1WIEA

Solution structure of the first sh3 domain of kiaa0318 protein
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
96
structure length
96
Chain Sequence
b'GSSGSSGTSKQRYSGKVHLCVARYSYNPFDGPNENPEAELPLTAGKYLYVYGDMDEDGFYEGELLDGQRGLVPSNFVDFVQDNESRLASTSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIM binding protein 2
publication title Solution structure of the first SH3 domain of KIAA0318 protein
rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 5
structure length 96
sequence length 96
ec nomenclature
pdb deposition date 2004-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14604 SH3_9 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1wieA01
2FPDA 1ABQA 4LNPA 4LE9A 2DE0X 3GBQA 2ROTA 1RLPC 1OOTA 1X2QA 4WCIA 1OPKA 3EG2A 1RUWA 2DL8A 3EGUA 1ZX6A 2YUPA 2BZ8A 1AWXA 1B3QA 4RTTA 2AKKA 1VYVA 1M27C 2O2OA 2EGCA 3REAB 2JMCA 5ECAA 5FWCA 1H92A 2HSPA 2DL7A 1B07A 1JEGA 2EGEA 1S1NA 2KT1A 1T0JA 1GFCA 2FPFA 4OMNA 3PVQA 2P4RA 1KJWA 2SRCA 2J6KA 2KGTA 2LJ0A 2RF0A 2C0TA 1MV0B 1SEMA 1J3TA 2RQRA 3REBB 2GNCA 3M0PA 2CT4A 1T3LA 1H3HA 2DF6A 1ZSGA 1E7OA 2J6OA 4JJBA 2E5KA 1ABOA 1UJ0A 1XOVA 4DEYA 1NEBA 1UUEA 1U3OA 1UDLA 1AWOA 2F2WA 4J9GA 1OEBA 2LJ1A 2C0OA 1OV3A 1PKTA 2DBMA 2KNBB 2IIMA 3VS5A 3H0FA 4LN2A 1BU1A 4HVUA 2EVRA 4GBQA 3R6NA 1EFNA 2EQIA 1E6HA 2VVKA 3QWXX 4FSSA 2EYYA 4CC7A 2MCNA 1W6XA 1JXMA 4RTZA 5IHIA 1PWTA 2L0AA 1NYFA 2DL4A 1SSHA 2HDAA 1JXOA 1G83A 1U5SA 2KRNA 2DA9A 4KRTA 1ARKA 1KIKA 2YT6A 2J7IA 2DM1A 2AZSA 2YSQA 2J06A 4AFSC 2YUNA 2A28A 1GCQA 3EG3A 3ZL7C 1GL5A 1NEGA 1M30A 5FW9A 1WIEA 2BZYA 1WXUA 1T0HA 5L23A 2KXCA 1UFFA 4RTXA 2NUZA 1I1JA 1RI9A 1TUDA 2ABLA 3NHNA 1YNZA 2ROLA 1QWEA 1X6BA 4J9IA 1QLYA 2EGAA 3PVLA 1BB9A 2K7AA 2DVJA 2FEIA 1WX6A 1WXBA 1HSQA 4IIMA 2CSIA 3I35A 2DLPA 2GGRA 4E6RA 2DBKA 1HJDA 2O9SA 3EG0A 1WXTA 2F2XA 1M3BA 2K2MA 2LP5A 4HVWA 3I9QA 2D1XA 4AG1C 3VRYA 3KFVA 2OJ2A 4EIKA 4J9BA 2AKLA 3EG1A 2RNAA 2JW4A 1A0NB 5IH2A 5GJVB 2J05A 2FG0A 1M3AA 2CH4W 2D0NA 3A98A 2GQIA 2CDTA 2A37A 1Y57A 1GBQA 2CUDA 1NLPC 4D8DA 4DEXA 2KRSA 2JS0A 2EBPA 3VS6A 1JQQA 1MV3A 2DYBA 4ZNXA 1GCPA 2GBQA 1I0CA 1ZLMA 2HBWA 1PKSA 2NWMA 2RN8A 3VS4A 3FJ5A 4RUGA 4ORZA 2LJ3A 1ZUYA 4K11A 1YWPA 2V1RA 2ED1A 2LQWA 2JS2A 3VS3A 2FRYA 5HCKA 2MOXA 1QKWA 2D8JA 4X1VA 1YN8A 4ESRA 1KFZA 1PRLC 1AD5A 3M0SA 2FO0A 4R0KA 3RNJA 3H0HA 2DL3A 4OMLA 2JXBA 3I5SA 1K4US 2FPEA 4JPBW 5IHKA 1UE9A 2HEQA 3H0IA 2KROA 2ESWA 1AWJA 2YUQA 4QT7A 2XMFA 2DX1A 2CUBA 2VWFA 5I22A 2ED0A 4F16A 1YP5A 1GCQC 1UHCA 2KYBA 4JJCA 2OAWA 3CQTA 1ZUKA 1WLPB 4RTYA 2KRMA 2W10A 2V1QA 2BTTA 2BZXA 1SRMA 4JJDA 3NPFA 2CH4A 2JM8A 3M0UA 1VA7A 2LCSA 1FMKA 3VS0A 1WDXA 2LNHB 1UJYA 2EYWA 2DNUA 1PNJA 4HVVA 1G2BA 2KR3A 1GRIA 3EHQA 2EYXA 2L3PA 4OMOA 2X3WD 2DL5A 5I11A 1ZBJA 3JV3A 1M3CA 2C0IA 1CKAA 1PRMC 4M4ZA 2PNIA 2RQVA 5FWBA 4AG2C 4LUDA 2AK5A 2RQWA 1NYGA 2SEMA 1TUCA 1TG0A 1ZUUA 2EYZA 4JZ3A 2O88A 1WFWA 1VYUA 4A63B 4J9HA 2L2PA 5IHNA 1WA7A 3U23A 1JU5C 1K76A 2O31A 1CKBA 2DRMA 2F2VA 1M8MA 3UA7A 1H8KA 1MUZA 2O9VA 1AZGB 4CC3A 3THKA 2YDLA 3O5ZA 1K1ZA 4GLMA 2G6FX 1UTIA 2RPNA 4Z8AA 1AOJA 2H8HA 1E6GA 1WYXA 3RBBB 2DILA 2W0ZA 1LCKA 2X3XD 4Z88A 2RQUA 2DRKA 4JZ4A 2J6FA 1GFDA 4RTUA 3NGPA 1T3SA 3VRZA 5IXFA 2LX7A 3VS2A 1YCSB 2LQNA 2CSQA 1QWFA 1UECA 3UATA 2RMOA 1WI7A 2GTOA 1IO6A 1VYTA 3M0TA 4AFQC 2I0NA 2EKHA 1CSKA 4AFZC 1K0XA 1SPKA 1Z9ZA 1W70A 2CREA 4F14A 1W1FA 1YWOA 3UA6A 1OPLA 2JT4A 4J9DA 2M51A 1Y0MA 3IQLA 1I07A 1HD3A 2DJQA 1UGVA 1PHTA 1JO8A 3PE0A 4OMMA 1RLQC 4Y92A 3ULRB 2PZ1A 1AWWA 2KBTA 3LH5A 2M0YA 1V1CA 1NLOC 2D8HA 4RTWA 1NM7A 2PTKA 3TSWA 4HXJA 1SRLA 4CC4B 3SEMA 5GJWB 2KE9A 3NMZC 1BBZA 2FRWA 4IIOA 4J9CA 1X69A 2K6DA 2JTEA 3C0CA 1X27A 1AVZC 2LZ6B 3I5RA 1AZEA 2LMJA 3M0RA 1N5ZA 2OI3A 4CC2A 2MIOA 3M0QA 2RQTA 3VS7A 3TVTA 2CT3A 2L3QA 3VS1A 4OMQA 1K0SA 1Z9QA 3EHRA 2GTJA 2YUOA 2B86A 4J9EA 4AFUC 2KXDA 3H41A 2K9GA 2EPDA 4LUEA 1X43A 1QKXA 2A36A 3SHWA 5EC7A 1SHGA 4HCKA 2KT8A 2VKNA 2K79A 1FYNA 1AEYA 4Z89A 2EW3A 1X2KA 5IXBA 1BK2A 3UF4A 2ECZA 4RTVA 1K9AA 2A08A 2QDLA 2DMOA 2HCKA 2K3BA 1KSWA 1U06A 2AZVA 1UHFA 1QCFA 1SHFA 4F17A 4D8KA 2JM9A 2ENMA 4OMPA 4J9FA 1NG2A 2KYMA 2L3SA 2JMAA 3TSZA 3QWYA 2KEAA 1UG1A 1X6GA 1GBRA
chains in the Genus database with same CATH superfamily
3DLMA 1G3TA 1R77A 4OB3B 4LNPA 5IAYA 3PTAA 3P8DA 4LDXA 2CS7A 2RHZA 4C8QE 2DE0X 1PC0A 2ROTA 2ZCFB 1Q86R 5GANg 1X2QA 1OPKA 2XIDA 1BCOA 3X28B 1ZX6A 2BZ8A 4FT2A 1B3QA 2O2OA 4OMFB 5FLXE 2JMCA 1YHQT 2NYSA 5FWCA 1IRXA 1AT1B 3VUZA 1G5VA 2KT1A 4L59A 2QQSA 2NLUA 3OS5A 2FB7A 4BI8B 3PMTA 3A5ZB 3CMAA 5GMKe 2HZYA 3PVQA 5CO7A 1KK7A 3EAEA 4XTUA 1MV0B 2R58A 1R0BG 1J3TA 2E1HA 1M90U 3INZA 3MHXA 3NFCA 1T3LA 1ZSGA 4QQ6A 1SF9A 1N27A 2RM4A 4JJBA 1Q7YC 3M56A 4BD3A 1K73R 4E7IA 2P4TA 2RB6A 1UDLA 1OEBA 2QEXA 2HAXA 1IGUA 2IIMA 3VS5A 4KGXB 5FU6C 1BU1A 2LCCA 4GBQA 3R6NA 2I2LA 2VVKA 3HRTA 4FSSA 1M2VB 4CC7A 4C0ZA 4RTZA 1PWTA 5L8RE 3CC2A 1QQJA 3LW5E 2DL4A 3EGXA 4KULA 1JXOA 4KH1B 1VQOT 3V8JA 5IT9E 2J7IA 2QQ9A 3GLXA 2AZSA 1BKBA 3CCLT 2J06A 4F7UG 4M75B 2A28A 2VV5A 1NJIC 1VQ7T 1GCQA 1NEGA 4TVRA 2BZYA 3A8GB 1T0HA 2RHXA 2KXCA 4RTXA 3J80E 1VQKQ 1I1JA 1Q7YU 1RAFB 2EFIA 4FSXA 3LX7A 4FYVB 3EFRA 1QLYA 1YITT 4JRPA 4M78E 3CD6A 1TTHB 3VJPA 3FDRA 1WX6A 1YBYA 2RI2A 1HSQA 4IIMA 1OZ3A 2DVEA 2X4XA 4HCZA 3CCMA 2O9SA 3EG0A 3QIIA 5KYXA 1PD0A 3SDZA 2JTMA 4LDYA 1AHJB 3I9QA 2XI9A 2CYZB 3MKDA 5GAOn 3WXMB 4A54A 5GAOp 4EIKA 2XHCA 2EJFA 4JJNK 2AKLA 1NJIU 2QGFB 2CH4W 2DJZA 3O8VA 3JCMW 3CMET 2A37A 3G4SQ 3CCVA 1PSEA 1YJWT 4A53A 4ZNXA 1GCPA 3S3OA 4GY5A 4C0FA 2R57A 3JCMf 3ME9A 4PFOA 1PKSA 4ATOA 1VUBA 2E65A 1OX8A 2RN8A 4ORZA 2LJ3A 1YWPA 2QA4T 1W2BS 2L89A 4E7JA 3VS3A 3M59A 4WF2A 3BY7A 4XK8E 2EIFA 3CC7T 1X01A 1YN8A 4C8QG 2VB6A 3RESA 2Y90A 2F69A 1PRLC 5LJ3j 3RERA 2K5IA 3QKJA 1G8XA 2LQKA 3H0HA 5KYYA 1RACB 2JXBA 1GXIE 2RJFA 2GFAA 1K9MC 2KROA 4FL6A 4QT7A 1QP2A 2VWFA 1PD1A 4F16A 1YP5A 2CZ1B 2OAWA 2QDYB 4M77F 2CP5A 1WLPB 2BTTA 1Q81U 2BUDA 2MMPA 5KH6A 2KQWA 4JJDA 2LVMA 1MNDA 2E12A 3M0UA 1YITA 2LCSA 2QXFA 4RCCA 3VS0A 1KC8R 1WDXA 3MP8A 5CKFA 2EYWA 4M75E 2CP2A 4J7FA 1H3ZA 2ZPEB 1VQPT 3A8HB 4BB7A 5M9OA 4N0AC 1M1KC 5GMKj 5KYUB 2RQVA 4FCYA 5FWBA 1K9MU 2SEMA 4OVAA 4EPCA 3OS2A 