1WIEA

Solution structure of the first sh3 domain of kiaa0318 protein
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
96
structure length
96
Chain Sequence
b'GSSGSSGTSKQRYSGKVHLCVARYSYNPFDGPNENPEAELPLTAGKYLYVYGDMDEDGFYEGELLDGQRGLVPSNFVDFVQDNESRLASTSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIM binding protein 2
publication title Solution structure of the first SH3 domain of KIAA0318 protein
rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 5
structure length 96
sequence length 96
ec nomenclature
pdb deposition date 2004-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14604 SH3_9 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1wieA01
2JMCA 1UG1A 2FRWA 5FWCA 2K3BA 4HCKA 4AG2C 2O31A 2KR3A 2JXBA 2KRMA 1ARKA 2DBMA 2DRMA 1I07A 1PRMC 1WFWA 1G2BA 4AFQC 1K1ZA 2DILA 2RN8A 1T0JA 2LX7A 2K7AA 1VYUA 3IQLA 1JU5C 1NLPC 2O9VA 2EYZA 2D8JA 4RTZA 1QLYA 4IIMA 3QWXX 1EFNA 1WXBA 3C0CA 1GRIA 2HSPA 2C0IA 1VYVA 1KFZA 2MOXA 2HCKA 2RQRA 1H8KA 1M3AA 3TSZA 2HDAA 1E7OA 5IHKA 2G6FX 2K2MA 3PVQA 2CUBA 2KEAA 2V1QA 4LNPA 4JJBA 1YWOA 1QKXA 5GJVB 2FPEA 1X6GA 1U5SA 1UJYA 2KT1A 1ZSGA 3ZL7C 1Y57A 2LJ3A 3VRZA 2C0OA 2F2WA 2K79A 4RTXA 2HEQA 2LMJA 3LH5A 2MIOA 2V1RA 1W1FA 1NLOC 4JPBW 1BU1A 3QWYA 2FRYA 2J06A 1HSQA 2AKLA 2KXCA 1V1CA 2DL8A 3I5RA 1PWTA 5IHIA 4RTTA 4D8KA 1QWEA 2YUOA 1J3TA 1GCPA 1AZEA 4WCIA 4GBQA 4X1VA 1I0CA 2SEMA 2KROA 2FO0A 2KYMA 3THKA 4F17A 2YSQA 1WX6A 2KGTA 1FYNA 2VVKA 4E6RA 2LJ0A 1ZUUA 1JQQA 1HJDA 4JZ3A 1AOJA 2I0NA 3VS4A 1K9AA 2DL4A 2LQWA 1IO6A 2ROTA 4A63B 1BBZA 2DM1A 3M0PA 1QWFA 4OMLA 2DF6A 3VS1A 4QT7A 2J05A 1RLQC 1WI7A 1XOVA 2LZ6B 1OEBA 2PNIA 2ED1A 2XMFA 4AFSC 1U06A 2GTOA 1PHTA 2NUZA 3UATA 1CSKA 1AEYA 1X27A 1KIKA 2MCNA 1T3SA 2EYYA 2EPDA 2F2XA 4Z88A 3I35A 4JZ4A 2AZSA 3U23A 2JS0A 1ZX6A 1K76A 2L3QA 1NEBA 1GFDA 1GL5A 3O5ZA 1NM7A 2A37A 2AK5A 2DYBA 2OAWA 5FW9A 1YCSB 2LJ1A 1TUDA 2O88A 2PTKA 2KYBA 2QDLA 2DLPA 2A28A 2DL3A 1Y0MA 1I1JA 1K0SA 1TUCA 2CSIA 3VS7A 2DRKA 4KRTA 1SEMA 1M8MA 1AZGB 2EYWA 1MV3A 2JM9A 5HCKA 4CC7A 2RQTA 1U3OA 5FWBA 1ZLMA 2EQIA 4J9IA 4OMMA 4M4ZA 1AWJA 1SHFA 1TG0A 4RUGA 2EGAA 2EGEA 1W70A 3VS0A 2C0TA 1SHGA 1YN8A 1WYXA 1YWPA 4HVVA 2L2PA 4DEYA 2EVRA 1ABQA 4CC4B 1M3BA 2K9GA 2GQIA 1UUEA 1SSHA 1JXOA 3M0QA 4J9FA 2RF0A 2ABLA 2KRSA 2KXDA 2CSQA 3H0IA 5I22A 1E6GA 4FSSA 2GBQA 1Z9QA 3EG2A 3NGPA 5IXBA 3CQTA 3M0SA 4AG1C 1B3QA 1WDXA 2J7IA 1H92A 1ABOA 1X2QA 4GLMA 3TSWA 4J9BA 1M27C 2CT3A 2YDLA 4DEXA 1ZUYA 4JJDA 1JXMA 3UA6A 2JS2A 2K6DA 1UGVA 2DL5A 2DE0X 2NWMA 1PKTA 2P4RA 3VS5A 1NYGA 4LUDA 3FJ5A 2O9SA 2ECZA 1NEGA 1B07A 2J6KA 1M3CA 4ZNXA 5GJWB 2EBPA 1LCKA 3EG3A 4OMPA 2FEIA 1GBQA 4K11A 1AWXA 1K0XA 1AD5A 2ESWA 3PE0A 4RTUA 1JEGA 3A98A 2OI3A 4LUEA 4CC2A 1T3LA 2E5KA 1RI9A 2FG0A 1A0NB 1KSWA 1UE9A 1X6BA 2EKHA 1QCFA 3EHQA 2W0ZA 3EHRA 2AKKA 1SRLA 2L3PA 4Z8AA 3ULRB 2H8HA 4RTWA 3R6NA 1GCQA 1WIEA 2M51A 1OPKA 2SRCA 5ECAA 1PNJA 1BB9A 2KT8A 2CH4A 1M30A 1X69A 2YT6A 2LQNA 2KE9A 2L0AA 2KBTA 3M0RA 1X43A 3NPFA 4Y92A 3VS2A 3M0TA 4RTVA 1SRMA 2ROLA 5I11A 2L3SA 4HVUA 1PRLC 2IIMA 3I9QA 4CC3A 1E6HA 2EYXA 4J9HA 2F2VA 4OMQA 1GFCA 1FMKA 1MUZA 1NG2A 1SPKA 3TVTA 2LP5A 2GTJA 1RLPC 2D0NA 3SEMA 4EIKA 3EG1A 1MV0B 2X3WD 3PVLA 1RUWA 1UHCA 1WXUA 2GGRA 5EC7A 1GCQC 3KFVA 3UF4A 2DBKA 2O2OA 2DNUA 2DVJA 2JT4A 2CH4W 2JM8A 3H41A 4J9CA 2BZYA 1AVZC 2CT4A 2BZXA 2YUNA 1UDLA 1Z9ZA 1X2KA 1OOTA 5IHNA 1K4US 1YP5A 2J6OA 1UECA 2PZ1A 1AWOA 2DMOA 4J9EA 1WA7A 2KRNA 2RQWA 3REBB 1N5ZA 2RQVA 2KNBB 2W10A 2YUQA 2CREA 1WLPB 4RTYA 2CUDA 4J9GA 1PKSA 2BZ8A 4ESRA 2JTEA 1VA7A 3UA7A 2CDTA 1S1NA 2RNAA 1WXTA 3EG0A 4IIOA 3M0UA 2YUPA 3I5SA 4HVWA 1JO8A 4AFUC 2ENMA 2DA9A 4J9DA 2RQUA 1CKBA 5L23A 1QKWA 1OPLA 2DL7A 4AFZC 1OV3A 5IXFA 2OJ2A 2B86A 2M0YA 3JV3A 3H0HA 4OMNA 2D1XA 1ZUKA 3NMZC 2X3XD 2FPDA 4D8DA 1UTIA 1H3HA 4HXJA 1AWWA 3RBBB 1W6XA 2JW4A 2EW3A 1G83A 2RPNA 2VWFA 1HD3A 2EGCA 4JJCA 4LE9A 1BK2A 1VYTA 4Z89A 2DX1A 5IH2A 2GNCA 1UFFA 3VS6A 3NHNA 1ZBJA 3REAB 3RNJA 4R0KA 4ORZA 2A08A 3GBQA 1UJ0A 3VRYA 2D8HA 3H0FA 4F14A 2HBWA 1YNZA 2JMAA 3SHWA 2RMOA 3VS3A 3EGUA 2VKNA 2BTTA 1T0HA 4LN2A 1GBRA 2A36A 2J6FA 2DJQA 2LCSA 1KJWA 1UHFA 2LNHB 2AZVA 1CKAA 4F16A 4OMOA 1NYFA 2ED0A 2FPFA
chains in the Genus database with same CATH superfamily
3DLLA 1UG1A 4C0GA 1IREB 2K3BA 2K4YA 1KG1A 1EZZB 2O31A 2DKGA 4C8QF 3AHUA 3QHSA 4ELYC 2DXCA 2RHZA 2DILA 2RJDA 1WQWA 5KYUA 3CCMA 2KSSA 5GAN3 4PJOF 1ZA2B 2C0IA 3O8VA 4QKUA 3MO8A 2HCKA 1H8KA 1VQPQ 3KBGA 3PVQA 2K5LA 2P0PA 1QKXA 2IG0A 4FYWB 1S72T 1U5SA 4M7AA 2GF7A 2Z0WA 3MEAA 3VRZA 4FW1A 2FYKA 1V76A 3MEVA 1OZ2A 1M2VB 1OX9A 2QTVA 1K8AC 2MIOA 4M7DE 1W1FA 4JPBW 2EQMA 4C92D 3VKIA 2FRYA 3OW2A 2J06A 1VQ7T 2DL8A 1PWTA 2D9TA 5KYYB 7AT1B 3QDFA 2DVEA 1ZHIA 3FC3A 3CXCA 1ZSZB 4QVDA 4FU6A 4ZGEB 4M7AF 1GCPA 3OA6A 1I0CA 2DD4A 2KROA 2KYMA 3FRNA 3EFRA 1WX6A 2KGTA 2P0KA 3QIIA 3CMAA 3G1JA 4E6RA 1ZUUA 1HJDA 2O4XB 2BE7D 2HD0A 5HK0A 5GAN8 1TOVA 3CMET 4A63B 4PK4A 3JB9J 2RI3A 4C5EA 4QT7A 2OTJT 1XOVA 2KY9A 4ATOA 3V7SA 4CRIA 4OB2B 2KI7A 2NUZA 2VXFA 4X34A 1CSKA 1VQ4A 1AEYA 2DD5A 1X27A 2R57A 3PT9A 2F2XA 3CCET 1S72Q 2QG9B 4WTOB 3KUFA 1QVFP 3I35A 4PFPA 4HCCA 2QI2A 5FU6C 5KYNA 1ZX6A 4MDXA 2E41A 2RHXA 2AK5A 2DYBA 4KGZB 2GCXA 1TUDA 4BY6C 4M75G 1K8AR 2PTKA 1VQ7Q 1BI3A 2LC4A 3OS5A 2RJFA 3G71Q 4N4HA 2E6ZA 2DL3A 3ZEHA 2K2VA 1I1JA 1K0SA 3TU4K 1ACMB 3S3OA 1RL2A 1VQ9T 3LWIA 5HCKA 2JM9A 3HL8A 1Q86C 2RQTA 1U3OA 3MEUA 5FWBA 5D6WA 2EQIA 2PQWA 3CBPA 1TG0A 4RUGA 4OMFB 3J7AF 2EGAA 1YJWA 2COYA 4M7DG 2EVRA 3LW5E 5CKHA 1N6AA 2WSEE 4C5HA 5FLXE 4DBRA 3CMEQ 1SSHA 3CCUA 4J8OA 1R77A 1JXOA 6AT1B 2OTJQ 1VIFA 3J80E 3M0QA 1IHVA 5LJ3e 2KXDA 3EG9B 3CCEQ 3VU3C 1JB0E 3M0SA 1QW1A 5C0MA 3RKXA 1H92A 3TCJA 1X2QA 2VUBA 1VQ6A 3TSWA 2CT3A 2YDLA 4XAXB 2EYQA 4AMCA 3UA6A 2E65A 2JS2A 3EFSA 1M1KR 1UGVA 3OY9A 4C92A 3VS5A 5DLOA 3JCMb 3OYNA 3CCSA 1YCYA 2J6KA 3EG3A 1VQ9Q 2RHUA 1QVPA 2CKKA 1GBQA 4XTXA 2LVMA 3PE0A 4RTUA 3A98A 4DOVA 1A0NB 1UE9A 4M75C 2VGNA 2DEQA 1QCFA 2YXYA 1X75C 3OSVA 3X28B 3EHRA 1SRLA 3EFOB 2L89A 3QBYA 3JB9F 4PJMA 3HTRA 3HP9A 3VUBA 4E7KA 2M51A 4ZGDB 4XU2A 1TH7A 3EH1A 4A4GA 3C95A 3FB9A 5GMKh 1BB9A 1KQ2A 4M77D 4RMOA 5FRNA 2QEXT 2YT6A 4IKFA 4QVCA 5LJ5e 2XI9A 4NS5A 