W9L A;  2KZR A;  3EUB 2;  4AP4 C;  1RRB A;  3ZRC A;  2KX0 A;  3PS6 A;  2KVR A;  2O6V D;  1EF1 A;  2KDB A;  4HKZ E;  3ETR A;  3B2F A;  2VRR B;  3RI7 C;  3HHM A;  3UGB B;  3RUL A;  2D3A A;  3OLM D;  1GC7 A;  1U4A A;  1FCL A;  3ML8 A;  3WAN A;  3DHG C;  1ZE3 D;  4RNA A;  5E6J A;  1AW7 A;  4JIO U;  4LCD E;  1Y8R C;  3MHZ A;  2ZZP B;  2JSV X;  4WJQ A;  5BMH A;  2BS3 B;  1XO3 A;  1WRI A;  1OEY J;  4ICV A;  3WAM A;  2NTT A;  3P1M A;  3VRA B;  2L83 A;  2ZCC A;  1F2R C;  2N9X A;  1VDV A;  3R66 C;  3AI5 A;  5JZE B;  2D3G A;  2KD0 A;  1ZUD 2;  4ITK A;  4B6W A;  1I4Q A;  1NYR A;  2HJ1 A;  4AUQ C;  4WQO B;  1M4V A;  3PO0 A;  2QIE B;  2LUM A;  2FNJ B;  2L76 A;  3L16 A;  3NVV A;  4LDT B;  1F1H A;  5G5G A;  2CJO A;  2ZNV C;  1F52 A;  2LGD A;  2MSE D;  3AEF B;  1WGD A;  1V6E A;  1BT0 A;  2BWF A;  3PT2 B;  4JGH B;  1NDD A;  1FO4 A;  3RNE C;  3IXS A;  2KWV B;  2K0P A;  1OQY A;  1Z2M A;  3AEE B;  2KDI A;  4MGZ E;  3ZJT A;  2LHD A;  1NI2 A;  2N4F A;  2VH1 A;  3TEW A;  3BWU D;  2GLS A;  1ZOY B;  4GSW A;  1UUP A;  3TEX A;  3PRP B;  4WUR A;  1WM3 A;  1WX7 A;  2BWE S;  3CMM B;  1I4H A;  1E8X A;  3EFC A;  1WGR A;  2N9L A;  2AQ1 B;  2LHE A;  3AE5 B;  1K53 A;  4ARI A;  1TY2 A;  3AE7 B;  4NQK E;  2V4L A;  2KJH B;  2YLM A;  3IHP C;  4WJO A;  1UH6 A;  2NR2 A;  1BXT A;  2O2V B;  2HE7 A;  2G3Q B;  4WWN A;  2Y5B B;  4MDK E;  5CX3 A;  3AEA B;  3FIL B;  2B3A A;  1GUA B;  1OQR A;  2Z8L A;  3MC8 A;  1G6J A;  1C4P A;  2WXO A;  3R7R A;  2YVC A;  1WR6 E;  3ABV B;  1L7Y A;  2XEW A;  3ZJV A;  4LNO A;  1NEK B;  1QOG A;  1S1Q B;  3VR9 B;  4LK0 M;  3IVF A;  2EKE C;  4RGM A;  1OFF A;  4E71 A;  2BTE A;  1D5Z C;  3L54 A;  1L4D B;  3Q3O C;  1I7H A;  1WGY A;  2EMS A;  2BKF A;  2V3N A;  2ZPN A;  3PHX B;  2M0A A;  3KVF B;  5BMG A;  3GB1 A;  2J42 A;  4BBN C;  1YN4 A;  5J2R A;  2KJR A;  5H8Y E;  5C3J B;  3HVZ A;  3TEZ A;  5FK9 C;  4HPL B;  3JSV A;  4HWI B;  1F9J A;  4RCO A;  2BVC A;  3EA6 A;  3L13 A;  4NQL B;  2IGG A;  3PSE B;  2KLG A;  1LXD A;  5L83 A;  4NJ6 A;  2HD5 B;  3P2B A;  1J19 A;  1TBE A;  3RYT A;  3AUL