2ATCB 1TG0A 1ZUUA 4M7DG 1YCYA 4N4GA 3OMCA 4DBRA 4J83A 2D0QB 4PNOA 2O31A 2HL5C 2F2VA 1M8MA 3CMEA 3TU4K 3CXCS 1K1ZA 2VYTA 1UTIA 5D6WA 2H8HA 1E6GA 2DILA 2RQUA 3EH2A 4QQDA 4XTZA 1GFDA 4B9WA 1T3SA 3DKMA 3VRZA 6AT1B 3VS2A 3SWNA 1N9RA 5CKDA 4M77D 2CSQA 4E2FB 1UECA 3CCRT 1D3BA 1M90R 4FYXB 2QA4A 4NOYA 2RMOA 1M1KU 4ZN3A 2XDBA 2I0NA 3GOXA 3OA6A 1WHHA 1CSKA 1MHNA 1WHKA 3JB9I 3JCMe 1W70A 2CREA 3CC7A 2YRVA 4XQ3A 1EX4A 2PQWA 2YLBA 4A4KA 3CD6T 1NBEB 2X9HA 1I07A 1ZSZB 5LJ5g 5FU7C 3PFSA 1FMWA 1UGVA 4OMMA 4PJOC 3L2UA 3TREA 2DTIA 2MAMA 2HQEA 3CC4T 3OYHA 1VQMA 4B9XA 2PTKA 3SEMA 2FRWA 4J9CA 3J81E 1X69A 4DBQA 2K6DA 4JS5A 3T9NA 2LTOA 3I5RA 1AZEA 4FYYB 1N5ZA 1N9SA 1JRIA 2KDSA 3META 4C92C 2XG8D 2OTJT 2E5QA 2EQKA 5HK3A 1Z9QA 4HT9A 1YHQQ 5KCOA 3OYBA 2DPPB 2D9TA 1HXDA 4OB0B 4FW1A 4A4EA 2LQ8A 3URGA 4LUEA 2HNIA 4MZPA 2A36A 3G4ST 1M9SA 3JB9F 3I56T 4HCKA 4FM4B 2K79A 1VIEA 5IXBA 3QDFA 4X9DA 1PSFA 4Z02A 2ECZA 3X26B 1NJIR 2A08A 3HPWA 4JRIA 4J6XA 5J3BA 1VQ9T 1YIJT 1UGRB 1NG2A 1NPRA 4BY6C 3SD4A 3CCRA 1NE8A 4M7AG 1X6GA 1GBRA 2FPDA 4C5GA 1ABQA 1VQOQ 4XU0A 4M75G 1KQSS 5CIUA 2E6NA 3CCLQ 3L2QA 3MJXA 1OOTA 1KG1A 2KY9A 4KUIA 2JZ2A 1VQ7Q 1RUWA 3EGUA 1ZBXA 2MK5A 1AWXA 1VQKA 1TXQA 1OYXA 4RTTA 5GAMh 2AKKA 4KT0E 1KHIA 1TWBA 8AT1B 4IUQA 5GANf 2FL7A 3REAB 3GPLA 2HD0A 4BACA 1H92A 4BE2A 2DL7A 3JB9D 4OB2B 3MEVA 2EWNA 1B34A 1XJWB 2P4RA 4QQGA 2KGTA 4KUDK 2C0TA 5HK0A 1OZ2A 2ZPHB 3M0PA 5KYYB 1Q81R 1H3HA 1OULA 2J6OA 3JCMP 2E5KA 1ABOA 1UJ0A 1XOVA 1VIFA 1NEBA 5DM7R 1UUEA 3PNWC 1U3OA 1TOVA 3CPFA 3V8KA 1AWOA 2F2WA 1M1FA 4J9GA 1W2BP 2C0OA 1OV3A 4E7ZA 1X75C 4HVUA 2RH2A 4PLIA 1EFNA 3G4SA 3HKSA 2EQIA 3I56A 5J26A 1IB8A 2EYYA 1YJWQ 1KHCA 2AT1B 3TQ7P 4M77A 1XTDA 2L0AA 1NYFA 2PUKB 5I2SA 3JCMX 3RKXA 1G83A 2KRNA 3ZFJA 2DA9A 4KRTA 1ARKA 1JJ2A 2YSQA 3ZEHA 5HY6A 2YUNA 3QG1A 2GQVA 1GL5A 2K2VA 2WSFE 1IHWA 3OW2S 2K57A 1WXUA 2Y4YA 1K8AC 3CCEQ 2JOYA 1YIJA 1ZQ1A 3CC7Q 1RI9A 1TUDA 2ABLA 3NHNA 1YNZA 3NTIA 2X35A 2EGAA 3PVLA 5KYUA 2FEIA 2DFUA 1TUGB 4D6WA 4JRQA 1PCXA 3OYIA 4C92G 5LJ5h 3I35A 3JB9J 3GNFB 4XTXA 2K2MA 4HVWA 1LJOA 2VXFA 4JRKA 4C8QC 4ZN1A 4AG1C 5C0MA 3JRZA 3SWNB 1D3BB 1KQ1A 2JW4A 2RNAA 1RAAB 3R6OA 3C4SA 2FG0A 1WPYA 3A98A 1K8AU 4KGZB 1NLPC 4D8DA 2DEQA 1VQPQ 4DEXA 3CXCP 4GLKA 5GANe 3AHUA 3C12A 1MMAA 5CK9A 2NUTA 5CKHA 4M7DD 2DYBA 3BDUA 1ZLMA 3M4YA 3AT1B 2VC8A 4J6YA 3S6WA 4L6V5 5GAN5 1EIFA 3FJ5A 2MI6A 4K11A 1ZSZA 2PVOB 5GAN2 2ED1A 2LX9A 1WHMA 1Q95G 2EQJA 4EMKC 3KBGA 1QKWA 3OYJA 2DEUA 3UDCA 3P8HA 4OB1B 5A2QE 3M0SA 1VQ8T 4R0KA 3MEWA 4LD9K 4M7DC 3I5SA 1YJNT 1UE9A 4F7UA 1RAGB 3D7SB 1AWJA 3CCRQ 1ACMB 2CUBA 2KVQG 3VYGA 2ED0A 2KYBA 2F5KA 4ELYC 5CAIA 2KSSA 4RTYA 2KRMA 2RI3A 2W10A 1ZA1B 4OF1A 2CH4A 2JM8A 3JCMd 2K3YA 1KD1C 3MEUA 1PNJA 2KR3A 1GRIA 2EYXA 2DL5A 1QCOA 3CC4Q 1ZBJA 3JV3A 1PRMC 2PNIA 1RAEB 2RJEA 3QJYA 2MWOA 2BE9B 2EJGA 1TUCA 4JZ3A 4B6MA 1FWZA 4J9HA 1Y7XA 3U23A 4JLGA 1Q82R 1K76A 3E9FA 5GMKl 3H9NA 3NTHA 1IZ6A 3UA7A 4ANJA 3OYNA 2OTJQ 4BI3A 3PGGA 5KYWA 4CC3A 1OU8A 3THKA 3L2RA 2QQRA 2RPNA 4LDUA 1YHQA 5CQYA 1WYXA 1QMCA 1JBMA 5CR2A 1KD1U 2DRKA 2J6FA 2RO0A 1Y96B 2LX7A 1N8RR 2Z0WA 1DJ7B 3I56Q 3PMIA 3MEAA 1VQ4Q 3N5BB 2GTOA 1IO6A 1VYTA 4AFQC 1MNEA 2EKHA 2IPOB 3OYDA 2YRDA 1B34B 1SPKA 1K0XA 4QVZA 4F14A 4FW2A 2IVWA 1W1FA 1YWOA 3RMSA 3OYCA 1KQSP 4J9DA 2M51A 1Y0MA 2E4HA 1QVGP 1VQ8A 2DJQA 1VQ9Q 1JO8A 3PE0A 4R55A 3CCET 1OU9A 1YIJQ 1TS9A 1RLQC 5AYFA 2COWA 2DD5A 2A3LA 3ULRB 4M7AD 3FEOA 1U1SA 1UEBA 1FX7A 3ASKA 2PU9B 1UGQB 2M0YA 5LJ5f 5FU7B 3TSWA 4CC4B 1VQOA 3QJ6A 4FYWB 4J7IA 3OBWA 1X27A 3BDLA 4PJOF 2LZ6B 1I8FA 2MF2A 2V8IA 2OI3A 3CCLA 5GAMg 1VQ7A 4M77B 5LJ3h 3VS7A 3TVTA 2COZA 2CT3A 2L3QA 5CQXA 1BI3A 3A1PA 1K0SA 2OTLQ 3H8ZA 4M7AC 2GTJA 2O01E 2KXDA 4M75C 4RCBA 3CCQT 5GANj 4M7DA 4ZTJA 4N4HA 3L42A 4JLIA 1SHGA 4ELZC 2KT8A 2VKNA 1FYNA 1V29B 4Z89A 3OYEA 2EW3A 5I2MA 1N6AA 4PFZA 4RTVA 4A4FA 4PLLA 2X4WA 1QW1A 4CRIA 3G71Q 1Y07A 2AZVA 1UHFA 1QCFA 1BCMA 3CEYA 5GMKh 1M2OA 3OW2P 3CPWS 2ENMA 4MZMA 2KYMA 2L3SA 1YJWA 3WVDB 2QASA 3TSZA 4PL6A 4QVDA 3QWYA 1Q86C 4PJOD 1G3YA 1U8RA 2CP3A 1LVKA 2A0FB 3UT1A 4MDXA 5IN1A 3ER0A 3E19A 3G7ZA 1QVFS 1LNXA 2M16A 4KH0B 3GBQA 3I55T 3RKYA 2RJCA 1RLPC 4BY6B 4WCIA 2NUTB 2VGNA 3EG2A 3E2UA 1WJSA 2JVVA 4M78G 2YUPA 3CCEA 3RR6A 3M4GA 4AMCA 4PJLA 2QTXA 1KQ2A 5AT1B 1M27C 2EGCA 1I81A 4C92D 5ECAA 1XQHA 3JCMQ 3L2ZA 3OYFA 3JCMc 2HSPA 1RL2A 1B07A 1FXXA 3JSCA 1S72T 2DZ9A 1JEGA 1S1NA 4XAXB 3JB9H 2FPFA 2VUBA 2HMAA 1KJWA 2SRCA 4OGEA 4RKUE 1BI2A 1Q86U 4L5GA 5LJ5e 3REBB 1K73C 2LC4A 3MPUB 4F7UB 3OMGA 1YJ9T 1R8OB 4F7UF 1D0YA 4DEYA 4R56A 2X4JA 5D7UA 2RK1A 1KQSA 1Q7YR 1PKTA 3HP9A 4M77E 3H0FA 1QVGA 3CBMA 4LN2A 2EVRA 4E7LA 1VQPA 1ZHIA 3QWXX 2X51A 2MCNA 5FRMA 3L1AA 5GANd 5KYNA 2HDAA 2DXCA 3OQ5A 1U5SA 2YT6A 3L2WA 5KE2A 4BI4A 1VQ4T 2RJDA 2QQBA 5GAOl 2DK3A 4C5EA 5A0LA 5HKCA 1M30A 5FW9A 1K73U 5L23A 2HQXA 1UFFA 3OS0A 3EG9A 3E9GA 2NUZA 3OYYA 1WJQA 4BE1A 1C0MA 4ZTFA 2WSEE 1X6BA 1VQ8Q 3GIBA 2DYIA 4N4IA 2K7AA 1UB4A 5GAOr 5GAN3 5KYWB 1WXBA 1YJNQ 2K4YA 3JCMb 2CSIA 2DLPA 2GGRA 4E6RA 2DBKA 4N0AA 1QCNA 2F2XA 1OX9A 2LP5A 3CCUQ 1MMDA 2D1XA 2DTOA 3VRYA 3KFVA 3WVEB 3FIFA 3EG1A 4HCBA 5IH2A 2RA2A 3OYMA 4DQ2A 3DLLA 2D0NA 4EMHA 1Y96A 3EGDA 4C8QB 2CDTA 1Y57A 2ZPIB 2CUDA 3F70A 4C8QF 3DB3A 2ZPGB 2OTLT 2M0OA 3CC4A 2KRSA 4XU3A 2JS0A 4RG8A 2B8AA 2K3XA 3RUXA 1NPPA 4XU2A 1ZA2B 1D1CA 2HBWA 3PIPA 2PVDB 2MWPA 2QG9B 1YJ9A 2IG0A 3VS4A 4RUGA 1ZUYA 1WHLA 2V1RA 4J5YA 4KBMB 3OYLA 2LQWA 2JS2A 2RHIA 2FYKA 3QUIA 3EFSA 3VU3C 3P8BB 4QVCA 1VQ6T 2OTJA 1WZOA 2FRYA 5HCKA 3BE3A 4X1VA 1KFZA 1VQ5Q 2GF7A 2GFUA 1VQNQ 3G71T 3OSVA 1D1AA 4F7UE 1AD5A 4C0DC 1IHVA 1RAHB 2DL3A 4PJOA 4RMOA 1VQLQ 4LD6A 4JPBW 1PM3A 4E7HA 2HEQA 3H0IA 3CMAT 1VQ4A 2YUQA 3PIOA 3OS1A 4QW2A 1K9MR 1WQ7A 5I22A 1GCQC 1UHCA 3CQTA 4M7DB 1ZUKA 5FU6B 2NUPB 4M7DF 1SSFA 2V1QA 1XNIA 1KC8C 2BZXA 4MZTA 3RDVA 1SRMA 2JNGA 4C8QD 3SFMA 1VQ9A 2VGMA 4C92A 3CCSQ 2LNHB 5GAN7 3VUBA 1C6VX 2QEXT 1G3SA 4HVVA 1G2BA 3EHQA 2L3PA 1LPLA 3MCAB 4PJJA 2C0IA 2DAQA 3S3NA 1CKAA 2EAYA 2HBPA 4Q5WA 1Y71A 4M4ZA 3JCMJ 2L8DA 3CC2T 4MMKA 4LUDA 5LJ3g 2AK5A 4M77G 1C1AA 1M1KR 2O88A 1WA7A 3M54A 1SG5A 3A8MB 1CKBA 2FZGB 3FRNA 1BIAA 1H8KA 5GAOm 1AZGB 1KC8U 2OTLA 1D09B 2E70A 