2KE9A 4LDYA 1VQ8T 3VS2A 1JJ2A 3HRTA 3M0TA 4M7DC 1B7TA 4FT2A 4M78F 4DA4A 3M53A 4XU0A 1PRLC 2IIMA 2QA4A 4PNOA 1K8AU 4A53A 1NJIR 2F5KA 4J9HA 1M5Q1 2RHIA 2WACA 3TVTA 2XDBA 2LP5A 1RLPC 3CC4T 1KQSP 1YITT 2E1HA 4EIKA 9ATCB 3MHXA 1RUWA 1UHCA 1YJNT 2K3XA 2G3RA 2DAQA 2B8AA 3UF4A 3OYFA 2DBKA 1KD1R 1LPLA 3JB9I 1VQ5T 1N9RA 3H41A 3FIFA 4J9CA 2BZYA 4PJNA 4JRQA 4JJNK 4KUDK 1OOTA 2LDMA 1K4US 1YP5A 1QVGA 1LJOA 2J6OA 5GANh 1K73C 3PIPA 2PZ1A 1AWOA 2DMOA 2RI5A 1LOJA 5GANg 1WA7A 3REBB 3V8JA 1VQKT 2OTLA 5D7UA 4C8QG 2QYZA 2W10A 2YUQA 2QEXQ 5GAOn 3A8HB 2FVUA 4ESRA 1VQ8Q 2RH2A 1WGSA 2QQSA 2DERA 1S1NA 1Q7YR 4N4GA 5FROA 2YUPA 1W4SA 2JJ9A 3I5SA 1M1KU 2EQJA 5LL6S 2ENMA 2RQUA 3EGDA 2DL7A 3L2VA 3OS1A 2P4TA 2OJ2A 3CD6T 3CC4Q 3TQ7P 3A8MB 3NMZC 3X20B 3L1AA 3VUZA 2JTFA 2L3RA 1YJ9T 4OP0A 1Q81R 3P8DA 2VWFA 5KCOA 1YJNQ 4JJCA 1QP3A 1BK2A 2LT4A 3E9FA 2DX1A 2MMPA 5LJ3d 2GNCA 1UFFA 1VQNA 1ZBJA 3RNJA 4R0KA 1VQ5Q 3ASKA 2RD1A 1UJ0A 1BKBA 1MHNA 1OX8A 2MPXC 2RA2A 1UGPB 3QSUA 2RMOA 3VS3A 3X26B 4OGEA 5CK9A 1GBRA 3OYJA 2ZZDA 3CCMT 1YI2A 2MWPA 4HCBA 3M4GA 3I56A 5KCHA 2DXTA 2LCSA 3V7RA 3GP8A 5GAMh 4M7AG 3DLMA 1VQKQ 2BE9B 2JMCA 2EQUA 3BE3A 2HQEA 4M77A 3OBYA 4BY6B 4AG2C 2MYSA 3MJXA 2KR3A 2JXBA 1WJQA 2MF2A 3RMSA 2CGHA 2DTHA 3BFMA 4LD9K 1PRMC 4J6WA 3RKYA 2ZPHB 2PUKB 4J83A 3FEOA 5CKBA 4AFQC 3RDVA 1NJIU 2RN8A 3HRUA 1T0JA 2LX7A 2RM4A 1D0ZA 1PSEA 1VYUA 5KE2A 1G3YA 4PFZA 3CCVT 4RTZA 4IIMA 3QWXX 4C8QC 3OSSC 5AYFA 5KYYA 3C0CA 2EJGA 1KFZA 2MOXA 2RQRA 4M77F 5D6YA 2DZCA 2ZGWA 1YJ9Q 4RG2A 3QUIA 4C5IA 2HDAA 1E7OA 5IHKA 3H8ZA 2RK1A 1KD1U 2K2MA 2V1QA 2KEAA 2RJEA 4LNPA 4JJBA 1WZOA 1X6GA 4PJOC 1WHJA 5LJ5d 1UJYA 3ZL7C 1Y57A 2LJ3A 4C92E 1Y96A 2K79A 4KH0B 2HEQA 3CMAT 1BI0A 4L5GA 3QWYA 2DETA 1TTHB 3CCMQ 4BDZA 3GIBA 2KXCA 4IUTA 3V8LA 3HSBA 5IHIA 2E6NA 1KQ1A 4X9DA 4FIBA 4D8KA 2CZ6B 5HY6A 2GQVA 5LJ3g 1PC0A 1EIFA 3INZA 4WCIA 4X1VA 1VQ4T 2HMAA 5EG2A 2E3IA 1WHLA 2V26A 1VOMA 2COZA 2X4JA 5A0DA 4UC4A 5FRMA 2VVKA 4RCBA 2LJ0A 4E7HA 1JQQA 3PIOA 3JCMJ 2D6FA 5KH6A 4M7AC 1Y07A 3VS4A 4TVRA 3MCAB 2DL4A 1IO6A 3L2QA 2OAUA 3M0PA 1QWFA 4M75B 1Q81U 4BUGA 3SWNA 3VS1A 1RLQC 1WI7A 2LZ6B 2PNIA 2ED1A 4AFSC 1U06A 1W2BP 3UATA 1QP2A 3RIRA 5CKFA 2ZCFB 1RADB 1T3SA 4MMLA 1RAHB 3OMGA 1BI2A 3NTIA 4E7ZA 3JCMe 1N8RC 2Y4YA 1GFDA 4JRPA 1GL5A 3O5ZA 5CVIA 1NM7A 2A37A 5CO7A 3CMAQ 4M7DB 2OAWA 3JCMf 3JAME 5FW9A 1TSFA 2QXFA 1JJ2P 2O88A 1FMVA 1WJRA 1YIJA 5GMKj 4GY5A 4OB1B 3DB3A 3CCUT 1U8RA 2QQAA 4MMKA 1TUCA 1WNLA 1I5LA 1M8VA 3VS7A 5CCAA 4QVZA 4KRTA 1M8MA 2QDYB 4V2SA 5LJ5g 2LRQA 1VQ4Q 4J9IA 4M75E 1KQSS 3QYGB 1HYOA 2HSEB 4C92G 1C6VX 2JN0A 1D0YA 2LNVA 1VQ6T 1WYXA 2M9UA 2K9GA 2GQIA 2LCCA 3A5ZB 3BDUA 5AT1B 2A7YA 2DJZA 3WXMB 2RF0A 3CCST 4JRIA 2QTXA 2YRCA 4DBFA 5I22A 3LX7A 2GBQA 4RG8A 1K9MC 2K5IA 3JB9D 3M58A 3G71T 1I4K1 3CQTA 4AG1C 1B3QA 4II1A 3AT1B 3EFOA 4J9BA 4DEXA 3DKMA 4XU3A 2WSCE 1IRXA 4PKCC 1YJWQ 4JJDA 5KYXB 2DL5A 4X9CA 4E2FB 1NYGA 4YTLA 3QJ6A 3G6EA 2VYTA 3CCUQ 4M78D 5M9OA 4XTWA 1B07A 1PD0A 2JTMA 1BCMA 4ZNXA 5GJWB 1M9SA 1LCKA 4RKUE 2XICA 4OMPA 3ZFJA 5D6XA 4J7IA 1AWXA 1D3BA 1JEGA 5GAN7 4CC2A 2H3JA 3HKSA 1RI9A 2FG0A 3Q1JA 2EKHA 4OB0B 3CC2A 1U1SA 3FJPA 4N4IA 5KYWA 1VQ6Q 2AKKA 2QA4T 5GAOr 4Z8AA 1BI1A 3R6NA 1GCQA 1OPKA 3V8KA 2SRCA 5ECAA 1R0BG 3CCSQ 2V8KA 3S6WA 4C92C 1Q95G 2LQNA 2XHCA 2NUPB 3I55A 4F7UE 2LQKA 3NFCA 1M1GA 4FYXB 5GAMf 3T9NA 1SRMA 2EIFA 2L3SA 4HVUA 3EGXB 4CC3A 4F04B 2EYXA 2F2VA 1SSFA 4IUQA 3QZ9B 1FMKA 4J6XA 1GXIE 4FW2A 5GAMj 4NOYA 2D0NA 3SEMA 2YRDA 3JSCA 3OYAA 1C0MA 2OTLT 4C8QB 2E10A 2HNIA 2M1HA 3OYDA 3HHTB 4DQ2A 3CBMA 3OYHA 4JS5A 1FXXA 2DNUA 3OS2A 2D0QB 1TXQA 4NL2A 1AVZC 2BZXA 2YUNA 3LYIA 1X2KA 2KMTA 3G4SA 3JCMd 3UT1A 1Y71A 2QA4Q 1PCXA 2DEUA 3META 1UECA 3DB4A 2GFAA 2FZGB 1PD1A 1KHCA 1D1AA 3A8LB 4QQGA 2RQWA 2RQVA 1M90C 1FWZA 2KNBB 4OVAA 3S3NA 2FB7A 4B9XA 2EAYA 5KYUB 3RR6A 1VA7A 3OYKA 3UA7A 2PU9B 1QCOA 3BW1A 3EG0A 3QKJA 4AFUC 2L5QA 2DA9A 4J9DA 4C8QE 1Q82R 3OYLA 5L23A 1OPLA 2HQXA 3ZBDA 2M0OA 4M77G 5IXFA 3PGGA 4OMNA 1PSFA 5CAIA 1IHWA 1Q86R 4R55A 4D8DA 1H3HA 4M7AB 1H641 1AWWA 4M78A 2NLUA 4BI8B 4PLLA 4PJOE 2OTLQ 3ER0A 3OYIA 1HD3A 2EGCA 4D6WA 4F7UG 1IZ6A 5IH2A 5CQXA 2VASA 2L8DA 1NPPA 1P92A 4L59A 4MZMA 3GBQA 4C0DC 1G8XA 1W2BS 1YNZA 2VXEA 4PLIA 4ME7A 1XNIA 1T0HA 5GAN2 2DJQA 1VQOA 4KULA 4KGXB 1UHFA 5J26A 2DYIA 4KT0E 3RESA 2ZPGB 2K3YA 4N0AC 4OMOA 4JZ4A 4EMKA 2JNGA 2Y90A 2DXUA 2DXBA 5CR2A 2YRVA 1MMGA 2KRMA 1K9MU 4C5GA 1YFNA 4PJLA 5HKCA 2DRMA 3QXEB 1I07A 1VQNQ 1JBMA 2EJFA 1OU9A 2OX7A 4M7AE 4HT9A 4B9WA 2E12A 2CP2A 2K7AA 1O9SA 3IQLA 2O9VA 1QMCA 1QLYA 1SF9A 1N9SA 2PVDB 2C06A 1WXBA 1GRIA 1YI2Q 1VYVA 5IT9E 4BI3A 3I56Q 3CEYA 1I5OB 4EMGA 1OQKA 5FU7C 1R8OB 1OULA 4AT1B 1G3WA 2CUBA 1N27A 4JDSA 4OB3B 1OI1A 1YWOA 5GJVB 3CC7A 2FPEA 3C94A 3H9NA 4FSXA 4M77C 4RTXA 3N5BB 5J39A 1HXDA 3S3MA 1NLOC 3OW2P 3GNGA 1BU1A 2JOYA 3JB9H 5CKDA 3L42A 2AKLA 2Y4XA 2COWA 3UWNA 4ELZC 3CBOA 1Y7XA 3CXCP 1D1CA 4PJOG 2P84A 4Z02A 1J3TA 2WSFE 4Y91A 3GLXA 2AIRB 2HL3A 2CP0A 2SEMA 3THKA 2XKOC 3MEWA 1FMWA 1TU0B 4P5NA 4A4EA 2EFIA 2K5FA 2HL5C 4JZ3A 1AOJA 2I0NA 1Q86U 2ROTA 2DTOA 1BBZA 2DM1A 5HK3A 2XDDA 4JUVA 4IURA 1YIJT 2DF6A 2YLBA 4FL6A 5GAOm 1OEBA 2XMFA 1PG5B 1WHHA 8AT1B 4E7LA 2X4XA 2PVOB 5FU6B 1QVFS 3GNFB 2RHYA 4M7DF 4BI4A 2AZSA 3P8BB 1AHJB 2HKNA 1K73R 3E19A 4C92B 1K76A 1NEBA 4O6JA 3QYHB 3JCMV 4LDWA 1C1AA 1JRIA 1M2VA 2A28A 2QQBA 1Y0MA 2F69A 3PMTA 3RMQA 2EJ9A 2MK5A 3PTAA 1AZGB 4CC7A 1MV3A 3SWNC 4J5YA 4R56A 3A8GB 3PNWC 4M4ZA 4OMMA 1UGSB 1XJWB 1SHFA 3QG1A 2JVVA 1ZSZA 2EQKA 2KK4A 1W70A 4LDXA 3CCJA 2C0TA 1SHGA 3TREA 1YWPA 5GAN5 1VQLA 1ABQA 3E9GA 2CP6A 5A2QE 2ATCB 3PMIA 3SDZA 4VUBA 1YIJQ 5A0LA 3M55A 2O4XA 1MGQA 4J9FA 3G6ET 2X4YA 2F5TX 3H6ZA 1YHQA 2RK2A 4CI0C 1G3SA 5A0GA 1Z9QA 3EG2A 1LVKA 1Q82C 5IXBA 3GPLA 2E3HA 4Y28E 5LJ3h 1PM3A 1WDXA 2NUTB 1OYXA 2E64A 2XU8A 1M27C 3SFMA 4ZTFA 3M5AA 1ZUYA 4ZN1A 1JXMA 4M78E 2NWMA 5GMKi 1PKTA 3FJ5A 3ME9A 2QGFB 2O9SA 4BACA 1NEGA 3VYHB 3CPWA 1M3CA 3OMCA 2NUPA 2X51A 1IGUA 2X4WA 4LD6A 1K0XA 3CCRA 1G3TA 2OI3A 1V29B 2A0FB 4KGVB 4LUEA 2E5KA 1KSWA 1X6BA 5GMKe 1B34B 3EHQA 3L2RA 1OZ3A 3C12A 3OB9A 3ULRB 4J6YA 4HKEA 2H8HA 4C0DB 2CP7A 2CZ0B 4C0ZA 1PNJA 2QQRA 3G6EQ 4L6V5 3M54A 2CH4A 1LNXA 