A;  1HZ5 A;  4AJY B;  1Q0W B;  3T3N A;  2AX5 A;  2C9W B;  5D7G A;  1WZ0 A;  1GAQ B;  2C7H A;  3RD2 A;  2D5G A;  4YSX B;  4P1C C;  1UF0 A;  4J3O D;  3M63 B;  3WA0 A;  2L7R A;  4M00 A;  1Q1O A;  2IPK D;  4MSQ B;  3TJP A;  1D5M C;  2KMC A;  2WXF A;  3Q3F A;  5JHA A;  5IKC M;  4DHJ B;  1N62 A;  2FUG 1;  2BYV E;  4B0M A;  1RFA A;  5D2M B;  4DWF A;  1KH0 A;  3P4P B;  1WM2 A;  1PGB A;  1EO6 A;  4REZ A;  1WJU A;  4TQ1 A;  4YSZ B;  3H8H A;  1XCT L;  1SSN A;  2LJ5 A;  1AN8 A;  2L0F A;  3GOE A;  3CIR B;  1C1Y B;  3GE3 C;  5D94 A;  2XK5 B;  1PGA A;  1D3Z A;  3DBL I;  4M02 A;  3APF A;  2QC8 A;  3WAP A;  2D11 A;  4RM9 A;  2JRI B;  4CHK A;  2IGD A;  3H7P B;  3BK2 A;  3EHV A;  1SB3 C;  3GZN I;  4II3 B;  1NVI D;  1VLB A;  2KWC A;  4HEA 1;  4RF0 A;  3VUW A;  3ZIM A;  1IUE A;  3IT4 B;  2IND C;  5D3D A;  2NPT A;  1MI0 A;  5H92 C;  3R2I A;  4A20 A;  1JWA D;  3R8B A;  1RM6 C;  1WMH B;  5LLI A;  1FFV A;  1SJE D;  1IGC A;  4HJK A;  1PYW D;  1E8Y A;  2M17 A;  1R4M I;  1GG3 A;  4S0R A;  1AYF A;  4MH0 E;  4P16 A;  1JWM D;  3IT6 B;  1XLN A;  2E3T A;  2BW2 A;  2XBB C;  3PRE A;  3ZNI D;  3M95 A;  2PW9 A;  1QZE A;  2IO0 B;  2V3P A;  3P42 A;  3UIP B;  3AE2 B;  4HPM B;  3BVG A;  1I4X A;  3MFG A;  2KTF A;  4ANU A;  2OOB B;  4ZRP A;  2FUH B;  3CWI A;  3UQB A;  2JZP A;  3EGR A;  2BQQ A;  2DHZ A;  3CST A;  4K7W A;  1K52 A;  3A9J B;  3UIO B;  3NUH B;  4M0W B;  5IAA C;  3S2A A;  3ZVV A;  2JQR B;  3WAO A;  3H1U A;  2ON8 A;  3VH4 B;  4DXA B;  1IBX B;  4NJ7 A;  1ENF A;  3DBL B;  2MEK A;  3M62 B;  1N63 A;  4HVB A;  3FIL A;  1R7S A;  5JXV A;  3CSF A;  1ZPS A;  3X0W A;  5AEK B;  1QT9 A;  1RFK A;  3BYY B;  5BYQ A;  3H9D A;  3NG0 A;  2JY6 A;  1K51 A;  2NTS A;  4P6V F;  2LMC A;  1MHH E;  3UF8 A;  2CR5 A;  2WXK A;  2RPQ A;  2N9E B;  1XEE A;  3JYU A;  3RNG C;  2L0T A;  1WXQ A;  3CF6 E;  2D07 B;  2PLP A;  1GB4 A;  1LQB A;  4KDI C;  1E9M A;  3NZS A;  3ALB A;  2INC C;  1I35 A;  2KYW A;  1XD3 B;  4KSL C;  4LJP B;  2O6V B;  4PYU A;  4AS1 A;  1WF9 A;  2PVO D;  4MEL A;  4W9G A;  3AEB B;  4ASW C;  3AH7 A;  5KHO A;  