4Z8AA 2RD1A 1AOJA 2EJ9A 3RKWA 2W0ZA 2X3XD 3CCQQ 4RTUA 3NGPA 1M90C 3HL8A 4BE0A 5GAMd 4PFPA 1YCSB 3CPWP 2LQNA 2H3JA 4QKUA 2WSCE 2V8KA 2M1HA 3UATA 3CCMT 1YI2Q 3M0TA 1WNLA 1JB0E 1QP3A 1VQ6A 2DXBA 2EYQA 1Z9ZA 2LDMA 1QVFP 3G71A 5CKEA 1VOMA 3M9QA 1JJ2S 3HSBA 5FROA 1PHTA 4J8OA 2PZ1A 4F04B 1AWWA 4XTWA 1UGSB 3CCVT 1V1CA 3V7RA 2F5TX 4BDZA 5GJWB 2KE9A 1BBZA 4IIOA 4JUVA 3LYIA 2JTEA 2XU8A 3LWIA 1AVZC 4M78D 3I55Q 5DLQE 3M0RA 3OBYA 5CKBA 2MIOA 3M0QA 2DD4A 4PJMA 3CCUT 1WHJA 3CCJT 2RQTA 3HRSA 3UWNA 5A0DA 4OMQA 4M7DE 2COYA 2C06A 2B86A 3QZ9B 5GAMf 3M55A 3G6ET 5J39A 1S72Q 1D1BA 2L5QA 2ZPBB 3H41A 2EPDA 1X43A 1QKXA 3EG9B 4MMLA 1W2BA 3V7CA 3SHWA 2XDDA 4XTYA 5EC7A 4M7AB 4M78C 2GCXA 4M7AF 2M02A 4O6JA 1AEYA 1M1GA 5EG2A 2YLCA 2E3IA 3LH0A 4M75F 2JTFA 3QYHB 5LJ5d 1YJ9Q 2XDPA 3J7AF 2QDLA 4VUBA 4C0GA 2AHJB 2DMOA 4HCCA 2HCKA 2O4XB 1TSFA 2ZAEA 4IUTA 2DZCA 3HTRA 4HT8A 5I21A 1LOJA 1SHFA 4F17A 1O75A 2OX7A 1I5LA 2AIRB 4FIBA 2V8JA 1VQ5T 1WQWA 1VQNT 3SWNC 2FZCB 3QYGB 3HFOA 2BE7D 4PJNA 3JB9G 1OQKA 2CZ6B 2LT1A 2KEAA 2RHUA 2KI7A 2ZGWA 3EGDB 1VQLT 3M53A 4LE9A 1D0XA 3QDRB 1HYOA 3RIRA 3C94A 3NTKA 2HKQB 2DL8A 2R5MA 4C8QA 1QVPA 2E6ZA 4NL3A 5KCHA 2V26A 2RHYA 5CCAA 3X20B 1VYVA 1F1BB 3JCMV 4V2SA 5D6XA 1U1TA 3CCST 2EGEA 1T0JA 1GFCA 2DKGA 1YJNA 3OYKA 4OMNA 4E7KA 2JJ9A 1Q81C 3C95A 4M75D 2J6KA 2LJ0A 2RF0A 3CXCA 1TU0B 1SEMA 3CPWA 1SKUB 2RQRA 3CCUA 3CCJA 2GNCA 4PJOB 3X25B 2CT4A 2DF6A 1E7OA 3HRUA 3GF5A 2HKNA 3VKIA 1V76A 3H6ZA 2MYSA 3G6EA 4IUUA 3M58A 1QVFA 2RK2A 3KXTA 4E7SA 2LJ1A 4IUVA 2DBMA 2KNBB 4NL2A 4EMKA 1RADB 7AT1B 2QGGA 2KAFA 1E6HA 2X4YA 4Y91A 3S3MA 1MMGA 1W6XA 5GAMe 1JXMA 5IHIA 3VV0A 1VQMT 4C92B 2NUPA 1SSHA 4C92F 3OSSC 4A4GA 1WJRA 2QTVA 1IREB 1KIKA 2JUFA 2DM1A 3M57A 4KGVB 5GAN4 4AFSC 1HK9A 4YTLA 1YI2T 3EG3A 2D6FA 3ZL7C 4M7AE 1WIEA 3OB9A 1VQ6Q 5GANh 2VASA 4XU1A 1VQ5A 2OAUA 1VQNA 3E1SA 3EFOA 2ROLA 1QWEA 1K8AR 1WGSA 4J9IA 2LRQA 4Y28E 1BB9A 1NZ9A 2DVJA 1VQLA 4JDSA 2WACA 4IUPA 2CZ0B 4EDUA 3CMAQ 2Y4XA 2QQAA 2FZKB 2E41A 3QPHA 4IURA 1HJDA 2DXTA 4M78A 3OYGA 2R5AA 1WXTA 2FVUA 1FMVA 1M3BA 2HL3A 4FT4A 2CP7A 3TCJA 9ATCB 4DA4A 3JAME 3EH1A 2G3RA 2OJ2A 4J9BA 2DIQA 2LCLA 2JN0A 1A0NB 8ATCB 2YRCA 5GJVB 2J05A 3CCSA 1M3AA 3V7SA 2GQIA 5GMKm 2QEXQ 3UPUA 1GBQA 1BI1A 2E10A 3MP1A 3JCMg 2XKOC 2K5FA 4ME7A 4AT1B 2P0QA 1M4ZA 3MP6A 2EBPA 3GNGA 3VS6A 1JQQA 1MV3A 2GBQA 3CC2Q 3QO3A 1I0CA 3SB2A 3HHTB 1RAIB 2NWMA 5A0GA 2MPXC 1I5OB 3OY9A 1P92A 2QAZA 3FJPA 2MOXA 1MMNA 1VQKT 2D8JA 2DIGA 5DLOA 4PJOE 4ESRA 3ZBDA 2HSEB 3A8LB 4LXCA 1X6OA 5LJ3d 5DY9A 3CCQA 4M77C 2FO0A 1H641 3RNJA 4XTVA 3CD6Q 2KMTA 4OMLA 1JJ2P 4DOVA 5C6SA 1K4US 2FPEA 2E3HA 5IHKA 3QBYA 5CVIA 5GMKi 2ESWA 2ZZDA 2XMFA 2DX1A 3CCMQ 2H3EB 1YI2A 4C0DB 2FHDA 4JJCA 2VXEA 4C92E 3EGXB 2CZ7B 3NPFA 3LGFA 1MGQA 2F1LA 1M2VA 4ZGJB 1VA7A 1RABB 1FMKA 1W4SA 4C5IA 1UJYA 3GP8A 2DNUA 4OMOA 2X3WD 4M7AA 5I11A 3CCVQ 1KD1R 1M3CA 1UGPB 3OYAA 4M75A 4EMGA 4WTOB 4DOWA 1Q82C 3PT9A 1R0CB 4AG2C 1EZZB 2RQWA 1NYGA 2DETA 3I55A 2EYZA 2CP6A 1WFWA 1VYUA 4A63B 5GAN8 2O4XA 2L2PA 5IHNA 1JU5C 3CBPA 3V8LA 4DBHA 2BKDN 5KYXB 1G3WA 3CCJQ 2DRMA 2DXUA 1MUZA 2O9VA 2DERA 3LLRA 5LJ3f 4E47A 2YDLA 4O5VA 1TH7A 3O5ZA 4A4HA 1RI0A 4GLMA 2G6FX 4X9CA 4BDYA 2M9UA 1N8RC 3G6EQ 1S72A 3RBBB 3RMQA 1LCKA 4Z88A 4JZ4A 3QZ5B 4CI0C 2YHTA 3BFMA 4ZGEB 5GAMj 3Q1JA 5IXFA 2KK4A 2QYZA 4II1A 1BIBA 3OW2A 2P0PA 3HFNA 1PG5B 4P5NA 1QWFA 2ZPFB 2PUOB 4RG2A 1QVGS 2P84A 1ZSZC 1WI7A 2EQUA 2PVGB 1YFNA 3FLGA 4BUGA 1Q82U 3X24B 4AFZC 2LT4A 2DTHA 2DO3A 3LGLA 4OGCA 3UA6A 1OPLA 3M5AA 4PKCC 2JT4A 3LWHA 3IQLA 1YITQ 1HD3A 3BW1A 4Y92A 1BYMA 4NS5A 2KBTA 3LH5A 1N8RU 2L3RA 3QHSA 2CKKA 4HA8A 1NLOC 2D8HA 4RTWA 1NM7A 3KUFA 3QSUA 4HXJA 1SRLA 3QXEB 1IXDA 5FRNA 4EMKB 3NMZC 1I4K1 3TEEA 3C0CA 2EKOA 1OI1A 2YXYA 2LMJA 2HQHA 3MO8A 1O9SA 4CC2A 1B7TA 4X34A 2QK0A 5KE3A 2QI2A 4ZGDB 3CMEQ 2CP0A 4PK4A 3VS1A 4C5HA 5GAN6 4IKFA 1D0ZA 3EHRA 1BI0A 4J6WA 1M8VA 4HKEA 3VYHB 4J9EA 4OP0A 2EQMA 4AFUC 2K9GA 4LDWA 2XK0A 2CGHA 4DBFA 3CBOA 3L2VA 3EFOB 4PJOG 3A8OB 2RI5A 3JCMh 2QA4Q 2P0KA 4JS4A 1IGQA 1X2KA 2K5LA 1BK2A 3UF4A 5LL6S 5LJ5j 5GAOq 1K9AA 4FU6A 3FB9A 4UC4A 4M78B 2XICA 2XD0A 1WHGA 1U06A 1KSWA 2K3BA 4M78F 2E64A 3FC3A 4D8KA 5LJ3e 2JM9A 2YWWA 4OMPA 3DB4A 2LNVA 4J9FA 5D6YA 2JMAA 3G1JA 2BIVA 1M5Q1 4MDWA 1VQMQ 1UG1A 4LDVA 2YUOA 2A7YA
chains in the Genus database with same CATH topology
2FPDA 1ABQA 4LNPA 4LE9A 2DE0X 3GBQA 2ROTA 1RLPC 1OOTA 1X2QA 4WCIA 1OPKA 3EG2A 1RUWA 2DL8A 3EGUA 1ZX6A 2YUPA 2BZ8A 1AWXA 1B3QA 4RTTA 2AKKA 1VYVA 1M27C 2O2OA 2EGCA 3REAB 2JMCA 5ECAA 5FWCA 1H92A 2HSPA 2DL7A 1B07A 1JEGA 2EGEA 1S1NA 2KT1A 1T0JA 1GFCA 2FPFA 4OMNA 3PVQA 2P4RA 1KJWA 2SRCA 2J6KA 2KGTA 2LJ0A 2RF0A 2C0TA 1MV0B 1SEMA 1J3TA 2RQRA 3REBB 2GNCA 3M0PA 2CT4A 1T3LA 1H3HA 2DF6A 1ZSGA 1E7OA 2J6OA 4JJBA 2E5KA 1ABOA 1UJ0A 1XOVA 4DEYA 1NEBA 1UUEA 1U3OA 1UDLA 1AWOA 2F2WA 4J9GA 1OEBA 2LJ1A 2C0OA 1OV3A 1PKTA 2DBMA 2KNBB 2IIMA 3VS5A 3H0FA 4LN2A 1BU1A 4HVUA 2EVRA 4GBQA 3R6NA 1EFNA 2EQIA 1E6HA 2VVKA 3QWXX 4FSSA 2EYYA 4CC7A 2MCNA 1W6XA 1JXMA 4RTZA 5IHIA 1PWTA 2L0AA 1NYFA 2DL4A 1SSHA 2HDAA 1JXOA 1G83A 1U5SA 2KRNA 2DA9A 4KRTA 1ARKA 1KIKA 2YT6A 2J7IA 2DM1A 2AZSA 2YSQA 2J06A 4AFSC 2YUNA 2A28A 1GCQA 3EG3A 3ZL7C 1GL5A 1NEGA 1M30A 5FW9A 1WIEA 2BZYA 1WXUA 1T0HA 5L23A 2KXCA 1UFFA 4RTXA 2NUZA 1I1JA 1RI9A 1TUDA 2ABLA 3NHNA 1YNZA 2ROLA 1QWEA 1X6BA 4J9IA 1QLYA 2EGAA 3PVLA 1BB9A 2K7AA 2DVJA 2FEIA 1WX6A 1WXBA 1HSQA 4IIMA 2CSIA 3I35A 2DLPA 2GGRA 4E6RA 2DBKA 1HJDA 2O9SA 3EG0A 1WXTA 2F2XA 1M3BA 2K2MA 2LP5A 4HVWA 3I9QA 2D1XA 4AG1C 3VRYA 3KFVA 2OJ2A 4EIKA 4J9BA 2AKLA 3EG1A 2RNAA 2JW4A 1A0NB 5IH2A 5GJVB 2J05A 2FG0A 1M3AA 2CH4W 2D0NA 3A98A 2GQIA 2CDTA 2A37A 1Y57A 1GBQA 2CUDA 1NLPC 4D8DA 4DEXA 2KRSA 2JS0A 2EBPA 3VS6A 1JQQA 1MV3A 2DYBA 4ZNXA 1GCPA 2GBQA 1I0CA 1ZLMA 2HBWA 1PKSA 2NWMA 2RN8A 3VS4A 3FJ5A 4RUGA 4ORZA 2LJ3A 1ZUYA 4K11A 1YWPA 2V1RA 2ED1A 2LQWA 2JS2A 3VS3A 2FRYA 5HCKA 2MOXA 1QKWA 2D8JA 4X1VA 1YN8A 4ESRA 1KFZA 1PRLC 1AD5A 3M0SA 2FO0A 4R0KA 3RNJA 3H0HA 2DL3A 4OMLA 2JXBA 3I5SA 1K4US 2FPEA 4JPBW 5IHKA 1UE9A 2HEQA 3H0IA 2KROA 2ESWA 1AWJA 2YUQA 4QT7A 2XMFA 2DX1A 2CUBA 2VWFA 5I22A 2ED0A 4F16A 1YP5A 1GCQC 1UHCA 2KYBA 4JJCA 2OAWA 3CQTA 