1M30A 3OYCA 1YJWT 4KBMB 3CD6A 2L0AA 1K73U 3BY7A 5I2MA 2KBTA 1X43A 4B6MA 4E7IA 2HAXA 1HK9A 4RTVA 2ROLA 3CCLA 5I11A 3OYYA 3EG9A 5LJ5h 3CCQA 2RI2A 4HA8A 2QK0A 1E6HA 3CC2Q 3G4ST 2E4HA 2V8IA 1NG2A 1SPKA 2PUOB 3C4SA 2GTJA 4E7JA 1MNDA 3BDLA 2BKDN 1KQSA 3JB9G 1RAAB 3EG1A 4XK8E 3JCMc 2LCLA 4KUIA 2XD0A 2GGRA 4E47A 1GCQC 1RAIB 1WHMA 3KFVA 3I55Q 2DVJA 2JT4A 2EWNA 2ZPEB 5GANe 3RERA 2CH4W 5FU7B 5CIUA 2CT4A 3FLGA 3VV0A 5IAYA 1QVGP 3A8OB 1VQMA 2PVGB 5IHNA 1TWBA 2VC8A 5GANf 4M78G 4ZGJB 4M77B 2YHTA 1WJSA 4J9EA 2KRNA 2A3LA 1RACB 4XQ3A 1X01A 3E2UA 3CCVA 2CREA 1WLPB 3NTHA 5GANj 3OW2S 1N8RR 4O5VA 2CUDA 4F7UB 3LWHA 4FT4A 2JTEA 1KC8C 1WXTA 3M0UA 3CXCS 4HVWA 1JO8A 4FYYB 3M59A 4JLGA 4QQ6A 1QKWA 3G4SQ 2QQ9A 2B86A 5DM7R 3H0HA 4BB7A 2FHDA 3LGFA 3SB2A 1VQOT 1IXDA 1UTIA 4HXJA 1W6XA 2RPNA 1Y96B 1BIAA 3EH2A 4M77E 3NTKA 3NHNA 2ZPFB 4JS4A 5GMKm 1O75A 2FL7A 3HRSA 2A08A 5GAN6 4PJJA 3VRYA 4EDUA 2VV5A 1RAGB 3JCMW 2D8HA 2HBWA 5GAMe 4IUPA 3SHWA 3CPFA 3EGUA 2VKNA 2BTTA 2A36A 2J6FA 2FZKB 3RKWA 2LNHB 1K9MR 2AZVA 1VQPA 3VYGA 4F16A 1M1KC 3MKDA 2FRWA 1VUBA 5FWCA 5GAOq 1G5VA 4HCKA 2M02A 2IPOB 1ARKA 2AT1B 3QO3A 2DBMA 5J3BA 1Q82U 3CC7T 3MP1A 4JLIA 4M78C 1WFWA 1G2BA 1K1ZA 2AHJB 2V8JA 1KC8R 3SWNB 1NE8A 1JU5C 1NLPC 2MWOA 2CZ1B 2EYZA 2QAZA 3M4YA 4KH1B 2D8JA 3SD4A 2ZAEA 3OYBA 1EFNA 2HSPA 1UGRB 1VQOQ 3OYMA 1IB8A 1M1FA 3QPHA 1M3AA 3TSZA 4PJOB 2G6FX 4M75D 1UGQB 1EX4A 3V7CA 5GAOl 2KT1A 3HPWA 1ZSGA 2KVQG 4EMKC 1NZ9A 3UDCA 2C0OA 2F2WA 2EKOA 2F1LA 2MI6A 5GAOp 2LMJA 3LH5A 4EPCA 2V1RA 5DLQE 2KQWA 3PFSA 4NL3A 2VB6A 1HSQA 5LJ3f 1KK7A 1V1CA 3I5RA 1VQNT 3OYEA 1NJIC 4XU1A 4M7DD 4WF2A 1N8RU 2DTIA 4FM4B 4RTTA 2ZPIB 1M4ZA 1QWEA 2YUOA 1WHKA 1I8FA 3L2WA 3F70A 3JCMX 1AZEA 1S72A 4GBQA 1WQ7A 1YI2T 5LJ3j 2FO0A 4F17A 2YSQA 3I56T 3CC7Q 1XQHA 3CPWP 1BIBA 1FYNA 2BUDA 5GANd 4C0FA 1KD1C 1K9AA 1VQ7A 3G71A 2LQWA 2MAMA 2XIDA 4FCYA 3LGLA 2KDSA 4OMLA 4A4HA 4IUUA 2J05A 3QZ5B 5CKEA 1KHIA 4BD3A 2GTOA 1PHTA 2CYZB 1W2BA 4C92F 2LTOA 8ATCB 1M2OA 2DO3A 4MZTA 1KIKA 3HFOA 2MCNA 2EYYA 2EPDA 4Z88A 1ZA1B 4JRKA 3OBWA 3U23A 2JS0A 2YWWA 1DJ7B 1MMAA 1RAFB 2CP3A 2L3QA 1U1TA 2CP5A 3J81E 3CCJT 3CMEA 1Q7YC 1JJ2S 1YCSB 1VQLT 2LJ1A 1M90R 2DPPB 5I21A 3JCMh 2KYBA 2QDLA 2DFUA 2OTJA 2DLPA 2O01E 5LJ5f 1D3BB 1MMNA 3R6OA 3JCMg 4PL6A 2CSIA 1BYMA 1RAEB 2DRKA 1SEMA 4LDVA 3L2UA 1YHQT 2EYWA 4HCZA 3CCEA 4BE2A 1ZLMA 5KYWB 2NUTA 1KC8U 1AWJA 1TUGB 1Q81C 5LJ5j 2EGEA 3VS0A 2LT1A 3M9QA 2FZCB 1YN8A 4DBQA 4HVVA 1TS9A 2L2PA 1XTDA 4DEYA 4CC4B 1M3BA 5GAMd 3KXTA 1UUEA 2LQ8A 3RUXA 4DBHA 2NYSA 1VQ9A 3URGA 1QVGS 2ABLA 2KRSA 3LH0A 2M16A 2CSQA 3A1PA 3H0IA 4M75A 1E6GA 3M57A 4FSSA 4Q5WA 3NGPA 1RI0A 3OQ5A 1B34A 2J7IA 3CCRT 1YBYA 1ABOA 4GLMA 1NBEB 3JCMP 3CCJQ 2HZYA 2JUFA 2K6DA 4A4FA 3VJPA 1VQLQ 1ZSZC 2RO0A 2DE0X 1D1BA 2P4RA 4RCCA 4LUDA 2K57A 2YLCA 2HQHA 2ECZA 1D09B 3X25B 4ZN3A 4M7DA 4BE0A 2XDPA 4M75F 3OS0A 4ZTJA 2EBPA 3UPUA 4N0AA 2FEIA 1YHQQ 3EAEA 2R58A 4K11A 1AD5A 3OYGA 2ESWA 3LLRA 4C8QD 2HKQB 2XG8D 1YITQ 1T3LA 1VIEA 3CCLT 2W0ZA 3CCQT 2L3PA 3D7SB 1F1BB 4J7FA 3QJYA 1UEBA 4RTWA 1WIEA 3FDRA 4PJOD 2P0QA 1QVFA 4MZPA 2KT8A 5IN1A 4PFOA 1X69A 4DOWA 5C6SA 3GOXA 4XTVA 3M0RA 3HFNA 3NPFA 4Y92A 2X9HA 3CCRQ 4MDWA 1OU8A 1M90U 3I9QA 2RJCA 4QQDA 1R0CB 5GAMg 4OMQA 1VQMT 1GFCA 2XK0A 1MMDA 4M78B 3L2ZA 1MUZA 2CZ7B 2DIGA 1MV0B 2X3WD 2QEXA 4LDUA 3MP8A 3PVLA 5KYXA 4HT8A 2QASA 4F7UA 1WXUA 1H3ZA 4XTZA 1VQ8A 5EC7A 4FYVB 2R5AA 4A4KA 4M7AD 3CD6Q 4QW2A 2O2OA 2JM8A 3CCLQ 1WHGA 3TEEA 1UDLA 1Z9ZA 3MP6A 3G7ZA 5CQYA 3CCQQ 1UB4A 4EMKB 2IVWA 5GMKl 3CC4A 1YITA 2RB6A 2E70A 2ZPBB 2DZ9A 4EMHA 2H3EB 4F7UF 1YJNA 1N5ZA 2LX9A 4LXCA 3CC2T 1QQJA 3MPUB 4RTYA 4E7SA 4J9GA 2KAFA 4GLKA 1PKSA 2BZ8A 1VQ5A 1ZQ1A 5GAN4 2CDTA 2RNAA 4A54A 4IIOA 2DK3A 1SG5A 2X35A 3WVEB 1CKBA 1QCNA 4OF1A 5KE3A 2DIQA 3GF5A 5L8RE 1IGQA 1MNEA 2HBPA 3QDRB 4AFZC 1VQMQ 1OV3A 1Q7YU 4OGCA 2M0YA 3JV3A 3I55T 5I2SA 2D1XA 1ZUKA 3EGXA 1VQKA 3CPWS 2X3XD 2FPDA 4XTUA 1NPRA 1WPYA 1SKUB 2I2LA 1FX7A 3RBBB 2JW4A 2EW3A 1VQPT 1G83A 1RABB 4LE9A 3CCVQ 1VYTA 4Z89A 1BCOA 2E5QA 1I81A 3JRZA 3JCMQ 3VS6A 2CS7A 3REAB 4ORZA 4C8QA 1ZBXA 2BIVA 1X6OA 4IUVA 2VGMA 1D0XA 3H0FA 4F14A 4XTYA 2JMAA 2R5MA 3X24B 4LN2A 3E1SA 3EGDB 3P8HA 2QGGA 4BDYA 4BE1A 1KJWA 5DY9A 2GFUA 3WVDB 1AT1B 1YJ9A 2JZ2A 4ANJA 4PJOA 1CKAA 3M56A 1NYFA 2ED0A 2FPFA
chains in the Genus database with same CATH topology
2JMCA 1UG1A 2FRWA 5FWCA 2K3BA 4HCKA 4AG2C 2O31A 2KR3A 2JXBA 2KRMA 1ARKA 2DBMA 2DRMA 1I07A 1PRMC 1WFWA 1G2BA 4AFQC 1K1ZA 2DILA 2RN8A 1T0JA 2LX7A 2K7AA 1VYUA 3IQLA 1JU5C 1NLPC 2O9VA 2EYZA 2D8JA 4RTZA 1QLYA 4IIMA 3QWXX 1EFNA 1WXBA 3C0CA 1GRIA 2HSPA 2C0IA 1VYVA 1KFZA 2MOXA 2HCKA 2RQRA 1H8KA 1M3AA 3TSZA 2HDAA 1E7OA 5IHKA 2G6FX 2K2MA 3PVQA 2CUBA 2KEAA 2V1QA 4LNPA 4JJBA 1YWOA 1QKXA 5GJVB 2FPEA 1X6GA 1U5SA 1UJYA 2KT1A 1ZSGA 3ZL7C 1Y57A 2LJ3A 3VRZA 2C0OA 2F2WA 2K79A 4RTXA 2HEQA 2LMJA 3LH5A 2MIOA 2V1RA 1W1FA 1NLOC 4JPBW 1BU1A 3QWYA 2FRYA 2J06A 1HSQA 2AKLA 2KXCA 1V1CA 2DL8A 3I5RA 1PWTA 5IHIA 4RTTA 4D8KA 1QWEA 2YUOA 1J3TA 1GCPA 1AZEA 4WCIA 4GBQA 4X1VA 1I0CA 2SEMA 2KROA 2FO0A 2KYMA 3THKA 4F17A 2YSQA 1WX6A 2KGTA 1FYNA 2VVKA 4E6RA 2LJ0A 1ZUUA 1JQQA 1HJDA 4JZ3A 1AOJA 2I0NA 3VS4A 1K9AA 2DL4A 2LQWA 1IO6A 2ROTA 4A63B 1BBZA 2DM1A 3M0PA 1QWFA 4OMLA 2DF6A 3VS1A 4QT7A 2J05A 1RLQC 1WI7A 1XOVA 2LZ6B 1OEBA 2PNIA 2ED1A 2XMFA 4AFSC 1U06A 2GTOA 1PHTA 2NUZA 3UATA 1CSKA 1AEYA 1X27A 1KIKA 2MCNA 1T3SA 2EYYA 2EPDA 2F2XA 4Z88A 3I35A 4JZ4A 2AZSA 3U23A 2JS0A 1ZX6A 1K76A 2L3QA 1NEBA 1GFDA 1GL5A 3O5ZA 1NM7A 2A37A 2AK5A 2DYBA 2OAWA 5FW9A 1YCSB 2LJ1A 1TUDA 2O88A 2PTKA 2KYBA 2QDLA 2DLPA 2A28A 2DL3A 1Y0MA 1I1JA 1K0SA 1TUCA 2CSIA 3VS7A 2DRKA 4KRTA 1SEMA 1M8MA 1AZGB 2EYWA 1MV3A 2JM9A 5HCKA 4CC7A 2RQTA 1U3OA 5FWBA 1ZLMA 2EQIA 4J9IA 4OMMA 4M4ZA 1AWJA 1SHFA 1TG0A 4RUGA 2EGAA 2EGEA 1W70A 3VS0A 2C0TA 1SHGA 1YN8A 1WYXA 1YWPA 4HVVA 2L2PA 4DEYA 2EVRA 1ABQA 4CC4B 1M3BA 2K9GA 2GQIA 1UUEA 1SSHA 1JXOA 3M0QA 4J9FA 2RF0A 2ABLA 2KRSA 2KXDA 2CSQA 3H0IA 5I22A 1E6GA 4FSSA 2GBQA 1Z9QA 3EG2A 3NGPA 5IXBA 3CQTA 3M0SA 4AG1C 1B3QA 1WDXA 2J7IA 1H92A 1ABOA 1X2QA 4GLMA 3TSWA 4J9BA 1M27C 2CT3A 2YDLA 4DEXA 1ZUYA 4JJDA 1JXMA 3UA6A 2JS2A 2K6DA 1UGVA 2DL5A 2DE0X 2NWMA 1PKTA 