3ENE A;  3RT3 B;  1ET9 A;  1FNU A;  4TSS A;  3VVW B;  2WWZ A;  2X8X X;  4BOZ B;  1YX5 B;  3NHE B;  4KKI A;  3AE6 B;  4PK1 A;  2IGH A;  1SXT A;  1PDX A;  3I9V 1;  4L23 A;  2W55 A;  3L10 B;  2JWZ A;  4F7Z A;  1XT9 B;  1ZP0 B;  5BYR A;  3P63 A;  2WU5 B;  1E7P B;  1R4N I;  5EE9 A;  2BF8 B;  2KN4 A;  3KW5 B;  3C19 A;  2KQ4 X;  3M3J A;  1TIF A;  2G9H D;  3VQI A;  4RF1 A;  2JT4 B;  5EE1 A;  1E6E B;  3V62 A;  4XYC A;  2WDQ B;  4A6Q A;  1WWT A;  1L2N A;  1WX8 A;  2WXI A;  3FKY A;  3AV8 A;  2LFI A;  2MRP A;  4RFB A;  1TT5 B;  4BKS D;  4KZ0 A;  4ZYS A;  4YSY B;  4JLC A;  2R61 A;  4GLS C;  4LNK A;  3W9C B;  1T0Q C;  1VZ6 A;  4GU2 A;  4FJY A;  2M19 A;  2W9N A;  4NY0 A;  4JQW C;  2QDF A;  2KWD A;  3A33 B;  3DVG Y;  4PS7 A;  3RN9 C;  5D3I B;  2D2Q A;  2G4S A;  5CTR C;  1V9J A;  4HRO A;  4EOY A;  3D32 A;  2BS4 B;  4RH6 A;  1D4B A;  2KDE B;  2K6D B;  2DLB A;  4XDD A;  1D6E C;  1ZKH A;  3KQ4 A;  4RGN A;  1TKG A;  1SIJ A;  3ZNZ B;  3QQ8 B;  2L05 A;  3H7P A;  3AN1 A;  2JRH A;  5AUK A;  2AEH A;  1GB1 A;  5MPO A;  4HCP B;  2JXT A;  2DZJ A;  1YQB A;  2WXP A;  2DBY A;  3MHS D;  2JUO A;  1PGX A;  2K1F A;  3DBR B;  1ESF A;  1WMH A;  2AQ3 B;  2KAC A;  2K9X A;  1WGH A;  1EU3 A;  4DDI D;  3DVN V;  1DYQ A;  3R2T A;  1B9R A;  2G45 B;  4ZDV A;  3MC9 A;  4IWP A;  1AWD A;  1LM8 B;  3B0A A;  1TGZ B;  2DYB A;  3PZ7 A;  4ZRI A;  3DVG X;  3BVZ A;  3RPF C;  4FHJ A;  5C2T B;  1MJD A;  2CJN A;  5C23 A;  3LYY A;  4XX5 A;  4ZRK A;  4WIP A;  4FAD A;  2N0S B;  4LJO B;  4LNN A;  2IDY A;  3U4E G;  4ANX A;  1YIW A;  3A9J A;  4M0W A;  3QK0 A;  3B9J A;  2ZW0 A;  3TIX A;  4NZL B;  5G55 A;  2KO3 A;  1HTO A;  1SE4 A;  1JWB D;  2LGI A;  1Z5S B;  3QIJ A;  3VFK A;  1V5O A;  1JRP A;  1WFY A;  3QC8 B; 
#chains in the Genus database with same CATH homology