1ZUKA 1WLPB 4RTYA 2KRMA 2W10A 2V1QA 2BTTA 2BZXA 1SRMA 4JJDA 3NPFA 2CH4A 2JM8A 3M0UA 1VA7A 2LCSA 1FMKA 3VS0A 1WDXA 2LNHB 1UJYA 2EYWA 2DNUA 1PNJA 4HVVA 1G2BA 2KR3A 1GRIA 3EHQA 2EYXA 2L3PA 4OMOA 2X3WD 2DL5A 5I11A 1ZBJA 3JV3A 1M3CA 2C0IA 1CKAA 1PRMC 4M4ZA 2PNIA 2RQVA 5FWBA 4AG2C 4LUDA 2AK5A 2RQWA 1NYGA 2SEMA 1TUCA 1TG0A 1ZUUA 2EYZA 4JZ3A 2O88A 1WFWA 1VYUA 4A63B 4J9HA 2L2PA 5IHNA 1WA7A 3U23A 1JU5C 1K76A 2O31A 1CKBA 2DRMA 2F2VA 1M8MA 3UA7A 1H8KA 1MUZA 2O9VA 1AZGB 4CC3A 3THKA 2YDLA 3O5ZA 1K1ZA 4GLMA 2G6FX 1UTIA 2RPNA 4Z8AA 1AOJA 2H8HA 1E6GA 1WYXA 3RBBB 2DILA 2W0ZA 1LCKA 2X3XD 4Z88A 2RQUA 2DRKA 4JZ4A 2J6FA 1GFDA 4RTUA 3NGPA 1T3SA 3VRZA 5IXFA 2LX7A 3VS2A 1YCSB 2LQNA 2CSQA 1QWFA 1UECA 3UATA 2RMOA 1WI7A 2GTOA 1IO6A 1VYTA 3M0TA 4AFQC 2I0NA 2EKHA 1CSKA 4AFZC 1K0XA 1SPKA 1Z9ZA 1W70A 2CREA 4F14A 1W1FA 1YWOA 3UA6A 1OPLA 2JT4A 4J9DA 2M51A 1Y0MA 3IQLA 1I07A 1HD3A 2DJQA 1UGVA 1PHTA 1JO8A 3PE0A 4OMMA 1RLQC 4Y92A 3ULRB 2PZ1A 1AWWA 2KBTA 3LH5A 2M0YA 1V1CA 1NLOC 2D8HA 4RTWA 1NM7A 2PTKA 3TSWA 4HXJA 1SRLA 4CC4B 3SEMA 5GJWB 2KE9A 3NMZC 1BBZA 2FRWA 4IIOA 4J9CA 1X69A 2K6DA 2JTEA 3C0CA 1X27A 1AVZC 2LZ6B 3I5RA 1AZEA 2LMJA 3M0RA 1N5ZA 2OI3A 4CC2A 2MIOA 3M0QA 2RQTA 3VS7A 3TVTA 2CT3A 2L3QA 3VS1A 4OMQA 1K0SA 1Z9QA 3EHRA 2GTJA 2YUOA 2B86A 4J9EA 4AFUC 2KXDA 3H41A 2K9GA 2EPDA 4LUEA 1X43A 1QKXA 2A36A 3SHWA 5EC7A 1SHGA 4HCKA 2KT8A 2VKNA 2K79A 1FYNA 1AEYA 4Z89A 2EW3A 1X2KA 5IXBA 1BK2A 3UF4A 2ECZA 4RTVA 1K9AA 2A08A 2QDLA 2DMOA 2HCKA 2K3BA 1KSWA 1U06A 2AZVA 1UHFA 1QCFA 1SHFA 4F17A 4D8KA 2JM9A 2ENMA 4OMPA 4J9FA 1NG2A 2KYMA 2L3SA 2JMAA 3TSZA 3QWYA 2KEAA 1UG1A 1X6GA 1GBRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FPD A;  1ABQ A;  4LNP A;  4LE9 A;  2DE0 X;  3GBQ A;  2ROT A;  1RLP C;  1OOT A;  1X2Q A;  4WCI A;  1OPK A;  3EG2 A;  1RUW A;  2DL8 A;  3EGU A;  1ZX6 A;  2YUP A;  2BZ8 A;  1AWX A;  1B3Q A;  4RTT A;  2AKK A;  1VYV A;  1M27 C;  2O2O A;  2EGC A;  3REA B;  2JMC A;  5ECA A;  5FWC A;  1H92 A;  2HSP A;  2DL7 A;  1B07 A;  1JEG A;  2EGE A;  1S1N A;  2KT1 A;  1T0J A;  1GFC A;  2FPF A;  4OMN A;  3PVQ A;  2P4R A;  1KJW A;  2SRC A;  2J6K A;  2KGT A;  2LJ0 A;  2RF0 A;  2C0T A;  1MV0 B;  1SEM A;  1J3T A;  2RQR A;  3REB B;  2GNC A;  3M0P A;  2CT4 A;  1T3L A;  1H3H A;  2DF6 A;  1ZSG A;  1E7O A;  2J6O A;  4JJB A;  2E5K A;  1ABO A;  1UJ0 A;  1XOV A;  4DEY A;  1NEB A;  1UUE A;  1U3O A;  1UDL A;  1AWO A;  2F2W A;  4J9G A;  1OEB A;  2LJ1 A;  2C0O A;  1OV3 A;  1PKT A;  2DBM A;  2KNB B;  2IIM A;  3VS5 A;  3H0F A;  4LN2 A;  1BU1 A;  4HVU A;  2EVR A;  4GBQ A;  3R6N A;  1EFN A;  2EQI A;  1E6H A;  2VVK A;  3QWX X;  4FSS A;  2EYY A;  4CC7 A;  2MCN A;  1W6X A;  1JXM A;  4RTZ A;  5IHI A;  1PWT A;  2L0A A;  1NYF A;  2DL4 A;  1SSH A;  2HDA A;  1JXO A;  1G83 A;  1U5S A;  2KRN A;  2DA9 A;  4KRT A;  1ARK A;  1KIK A;  2YT6 A;  2J7I A;  2DM1 A;  2AZS A;  2YSQ A;  2J06 A;  4AFS C;  2YUN A;  2A28 A;  1GCQ A;  3EG3 A;  3ZL7 C;  1GL5 A;  1NEG A;  1M30 A;  5FW9 A;  1WIE A;  2BZY A;  1WXU A;  1T0H A;  5L23 A;  2KXC A;  1UFF A;  4RTX A;  2NUZ A;  1I1J A;  1RI9 A;  1TUD A;  2ABL A;  3NHN A;  1YNZ A;  2ROL A;  1QWE A;  1X6B A;  4J9I A;  1QLY A;  2EGA A;  3PVL A;  1BB9 A;  2K7A A;  2DVJ A;  2FEI A;  1WX6 A;  1WXB A;  1HSQ A;  4IIM A;  2CSI A;  3I35 A;  2DLP A;  2GGR A;  4E6R A;  2DBK A;  1HJD A;  2O9S A;  3EG0 A;  1WXT A;  2F2X A;  1M3B A;  2K2M A;  2LP5 A;  4HVW A;  3I9Q A;  2D1X A;  4AG1 C;  3VRY A;  3KFV A;  2OJ2 A;  4EIK A;  4J9B A;  2AKL A;  3EG1 A;  2RNA A;  2JW4 A;  1A0N B;  5IH2 A;  5GJV B;  2J05 A;  2FG0 A;  1M3A A;  2CH4 W;  2D0N A;  3A98 A;  2GQI A;  2CDT A;  2A37 A;  1Y57 A;  1GBQ A;  2CUD A;  1NLP C;  4D8D A;  4DEX A;  2KRS A;  2JS0 A;  2EBP A;  3VS6 A;  1JQQ A;  1MV3 A;  2DYB A;  4ZNX A;  1GCP A;  2GBQ A;  1I0C A;  1ZLM A;  2HBW A;  1PKS A;  2NWM A;  2RN8 A;  3VS4 A;  3FJ5 A;  4RUG A;  4ORZ A;  2LJ3 A;  1ZUY A;  4K11 A;  1YWP A;  2V1R A;  2ED1 A;  2LQW A;  2JS2 A;  3VS3 A;  2FRY A;  5HCK A;  2MOX A;  1QKW A;  2D8J A;  4X1V A;  1YN8 A;  4ESR A;  1KFZ A;  1PRL C;  1AD5 A;  3M0S A;  2FO0 A;  4R0K A;  3RNJ A;  3H0H A;  2DL3 A;  4OML A;  2JXB A;  3I5S A;  1K4U S;  2FPE A;  4JPB W;  5IHK A;  1UE9 A;  2HEQ A;  3H0I A;  2KRO A;  2ESW A;  1AWJ A;  2YUQ A;  4QT7 A;  2XMF A;  2DX1 A;  2CUB A;  2VWF A;  5I22 A;  2ED0 A;  4F16 A;  1YP5 A;  1GCQ C;  1UHC A;  2KYB A;  4JJC A;  2OAW A;  3CQT A;  1ZUK A;  1WLP B;  4RTY A;  2KRM A;  2W10 A;  2V1Q A;  2BTT A;  2BZX A;  1SRM A;  4JJD A;  3NPF A;  2CH4 A;  2JM8 A;  3M0U A;  1VA7 A;  2LCS A;  1FMK A;  3VS0 A;  1WDX A;  2LNH B;  1UJY A;  2EYW A;  2DNU A;  1PNJ A;  4HVV A;  1G2B A;  2KR3 A;  1GRI A;  3EHQ A;  2EYX A;  2L3P A;  4OMO A;  2X3W D;  2DL5 A;  5I11 A;  1ZBJ A;  3JV3 A;  1M3C A;  2C0I A;  1CKA A;  1PRM C;  4M4Z A;  2PNI A;  2RQV A;  5FWB A;  4AG2 C;  4LUD A;  2AK5 A;  2RQW A;  1NYG A;  2SEM A;  1TUC A;  1TG0 A;  1ZUU A;  2EYZ A;  4JZ3 A;  2O88 A;  1WFW A;  1VYU A;  4A63 B;  4J9H A;  2L2P A;  5IHN A;  1WA7 A;  3U23 A;  1JU5 C;  1K76 A;  2O31 A;  1CKB A;  2DRM A;  2F2V A;  1M8M A;  3UA7 A;  1H8K A;  1MUZ A;  2O9V A;  1AZG B;  4CC3 A;  3THK A;  2YDL A;  3O5Z A;  1K1Z A;  4GLM A;  2G6F X;  1UTI A;  2RPN A;  4Z8A A;  1AOJ A;  2H8H A;  1E6G A;  1WYX A;  3RBB B;  2DIL A;  2W0Z A;  1LCK A;  2X3X D;  4Z88 A;  2RQU A;  2DRK A;  4JZ4 A;  2J6F A;  1GFD A;  4RTU A;  3NGP A;  1T3S A;  3VRZ A;  5IXF A;  2LX7 A;  3VS2 A;  1YCS B;  2LQN A;  2CSQ A;  1QWF A;  1UEC A;  3UAT A;  2RMO A;  1WI7 A;  2GTO A;  1IO6 A;  1VYT A;  3M0T A;  4AFQ C;  2I0N A;  2EKH A;  1CSK A;  4AFZ C;  1K0X A;  1SPK A;  1Z9Z A;  1W70 A;  2CRE A;  4F14 A;  1W1F A;  1YWO A;  3UA6 A;  1OPL A;  2JT4 A;  4J9D A;  2M51 A;  1Y0M A;  3IQL A;  1I07 A;  1HD3 A;  2DJQ A;  1UGV A;  1PHT A;  1JO8 A;  3PE0 A;  4OMM A;  1RLQ C;  4Y92 A;  3ULR B;  2PZ1 A;  1AWW A;  2KBT A;  3LH5 A;  2M0Y A;  1V1C A;  1NLO C;  2D8H A;  4RTW A;  1NM7 A;  2PTK A;  3TSW A;  4HXJ A;  1SRL A;  4CC4 B;  3SEM A;  5GJW B;  2KE9 A;  3NMZ C;  1BBZ A;  2FRW A;  4IIO A;  4J9C A;  1X69 A;  2K6D A;  2JTE A;  3C0C A;  1X27 A;  1AVZ C;  2LZ6 B;  3I5R A;  1AZE A;  2LMJ A;  3M0R A;  1N5Z A;  2OI3 A;  4CC2 A;  2MIO A;  3M0Q A;  2RQT A;  3VS7 A;  3TVT A;  2CT3 A;  2L3Q A;  3VS1 A;  4OMQ A;  1K0S A;  1Z9Q A;  3EHR A;  2GTJ A;  2YUO A;  2B86 A;  4J9E A;  4AFU C;  2KXD A;  3H41 A;  2K9G A;  2EPD A;  4LUE A;  1X43 A;  1QKX A;  2A36 A;  3SHW A;  5EC7 A;  1SHG A;  4HCK A;  2KT8 A;  2VKN A;  2K79 A;  1FYN A;  1AEY A;  4Z89 A;  2EW3 A;  1X2K A;  5IXB A;  1BK2 A;  3UF4 A;  2ECZ A;  4RTV A;  1K9A A;  2A08 A;  2QDL A;  2DMO A;  2HCK A;  2K3B A;  1KSW A;  1U06 A;  2AZV A;  1UHF A;  1QCF A;  1SHF A;  4F17 A;  4D8K A;  2JM9 A;  2ENM A;  4OMP A;  4J9F A;  1NG2 A;  2KYM A;  2L3S A;  2JMA A;  3TSZ A;  3QWY A;  2KEA A;  1UG1 A;  1X6G A;  1GBR A; 