2P4RA 3VS5A 1NYGA 4LUDA 3FJ5A 2O9SA 2ECZA 1NEGA 1B07A 2J6KA 1M3CA 4ZNXA 5GJWB 2EBPA 1LCKA 3EG3A 4OMPA 2FEIA 1GBQA 4K11A 1AWXA 1K0XA 1AD5A 2ESWA 3PE0A 4RTUA 1JEGA 3A98A 2OI3A 4LUEA 4CC2A 1T3LA 2E5KA 1RI9A 2FG0A 1A0NB 1KSWA 1UE9A 1X6BA 2EKHA 1QCFA 3EHQA 2W0ZA 3EHRA 2AKKA 1SRLA 2L3PA 4Z8AA 3ULRB 2H8HA 4RTWA 3R6NA 1GCQA 1WIEA 2M51A 1OPKA 2SRCA 5ECAA 1PNJA 1BB9A 2KT8A 2CH4A 1M30A 1X69A 2YT6A 2LQNA 2KE9A 2L0AA 2KBTA 3M0RA 1X43A 3NPFA 4Y92A 3VS2A 3M0TA 4RTVA 1SRMA 2ROLA 5I11A 2L3SA 4HVUA 1PRLC 2IIMA 3I9QA 4CC3A 1E6HA 2EYXA 4J9HA 2F2VA 4OMQA 1GFCA 1FMKA 1MUZA 1NG2A 1SPKA 3TVTA 2LP5A 2GTJA 1RLPC 2D0NA 3SEMA 4EIKA 3EG1A 1MV0B 2X3WD 3PVLA 1RUWA 1UHCA 1WXUA 2GGRA 5EC7A 1GCQC 3KFVA 3UF4A 2DBKA 2O2OA 2DNUA 2DVJA 2JT4A 2CH4W 2JM8A 3H41A 4J9CA 2BZYA 1AVZC 2CT4A 2BZXA 2YUNA 1UDLA 1Z9ZA 1X2KA 1OOTA 5IHNA 1K4US 1YP5A 2J6OA 1UECA 2PZ1A 1AWOA 2DMOA 4J9EA 1WA7A 2KRNA 2RQWA 3REBB 1N5ZA 2RQVA 2KNBB 2W10A 2YUQA 2CREA 1WLPB 4RTYA 2CUDA 4J9GA 1PKSA 2BZ8A 4ESRA 2JTEA 1VA7A 3UA7A 2CDTA 1S1NA 2RNAA 1WXTA 3EG0A 4IIOA 3M0UA 2YUPA 3I5SA 4HVWA 1JO8A 4AFUC 2ENMA 2DA9A 4J9DA 2RQUA 1CKBA 5L23A 1QKWA 1OPLA 2DL7A 4AFZC 1OV3A 5IXFA 2OJ2A 2B86A 2M0YA 3JV3A 3H0HA 4OMNA 2D1XA 1ZUKA 3NMZC 2X3XD 2FPDA 4D8DA 1UTIA 1H3HA 4HXJA 1AWWA 3RBBB 1W6XA 2JW4A 2EW3A 1G83A 2RPNA 2VWFA 1HD3A 2EGCA 4JJCA 4LE9A 1BK2A 1VYTA 4Z89A 2DX1A 5IH2A 2GNCA 1UFFA 3VS6A 3NHNA 1ZBJA 3REAB 3RNJA 4R0KA 4ORZA 2A08A 3GBQA 1UJ0A 3VRYA 2D8HA 3H0FA 4F14A 2HBWA 1YNZA 2JMAA 3SHWA 2RMOA 3VS3A 3EGUA 2VKNA 2BTTA 1T0HA 4LN2A 1GBRA 2A36A 2J6FA 2DJQA 2LCSA 1KJWA 1UHFA 2LNHB 2AZVA 1CKAA 4F16A 4OMOA 1NYFA 2ED0A 2FPFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JMC A;  1UG1 A;  2FRW A;  5FWC A;  2K3B A;  4HCK A;  4AG2 C;  2O31 A;  2KR3 A;  2JXB A;  2KRM A;  1ARK A;  2DBM A;  2DRM A;  1I07 A;  1PRM C;  1WFW A;  1G2B A;  4AFQ C;  1K1Z A;  2DIL A;  2RN8 A;  1T0J A;  2LX7 A;  2K7A A;  1VYU A;  3IQL A;  1JU5 C;  1NLP C;  2O9V A;  2EYZ A;  2D8J A;  4RTZ A;  1QLY A;  4IIM A;  3QWX X;  1EFN A;  1WXB A;  3C0C A;  1GRI A;  2HSP A;  2C0I A;  1VYV A;  1KFZ A;  2MOX A;  2HCK A;  2RQR A;  1H8K A;  1M3A A;  3TSZ A;  2HDA A;  1E7O A;  5IHK A;  2G6F X;  2K2M A;  3PVQ A;  2CUB A;  2KEA A;  2V1Q A;  4LNP A;  4JJB A;  1YWO A;  1QKX A;  5GJV B;  2FPE A;  1X6G A;  1U5S A;  1UJY A;  2KT1 A;  1ZSG A;  3ZL7 C;  1Y57 A;  2LJ3 A;  3VRZ A;  2C0O A;  2F2W A;  2K79 A;  4RTX A;  2HEQ A;  2LMJ A;  3LH5 A;  2MIO A;  2V1R A;  1W1F A;  1NLO C;  4JPB W;  1BU1 A;  3QWY A;  2FRY A;  2J06 A;  1HSQ A;  2AKL A;  2KXC A;  1V1C A;  2DL8 A;  3I5R A;  1PWT A;  5IHI A;  4RTT A;  4D8K A;  1QWE A;  2YUO A;  1J3T A;  1GCP A;  1AZE A;  4WCI A;  4GBQ A;  4X1V A;  1I0C A;  2SEM A;  2KRO A;  2FO0 A;  2KYM A;  3THK A;  4F17 A;  2YSQ A;  1WX6 A;  2KGT A;  1FYN A;  2VVK A;  4E6R A;  2LJ0 A;  1ZUU A;  1JQQ A;  1HJD A;  4JZ3 A;  1AOJ A;  2I0N A;  3VS4 A;  1K9A A;  2DL4 A;  2LQW A;  1IO6 A;  2ROT A;  4A63 B;  1BBZ A;  2DM1 A;  3M0P A;  1QWF A;  4OML A;  2DF6 A;  3VS1 A;  4QT7 A;  2J05 A;  1RLQ C;  1WI7 A;  1XOV A;  2LZ6 B;  1OEB A;  2PNI A;  2ED1 A;  2XMF A;  4AFS C;  1U06 A;  2GTO A;  1PHT A;  2NUZ A;  3UAT A;  1CSK A;  1AEY A;  1X27 A;  1KIK A;  2MCN A;  1T3S A;  2EYY A;  2EPD A;  2F2X A;  4Z88 A;  3I35 A;  4JZ4 A;  2AZS A;  3U23 A;  2JS0 A;  1ZX6 A;  1K76 A;  2L3Q A;  1NEB A;  1GFD A;  1GL5 A;  3O5Z A;  1NM7 A;  2A37 A;  2AK5 A;  2DYB A;  2OAW A;  5FW9 A;  1YCS B;  2LJ1 A;  1TUD A;  2O88 A;  2PTK A;  2KYB A;  2QDL A;  2DLP A;  2A28 A;  2DL3 A;  1Y0M A;  1I1J A;  1K0S A;  1TUC A;  2CSI A;  3VS7 A;  2DRK A;  4KRT A;  1SEM A;  1M8M A;  1AZG B;  2EYW A;  1MV3 A;  2JM9 A;  5HCK A;  4CC7 A;  2RQT A;  1U3O A;  5FWB A;  1ZLM A;  2EQI A;  4J9I A;  4OMM A;  4M4Z A;  1AWJ A;  1SHF A;  1TG0 A;  4RUG A;  2EGA A;  2EGE A;  1W70 A;  3VS0 A;  2C0T A;  1SHG A;  1YN8 A;  1WYX A;  1YWP A;  4HVV A;  2L2P A;  4DEY A;  2EVR A;  1ABQ A;  4CC4 B;  1M3B A;  2K9G A;  2GQI A;  1UUE A;  1SSH A;  1JXO A;  3M0Q A;  4J9F A;  2RF0 A;  2ABL A;  2KRS A;  2KXD A;  2CSQ A;  3H0I A;  5I22 A;  1E6G A;  4FSS A;  2GBQ A;  1Z9Q A;  3EG2 A;  3NGP A;  5IXB A;  3CQT A;  3M0S A;  4AG1 C;  1B3Q A;  1WDX A;  2J7I A;  1H92 A;  1ABO A;  1X2Q A;  4GLM A;  3TSW A;  4J9B A;  1M27 C;  2CT3 A;  2YDL A;  4DEX A;  1ZUY A;  4JJD A;  1JXM A;  3UA6 A;  2JS2 A;  2K6D A;  1UGV A;  2DL5 A;  2DE0 X;  2NWM A;  1PKT A;  2P4R A;  3VS5 A;  1NYG A;  4LUD A;  3FJ5 A;  2O9S A;  2ECZ A;  1NEG A;  1B07 A;  2J6K A;  1M3C A;  4ZNX A;  5GJW B;  2EBP A;  1LCK A;  3EG3 A;  4OMP A;  2FEI A;  1GBQ A;  4K11 A;  1AWX A;  1K0X A;  1AD5 A;  2ESW A;  3PE0 A;  4RTU A;  1JEG A;  3A98 A;  2OI3 A;  4LUE A;  4CC2 A;  1T3L A;  2E5K A;  1RI9 A;  2FG0 A;  1A0N B;  1KSW A;  1UE9 A;  1X6B A;  2EKH A;  1QCF A;  3EHQ A;  2W0Z A;  3EHR A;  2AKK A;  1SRL A;  2L3P A;  4Z8A A;  3ULR B;  2H8H A;  4RTW A;  3R6N A;  1GCQ A;  1WIE A;  2M51 A;  1OPK A;  2SRC A;  5ECA A;  1PNJ A;  1BB9 A;  2KT8 A;  2CH4 A;  1M30 A;  1X69 A;  2YT6 A;  2LQN A;  2KE9 A;  2L0A A;  2KBT A;  3M0R A;  1X43 A;  3NPF A;  4Y92 A;  3VS2 A;  3M0T A;  4RTV A;  1SRM A;  2ROL A;  5I11 A;  2L3S A;  4HVU A;  1PRL C;  2IIM A;  3I9Q A;  4CC3 A;  1E6H A;  2EYX A;  4J9H A;  2F2V A;  4OMQ A;  1GFC A;  1FMK A;  1MUZ A;  1NG2 A;  1SPK A;  3TVT A;  2LP5 A;  2GTJ A;  1RLP C;  2D0N A;  3SEM A;  4EIK A;  3EG1 A;  1MV0 B;  2X3W D;  3PVL A;  1RUW A;  1UHC A;  1WXU A;  2GGR A;  5EC7 A;  1GCQ C;  3KFV A;  3UF4 A;  2DBK A;  2O2O A;  2DNU A;  2DVJ A;  2JT4 A;  2CH4 W;  2JM8 A;  3H41 A;  4J9C A;  2BZY A;  1AVZ C;  2CT4 A;  2BZX A;  2YUN A;  1UDL A;  1Z9Z A;  1X2K A;  1OOT A;  5IHN A;  1K4U S;  1YP5 A;  2J6O A;  1UEC A;  2PZ1 A;  1AWO A;  2DMO A;  4J9E A;  1WA7 A;  2KRN A;  2RQW A;  3REB B;  1N5Z A;  2RQV A;  2KNB B;  2W10 A;  2YUQ A;  2CRE A;  1WLP B;  4RTY A;  2CUD A;  4J9G A;  1PKS A;  2BZ8 A;  4ESR A;  2JTE A;  1VA7 A;  3UA7 A;  2CDT A;  1S1N A;  2RNA A;  1WXT A;  3EG0 A;  4IIO A;  3M0U A;  2YUP A;  3I5S A;  4HVW A;  1JO8 A;  4AFU C;  2ENM A;  2DA9 A;  4J9D A;  2RQU A;  1CKB A;  5L23 A;  1QKW A;  1OPL A;  2DL7 A;  4AFZ C;  1OV3 A;  5IXF A;  2OJ2 A;  2B86 A;  2M0Y A;  3JV3 A;  3H0H A;  4OMN A;  2D1X A;  1ZUK A;  3NMZ C;  2X3X D;  2FPD A;  4D8D A;  1UTI A;  1H3H A;  4HXJ A;  1AWW A;  3RBB B;  1W6X A;  2JW4 A;  2EW3 A;  1G83 A;  2RPN A;  2VWF A;  1HD3 A;  2EGC A;  4JJC A;  4LE9 A;  1BK2 A;  1VYT A;  4Z89 A;  2DX1 A;  5IH2 A;  2GNC A;  1UFF A;  3VS6 A;  3NHN A;  1ZBJ A;  3REA B;  3RNJ A;  4R0K A;  4ORZ A;  2A08 A;  3GBQ A;  1UJ0 A;  3VRY A;  2D8H A;  3H0F A;  4F14 A;  2HBW A;  1YNZ A;  2JMA A;  3SHW A;  2RMO A;  3VS3 A;  3EGU A;  2VKN A;  2BTT A;  1T0H A;  4LN2 A;  1GBR A;  2A36 A;  2J6F A;  2DJQ A;  2LCS A;  1KJW A;  1UHF A;  2LNH B;  2AZV A;  1CKA A;  4F16 A;  4OMO A;  1NYF A;  2ED0 A;  2FPF A; 