 2KDF B;  4BBN C;  5J2R A;  1YD8 U;  1EUV B;  1K8R B;  2L00 B;  2ZEQ A;  4K81 A;  3X23 A;  1P98 A;  1UBI A;  2KJR A;  2DZM A;  4MGI E;  1E5W A;  2L8J A;  2NBW B;  4IWQ A;  3ZO5 B;  3JW0 X;  1NBF C;  2LZ6 A;  2M0X A;  4DBG A;  2KMA A;  4HPL B;  2MA9 B;  4WWO A;  3JSV A;  4HWI B;  2V1Y A;  1P3Q U;  1SIF A;  1F9J A;  1V2Y A;  3IBE A;  3L13 A;  4GDL B;  3OAW A;  1RAX A;  4NQL B;  2KOX A;  2DX5 B;  2ZVN A;  3PSE B;  2KLG A;  2NBV B;  1LXD A;  2J0M A;  2GBR A;  2XK5 A;  2LRU A;  4HDO A;  5L83 A;  4NJ6 A;  2HD5 B;  4IG7 B;  2LGX A;  3P2B A;  1J19 A;  1TBE A;  4B95 A;  2FID A;  1GJZ A;  3NY5 A;  3RYT A;  2D10 A;  3V6E B;  3AUL A;  3VXW A;  1ISN A;  4M8M A;  4AJY B;  3VTW A;  1Q0W B;  3PGE A;  2C9W B;  2IO1 B;  3APD A;  5D7G A;  1WZ0 A;  2KK8 A;  2C7H A;  1I42 A;  3RD2 A;  3VH3 B;  3A1Q B;  2DYM A;  4GDK B;  3B1L X;  2R2Q A;  1XQQ A;  1UD7 A;  2UYZ B;  3M63 B;  5DPS A;  3WA0 A;  2OJR A;  2L7R A;  3ZTC A;  1Q1O A;  3JVZ X;  3DPD A;  4MSQ B;  5DPT A;  3TJP A;  3TCA A;  2NVU I;  3RZW C;  5IA7 A;  2C60 A;  2KMC A;  3Q3F A;  3QHT A;  5HKH A;  5JHA A;  2DZI A;  4ANV A;  5L95 C;  2Z59 B;  3B08 A;  4MEM A;  4DHJ B;  2BYV E;  2FCN A;  1WX9 A;  1RFA A;  5D2M B;  3QA8 A;  2J0K A;  2J7Q B;  2C7N B;  4W9F A;  2MQJ A;  2N9P C;  4DWF A;  5J17 A;  3NOB A;  2BGF A;  2DZK A;  1WM2 A;  1EO6 A;  1Q5W B;  3JSV B;  3BIN A;  3HIZ A;  1WJU A;  2MX2 A;  4TQ0 A;  1UEL A;  3MTN B;  4TQ1 A;  3W1S A;  3APC A;  3VUY A;  1KLV A;  1M94 A;  4G50 A;  1OEY A;  2ASQ A;  2LJ5 A;  2AWT A;  2L3Z A;  4MSM B;  4TUU A;  2KC1 A;  2L0F A;  2N7E A;  3GOE A;  3KUZ A;  2RGF A;  2CS4 A;  3H6N A;  3W1S C;  4FN2 A;  3VTV A;  1C1Y B;  4HK2 A;  4PYZ A;  2EMT A;  4XC2 A;  4PS3 A;  5D94 A;  2JZ3 B;  4DHZ B;  2XK5 B;  4J6I A;  3Q3J A;  3MJW A;  1PQS A;  1V5T A;  1RLF A;  3VHT C;  4HLE A;  1D3Z A;  5EDS A;  3DBL I;  3ZTD A;  3UQA A;  4EUT A;  3W1Y A;  1P9D U;  3APF A;  3WAP A;  2D11 A;  3KUC B;  4RM9 A;  2JRI B;  2IBI B;  3H7P B;  4CHK A;  3EHV A;  4WJP A;  1TZ1 A;  4N9F 4;  3GZN I;  4II3 B;  2LXC A;  1IP9 A;  1UGM A;  2KWC A;  3VUW A;  3ZIM A;  5CHW A;  4F1S A;  2A4Z A;  1YJ1 A;  4IWO A;  4HXD A;  2GMI C;  3N30 A;  2KLC A;  4B9K A;  3U8Z A;  2NPT A;  3A9K A;  4FHK A;  3AXC A;  4MGY E;  2MBO A;  2PEA A;  3I3T B;  1WIA A;  1WE7 A;  2MBE A;  5KHQ A;  1KJT A;  1WXS A;  2PE9 A;  4A20 A;  