#chains in the Genus database with same CATH topology
 3DLM A;  1G3T A;  1R77 A;  4OB3 B;  4LNP A;  5IAY A;  3PTA A;  3P8D A;  4LDX A;  2CS7 A;  2RHZ A;  4C8Q E;  2DE0 X;  1PC0 A;  2ROT A;  2ZCF B;  1Q86 R;  5GAN g;  1X2Q A;  1OPK A;  2XID A;  1BCO A;  3X28 B;  1ZX6 A;  2BZ8 A;  4FT2 A;  1B3Q A;  2O2O A;  4OMF B;  5FLX E;  2JMC A;  1YHQ T;  2NYS A;  5FWC A;  1IRX A;  1AT1 B;  3VUZ A;  1G5V A;  2KT1 A;  4L59 A;  2QQS A;  2NLU A;  3OS5 A;  2FB7 A;  4BI8 B;  3PMT A;  3A5Z B;  3CMA A;  5GMK e;  2HZY A;  3PVQ A;  5CO7 A;  1KK7 A;  3EAE A;  4XTU A;  1MV0 B;  2R58 A;  1R0B G;  1J3T A;  2E1H A;  1M90 U;  3INZ A;  3MHX A;  3NFC A;  1T3L A;  1ZSG A;  4QQ6 A;  1SF9 A;  1N27 A;  2RM4 A;  4JJB A;  1Q7Y C;  3M56 A;  4BD3 A;  1K73 R;  4E7I A;  2P4T A;  2RB6 A;  1UDL A;  1OEB A;  2QEX A;  2HAX A;  1IGU A;  2IIM A;  3VS5 A;  4KGX B;  5FU6 C;  1BU1 A;  2LCC A;  4GBQ A;  3R6N A;  2I2L A;  2VVK A;  3HRT A;  4FSS A;  1M2V B;  4CC7 A;  4C0Z A;  4RTZ A;  1PWT A;  5L8R E;  3CC2 A;  1QQJ A;  3LW5 E;  2DL4 A;  3EGX A;  4KUL A;  1JXO A;  4KH1 B;  1VQO T;  3V8J A;  5IT9 E;  2J7I A;  2QQ9 A;  3GLX A;  2AZS A;  1BKB A;  3CCL T;  2J06 A;  4F7U G;  4M75 B;  2A28 A;  2VV5 A;  1NJI C;  1VQ7 T;  1GCQ A;  1NEG A;  4TVR A;  2BZY A;  3A8G B;  1T0H A;  2RHX A;  2KXC A;  4RTX A;  3J80 E;  1VQK Q;  1I1J A;  1Q7Y U;  1RAF B;  2EFI A;  4FSX A;  3LX7 A;  4FYV B;  3EFR A;  1QLY A;  1YIT T;  4JRP A;  4M78 E;  3CD6 A;  1TTH B;  3VJP A;  3FDR A;  1WX6 A;  1YBY A;  2RI2 A;  1HSQ A;  4IIM A;  1OZ3 A;  2DVE A;  2X4X A;  4HCZ A;  3CCM A;  2O9S A;  3EG0 A;  3QII A;  5KYX A;  1PD0 A;  3SDZ A;  2JTM A;  4LDY A;  1AHJ B;  3I9Q A;  2XI9 A;  2CYZ B;  3MKD A;  5GAO n;  3WXM B;  4A54 A;  5GAO p;  4EIK A;  2XHC A;  2EJF A;  4JJN K;  2AKL A;  1NJI U;  2QGF B;  2CH4 W;  2DJZ A;  3O8V A;  3JCM W;  3CME T;  2A37 A;  3G4S Q;  3CCV A;  1PSE A;  1YJW T;  4A53 A;  4ZNX A;  1GCP A;  3S3O A;  4GY5 A;  4C0F A;  2R57 A;  3JCM f;  3ME9 A;  4PFO A;  1PKS A;  4ATO A;  1VUB A;  2E65 A;  1OX8 A;  2RN8 A;  4ORZ A;  2LJ3 A;  1YWP A;  2QA4 T;  1W2B S;  2L89 A;  4E7J A;  3VS3 A;  3M59 A;  4WF2 A;  3BY7 A;  4XK8 E;  2EIF A;  3CC7 T;  1X01 A;  1YN8 A;  4C8Q G;  2VB6 A;  3RES A;  2Y90 A;  2F69 A;  1PRL C;  5LJ3 j;  3RER A;  2K5I A;  3QKJ A;  1G8X A;  2LQK A;  3H0H A;  5KYY A;  1RAC B;  2JXB A;  1GXI E;  2RJF A;  2GFA A;  1K9M C;  2KRO A;  4FL6 A;  4QT7 A;  1QP2 A;  2VWF A;  1PD1 A;  4F16 A;  1YP5 A;  2CZ1 B;  2OAW A;  2QDY B;  4M77 F;  2CP5 A;  1WLP B;  2BTT A;  1Q81 U;  2BUD A;  2MMP A;  5KH6 A;  2KQW A;  4JJD A;  2LVM A;  1MND A;  2E12 A;  3M0U A;  1YIT A;  2LCS A;  2QXF A;  4RCC A;  3VS0 A;  1KC8 R;  1WDX A;  3MP8 A;  5CKF A;  2EYW A;  4M75 E;  2CP2 A;  4J7F A;  1H3Z A;  2ZPE B;  1VQP T;  3A8H B;  4BB7 A;  5M9O A;  4N0A C;  1M1K C;  5GMK j;  5KYU B;  2RQV A;  4FCY A;  5FWB A;  1K9M U;  2SEM A;  4OVA A;  4EPC A;  3OS2 A;  2ATC B;  1TG0 A;  1ZUU A;  4M7D G;  1YCY A;  4N4G A;  3OMC A;  4DBR A;  4J83 A;  2D0Q B;  4PNO A;  2O31 A;  2HL5 C;  2F2V A;  1M8M A;  3CME A;  3TU4 K;  3CXC S;  1K1Z A;  2VYT A;  1UTI A;  5D6W A;  2H8H A;  1E6G A;  2DIL A;  2RQU A;  3EH2 A;  4QQD A;  4XTZ A;  1GFD A;  4B9W A;  1T3S A;  3DKM A;  3VRZ A;  6AT1 B;  3VS2 A;  3SWN A;  1N9R A;  5CKD A;  4M77 D;  2CSQ A;  4E2F B;  1UEC A;  3CCR T;  1D3B A;  1M90 R;  4FYX B;  2QA4 A;  4NOY A;  2RMO A;  1M1K U;  4ZN3 A;  2XDB A;  2I0N A;  3GOX A;  3OA6 A;  1WHH A;  1CSK A;  1MHN A;  1WHK A;  3JB9 I;  3JCM e;  1W70 A;  2CRE A;  3CC7 A;  2YRV A;  4XQ3 A;  1EX4 A;  2PQW A;  2YLB A;  4A4K A;  3CD6 T;  1NBE B;  2X9H A;  1I07 A;  1ZSZ B;  5LJ5 g;  5FU7 C;  3PFS A;  1FMW A;  1UGV A;  4OMM A;  4PJO C;  3L2U A;  3TRE A;  2DTI A;  2MAM A;  2HQE A;  3CC4 T;  3OYH A;  1VQM A;  4B9X A;  2PTK A;  3SEM A;  2FRW A;  4J9C A;  3J81 E;  1X69 A;  4DBQ A;  2K6D A;  4JS5 A;  3T9N A;  2LTO A;  3I5R A;  1AZE A;  4FYY B;  1N5Z A;  1N9S A;  1JRI A;  2KDS A;  3MET A;  4C92 C;  2XG8 D;  2OTJ T;  2E5Q A;  2EQK A;  5HK3 A;  1Z9Q A;  4HT9 A;  1YHQ Q;  5KCO A;  3OYB A;  2DPP B;  2D9T A;  1HXD A;  4OB0 B;  4FW1 A;  4A4E A;  2LQ8 A;  3URG A;  4LUE A;  2HNI A;  4MZP A;  2A36 A;  3G4S T;  1M9S A;  3JB9 F;  3I56 T;  4HCK A;  4FM4 B;  2K79 A;  1VIE A;  5IXB A;  3QDF A;  4X9D A;  1PSF A;  4Z02 A;  2ECZ A;  3X26 B;  1NJI R;  2A08 A;  3HPW A;  4JRI A;  4J6X A;  5J3B A;  1VQ9 T;  1YIJ T;  1UGR B;  1NG2 A;  1NPR A;  4BY6 C;  3SD4 A;  3CCR A;  1NE8 A;  4M7A G;  1X6G A;  1GBR A;  2FPD A;  4C5G A;  1ABQ A;  1VQO Q;  4XU0 A;  4M75 G;  1KQS S;  5CIU A;  2E6N A;  3CCL Q;  3L2Q A;  3MJX A;  1OOT A;  1KG1 A;  2KY9 A;  4KUI A;  2JZ2 A;  1VQ7 Q;  1RUW A;  3EGU A;  1ZBX A;  2MK5 A;  1AWX A;  1VQK A;  1TXQ A;  1OYX A;  4RTT A;  5GAM h;  2AKK A;  4KT0 E;  1KHI A;  1TWB A;  8AT1 B;  4IUQ A;  5GAN f;  2FL7 A;  3REA B;  3GPL A;  2HD0 A;  4BAC A;  1H92 A;  4BE2 A;  2DL7 A;  3JB9 D;  4OB2 B;  3MEV A;  2EWN A;  1B34 A;  1XJW B;  2P4R A;  4QQG A;  2KGT A;  4KUD K;  2C0T A;  5HK0 A;  1OZ2 A;  2ZPH B;  3M0P A;  5KYY B;  1Q81 R;  1H3H A;  1OUL A;  2J6O A;  3JCM P;  2E5K A;  1ABO A;  1UJ0 A;  1XOV A;  1VIF A;  1NEB A;  5DM7 R;  1UUE A;  3PNW C;  1U3O A;  1TOV A;  3CPF A;  3V8K A;  1AWO A;  2F2W A;  1M1F A;  4J9G A;  1W2B P;  2C0O A;  1OV3 A;  4E7Z A;  1X75 C;  4HVU A;  2RH2 A;  4PLI A;  1EFN A;  3G4S A;  3HKS A;  2EQI A;  3I56 A;  5J26 