#chains in the Genus database with same CATH topology
 3DLL A;  1UG1 A;  4C0G A;  1IRE B;  2K3B A;  2K4Y A;  1KG1 A;  1EZZ B;  2O31 A;  2DKG A;  4C8Q F;  3AHU A;  3QHS A;  4ELY C;  2DXC A;  2RHZ A;  2DIL A;  2RJD A;  1WQW A;  5KYU A;  3CCM A;  2KSS A;  5GAN 3;  4PJO F;  1ZA2 B;  2C0I A;  3O8V A;  4QKU A;  3MO8 A;  2HCK A;  1H8K A;  1VQP Q;  3KBG A;  3PVQ A;  2K5L A;  2P0P A;  1QKX A;  2IG0 A;  4FYW B;  1S72 T;  1U5S A;  4M7A A;  2GF7 A;  2Z0W A;  3MEA A;  3VRZ A;  4FW1 A;  2FYK A;  1V76 A;  3MEV A;  1OZ2 A;  1M2V B;  1OX9 A;  2QTV A;  1K8A C;  2MIO A;  4M7D E;  1W1F A;  4JPB W;  2EQM A;  4C92 D;  3VKI A;  2FRY A;  3OW2 A;  2J06 A;  1VQ7 T;  2DL8 A;  1PWT A;  2D9T A;  5KYY B;  7AT1 B;  3QDF A;  2DVE A;  1ZHI A;  3FC3 A;  3CXC A;  1ZSZ B;  4QVD A;  4FU6 A;  4ZGE B;  4M7A F;  1GCP A;  3OA6 A;  1I0C A;  2DD4 A;  2KRO A;  2KYM A;  3FRN A;  3EFR A;  1WX6 A;  2KGT A;  2P0K A;  3QII A;  3CMA A;  3G1J A;  4E6R A;  1ZUU A;  1HJD A;  2O4X B;  2BE7 D;  2HD0 A;  5HK0 A;  5GAN 8;  1TOV A;  3CME T;  4A63 B;  4PK4 A;  3JB9 J;  2RI3 A;  4C5E A;  4QT7 A;  2OTJ T;  1XOV A;  2KY9 A;  4ATO A;  3V7S A;  4CRI A;  4OB2 B;  2KI7 A;  2NUZ A;  2VXF A;  4X34 A;  1CSK A;  1VQ4 A;  1AEY A;  2DD5 A;  1X27 A;  2R57 A;  3PT9 A;  2F2X A;  3CCE T;  1S72 Q;  2QG9 B;  4WTO B;  3KUF A;  1QVF P;  3I35 A;  4PFP A;  4HCC A;  2QI2 A;  5FU6 C;  5KYN A;  1ZX6 A;  4MDX A;  2E41 A;  2RHX A;  2AK5 A;  2DYB A;  4KGZ B;  2GCX A;  1TUD A;  4BY6 C;  4M75 G;  1K8A R;  2PTK A;  1VQ7 Q;  1BI3 A;  2LC4 A;  3OS5 A;  2RJF A;  3G71 Q;  4N4H A;  2E6Z A;  2DL3 A;  3ZEH A;  2K2V A;  1I1J A;  1K0S A;  3TU4 K;  1ACM B;  3S3O A;  1RL2 A;  1VQ9 T;  3LWI A;  5HCK A;  2JM9 A;  3HL8 A;  1Q86 C;  2RQT A;  1U3O A;  3MEU A;  5FWB A;  5D6W A;  2EQI A;  2PQW A;  3CBP A;  1TG0 A;  4RUG A;  4OMF B;  3J7A F;  2EGA A;  1YJW A;  2COY A;  4M7D G;  2EVR A;  3LW5 E;  5CKH A;  1N6A A;  2WSE E;  4C5H A;  5FLX E;  4DBR A;  3CME Q;  1SSH A;  3CCU A;  4J8O A;  1R77 A;  1JXO A;  6AT1 B;  2OTJ Q;  1VIF A;  3J80 E;  3M0Q A;  1IHV A;  5LJ3 e;  2KXD A;  3EG9 B;  3CCE Q;  3VU3 C;  1JB0 E;  3M0S A;  1QW1 A;  5C0M A;  3RKX A;  1H92 A;  3TCJ A;  1X2Q A;  2VUB A;  1VQ6 A;  3TSW A;  2CT3 A;  2YDL A;  4XAX B;  2EYQ A;  4AMC A;  3UA6 A;  2E65 A;  2JS2 A;  3EFS A;  1M1K R;  1UGV A;  3OY9 A;  4C92 A;  3VS5 A;  5DLO A;  3JCM b;  3OYN A;  3CCS A;  1YCY A;  2J6K A;  3EG3 A;  1VQ9 Q;  2RHU A;  1QVP A;  2CKK A;  1GBQ A;  4XTX A;  2LVM A;  3PE0 A;  4RTU A;  3A98 A;  4DOV A;  1A0N B;  1UE9 A;  4M75 C;  2VGN A;  2DEQ A;  1QCF A;  2YXY A;  1X75 C;  3OSV A;  3X28 B;  3EHR A;  1SRL A;  3EFO B;  2L89 A;  3QBY A;  3JB9 F;  4PJM A;  3HTR A;  3HP9 A;  3VUB A;  4E7K A;  2M51 A;  4ZGD B;  4XU2 A;  1TH7 A;  3EH1 A;  4A4G A;  3C95 A;  3FB9 A;  5GMK h;  1BB9 A;  1KQ2 A;  4M77 D;  4RMO A;  5FRN A;  2QEX T;  2YT6 A;  4IKF A;  4QVC A;  5LJ5 e;  2XI9 A;  4NS5 A;  2KE9 A;  4LDY A;  1VQ8 T;  3VS2 A;  1JJ2 A;  3HRT A;  3M0T A;  4M7D C;  1B7T A;  4FT2 A;  4M78 F;  4DA4 A;  3M53 A;  4XU0 A;  1PRL C;  2IIM A;  2QA4 A;  4PNO A;  1K8A U;  4A53 A;  1NJI R;  2F5K A;  4J9H A;  1M5Q 1;  2RHI A;  2WAC A;  3TVT A;  2XDB A;  2LP5 A;  1RLP C;  3CC4 T;  1KQS P;  1YIT T;  2E1H A;  4EIK A;  9ATC B;  3MHX A;  1RUW A;  1UHC A;  1YJN T;  2K3X A;  2G3R A;  2DAQ A;  2B8A A;  3UF4 A;  3OYF A;  2DBK A;  1KD1 R;  1LPL A;  3JB9 I;  1VQ5 T;  1N9R A;  3H41 A;  3FIF A;  4J9C A;  2BZY A;  4PJN A;  4JRQ A;  4JJN K;  4KUD K;  1OOT A;  2LDM A;  1K4U S;  1YP5 A;  1QVG A;  1LJO A;  2J6O A;  5GAN h;  1K73 C;  3PIP A;  2PZ1 A;  1AWO A;  2DMO A;  2RI5 A;  1LOJ A;  5GAN g;  1WA7 A;  3REB B;  3V8J A;  1VQK T;  2OTL A;  5D7U A;  4C8Q G;  2QYZ A;  2W10 A;  2YUQ A;  2QEX Q;  5GAO n;  3A8H B;  2FVU A;  4ESR A;  1VQ8 Q;  2RH2 A;  1WGS A;  2QQS A;  2DER A;  1S1N A;  1Q7Y R;  4N4G A;  5FRO A;  2YUP A;  1W4S A;  2JJ9 A;  3I5S A;  1M1K U;  2EQJ A;  5LL6 S;  2ENM A;  2RQU A;  3EGD A;  2DL7 A;  3L2V A;  3OS1 A;  2P4T A;  2OJ2 A;  3CD6 T;  3CC4 Q;  3TQ7 P;  3A8M B;  3NMZ C;  3X20 B;  3L1A A;  3VUZ A;  2JTF A;  2L3R A;  1YJ9 T;  4OP0 A;  1Q81 R;  3P8D A;  2VWF A;  5KCO A;  1YJN Q;  4JJC A;  1QP3 A;  1BK2 A;  2LT4 A;  3E9F A;  2DX1 A;  2MMP A;  5LJ3 d;  2GNC A;  1UFF A;  1VQN A;  1ZBJ A;  3RNJ A;  4R0K A;  1VQ5 Q;  3ASK A;  2RD1 A;  1UJ0 A;  1BKB A;  1MHN A;  1OX8 A;  2MPX C;  2RA2 A;  1UGP B;  3QSU A;  2RMO A;  3VS3 A;  3X26 B;  4OGE A;  5CK9 A;  1GBR A;  3OYJ A;  2ZZD A;  3CCM T;  1YI2 A;  2MWP A;  4HCB A;  3M4G A;  3I56 A;  5KCH A;  2DXT A;  2LCS A;  3V7R A;  3GP8 A;  5GAM h;  4M7A G;  3DLM A;  1VQK Q;  2BE9 B;  2JMC A;  2EQU A;  3BE3 A;  2HQE A;  4M77 A;  3OBY A;  4BY6 B;  4AG2 C;  2MYS A;  3MJX A;  2KR3 A;  2JXB A;  1WJQ A;  2MF2 A;  3RMS A;  2CGH A;  2DTH A;  3BFM A;  4LD9 K;  1PRM C;  4J6W A;  3RKY A;  2ZPH B;  2PUK B;  4J83 A;  3FEO A;  5CKB A;  4AFQ C;  3RDV A;  1NJI U;  2RN8 A;  3HRU A;  1T0J A;  2LX7 A;  2RM4 A;  1D0Z A;  1PSE A;  1VYU A;  5KE2 A;  1G3Y A;  4PFZ A;  3CCV T;  4RTZ A;  4IIM A;  3QWX X;  4C8Q C;  3OSS C;  5AYF A;  5KYY A;  3C0C A;  2EJG A;  1KFZ A;  2MOX A;  2RQR A;  4M77 F;  5D6Y A;  2DZC A;  2ZGW A;  1YJ9 Q;  4RG2 A;  3QUI A;  4C5I A;  2HDA A;  1E7O A;  5IHK A;  3H8Z A;  2RK1 A;  1KD1 U;  2K2M A;  2V1Q A;  2KEA A;  2RJE A;  4LNP A;  4JJB A;  1WZO A;  1X6G A;  4PJO C;  1WHJ A;  5LJ5 d;  1UJY A;  3ZL7 