4NNJ B;  1WRD B;  3TBL D;  5E6N A;  1WMH B;  2WX1 A;  2BYE A;  4GMV A;  5G2N A;  4FLH A;  5LLI A;  4HJK A;  1E8Y A;  2M17 A;  2J0J A;  2LVO A;  4EKU A;  4URK A;  1R4M I;  1TTN A;  1GG3 A;  1V80 A;  4DHZ E;  4KVG B;  4MH0 E;  4K7S A;  3R3M A;  4MJS A;  3ZDT A;  2I1J A;  5GMV A;  1V81 A;  2MBH A;  3ZKJ C;  2LGY A;  5AZG A;  5CHV C;  4A3O A;  1MG8 A;  4W9E A;  1UZX B;  2XBB C;  2G4D B;  3PV1 A;  4KIK A;  2WX0 A;  3PRE A;  3ZNI D;  4X57 B;  3M95 A;  4NPN A;  2M1M A;  1H4R A;  4RMA A;  3SD5 A;  2LD9 A;  2LXA A;  2JVC A;  1V49 A;  1E8Z A;  2LVQ A;  4ZYN A;  1QZE A;  2IO0 B;  1VCB A;  3UIP B;  2ZCB A;  2N7D A;  2MBQ A;  3SU8 X;  4HPM B;  2IYD B;  4G3X B;  3V61 A;  2GBN A;  4BVU C;  3EFU A;  2ZPY A;  1ZW7 A;  3WAL A;  3KH0 A;  3KYD D;  4FJZ A;  1WXV A;  4GN1 A;  2KTF A;  4EFO A;  3LJ3 A;  4FUL A;  4ANU A;  4ANW A;  2OOB B;  2R2O A;  2FUH B;  3PZD A;  3UQB A;  4F8C B;  3TMP B;  2DHZ A;  4K7W A;  3CST A;  5LXH A;  2O6V A;  2ZJD A;  4HCN B;  2CHX A;  2WYQ A;  2ZVO A;  3A9J B;  3NS8 A;  3UIO B;  2GBJ A;  4HDQ A;  3AU5 A;  4GGQ A;  4M0W B;  3KUD B;  5IAA C;  2NPT B;  3A9K B;  2KTR B;  3S2A A;  3ZVV A;  2FIF A;  4DK5 A;  3ZDM C;  2GOW A;  3O65 B;  2BKR B;  4OVU A;  3WAO A;  3H1U A;  1SGH A;  4II2 B;  3VH4 B;  3PRZ A;  3AU4 A;  4NAW A;  4NJ7 A;  4DXA B;  4IUM B;  4GB9 A;  3HM3 A;  2Z0E B;  2M4N A;  3M62 B;  4HVB A;  3QJZ A;  5FR6 A;  2A5U A;  2MP2 A;  1WYW B;  1WJN A;  2RD0 A;  1AAR A;  2KAN A;  4W9C A;  3K9P B;  2QHO A;  1KOT A;  4GIV A;  3CSF A;  2DAJ A;  2KX3 A;  4MJS B;  3X0W A;  2JF5 A;  2C5L C;  5AEK B;  3TL5 A;  3H7S A;  5CHF A;  3UIN B;  3N3K B;  2IY0 B;  3SHQ A;  3ZUN A;  3L08 A;  1WJ6 A;  3H9D A;  5J18 A;  2REX A;  1GNU A;  1H8C A;  3RUI B;  2JY6 A;  2FCM A;  4BKS A;  3HK0 A;  2IZV B;  4KIK B;  3L0W B;  4W9I A;  2JXX A;  4AJW A;  5TR5 A;  1WI0 A;  2DEN B;  2DYO A;  3K9O B;  4FBJ B;  5E6P A;  2KFJ A;  3LDZ E;  3UF8 A;  2CR5 A;  2RPQ A;  2N9E B;  1JRU A;  4G11 A;  4W9H A;  2PPH A;  1J0G A;  2RR9 A;  3KYC D;  3DBH I;  3JYU A;  2HJ8 A;  1UBQ A;  3BY4 B;  1P1A A;  3PRM