A;  1IB8 A;  2EYY A;  1YJW Q;  1KHC A;  2AT1 B;  3TQ7 P;  4M77 A;  1XTD A;  2L0A A;  1NYF A;  2PUK B;  5I2S A;  3JCM X;  3RKX A;  1G83 A;  2KRN A;  3ZFJ A;  2DA9 A;  4KRT A;  1ARK A;  1JJ2 A;  2YSQ A;  3ZEH A;  5HY6 A;  2YUN A;  3QG1 A;  2GQV A;  1GL5 A;  2K2V A;  2WSF E;  1IHW A;  3OW2 S;  2K57 A;  1WXU A;  2Y4Y A;  1K8A C;  3CCE Q;  2JOY A;  1YIJ A;  1ZQ1 A;  3CC7 Q;  1RI9 A;  1TUD A;  2ABL A;  3NHN A;  1YNZ A;  3NTI A;  2X35 A;  2EGA A;  3PVL A;  5KYU A;  2FEI A;  2DFU A;  1TUG B;  4D6W A;  4JRQ A;  1PCX A;  3OYI A;  4C92 G;  5LJ5 h;  3I35 A;  3JB9 J;  3GNF B;  4XTX A;  2K2M A;  4HVW A;  1LJO A;  2VXF A;  4JRK A;  4C8Q C;  4ZN1 A;  4AG1 C;  5C0M A;  3JRZ A;  3SWN B;  1D3B B;  1KQ1 A;  2JW4 A;  2RNA A;  1RAA B;  3R6O A;  3C4S A;  2FG0 A;  1WPY A;  3A98 A;  1K8A U;  4KGZ B;  1NLP C;  4D8D A;  2DEQ A;  1VQP Q;  4DEX A;  3CXC P;  4GLK A;  5GAN e;  3AHU A;  3C12 A;  1MMA A;  5CK9 A;  2NUT A;  5CKH A;  4M7D D;  2DYB A;  3BDU A;  1ZLM A;  3M4Y A;  3AT1 B;  2VC8 A;  4J6Y A;  3S6W A;  4L6V 5;  5GAN 5;  1EIF A;  3FJ5 A;  2MI6 A;  4K11 A;  1ZSZ A;  2PVO B;  5GAN 2;  2ED1 A;  2LX9 A;  1WHM A;  1Q95 G;  2EQJ A;  4EMK C;  3KBG A;  1QKW A;  3OYJ A;  2DEU A;  3UDC A;  3P8H A;  4OB1 B;  5A2Q E;  3M0S A;  1VQ8 T;  4R0K A;  3MEW A;  4LD9 K;  4M7D C;  3I5S A;  1YJN T;  1UE9 A;  4F7U A;  1RAG B;  3D7S B;  1AWJ A;  3CCR Q;  1ACM B;  2CUB A;  2KVQ G;  3VYG A;  2ED0 A;  2KYB A;  2F5K A;  4ELY C;  5CAI A;  2KSS A;  4RTY A;  2KRM A;  2RI3 A;  2W10 A;  1ZA1 B;  4OF1 A;  2CH4 A;  2JM8 A;  3JCM d;  2K3Y A;  1KD1 C;  3MEU A;  1PNJ A;  2KR3 A;  1GRI A;  2EYX A;  2DL5 A;  1QCO A;  3CC4 Q;  1ZBJ A;  3JV3 A;  1PRM C;  2PNI A;  1RAE B;  2RJE A;  3QJY A;  2MWO A;  2BE9 B;  2EJG A;  1TUC A;  4JZ3 A;  4B6M A;  1FWZ A;  4J9H A;  1Y7X A;  3U23 A;  4JLG A;  1Q82 R;  1K76 A;  3E9F A;  5GMK l;  3H9N A;  3NTH A;  1IZ6 A;  3UA7 A;  4ANJ A;  3OYN A;  2OTJ Q;  4BI3 A;  3PGG A;  5KYW A;  4CC3 A;  1OU8 A;  3THK A;  3L2R A;  2QQR A;  2RPN A;  4LDU A;  1YHQ A;  5CQY A;  1WYX A;  1QMC A;  1JBM A;  5CR2 A;  1KD1 U;  2DRK A;  2J6F A;  2RO0 A;  1Y96 B;  2LX7 A;  1N8R R;  2Z0W A;  1DJ7 B;  3I56 Q;  3PMI A;  3MEA A;  1VQ4 Q;  3N5B B;  2GTO A;  1IO6 A;  1VYT A;  4AFQ C;  1MNE A;  2EKH A;  2IPO B;  3OYD A;  2YRD A;  1B34 B;  1SPK A;  1K0X A;  4QVZ A;  4F14 A;  4FW2 A;  2IVW A;  1W1F A;  1YWO A;  3RMS A;  3OYC A;  1KQS P;  4J9D A;  2M51 A;  1Y0M A;  2E4H A;  1QVG P;  1VQ8 A;  2DJQ A;  1VQ9 Q;  1JO8 A;  3PE0 A;  4R55 A;  3CCE T;  1OU9 A;  1YIJ Q;  1TS9 A;  1RLQ C;  5AYF A;  2COW A;  2DD5 A;  2A3L A;  3ULR B;  4M7A D;  3FEO A;  1U1S A;  1UEB A;  1FX7 A;  3ASK A;  2PU9 B;  1UGQ B;  2M0Y A;  5LJ5 f;  5FU7 B;  3TSW A;  4CC4 B;  1VQO A;  3QJ6 A;  4FYW B;  4J7I A;  3OBW A;  1X27 A;  3BDL A;  4PJO F;  2LZ6 B;  1I8F A;  2MF2 A;  2V8I A;  2OI3 A;  3CCL A;  5GAM g;  1VQ7 A;  4M77 B;  5LJ3 h;  3VS7 A;  3TVT A;  2COZ A;  2CT3 A;  2L3Q A;  5CQX A;  1BI3 A;  3A1P A;  1K0S A;  2OTL Q;  3H8Z A;  4M7A C;  2GTJ A;  2O01 E;  2KXD A;  4M75 C;  4RCB A;  3CCQ T;  5GAN j;  4M7D A;  4ZTJ A;  4N4H A;  3L42 A;  4JLI A;  1SHG A;  4ELZ C;  2KT8 A;  2VKN A;  1FYN A;  1V29 B;  4Z89 A;  3OYE A;  2EW3 A;  5I2M A;  1N6A A;  4PFZ A;  4RTV A;  4A4F A;  4PLL A;  2X4W A;  1QW1 A;  4CRI A;  3G71 Q;  1Y07 A;  2AZV A;  1UHF A;  1QCF A;  1BCM A;  3CEY A;  5GMK h;  1M2O A;  3OW2 P;  3CPW S;  2ENM A;  4MZM A;  2KYM A;  2L3S A;  1YJW A;  3WVD B;  2QAS A;  3TSZ A;  4PL6 A;  4QVD A;  3QWY A;  1Q86 C;  4PJO D;  1G3Y A;  1U8R A;  2CP3 A;  1LVK A;  2A0F B;  3UT1 A;  4MDX A;  5IN1 A;  3ER0 A;  3E19 A;  3G7Z A;  1QVF S;  1LNX A;  2M16 A;  4KH0 B;  3GBQ A;  3I55 T;  3RKY A;  2RJC A;  1RLP C;  4BY6 B;  4WCI A;  2NUT B;  2VGN A;  3EG2 A;  3E2U A;  1WJS A;  2JVV A;  4M78 G;  2YUP A;  3CCE A;  3RR6 A;  3M4G A;  4AMC A;  4PJL A;  2QTX A;  1KQ2 A;  5AT1 B;  1M27 C;  2EGC A;  1I81 A;  4C92 D;  5ECA A;  1XQH A;  3JCM Q;  3L2Z A;  3OYF A;  3JCM c;  2HSP A;  1RL2 A;  1B07 A;  1FXX A;  3JSC A;  1S72 T;  2DZ9 A;  1JEG A;  1S1N A;  4XAX B;  3JB9 H;  2FPF A;  2VUB A;  2HMA A;  1KJW A;  2SRC A;  4OGE A;  4RKU E;  1BI2 A;  1Q86 U;  4L5G A;  5LJ5 e;  3REB B;  1K73 C;  2LC4 A;  3MPU B;  4F7U B;  3OMG A;  1YJ9 T;  1R8O B;  4F7U F;  1D0Y A;  4DEY A;  4R56 A;  2X4J A;  5D7U A;  2RK1 A;  1KQS A;  1Q7Y R;  1PKT A;  3HP9 A;  4M77 E;  3H0F A;  1QVG A;  3CBM A;  4LN2 A;  2EVR A;  4E7L A;  1VQP A;  1ZHI A;  3QWX X;  2X51 A;  2MCN A;  5FRM A;  3L1A A;  5GAN d;  5KYN A;  2HDA A;  2DXC A;  3OQ5 A;  1U5S A;  2YT6 A;  3L2W A;  5KE2 A;  4BI4 A;  1VQ4 T;  2RJD A;  2QQB A;  5GAO l;  2DK3 A;  4C5E A;  5A0L A;  5HKC A;  1M30 A;  5FW9 A;  1K73 U;  5L23 A;  2HQX A;  1UFF A;  3OS0 A;  3EG9 A;  3E9G A;  2NUZ A;  3OYY A;  1WJQ A;  4BE1 A;  1C0M A;  4ZTF A;  2WSE E;  1X6B A;  1VQ8 Q;  3GIB A;  2DYI A;  4N4I A;  2K7A A;  1UB4 A;  5GAO r;  5GAN 3;  5KYW B;  1WXB A;  1YJN Q;  2K4Y A;  3JCM b;  2CSI A;  2DLP A;  2GGR A;  4E6R A;  2DBK A;  4N0A A;  1QCN A;  2F2X A;  1OX9 A;  2LP5 A;  3CCU Q;  1MMD A;  2D1X A;  2DTO A;  3VRY A;  3KFV A;  3WVE B;  3FIF A;  3EG1 A;  4HCB A;  5IH2 A;  2RA2 A;  3OYM A;  4DQ2 A;  3DLL A;  2D0N A;  4EMH A;  1Y96 A;  3EGD A;  4C8Q B;  2CDT A;  1Y57 A;  2ZPI B;  2CUD A;  3F70 A;  4C8Q F;  3DB3 A;  2ZPG B;  2OTL T;  2M0O A;  3CC4 A;  2KRS A;  4XU3 A;  2JS0 A;  4RG8 A;  2B8A A;  2K3X A;  3RUX A;  1NPP A;  4XU2 A;  1ZA2 B;  1D1C A;  2HBW A;  3PIP A;  2PVD B;  2MWP A;  2QG9 B;  1YJ9 A;  2IG0 A;  3VS4 A;  4RUG A;  1ZUY A;  1WHL A;  2V1R A;  4J5Y A;  4KBM B;  3OYL A;  2LQW A;  2JS2 A;  2RHI A;  2FYK A;  3QUI A;  3EFS A;  3VU3 C;  3P8B B;  4QVC A;  1VQ6 T;  2OTJ A;  1WZO A;  2FRY A;  5HCK A;  3BE3 A;  4X1V A;  1KFZ A;  1VQ5 Q;  2GF7 A;  2GFU A;  1VQN Q;  3G71 T;  3OSV A;  1D1A A;  4F7U E;  1AD5 A;  4C0D C;  1IHV A;  1RAH B;  2DL3 A;  4PJO A;  4RMO A;  1VQL Q;  4LD6 A;  4JPB W;  1PM3 A;  4E7H A;  2HEQ A;  3H0I A;  3CMA T;  1VQ4 A;  2YUQ A;  3PIO A;  3OS1 A;  4QW2 A;  1K9M R;  1WQ7 A;  5I22 A;  1GCQ C;  1UHC A;  3CQT A;  4M7D B;  1ZUK A;  5FU6 B;  2NUP B;  4M7D F;  