C;  1Y57 A;  2LJ3 A;  4C92 E;  1Y96 A;  2K79 A;  4KH0 B;  2HEQ A;  3CMA T;  1BI0 A;  4L5G A;  3QWY A;  2DET A;  1TTH B;  3CCM Q;  4BDZ A;  3GIB A;  2KXC A;  4IUT A;  3V8L A;  3HSB A;  5IHI A;  2E6N A;  1KQ1 A;  4X9D A;  4FIB A;  4D8K A;  2CZ6 B;  5HY6 A;  2GQV A;  5LJ3 g;  1PC0 A;  1EIF A;  3INZ A;  4WCI A;  4X1V A;  1VQ4 T;  2HMA A;  5EG2 A;  2E3I A;  1WHL A;  2V26 A;  1VOM A;  2COZ A;  2X4J A;  5A0D A;  4UC4 A;  5FRM A;  2VVK A;  4RCB A;  2LJ0 A;  4E7H A;  1JQQ A;  3PIO A;  3JCM J;  2D6F A;  5KH6 A;  4M7A C;  1Y07 A;  3VS4 A;  4TVR A;  3MCA B;  2DL4 A;  1IO6 A;  3L2Q A;  2OAU A;  3M0P A;  1QWF A;  4M75 B;  1Q81 U;  4BUG A;  3SWN A;  3VS1 A;  1RLQ C;  1WI7 A;  2LZ6 B;  2PNI A;  2ED1 A;  4AFS C;  1U06 A;  1W2B P;  3UAT A;  1QP2 A;  3RIR A;  5CKF A;  2ZCF B;  1RAD B;  1T3S A;  4MML A;  1RAH B;  3OMG A;  1BI2 A;  3NTI A;  4E7Z A;  3JCM e;  1N8R C;  2Y4Y A;  1GFD A;  4JRP A;  1GL5 A;  3O5Z A;  5CVI A;  1NM7 A;  2A37 A;  5CO7 A;  3CMA Q;  4M7D B;  2OAW A;  3JCM f;  3JAM E;  5FW9 A;  1TSF A;  2QXF A;  1JJ2 P;  2O88 A;  1FMV A;  1WJR A;  1YIJ A;  5GMK j;  4GY5 A;  4OB1 B;  3DB3 A;  3CCU T;  1U8R A;  2QQA A;  4MMK A;  1TUC A;  1WNL A;  1I5L A;  1M8V A;  3VS7 A;  5CCA A;  4QVZ A;  4KRT A;  1M8M A;  2QDY B;  4V2S A;  5LJ5 g;  2LRQ A;  1VQ4 Q;  4J9I A;  4M75 E;  1KQS S;  3QYG B;  1HYO A;  2HSE B;  4C92 G;  1C6V X;  2JN0 A;  1D0Y A;  2LNV A;  1VQ6 T;  1WYX A;  2M9U A;  2K9G A;  2GQI A;  2LCC A;  3A5Z B;  3BDU A;  5AT1 B;  2A7Y A;  2DJZ A;  3WXM B;  2RF0 A;  3CCS T;  4JRI A;  2QTX A;  2YRC A;  4DBF A;  5I22 A;  3LX7 A;  2GBQ A;  4RG8 A;  1K9M C;  2K5I A;  3JB9 D;  3M58 A;  3G71 T;  1I4K 1;  3CQT A;  4AG1 C;  1B3Q A;  4II1 A;  3AT1 B;  3EFO A;  4J9B A;  4DEX A;  3DKM A;  4XU3 A;  2WSC E;  1IRX A;  4PKC C;  1YJW Q;  4JJD A;  5KYX B;  2DL5 A;  4X9C A;  4E2F B;  1NYG A;  4YTL A;  3QJ6 A;  3G6E A;  2VYT A;  3CCU Q;  4M78 D;  5M9O A;  4XTW A;  1B07 A;  1PD0 A;  2JTM A;  1BCM A;  4ZNX A;  5GJW B;  1M9S A;  1LCK A;  4RKU E;  2XIC A;  4OMP A;  3ZFJ A;  5D6X A;  4J7I A;  1AWX A;  1D3B A;  1JEG A;  5GAN 7;  4CC2 A;  2H3J A;  3HKS A;  1RI9 A;  2FG0 A;  3Q1J A;  2EKH A;  4OB0 B;  3CC2 A;  1U1S A;  3FJP A;  4N4I A;  5KYW A;  1VQ6 Q;  2AKK A;  2QA4 T;  5GAO r;  4Z8A A;  1BI1 A;  3R6N A;  1GCQ A;  1OPK A;  3V8K A;  2SRC A;  5ECA A;  1R0B G;  3CCS Q;  2V8K A;  3S6W A;  4C92 C;  1Q95 G;  2LQN A;  2XHC A;  2NUP B;  3I55 A;  4F7U E;  2LQK A;  3NFC A;  1M1G A;  4FYX B;  5GAM f;  3T9N A;  1SRM A;  2EIF A;  2L3S A;  4HVU A;  3EGX B;  4CC3 A;  4F04 B;  2EYX A;  2F2V A;  1SSF A;  4IUQ A;  3QZ9 B;  1FMK A;  4J6X A;  1GXI E;  4FW2 A;  5GAM j;  4NOY A;  2D0N A;  3SEM A;  2YRD A;  3JSC A;  3OYA A;  1C0M A;  2OTL T;  4C8Q B;  2E10 A;  2HNI A;  2M1H A;  3OYD A;  3HHT B;  4DQ2 A;  3CBM A;  3OYH A;  4JS5 A;  1FXX A;  2DNU A;  3OS2 A;  2D0Q B;  1TXQ A;  4NL2 A;  1AVZ C;  2BZX A;  2YUN A;  3LYI A;  1X2K A;  2KMT A;  3G4S A;  3JCM d;  3UT1 A;  1Y71 A;  2QA4 Q;  1PCX A;  2DEU A;  3MET A;  1UEC A;  3DB4 A;  2GFA A;  2FZG B;  1PD1 A;  1KHC A;  1D1A A;  3A8L B;  4QQG A;  2RQW A;  2RQV A;  1M90 C;  1FWZ A;  2KNB B;  4OVA A;  3S3N A;  2FB7 A;  4B9X A;  2EAY A;  5KYU B;  3RR6 A;  1VA7 A;  3OYK A;  3UA7 A;  2PU9 B;  1QCO A;  3BW1 A;  3EG0 A;  3QKJ A;  4AFU C;  2L5Q A;  2DA9 A;  4J9D A;  4C8Q E;  1Q82 R;  3OYL A;  5L23 A;  1OPL A;  2HQX A;  3ZBD A;  2M0O A;  4M77 G;  5IXF A;  3PGG A;  4OMN A;  1PSF A;  5CAI A;  1IHW A;  1Q86 R;  4R55 A;  4D8D A;  1H3H A;  4M7A B;  1H64 1;  1AWW A;  4M78 A;  2NLU A;  4BI8 B;  4PLL A;  4PJO E;  2OTL Q;  3ER0 A;  3OYI A;  1HD3 A;  2EGC A;  4D6W A;  4F7U G;  1IZ6 A;  5IH2 A;  5CQX A;  2VAS A;  2L8D A;  1NPP A;  1P92 A;  4L59 A;  4MZM A;  3GBQ A;  4C0D C;  1G8X A;  1W2B S;  1YNZ A;  2VXE A;  4PLI A;  4ME7 A;  1XNI A;  1T0H A;  5GAN 2;  2DJQ A;  1VQO A;  4KUL A;  4KGX B;  1UHF A;  5J26 A;  2DYI A;  4KT0 E;  3RES A;  2ZPG B;  2K3Y A;  4N0A C;  4OMO A;  4JZ4 A;  4EMK A;  2JNG A;  2Y90 A;  2DXU A;  2DXB A;  5CR2 A;  2YRV A;  1MMG A;  2KRM A;  1K9M U;  4C5G A;  1YFN A;  4PJL A;  5HKC A;  2DRM A;  3QXE B;  1I07 A;  1VQN Q;  1JBM A;  2EJF A;  1OU9 A;  2OX7 A;  4M7A E;  4HT9 A;  4B9W A;  2E12 A;  2CP2 A;  2K7A A;  1O9S A;  3IQL A;  2O9V A;  1QMC A;  1QLY A;  1SF9 A;  1N9S A;  2PVD B;  2C06 A;  1WXB A;  1GRI A;  1YI2 Q;  1VYV A;  5IT9 E;  4BI3 A;  3I56 Q;  3CEY A;  1I5O B;  4EMG A;  1OQK A;  5FU7 C;  1R8O B;  1OUL A;  4AT1 B;  1G3W A;  2CUB A;  1N27 A;  4JDS A;  4OB3 B;  1OI1 A;  1YWO A;  5GJV B;  3CC7 A;  2FPE A;  3C94 A;  3H9N A;  4FSX A;  4M77 C;  4RTX A;  3N5B B;  5J39 A;  1HXD A;  3S3M A;  1NLO C;  3OW2 P;  3GNG A;  1BU1 A;  2JOY A;  3JB9 H;  5CKD A;  3L42 A;  2AKL A;  2Y4X A;  2COW A;  3UWN A;  4ELZ C;  3CBO A;  1Y7X A;  3CXC P;  1D1C A;  4PJO G;  2P84 A;  4Z02 A;  1J3T A;  2WSF E;  4Y91 A;  3GLX A;  2AIR B;  2HL3 A;  2CP0 A;  2SEM A;  3THK A;  2XKO C;  3MEW A;  1FMW A;  1TU0 B;  4P5N A;  4A4E A;  2EFI A;  2K5F A;  2HL5 C;  4JZ3 A;  1AOJ A;  2I0N A;  1Q86 U;  2ROT A;  2DTO A;  1BBZ A;  2DM1 A;  5HK3 A;  2XDD A;  4JUV A;  4IUR A;  1YIJ T;  2DF6 A;  2YLB A;  4FL6 A;  5GAO m;  1OEB A;  2XMF A;  1PG5 B;  1WHH A;  8AT1 B;  4E7L A;  2X4X A;  2PVO B;  5FU6 B;  1QVF S;  3GNF B;  2RHY A;  4M7D F;  4BI4 A;  2AZS A;  3P8B B;  1AHJ B;  2HKN A;  1K73 R;  3E19 A;  4C92 B;  1K76 A;  1NEB A;  4O6J A;  3QYH B;  3JCM V;  4LDW A;  1C1A A;  1JRI A;  1M2V A;  2A28 A;  2QQB A;  1Y0M A;  2F69 A;  3PMT A;  3RMQ A;  2EJ9 A;  2MK5 A;  3PTA A;  1AZG B;  4CC7 A;  1MV3 A;  3SWN C;  4J5Y A;  4R56 A;  3A8G B;  3PNW C;  4M4Z A;  4OMM A;  1UGS B;  1XJW B;  1SHF A;  3QG1 A;  2JVV A;  1ZSZ A;  2EQK A;  2KK4 A;  1W70 A;  4LDX A;  3CCJ A;  2C0T A;  1SHG A;  3TRE A;  1YWP A;  5GAN 5;  1VQL A;  1ABQ A;  3E9G A;  2CP6 A;  5A2Q E;  2ATC B;  3PMI A;  3SDZ A;  4VUB A;  1YIJ Q;  5A0L A;  3M55 A;  2O4X A;  1MGQ A;  4J9F A;  3G6E T;  2X4Y A;  2F5T X;  3H6Z A;  1YHQ A;  2RK2 A;  4CI0 C;  1G3S A;  5A0G A;  1Z9Q A;  3EG2 A;  1LVK A;  1Q82 C;  5IXB A;  3GPL A;  2E3H A;  4Y28 E;  5LJ3 h;  1PM3 A;  1WDX A;  