B;  2L0T A;  5D6J B;  4XZ4 A;  4BOS C;  3CF6 E;  1A5R A;  2D07 B;  4LDT D;  4EZK A;  1GC6 A;  4I6L B;  2CKH B;  1LQB A;  2DAF A;  4KDI C;  3NZS A;  3ALB A;  1I35 A;  1XD3 B;  4KSL C;  2KFK A;  4LJP B;  1E7V A;  2O6V B;  4A3P A;  4PYU A;  2N1W A;  2GBK A;  3U7D A;  4EZJ A;  2M8S A;  2KQ7 A;  2KNB A;  1WF9 A;  2MWS B;  4ZRJ A;  2KN5 A;  4MEL A;  1OGW A;  4W9G A;  1WY8 A;  3ECI A;  4ASW C;  3RZF A;  4I6P A;  3L17 A;  5LXI B;  2LVP A;  5KHO A;  3ENE A;  3U30 A;  3IG3 A;  1VD2 A;  1WJ4 A;  3EC8 A;  3QAR A;  3RT3 B;  4E3C A;  2LAS A;  2CHW A;  2MP2 B;  4I6N B;  2MBB B;  1E7U A;  3VVW B;  4BOZ B;  2NBU A;  2WWZ A;  1YX5 B;  3NHE B;  3EEC A;  4P7I A;  4W9L A;  2KZR A;  4IC7 B;  5AZF A;  2CHZ A;  1E8W A;  2JPH A;  4AP4 C;  3L10 B;  4MGK E;  1RRB A;  3ZRC A;  2JWZ A;  4OVV A;  2KX0 A;  4F7Z A;  1XT9 B;  3PS6 A;  2KVR A;  2O6V D;  4IW0 A;  1EF1 A;  2KDB A;  4KZC A;  2JZZ A;  2MCN B;  3PHW B;  1R4N I;  1WE6 A;  2BF8 B;  4WWP A;  3KW5 B;  2VRR B;  3HHM A;  3UGB B;  3QCA A;  3M3J A;  4JL9 A;  2AL6 A;  1KM7 A;  3RUL A;  3VUX A;  3VQI A;  3QWZ B;  4KDL B;  3OLM D;  2JT4 B;  1GC7 A;  1U4A A;  2HTH A;  3V62 A;  3A1Q A;  3ML8 A;  3WAN A;  1WH3 A;  1YX6 B;  5DPW A;  4GDK A;  3QAQ A;  3ZRF A;  4FJV B;  3HM6 X;  3N32 A;  1L2N A;  1WX8 A;  4IM2 A;  4JIO U;  3T9L A;  2MRP A;  2NS5 A;  2KFK B;  2LRW A;  4LCD E;  1Y8R C;  2LI5 A;  2ZZP B;  2KC2 A;  4WJQ A;  4KZ0 A;  4BKS D;  1C3T A;  2MW5 A;  4JLC A;  2KKC A;  1OEY J;  4ICV A;  3WAM A;  3DVN U;  4W9D A;  2ZCC A;  4K7U A;  2N9X A;  3R66 C;  4GU2 A;  1IYF A;  3AI5 A;  4FJY A;  5JZE B;  3ONS A;  5C1Z A;  4E74 A;  4GOC A;  2W9N A;  4NY0 A;  2D3G A;  2KD0 A;  4JQW C;  3A33 B;  3DVG Y;  4PS7 A;  1WXA A;  2D2Q A;  1WXM A;  2G4S A;  1V9J A;  5CTR C;  4B6W A;  2FAZ A;  2O2V A;  2FCQ A;  2IO2 B;  4AUQ C;  4EOY A;  4WQO B;  2I1K A;  3VAW A;  3DQV A;  4W9J A;  3D32 A;  3NZU A;  4EEW A;  1E90 A;  2AYO B;  5AZH A;  2KJ6 A;  1J8C A;  2FNJ B;  2KDE B;  2L76 A;  3L16 A;  3PVL A;  2N1V A;  2K6D B;  4LDT B;  3R7Q A;  2ZNV C;  3DCG A;  4IM3 A;  2IY1 B;  