1SSF A;  2V1Q A;  1XNI A;  1KC8 C;  2BZX A;  4MZT A;  3RDV A;  1SRM A;  2JNG A;  4C8Q D;  3SFM A;  1VQ9 A;  2VGM A;  4C92 A;  3CCS Q;  2LNH B;  5GAN 7;  3VUB A;  1C6V X;  2QEX T;  1G3S A;  4HVV A;  1G2B A;  3EHQ A;  2L3P A;  1LPL A;  3MCA B;  4PJJ A;  2C0I A;  2DAQ A;  3S3N A;  1CKA A;  2EAY A;  2HBP A;  4Q5W A;  1Y71 A;  4M4Z A;  3JCM J;  2L8D A;  3CC2 T;  4MMK A;  4LUD A;  5LJ3 g;  2AK5 A;  4M77 G;  1C1A A;  1M1K R;  2O88 A;  1WA7 A;  3M54 A;  1SG5 A;  3A8M B;  1CKB A;  2FZG B;  3FRN A;  1BIA A;  1H8K A;  5GAO m;  1AZG B;  1KC8 U;  2OTL A;  1D09 B;  2E70 A;  4Z8A A;  2RD1 A;  1AOJ A;  2EJ9 A;  3RKW A;  2W0Z A;  2X3X D;  3CCQ Q;  4RTU A;  3NGP A;  1M90 C;  3HL8 A;  4BE0 A;  5GAM d;  4PFP A;  1YCS B;  3CPW P;  2LQN A;  2H3J A;  4QKU A;  2WSC E;  2V8K A;  2M1H A;  3UAT A;  3CCM T;  1YI2 Q;  3M0T A;  1WNL A;  1JB0 E;  1QP3 A;  1VQ6 A;  2DXB A;  2EYQ A;  1Z9Z A;  2LDM A;  1QVF P;  3G71 A;  5CKE A;  1VOM A;  3M9Q A;  1JJ2 S;  3HSB A;  5FRO A;  1PHT A;  4J8O A;  2PZ1 A;  4F04 B;  1AWW A;  4XTW A;  1UGS B;  3CCV T;  1V1C A;  3V7R A;  2F5T X;  4BDZ A;  5GJW B;  2KE9 A;  1BBZ A;  4IIO A;  4JUV A;  3LYI A;  2JTE A;  2XU8 A;  3LWI A;  1AVZ C;  4M78 D;  3I55 Q;  5DLQ E;  3M0R A;  3OBY A;  5CKB A;  2MIO A;  3M0Q A;  2DD4 A;  4PJM A;  3CCU T;  1WHJ A;  3CCJ T;  2RQT A;  3HRS A;  3UWN A;  5A0D A;  4OMQ A;  4M7D E;  2COY A;  2C06 A;  2B86 A;  3QZ9 B;  5GAM f;  3M55 A;  3G6E T;  5J39 A;  1S72 Q;  1D1B A;  2L5Q A;  2ZPB B;  3H41 A;  2EPD A;  1X43 A;  1QKX A;  3EG9 B;  4MML A;  1W2B A;  3V7C A;  3SHW A;  2XDD A;  4XTY A;  5EC7 A;  4M7A B;  4M78 C;  2GCX A;  4M7A F;  2M02 A;  4O6J A;  1AEY A;  1M1G A;  5EG2 A;  2YLC A;  2E3I A;  3LH0 A;  4M75 F;  2JTF A;  3QYH B;  5LJ5 d;  1YJ9 Q;  2XDP A;  3J7A F;  2QDL A;  4VUB A;  4C0G A;  2AHJ B;  2DMO A;  4HCC A;  2HCK A;  2O4X B;  1TSF A;  2ZAE A;  4IUT A;  2DZC A;  3HTR A;  4HT8 A;  5I21 A;  1LOJ A;  1SHF A;  4F17 A;  1O75 A;  2OX7 A;  1I5L A;  2AIR B;  4FIB A;  2V8J A;  1VQ5 T;  1WQW A;  1VQN T;  3SWN C;  2FZC B;  3QYG B;  3HFO A;  2BE7 D;  4PJN A;  3JB9 G;  1OQK A;  2CZ6 B;  2LT1 A;  2KEA A;  2RHU A;  2KI7 A;  2ZGW A;  3EGD B;  1VQL T;  3M53 A;  4LE9 A;  1D0X A;  3QDR B;  1HYO A;  3RIR A;  3C94 A;  3NTK A;  2HKQ B;  2DL8 A;  2R5M A;  4C8Q A;  1QVP A;  2E6Z A;  4NL3 A;  5KCH A;  2V26 A;  2RHY A;  5CCA A;  3X20 B;  1VYV A;  1F1B B;  3JCM V;  4V2S A;  5D6X A;  1U1T A;  3CCS T;  2EGE A;  1T0J A;  1GFC A;  2DKG A;  1YJN A;  3OYK A;  4OMN A;  4E7K A;  2JJ9 A;  1Q81 C;  3C95 A;  4M75 D;  2J6K A;  2LJ0 A;  2RF0 A;  3CXC A;  1TU0 B;  1SEM A;  3CPW A;  1SKU B;  2RQR A;  3CCU A;  3CCJ A;  2GNC A;  4PJO B;  3X25 B;  2CT4 A;  2DF6 A;  1E7O A;  3HRU A;  3GF5 A;  2HKN A;  3VKI A;  1V76 A;  3H6Z A;  2MYS A;  3G6E A;  4IUU A;  3M58 A;  1QVF A;  2RK2 A;  3KXT A;  4E7S A;  2LJ1 A;  4IUV A;  2DBM A;  2KNB B;  4NL2 A;  4EMK A;  1RAD B;  7AT1 B;  2QGG A;  2KAF A;  1E6H A;  2X4Y A;  4Y91 A;  3S3M A;  1MMG A;  1W6X A;  5GAM e;  1JXM A;  5IHI A;  3VV0 A;  1VQM T;  4C92 B;  2NUP A;  1SSH A;  4C92 F;  3OSS C;  4A4G A;  1WJR A;  2QTV A;  1IRE B;  1KIK A;  2JUF A;  2DM1 A;  3M57 A;  4KGV B;  5GAN 4;  4AFS C;  1HK9 A;  4YTL A;  1YI2 T;  3EG3 A;  2D6F A;  3ZL7 C;  4M7A E;  1WIE A;  3OB9 A;  1VQ6 Q;  5GAN h;  2VAS A;  4XU1 A;  1VQ5 A;  2OAU A;  1VQN A;  3E1S A;  3EFO A;  2ROL A;  1QWE A;  1K8A R;  1WGS A;  4J9I A;  2LRQ A;  4Y28 E;  1BB9 A;  1NZ9 A;  2DVJ A;  1VQL A;  4JDS A;  2WAC A;  4IUP A;  2CZ0 B;  4EDU A;  3CMA Q;  2Y4X A;  2QQA A;  2FZK B;  2E41 A;  3QPH A;  4IUR A;  1HJD A;  2DXT A;  4M78 A;  3OYG A;  2R5A A;  1WXT A;  2FVU A;  1FMV A;  1M3B A;  2HL3 A;  4FT4 A;  2CP7 A;  3TCJ A;  9ATC B;  4DA4 A;  3JAM E;  3EH1 A;  2G3R A;  2OJ2 A;  4J9B A;  2DIQ A;  2LCL A;  2JN0 A;  1A0N B;  8ATC B;  2YRC A;  5GJV B;  2J05 A;  3CCS A;  1M3A A;  3V7S A;  2GQI A;  5GMK m;  2QEX Q;  3UPU A;  1GBQ A;  1BI1 A;  2E10 A;  3MP1 A;  3JCM g;  2XKO C;  2K5F A;  4ME7 A;  4AT1 B;  2P0Q A;  1M4Z A;  3MP6 A;  2EBP A;  3GNG A;  3VS6 A;  1JQQ A;  1MV3 A;  2GBQ A;  3CC2 Q;  3QO3 A;  1I0C A;  3SB2 A;  3HHT B;  1RAI B;  2NWM A;  5A0G A;  2MPX C;  1I5O B;  3OY9 A;  1P92 A;  2QAZ A;  3FJP A;  2MOX A;  1MMN A;  1VQK T;  2D8J A;  2DIG A;  5DLO A;  4PJO E;  4ESR A;  3ZBD A;  2HSE B;  3A8L B;  4LXC A;  1X6O A;  5LJ3 d;  5DY9 A;  3CCQ A;  4M77 C;  2FO0 A;  1H64 1;  3RNJ A;  4XTV A;  3CD6 Q;  2KMT A;  4OML A;  1JJ2 P;  4DOV A;  5C6S A;  1K4U S;  2FPE A;  2E3H A;  5IHK A;  3QBY A;  5CVI A;  5GMK i;  2ESW A;  2ZZD A;  2XMF A;  2DX1 A;  3CCM Q;  2H3E B;  1YI2 A;  4C0D B;  2FHD A;  4JJC A;  2VXE A;  4C92 E;  3EGX B;  2CZ7 B;  3NPF A;  3LGF A;  1MGQ A;  2F1L A;  1M2V A;  4ZGJ B;  1VA7 A;  1RAB B;  1FMK A;  1W4S A;  4C5I A;  1UJY A;  3GP8 A;  2DNU A;  4OMO A;  2X3W D;  4M7A A;  5I11 A;  3CCV Q;  1KD1 R;  1M3C A;  1UGP B;  3OYA A;  4M75 A;  4EMG A;  4WTO B;  4DOW A;  1Q82 C;  3PT9 A;  1R0C B;  4AG2 C;  1EZZ B;  2RQW A;  1NYG A;  2DET A;  3I55 A;  2EYZ A;  2CP6 A;  1WFW A;  1VYU A;  4A63 B;  5GAN 8;  2O4X A;  2L2P A;  5IHN A;  1JU5 C;  3CBP A;  3V8L A;  4DBH A;  2BKD N;  5KYX B;  1G3W A;  3CCJ Q;  2DRM A;  2DXU A;  1MUZ A;  2O9V A;  2DER A;  3LLR A;  5LJ3 f;  4E47 A;  2YDL A;  4O5V A;  1TH7 A;  3O5Z A;  4A4H A;  1RI0 A;  4GLM A;  2G6F X;  4X9C A;  4BDY A;  2M9U A;  1N8R C;  3G6E Q;  1S72 A;  3RBB B;  3RMQ A;  1LCK A;  4Z88 A;  4JZ4 A;  3QZ5 B;  4CI0 C;  2YHT A;  3BFM A;  4ZGE B;  5GAM j;  3Q1J A;  5IXF A;  2KK4 A;  2QYZ A;  4II1 A;  1BIB A;  3OW2 A;  2P0P A;  3HFN A;  1PG5 B;  4P5N A;  1QWF A;  2ZPF B;  2PUO B;  4RG2 A;  1QVG S;  2P84 A;  1ZSZ C;  1WI7 A;  2EQU A;  2PVG B;  1YFN A;  3FLG A;  4BUG A;  1Q82 U;  3X24 B;  4AFZ C;  2LT4 A;  2DTH A;  2DO3 A;  3LGL A;  4OGC A;  3UA6 A;  1OPL A;  3M5A A;  4PKC C;  2JT4 A;  3LWH A;  3IQL A;  1YIT Q;  1HD3 A;  3BW1 A;  4Y92 A;  1BYM A;  4NS5 A;  2KBT A;  3LH5 A;  1N8R U;  2L3R A;  3QHS A;  2CKK A;  4HA8 A;  1NLO C;  2D8H A;  4RTW A;  1NM7 A;  3KUF A;  3QSU A;  4HXJ A;  1SRL A;  3QXE B;  1IXD A;  5FRN A;  4EMK B;  3NMZ C;  1I4K 1;  3TEE A;  3C0C A;  2EKO A;  1OI1 A;  2YXY A;  2LMJ A;  2HQH A;  3MO8 A;  1O9S A;  4CC2 A;  1B7T A;  4X34 A;  2QK0 A;  5KE3 A;  2QI2 A;  4ZGD B;  3CME Q;  2CP0 A;  4PK4 A;  3VS1 A;  4C5H A;  5GAN 6;  4IKF A;  1D0Z A;  3EHR A;  1BI0 A;  4J6W A;  1M8V A;  4HKE A;  3VYH B;  4J9E A;  4OP0 A;  2EQM A;  4AFU C;  2K9G A;  4LDW A;  2XK0 A;  2CGH A;  4DBF A;  3CBO A;  3L2V A;  3EFO B;  4PJO G;  3A8O B;  2RI5 A;  3JCM h;  2QA4 Q;  2P0K A;  4JS4 A;  1IGQ A;  1X2K A;  2K5L A;  1BK2 A;  3UF4 A;  5LL6 S;  5LJ5 j;  5GAO q;  1K9A A;  4FU6 A;  3FB9 A;  4UC4 A;  4M78 B;  2XIC A;  2XD0 A;  1WHG A;  1U06 A;  1KSW A;  2K3B A;  4M78 F;  2E64 A;  3FC3 A;  4D8K A;  5LJ3 e;  2JM9 A;  2YWW A;  4OMP A;  3DB4 A;  2LNV A;  4J9F A;  5D6Y A;  2JMA A;  3G1J A;  2BIV A;  1M5Q 1;  4MDW A;  1VQM Q;  1UG1 A;  4LDV A;  2YUO A;  2A7Y A; 