2NUT B;  1OYX A;  2E64 A;  2XU8 A;  1M27 C;  3SFM A;  4ZTF A;  3M5A A;  1ZUY A;  4ZN1 A;  1JXM A;  4M78 E;  2NWM A;  5GMK i;  1PKT A;  3FJ5 A;  3ME9 A;  2QGF B;  2O9S A;  4BAC A;  1NEG A;  3VYH B;  3CPW A;  1M3C A;  3OMC A;  2NUP A;  2X51 A;  1IGU A;  2X4W A;  4LD6 A;  1K0X A;  3CCR A;  1G3T A;  2OI3 A;  1V29 B;  2A0F B;  4KGV B;  4LUE A;  2E5K A;  1KSW A;  1X6B A;  5GMK e;  1B34 B;  3EHQ A;  3L2R A;  1OZ3 A;  3C12 A;  3OB9 A;  3ULR B;  4J6Y A;  4HKE A;  2H8H A;  4C0D B;  2CP7 A;  2CZ0 B;  4C0Z A;  1PNJ A;  2QQR A;  3G6E Q;  4L6V 5;  3M54 A;  2CH4 A;  1LNX A;  1M30 A;  3OYC A;  1YJW T;  4KBM B;  3CD6 A;  2L0A A;  1K73 U;  3BY7 A;  5I2M A;  2KBT A;  1X43 A;  4B6M A;  4E7I A;  2HAX A;  1HK9 A;  4RTV A;  2ROL A;  3CCL A;  5I11 A;  3OYY A;  3EG9 A;  5LJ5 h;  3CCQ A;  2RI2 A;  4HA8 A;  2QK0 A;  1E6H A;  3CC2 Q;  3G4S T;  2E4H A;  2V8I A;  1NG2 A;  1SPK A;  2PUO B;  3C4S A;  2GTJ A;  4E7J A;  1MND A;  3BDL A;  2BKD N;  1KQS A;  3JB9 G;  1RAA B;  3EG1 A;  4XK8 E;  3JCM c;  2LCL A;  4KUI A;  2XD0 A;  2GGR A;  4E47 A;  1GCQ C;  1RAI B;  1WHM A;  3KFV A;  3I55 Q;  2DVJ A;  2JT4 A;  2EWN A;  2ZPE B;  5GAN e;  3RER A;  2CH4 W;  5FU7 B;  5CIU A;  2CT4 A;  3FLG A;  3VV0 A;  5IAY A;  1QVG P;  3A8O B;  1VQM A;  2PVG B;  5IHN A;  1TWB A;  2VC8 A;  5GAN f;  4M78 G;  4ZGJ B;  4M77 B;  2YHT A;  1WJS A;  4J9E A;  2KRN A;  2A3L A;  1RAC B;  4XQ3 A;  1X01 A;  3E2U A;  3CCV A;  2CRE A;  1WLP B;  3NTH A;  5GAN j;  3OW2 S;  1N8R R;  4O5V A;  2CUD A;  4F7U B;  3LWH A;  4FT4 A;  2JTE A;  1KC8 C;  1WXT A;  3M0U A;  3CXC S;  4HVW A;  1JO8 A;  4FYY B;  3M59 A;  4JLG A;  4QQ6 A;  1QKW A;  3G4S Q;  2QQ9 A;  2B86 A;  5DM7 R;  3H0H A;  4BB7 A;  2FHD A;  3LGF A;  3SB2 A;  1VQO T;  1IXD A;  1UTI A;  4HXJ A;  1W6X A;  2RPN A;  1Y96 B;  1BIA A;  3EH2 A;  4M77 E;  3NTK A;  3NHN A;  2ZPF B;  4JS4 A;  5GMK m;  1O75 A;  2FL7 A;  3HRS A;  2A08 A;  5GAN 6;  4PJJ A;  3VRY A;  4EDU A;  2VV5 A;  1RAG B;  3JCM W;  2D8H A;  2HBW A;  5GAM e;  4IUP A;  3SHW A;  3CPF A;  3EGU A;  2VKN A;  2BTT A;  2A36 A;  2J6F A;  2FZK B;  3RKW A;  2LNH B;  1K9M R;  2AZV A;  1VQP A;  3VYG A;  4F16 A;  1M1K C;  3MKD A;  2FRW A;  1VUB A;  5FWC A;  5GAO q;  1G5V A;  4HCK A;  2M02 A;  2IPO B;  1ARK A;  2AT1 B;  3QO3 A;  2DBM A;  5J3B A;  1Q82 U;  3CC7 T;  3MP1 A;  4JLI A;  4M78 C;  1WFW A;  1G2B A;  1K1Z A;  2AHJ B;  2V8J A;  1KC8 R;  3SWN B;  1NE8 A;  1JU5 C;  1NLP C;  2MWO A;  2CZ1 B;  2EYZ A;  2QAZ A;  3M4Y A;  4KH1 B;  2D8J A;  3SD4 A;  2ZAE A;  3OYB A;  1EFN A;  2HSP A;  1UGR B;  1VQO Q;  3OYM A;  1IB8 A;  1M1F A;  3QPH A;  1M3A A;  3TSZ A;  4PJO B;  2G6F X;  4M75 D;  1UGQ B;  1EX4 A;  3V7C A;  5GAO l;  2KT1 A;  3HPW A;  1ZSG A;  2KVQ G;  4EMK C;  1NZ9 A;  3UDC A;  2C0O A;  2F2W A;  2EKO A;  2F1L A;  2MI6 A;  5GAO p;  2LMJ A;  3LH5 A;  4EPC A;  2V1R A;  5DLQ E;  2KQW A;  3PFS A;  4NL3 A;  2VB6 A;  1HSQ A;  5LJ3 f;  1KK7 A;  1V1C A;  3I5R A;  1VQN T;  3OYE A;  1NJI C;  4XU1 A;  4M7D D;  4WF2 A;  1N8R U;  2DTI A;  4FM4 B;  4RTT A;  2ZPI B;  1M4Z A;  1QWE A;  2YUO A;  1WHK A;  1I8F A;  3L2W A;  3F70 A;  3JCM X;  1AZE A;  1S72 A;  4GBQ A;  1WQ7 A;  1YI2 T;  5LJ3 j;  2FO0 A;  4F17 A;  2YSQ A;  3I56 T;  3CC7 Q;  1XQH A;  3CPW P;  1BIB A;  1FYN A;  2BUD A;  5GAN d;  4C0F A;  1KD1 C;  1K9A A;  1VQ7 A;  3G71 A;  2LQW A;  2MAM A;  2XID A;  4FCY A;  3LGL A;  2KDS A;  4OML A;  4A4H A;  4IUU A;  2J05 A;  3QZ5 B;  5CKE A;  1KHI A;  4BD3 A;  2GTO A;  1PHT A;  2CYZ B;  1W2B A;  4C92 F;  2LTO A;  8ATC B;  1M2O A;  2DO3 A;  4MZT A;  1KIK A;  3HFO A;  2MCN A;  2EYY A;  2EPD A;  4Z88 A;  1ZA1 B;  4JRK A;  3OBW A;  3U23 A;  2JS0 A;  2YWW A;  1DJ7 B;  1MMA A;  1RAF B;  2CP3 A;  2L3Q A;  1U1T A;  2CP5 A;  3J81 E;  3CCJ T;  3CME A;  1Q7Y C;  1JJ2 S;  1YCS B;  1VQL T;  2LJ1 A;  1M90 R;  2DPP B;  5I21 A;  3JCM h;  2KYB A;  2QDL A;  2DFU A;  2OTJ A;  2DLP A;  2O01 E;  5LJ5 f;  1D3B B;  1MMN A;  3R6O A;  3JCM g;  4PL6 A;  2CSI A;  1BYM A;  1RAE B;  2DRK A;  1SEM A;  4LDV A;  3L2U A;  1YHQ T;  2EYW A;  4HCZ A;  3CCE A;  4BE2 A;  1ZLM A;  5KYW B;  2NUT A;  1KC8 U;  1AWJ A;  1TUG B;  1Q81 C;  5LJ5 j;  2EGE A;  3VS0 A;  2LT1 A;  3M9Q A;  2FZC B;  1YN8 A;  4DBQ A;  4HVV A;  1TS9 A;  2L2P A;  1XTD A;  4DEY A;  4CC4 B;  1M3B A;  5GAM d;  3KXT A;  1UUE A;  2LQ8 A;  3RUX A;  4DBH A;  2NYS A;  1VQ9 A;  3URG A;  1QVG S;  2ABL A;  2KRS A;  3LH0 A;  2M16 A;  2CSQ A;  3A1P A;  3H0I A;  4M75 A;  1E6G A;  3M57 A;  4FSS A;  4Q5W A;  3NGP A;  1RI0 A;  3OQ5 A;  1B34 A;  2J7I A;  3CCR T;  1YBY A;  1ABO A;  4GLM A;  1NBE B;  3JCM P;  3CCJ Q;  2HZY A;  2JUF A;  2K6D A;  4A4F A;  3VJP A;  1VQL Q;  1ZSZ C;  2RO0 A;  2DE0 X;  1D1B A;  2P4R A;  4RCC A;  4LUD A;  2K57 A;  2YLC A;  2HQH A;  2ECZ A;  1D09 B;  3X25 B;  4ZN3 A;  4M7D A;  4BE0 A;  2XDP A;  4M75 F;  3OS0 A;  4ZTJ A;  2EBP A;  3UPU A;  4N0A A;  2FEI A;  1YHQ Q;  3EAE A;  2R58 A;  4K11 A;  1AD5 A;  3OYG A;  2ESW A;  3LLR A;  4C8Q D;  2HKQ B;  2XG8 D;  1YIT Q;  1T3L A;  1VIE A;  3CCL T;  2W0Z A;  3CCQ T;  2L3P A;  3D7S B;  1F1B B;  4J7F A;  3QJY A;  1UEB A;  4RTW A;  1WIE A;  3FDR A;  4PJO D;  2P0Q A;  1QVF A;  4MZP A;  2KT8 A;  5IN1 A;  4PFO A;  1X69 A;  4DOW A;  5C6S A;  3GOX A;  4XTV A;  3M0R A;  3HFN A;  3NPF A;  4Y92 A;  2X9H A;  3CCR Q;  4MDW A;  1OU8 A;  1M90 U;  3I9Q A;  2RJC A;  4QQD A;  1R0C B;  5GAM g;  4OMQ A;  1VQM T;  1GFC A;  2XK0 A;  1MMD A;  4M78 B;  3L2Z A;  1MUZ A;  2CZ7 B;  2DIG A;  1MV0 B;  2X3W D;  2QEX A;  4LDU A;  3MP8 A;  3PVL A;  5KYX A;  4HT8 A;  2QAS A;  4F7U A;  1WXU A;  1H3Z A;  4XTZ A;  1VQ8 A;  5EC7 A;  4FYV B;  2R5A A;  4A4K A;  4M7A D;  3CD6 Q;  4QW2 A;  2O2O A;  2JM8 A;  3CCL Q;  1WHG A;  3TEE A;  1UDL A;  1Z9Z A;  3MP6 A;  3G7Z A;  5CQY A;  3CCQ Q;  1UB4 A;  4EMK B;  2IVW A;  5GMK l;  3CC4 A;  1YIT A;  2RB6 A;  2E70 A;  2ZPB B;  2DZ9 A;  4EMH A;  2H3E B;  4F7U F;  1YJN A;  1N5Z A;  2LX9 A;  4LXC A;  3CC2 T;  1QQJ A;  3MPU B;  4RTY A;  4E7S A;  4J9G A;  2KAF A;  4GLK A;  1PKS A;  2BZ8 A;  1VQ5 A;  1ZQ1 A;  5GAN 4;  2CDT A;  2RNA A;  4A54 A;  4IIO A;  2DK3 A;  1SG5 A;  2X35 A;  3WVE B;  1CKB A;  1QCN A;  4OF1 A;  5KE3 A;  2DIQ A;  3GF5 A;  5L8R E;  1IGQ A;  1MNE A;  2HBP A;  3QDR B;  4AFZ C;  1VQM Q;  1OV3 A;  1Q7Y U;  4OGC A;  2M0Y A;  3JV3 A;  3I55 T;  5I2S A;  2D1X A;  1ZUK A;  3EGX A;  1VQK A;  3CPW S;  2X3X D;  2FPD A;  4XTU A;  1NPR A;  1WPY A;  1SKU B;  2I2L A;  1FX7 A;  3RBB B;  2JW4 A;  2EW3 A;  1VQP T;  1G83 A;  1RAB B;  4LE9 A;  3CCV Q;  1VYT A;  4Z89 A;  1BCO A;  2E5Q A;  1I81 A;  3JRZ A;  3JCM Q;  3VS6 A;  2CS7 A;  3REA B;  4ORZ A;  4C8Q A;  1ZBX A;  2BIV A;  1X6O A;  4IUV A;  2VGM A;  1D0X A;  3H0F A;  4F14 A;  4XTY A;  2JMA A;  2R5M A;  3X24 B;  4LN2 A;  3E1S A;  3EGD B;  3P8H A;  2QGG A;  4BDY A;  4BE1 A;  1KJW A;  5DY9 A;  2GFU A;  3WVD B;  1AT1 B;  1YJ9 A;  2JZ2 A;  4ANJ A;  4PJO A;  1CKA A;  3M56 A;  1NYF A;  2ED0 A;  2FPF A; 