2MSE D;  2LGD A;  1ZKH A;  1WGD A;  1V6E A;  1BT0 A;  5E6O A;  2BWF A;  3PT2 B;  3QQ8 B;  2L05 A;  3ZNZ B;  2IO3 B;  3H7P A;  3PPA A;  4JGH B;  4WJN A;  2Z0D B;  1NDD A;  3RCZ A;  2K6Q A;  3PLV A;  4W9K A;  1EF5 A;  2KHW B;  5DPR A;  2KWV B;  4RM8 A;  1WGG A;  1OQY A;  4EZL A;  1Z2M A;  4BKG A;  4ICU A;  2JRH A;  2KDI A;  4G0N B;  2AEH A;  2KQS A;  4HCP B;  4MGZ E;  3DDC B;  1NI2 A;  2FCS A;  2N4F A;  2DZJ A;  1YQB A;  2WDT B;  1FXT B;  2C7M B;  4GSW A;  1HE8 A;  3MHS D;  1WZ3 A;  1P0R A;  3V60 A;  2JUO A;  4M8N A;  2K8C A;  2K1F A;  3PRP B;  1WMH A;  3VDZ A;  1WM3 A;  1LFD A;  1WX7 A;  2BWE S;  3CMM B;  3PLU A;  2KXJ A;  1E8X A;  1WGR A;  1WGH A;  4DDI D;  4AWJ A;  3DVN V;  1IPG A;  1SE9 A;  2UWQ A;  2K39 A;  3V6C B;  1T0Y A;  4KV2 A;  4KSK C;  4NQK E;  2V4L A;  2MLB A;  2KJH B;  2YLM A;  3IHP C;  2G45 B;  4WJO A;  3SDL C;  4ZDV A;  2LUE A;  4IWP A;  3ZLZ A;  4BBN F;  1UH6 A;  2BPS A;  2BYF A;  2NR2 A;  1LM8 B;  3IFW B;  2O2V B;  3B0A A;  4MM3 A;  1ZGU B;  2K8H A;  4NAW B;  1CMX B;  1TGZ B;  2HE7 A;  2DYB A;  2G3Q B;  2CU1 A;  2K8B A;  2LWP A;  2AL3 A;  2Y5B B;  2ZNV B;  4WAA A;  4WWN A;  2PE6 B;  4CO7 A;  4K1R B;  4MDK E;  3DOW A;  5CX3 A;  1OTR B;  4GDL A;  3DVG X;  4ZRI A;  2B3A A;  1GUA B;  4DHJ D;  4FA6 A;  1G6J A;  4BFR A;  2GBM A;  4PS8 A;  4FHJ A;  2V3S A;  3ZW3 A;  3ZNH B;  3R7R A;  3DBS A;  2YVC A;  1WR6 E;  3OJ3 A;  5C23 A;  3WIM A;  2PJH A;  1L7Y A;  4XX5 A;  2XEW A;  1WR1 A;  4ZRK A;  4FAD A;  2RSU A;  4BKT A;  5DCN A;  5JHB A;  4LJO B;  3ZNG C;  3ML9 A;  4DDG D;  3C0R B;  3DBR I;  4TV3 A;  4ANX A;  5BO4 B;  1YIW A;  4AOF A;  3A9J A;  3OJ4 B;  1S1Q B;  2NCN A;  3A4R A;  3IVF A;  3QK0 A;  2EKE C;  4IM0 A;  2KTR A;  3T8M A;  4TKN A;  4CYE A;  4E71 A;  2K25 A;  3VTU A;  1V86 A;  3TIX A;  1S3S G;  2KWU B;  3L54 A;  5JH5 C;  4GXB A;  5G55 A;  2KO3 A;  4YL8 A;  1Z5S B;  1WGY A;  3QIJ A;  3VFK A;  1V5O A;  1WFY A;  2EMS A;  2BKF A;  2ZPN A;  3PHX B;  3A4S C;  1X1M A;  3QX1 A;  3PTF C;  3KVF B;  3QC8 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...