#chains in the Genus database with same CATH homology
 2FPD A;  1ABQ A;  4LNP A;  4LE9 A;  2DE0 X;  3GBQ A;  2ROT A;  1RLP C;  1OOT A;  1X2Q A;  4WCI A;  1OPK A;  3EG2 A;  1RUW A;  2DL8 A;  3EGU A;  1ZX6 A;  2YUP A;  2BZ8 A;  1AWX A;  1B3Q A;  4RTT A;  2AKK A;  1VYV A;  1M27 C;  2O2O A;  2EGC A;  3REA B;  2JMC A;  5ECA A;  5FWC A;  1H92 A;  2HSP A;  2DL7 A;  1B07 A;  1JEG A;  2EGE A;  1S1N A;  2KT1 A;  1T0J A;  1GFC A;  2FPF A;  4OMN A;  3PVQ A;  2P4R A;  1KJW A;  2SRC A;  2J6K A;  2KGT A;  2LJ0 A;  2RF0 A;  2C0T A;  1MV0 B;  1SEM A;  1J3T A;  2RQR A;  3REB B;  2GNC A;  3M0P A;  2CT4 A;  1T3L A;  1H3H A;  2DF6 A;  1ZSG A;  1E7O A;  2J6O A;  4JJB A;  2E5K A;  1ABO A;  1UJ0 A;  1XOV A;  4DEY A;  1NEB A;  1UUE A;  1U3O A;  1UDL A;  1AWO A;  2F2W A;  4J9G A;  1OEB A;  2LJ1 A;  2C0O A;  1OV3 A;  1PKT A;  2DBM A;  2KNB B;  2IIM A;  3VS5 A;  3H0F A;  4LN2 A;  1BU1 A;  4HVU A;  2EVR A;  4GBQ A;  3R6N A;  1EFN A;  2EQI A;  1E6H A;  2VVK A;  3QWX X;  4FSS A;  2EYY A;  4CC7 A;  2MCN A;  1W6X A;  1JXM A;  4RTZ A;  5IHI A;  1PWT A;  2L0A A;  1NYF A;  2DL4 A;  1SSH A;  2HDA A;  1JXO A;  1G83 A;  1U5S A;  2KRN A;  2DA9 A;  4KRT A;  1ARK A;  1KIK A;  2YT6 A;  2J7I A;  2DM1 A;  2AZS A;  2YSQ A;  2J06 A;  4AFS C;  2YUN A;  2A28 A;  1GCQ A;  3EG3 A;  3ZL7 C;  1GL5 A;  1NEG A;  1M30 A;  5FW9 A;  1WIE A;  2BZY A;  1WXU A;  1T0H A;  5L23 A;  2KXC A;  1UFF A;  4RTX A;  2NUZ A;  1I1J A;  1RI9 A;  1TUD A;  2ABL A;  3NHN A;  1YNZ A;  2ROL A;  1QWE A;  1X6B A;  4J9I A;  1QLY A;  2EGA A;  3PVL A;  1BB9 A;  2K7A A;  2DVJ A;  2FEI A;  1WX6 A;  1WXB A;  1HSQ A;  4IIM A;  2CSI A;  3I35 A;  2DLP A;  2GGR A;  4E6R A;  2DBK A;  1HJD A;  2O9S A;  3EG0 A;  1WXT A;  2F2X A;  1M3B A;  2K2M A;  2LP5 A;  4HVW A;  3I9Q A;  2D1X A;  4AG1 C;  3VRY A;  3KFV A;  2OJ2 A;  4EIK A;  4J9B A;  2AKL A;  3EG1 A;  2RNA A;  2JW4 A;  1A0N B;  5IH2 A;  5GJV B;  2J05 A;  2FG0 A;  1M3A A;  2CH4 W;  2D0N A;  3A98 A;  2GQI A;  2CDT A;  2A37 A;  1Y57 A;  1GBQ A;  2CUD A;  1NLP C;  4D8D A;  4DEX A;  2KRS A;  2JS0 A;  2EBP A;  3VS6 A;  1JQQ A;  1MV3 A;  2DYB A;  4ZNX A;  1GCP A;  2GBQ A;  1I0C A;  1ZLM A;  2HBW A;  1PKS A;  2NWM A;  2RN8 A;  3VS4 A;  3FJ5 A;  4RUG A;  4ORZ A;  2LJ3 A;  1ZUY A;  4K11 A;  1YWP A;  2V1R A;  2ED1 A;  2LQW A;  2JS2 A;  3VS3 A;  2FRY A;  5HCK A;  2MOX A;  1QKW A;  2D8J A;  4X1V A;  1YN8 A;  4ESR A;  1KFZ A;  1PRL C;  1AD5 A;  3M0S A;  2FO0 A;  4R0K A;  3RNJ A;  3H0H A;  2DL3 A;  4OML A;  2JXB A;  3I5S A;  1K4U S;  2FPE A;  4JPB W;  5IHK A;  1UE9 A;  2HEQ A;  3H0I A;  2KRO A;  2ESW A;  1AWJ A;  2YUQ A;  4QT7 A;  2XMF A;  2DX1 A;  2CUB A;  2VWF A;  5I22 A;  2ED0 A;  4F16 A;  1YP5 A;  1GCQ C;  1UHC A;  2KYB A;  4JJC A;  2OAW A;  3CQT A;  1ZUK A;  1WLP B;  4RTY A;  2KRM A;  2W10 A;  2V1Q A;  2BTT A;  2BZX A;  1SRM A;  4JJD A;  3NPF A;  2CH4 A;  2JM8 A;  3M0U A;  1VA7 A;  2LCS A;  1FMK A;  3VS0 A;  1WDX A;  2LNH B;  1UJY A;  2EYW A;  2DNU A;  1PNJ A;  4HVV A;  1G2B A;  2KR3 A;  1GRI A;  3EHQ A;  2EYX A;  2L3P A;  4OMO A;  2X3W D;  2DL5 A;  5I11 A;  1ZBJ A;  3JV3 A;  1M3C A;  2C0I A;  1CKA A;  1PRM C;  4M4Z A;  2PNI A;  2RQV A;  5FWB A;  4AG2 C;  4LUD A;  2AK5 A;  2RQW A;  1NYG A;  2SEM A;  1TUC A;  1TG0 A;  1ZUU A;  2EYZ A;  4JZ3 A;  2O88 A;  1WFW A;  1VYU A;  4A63 B;  4J9H A;  2L2P A;  5IHN A;  1WA7 A;  3U23 A;  1JU5 C;  1K76 A;  2O31 A;  1CKB A;  2DRM A;  2F2V A;  1M8M A;  3UA7 A;  1H8K A;  1MUZ A;  2O9V A;  1AZG B;  4CC3 A;  3THK A;  2YDL A;  3O5Z A;  1K1Z A;  4GLM A;  2G6F X;  1UTI A;  2RPN A;  4Z8A A;  1AOJ A;  2H8H A;  1E6G A;  1WYX A;  3RBB B;  2DIL A;  2W0Z A;  1LCK A;  2X3X D;  4Z88 A;  2RQU A;  2DRK A;  4JZ4 A;  2J6F A;  1GFD A;  4RTU A;  3NGP A;  1T3S A;  3VRZ A;  5IXF A;  2LX7 A;  3VS2 A;  1YCS B;  2LQN A;  2CSQ A;  1QWF A;  1UEC A;  3UAT A;  2RMO A;  1WI7 A;  2GTO A;  1IO6 A;  1VYT A;  3M0T A;  4AFQ C;  2I0N A;  2EKH A;  1CSK A;  4AFZ C;  1K0X A;  1SPK A;  1Z9Z A;  1W70 A;  2CRE A;  4F14 A;  1W1F A;  1YWO A;  3UA6 A;  1OPL A;  2JT4 A;  4J9D A;  2M51 A;  1Y0M A;  3IQL A;  1I07 A;  1HD3 A;  2DJQ A;  1UGV A;  1PHT A;  1JO8 A;  3PE0 A;  4OMM A;  1RLQ C;  4Y92 A;  3ULR B;  2PZ1 A;  1AWW A;  2KBT A;  3LH5 A;  2M0Y A;  1V1C A;  1NLO C;  2D8H A;  4RTW A;  1NM7 A;  2PTK A;  3TSW A;  4HXJ A;  1SRL A;  4CC4 B;  3SEM A;  5GJW B;  2KE9 A;  3NMZ C;  1BBZ A;  2FRW A;  4IIO A;  4J9C A;  1X69 A;  2K6D A;  2JTE A;  3C0C A;  1X27 A;  1AVZ C;  2LZ6 B;  3I5R A;  1AZE A;  2LMJ A;  3M0R A;  1N5Z A;  2OI3 A;  4CC2 A;  2MIO A;  3M0Q A;  2RQT A;  3VS7 A;  3TVT A;  2CT3 A;  2L3Q A;  3VS1 A;  4OMQ A;  1K0S A;  1Z9Q A;  3EHR A;  2GTJ A;  2YUO A;  2B86 A;  4J9E A;  4AFU C;  2KXD A;  3H41 A;  2K9G A;  2EPD A;  4LUE A;  1X43 A;  1QKX A;  2A36 A;  3SHW A;  5EC7 A;  1SHG A;  4HCK A;  2KT8 A;  2VKN A;  2K79 A;  1FYN A;  1AEY A;  4Z89 A;  2EW3 A;  1X2K A;  5IXB A;  1BK2 A;  3UF4 A;  2ECZ A;  4RTV A;  1K9A A;  2A08 A;  2QDL A;  2DMO A;  2HCK A;  2K3B A;  1KSW A;  1U06 A;  2AZV A;  1UHF A;  1QCF A;  1SHF A;  4F17 A;  4D8K A;  2JM9 A;  2ENM A;  4OMP A;  4J9F A;  1NG2 A;  2KYM A;  2L3S A;  2JMA A;  3TSZ A;  3QWY A;  2KEA A;  1UG1 A;  1X6G A;  1GBR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...