#chains in the Genus database with same CATH homology
 2JMC A;  1UG1 A;  2FRW A;  5FWC A;  2K3B A;  4HCK A;  4AG2 C;  2O31 A;  2KR3 A;  2JXB A;  2KRM A;  1ARK A;  2DBM A;  2DRM A;  1I07 A;  1PRM C;  1WFW A;  1G2B A;  4AFQ C;  1K1Z A;  2DIL A;  2RN8 A;  1T0J A;  2LX7 A;  2K7A A;  1VYU A;  3IQL A;  1JU5 C;  1NLP C;  2O9V A;  2EYZ A;  2D8J A;  4RTZ A;  1QLY A;  4IIM A;  3QWX X;  1EFN A;  1WXB A;  3C0C A;  1GRI A;  2HSP A;  2C0I A;  1VYV A;  1KFZ A;  2MOX A;  2HCK A;  2RQR A;  1H8K A;  1M3A A;  3TSZ A;  2HDA A;  1E7O A;  5IHK A;  2G6F X;  2K2M A;  3PVQ A;  2CUB A;  2KEA A;  2V1Q A;  4LNP A;  4JJB A;  1YWO A;  1QKX A;  5GJV B;  2FPE A;  1X6G A;  1U5S A;  1UJY A;  2KT1 A;  1ZSG A;  3ZL7 C;  1Y57 A;  2LJ3 A;  3VRZ A;  2C0O A;  2F2W A;  2K79 A;  4RTX A;  2HEQ A;  2LMJ A;  3LH5 A;  2MIO A;  2V1R A;  1W1F A;  1NLO C;  4JPB W;  1BU1 A;  3QWY A;  2FRY A;  2J06 A;  1HSQ A;  2AKL A;  2KXC A;  1V1C A;  2DL8 A;  3I5R A;  1PWT A;  5IHI A;  4RTT A;  4D8K A;  1QWE A;  2YUO A;  1J3T A;  1GCP A;  1AZE A;  4WCI A;  4GBQ A;  4X1V A;  1I0C A;  2SEM A;  2KRO A;  2FO0 A;  2KYM A;  3THK A;  4F17 A;  2YSQ A;  1WX6 A;  2KGT A;  1FYN A;  2VVK A;  4E6R A;  2LJ0 A;  1ZUU A;  1JQQ A;  1HJD A;  4JZ3 A;  1AOJ A;  2I0N A;  3VS4 A;  1K9A A;  2DL4 A;  2LQW A;  1IO6 A;  2ROT A;  4A63 B;  1BBZ A;  2DM1 A;  3M0P A;  1QWF A;  4OML A;  2DF6 A;  3VS1 A;  4QT7 A;  2J05 A;  1RLQ C;  1WI7 A;  1XOV A;  2LZ6 B;  1OEB A;  2PNI A;  2ED1 A;  2XMF A;  4AFS C;  1U06 A;  2GTO A;  1PHT A;  2NUZ A;  3UAT A;  1CSK A;  1AEY A;  1X27 A;  1KIK A;  2MCN A;  1T3S A;  2EYY A;  2EPD A;  2F2X A;  4Z88 A;  3I35 A;  4JZ4 A;  2AZS A;  3U23 A;  2JS0 A;  1ZX6 A;  1K76 A;  2L3Q A;  1NEB A;  1GFD A;  1GL5 A;  3O5Z A;  1NM7 A;  2A37 A;  2AK5 A;  2DYB A;  2OAW A;  5FW9 A;  1YCS B;  2LJ1 A;  1TUD A;  2O88 A;  2PTK A;  2KYB A;  2QDL A;  2DLP A;  2A28 A;  2DL3 A;  1Y0M A;  1I1J A;  1K0S A;  1TUC A;  2CSI A;  3VS7 A;  2DRK A;  4KRT A;  1SEM A;  1M8M A;  1AZG B;  2EYW A;  1MV3 A;  2JM9 A;  5HCK A;  4CC7 A;  2RQT A;  1U3O A;  5FWB A;  1ZLM A;  2EQI A;  4J9I A;  4OMM A;  4M4Z A;  1AWJ A;  1SHF A;  1TG0 A;  4RUG A;  2EGA A;  2EGE A;  1W70 A;  3VS0 A;  2C0T A;  1SHG A;  1YN8 A;  1WYX A;  1YWP A;  4HVV A;  2L2P A;  4DEY A;  2EVR A;  1ABQ A;  4CC4 B;  1M3B A;  2K9G A;  2GQI A;  1UUE A;  1SSH A;  1JXO A;  3M0Q A;  4J9F A;  2RF0 A;  2ABL A;  2KRS A;  2KXD A;  2CSQ A;  3H0I A;  5I22 A;  1E6G A;  4FSS A;  2GBQ A;  1Z9Q A;  3EG2 A;  3NGP A;  5IXB A;  3CQT A;  3M0S A;  4AG1 C;  1B3Q A;  1WDX A;  2J7I A;  1H92 A;  1ABO A;  1X2Q A;  4GLM A;  3TSW A;  4J9B A;  1M27 C;  2CT3 A;  2YDL A;  4DEX A;  1ZUY A;  4JJD A;  1JXM A;  3UA6 A;  2JS2 A;  2K6D A;  1UGV A;  2DL5 A;  2DE0 X;  2NWM A;  1PKT A;  2P4R A;  3VS5 A;  1NYG A;  4LUD A;  3FJ5 A;  2O9S A;  2ECZ A;  1NEG A;  1B07 A;  2J6K A;  1M3C A;  4ZNX A;  5GJW B;  2EBP A;  1LCK A;  3EG3 A;  4OMP A;  2FEI A;  1GBQ A;  4K11 A;  1AWX A;  1K0X A;  1AD5 A;  2ESW A;  3PE0 A;  4RTU A;  1JEG A;  3A98 A;  2OI3 A;  4LUE A;  4CC2 A;  1T3L A;  2E5K A;  1RI9 A;  2FG0 A;  1A0N B;  1KSW A;  1UE9 A;  1X6B A;  2EKH A;  1QCF A;  3EHQ A;  2W0Z A;  3EHR A;  2AKK A;  1SRL A;  2L3P A;  4Z8A A;  3ULR B;  2H8H A;  4RTW A;  3R6N A;  1GCQ A;  1WIE A;  2M51 A;  1OPK A;  2SRC A;  5ECA A;  1PNJ A;  1BB9 A;  2KT8 A;  2CH4 A;  1M30 A;  1X69 A;  2YT6 A;  2LQN A;  2KE9 A;  2L0A A;  2KBT A;  3M0R A;  1X43 A;  3NPF A;  4Y92 A;  3VS2 A;  3M0T A;  4RTV A;  1SRM A;  2ROL A;  5I11 A;  2L3S A;  4HVU A;  1PRL C;  2IIM A;  3I9Q A;  4CC3 A;  1E6H A;  2EYX A;  4J9H A;  2F2V A;  4OMQ A;  1GFC A;  1FMK A;  1MUZ A;  1NG2 A;  1SPK A;  3TVT A;  2LP5 A;  2GTJ A;  1RLP C;  2D0N A;  3SEM A;  4EIK A;  3EG1 A;  1MV0 B;  2X3W D;  3PVL A;  1RUW A;  1UHC A;  1WXU A;  2GGR A;  5EC7 A;  1GCQ C;  3KFV A;  3UF4 A;  2DBK A;  2O2O A;  2DNU A;  2DVJ A;  2JT4 A;  2CH4 W;  2JM8 A;  3H41 A;  4J9C A;  2BZY A;  1AVZ C;  2CT4 A;  2BZX A;  2YUN A;  1UDL A;  1Z9Z A;  1X2K A;  1OOT A;  5IHN A;  1K4U S;  1YP5 A;  2J6O A;  1UEC A;  2PZ1 A;  1AWO A;  2DMO A;  4J9E A;  1WA7 A;  2KRN A;  2RQW A;  3REB B;  1N5Z A;  2RQV A;  2KNB B;  2W10 A;  2YUQ A;  2CRE A;  1WLP B;  4RTY A;  2CUD A;  4J9G A;  1PKS A;  2BZ8 A;  4ESR A;  2JTE A;  1VA7 A;  3UA7 A;  2CDT A;  1S1N A;  2RNA A;  1WXT A;  3EG0 A;  4IIO A;  3M0U A;  2YUP A;  3I5S A;  4HVW A;  1JO8 A;  4AFU C;  2ENM A;  2DA9 A;  4J9D A;  2RQU A;  1CKB A;  5L23 A;  1QKW A;  1OPL A;  2DL7 A;  4AFZ C;  1OV3 A;  5IXF A;  2OJ2 A;  2B86 A;  2M0Y A;  3JV3 A;  3H0H A;  4OMN A;  2D1X A;  1ZUK A;  3NMZ C;  2X3X D;  2FPD A;  4D8D A;  1UTI A;  1H3H A;  4HXJ A;  1AWW A;  3RBB B;  1W6X A;  2JW4 A;  2EW3 A;  1G83 A;  2RPN A;  2VWF A;  1HD3 A;  2EGC A;  4JJC A;  4LE9 A;  1BK2 A;  1VYT A;  4Z89 A;  2DX1 A;  5IH2 A;  2GNC A;  1UFF A;  3VS6 A;  3NHN A;  1ZBJ A;  3REA B;  3RNJ A;  4R0K A;  4ORZ A;  2A08 A;  3GBQ A;  1UJ0 A;  3VRY A;  2D8H A;  3H0F A;  4F14 A;  2HBW A;  1YNZ A;  2JMA A;  3SHW A;  2RMO A;  3VS3 A;  3EGU A;  2VKN A;  2BTT A;  1T0H A;  4LN2 A;  1GBR A;  2A36 A;  2J6F A;  2DJQ A;  2LCS A;  1KJW A;  1UHF A;  2LNH B;  2AZV A;  1CKA A;  4F16 A;  4OMO A;  1NYF A;  2ED0 A;  2FPF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...