1WIEA

Solution structure of the first sh3 domain of kiaa0318 protein
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
96
structure length
96
Chain Sequence
GSSGSSGTSKQRYSGKVHLCVARYSYNPFDGPNENPEAELPLTAGKYLYVYGDMDEDGFYEGELLDGQRGLVPSNFVDFVQDNESRLASTSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the first SH3 domain of KIAA0318 protein
rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords RIM binding protein 2
total genus 5
structure length 96
sequence length 96
ec nomenclature
pdb deposition date 2004-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14604 SH3_9 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1wieA01
2RQWA 1HJDA 5FWCA 1NG2A 2FO0A 2NUZA 3NHNA 1XOVA 4HCKA 2CH4A 1MV0B 3UF4A 2DRMA 4D8DA 2L3PA 3REBB 2ESWA 2OAWA 1X2KA 4F16A 2DBMA 3ULRB 2MCNA 2HBWA 1ZBJA 1HSQA 2ED1A 2DMOA 2DJQA 2EKHA 2AZSA 2CH4W 2VWFA 1U5SA 2JS0A 4JPBW 4GLMA 2ENMA 3THKA 2G6FX 2DYBA 2DVJA 1VYUA 1Y57A 1UG1A 4LNPA 3I5RA 2K79A 3O5ZA 4J9BA 1B07A 1N5ZA 2D0NA 4K11A 3VS2A 3M0PA 2KROA 3IQLA 1OEBA 3VS4A 2DL5A 5HCKA 1YN8A 2LJ3A 1AZEA 2KYMA 1K4US 1PNJA 2BZ8A 4RTTA 1TG0A 2BTTA 4HXJA 1PRLC 2RNAA 1Z9ZA 4J9DA 1H3HA 1AZGB 2K9GA 1K0XA 3I35A 5L23A 1ZUKA 2K7AA 2JTEA 3JV3A 2OI3A 2FEIA 2JMCA 1K76A 2RQUA 2EQIA 2LZ6B 3NPFA 3EG3A 1YP5A 2B86A 1OOTA 2CREA 2X3WD 4HVUA 2JW4A 4RUGA 2YSQA 2J6KA 1M3CA 2JMAA 1AWJA 2MIOA 4ESRA 2SRCA 4J9CA 3TSWA 2DLPA 1J3TA 1SHFA 1OPKA 3VS7A 1UJ0A 1RUWA 4CC4B 2W0ZA 5IH2A 4AFUC 4LUEA 3U23A 4CC7A 2SEMA 2CSQA 1W1FA 2HEQA 1SRLA 4JZ3A 1RLQC 4RTZA 2O31A 1WDXA 1X6BA 2KRSA 3RNJA 2HDAA 3EHRA 1IO6A 1WLPB 2CSIA 1SHGA 1YCSB 3PE0A 3CQTA 1PRMC 3M0RA 2KBTA 2AKLA 2KYBA 4FSSA 2RN8A 1SEMA 2KR3A 2O88A 4A63B 1T0JA 1T3SA 2FG0A 1W70A 3VS5A 1T3LA 4OMPA 1G83A 1ZX6A 1K9AA 2FRWA 3TSZA 2LQWA 1EFNA 2EGEA 1QWEA 2V1QA 1UGVA 1AEYA 3QWXX 4GBQA 2DM1A 1GBQA 2K6DA 1NLOC 1UHFA 1X27A 2BZYA 1MUZA 1ZUYA 1E6HA 2CDTA 2I0NA 4QT7A 1NEBA 2EVRA 2JS2A 3VS3A 2CUDA 3SEMA 1ABOA 2YUNA 3FJ5A 1GFDA 2K2MA 3ZL7C 1X43A 4E6RA 1QLYA 1UECA 4JJBA 2J05A 4ORZA 3VS0A 4M4ZA 2D8HA 2KE9A 4Z88A 3SHWA 2RF0A 4OMQA 2CUBA 2LJ0A 2DA9A 2YUPA 1K0SA 1WXUA 1UJYA 2O9VA 2KXDA 2YUQA 1V1CA 2DL8A 2LX7A 1JU5C 4AFZC 4CC2A 2DILA 2KRMA 2KXCA 2KT8A 1VYVA 2M51A 1A0NB 3PVLA 2JT4A 2EYXA 2QDLA 1GBRA 1UDLA 1KJWA 3NGPA 4Z89A 1M8MA 2L0AA 3QWYA 2CT3A 1WXTA 1NYGA 4D8KA 3UA7A 1WA7A 2EYYA 1GCQC 1GRIA 2J6FA 2DX1A 4JZ4A 2DL4A 4J9HA 4R0KA 1AWOA 3H0HA 1I0CA 1PKTA 3A98A 1E6GA 2LJ1A 4OMOA 1WYXA 2DL7A 2GQIA 1CKAA 4KRTA 4F14A 1I07A 2LQNA 1UFFA 1ZSGA 2KNBB 2RMOA 1PWTA 2JM8A 2DF6A 4DEXA 1GFCA 1KFZA 1B3QA 2DE0X 3TVTA 2EW3A 2A36A 2L2PA 5EC7A 2DBKA 1QWFA 1RI9A 3EGUA 4IIMA 2YUOA 2ABLA 1UHCA 1YNZA 2EBPA 3M0QA 4AG2C 1NEGA 1U06A 1W6XA 2EGCA 4IIOA 2GTJA 2VKNA 1VYTA 4LN2A 2AK5A 2P4RA 2RPNA 1GCPA 2KEAA 1M30A 3VS6A 1AOJA 1SRMA 4J9FA 1WX6A 2J6OA 3UATA 2EYWA 2K3BA 1Y0MA 2J7IA 5I22A 2GTOA 2F2WA 2PZ1A 3M0SA 5GJVB 1M27C 4Z8AA 2GGRA 3EHQA 2CT4A 5FWBA 2LCSA 2A08A 4X1VA 1AWWA 1I1JA 2JM9A 1CSKA 1UUEA 1JEGA 2ROLA 1GCQA 1M3BA 1JO8A 2FPFA 3I5SA 1X69A 5IHNA 3UA6A 2RQRA 2MOXA 1U3OA 2VVKA 4J9GA 1JXOA 4LUDA 3EG0A 2L3SA 1H8KA 2FRYA 1WIEA 2W10A 4JJDA 4OMNA 1OPLA 3NMZC 3VRYA 1SSHA 4RTUA 2D8JA 4F17A 1KSWA 2O2OA 2ECZA 2YT6A 1JXMA 3I9QA 5IHIA 3VRZA 4DEYA 2LMJA 2HSPA 2RQVA 4JJCA 1PKSA 1ZLMA 2M0YA 1H92A 3LH5A 2E5KA 1PHTA 1WFWA 4EIKA 1T0HA 3H0IA 1AVZC 1BK2A 3EG2A 2V1RA 3M0TA 1JQQA 3PVQA 4OMLA 1X6GA 4AFQC 2FPEA 3M0UA 1ABQA 5ECAA 2X3XD 1SPKA 4Y92A 2F2XA 2OJ2A 2H8HA 2IIMA 1BB9A 4OMMA 1S1NA 2GNCA 4AFSC 1CKBA 2HCKA 4WCIA 2A37A 2PTKA 1HD3A 2C0TA 2JXBA 4RTWA 1QCFA 1AD5A 2XMFA 2C0IA 2EYZA 4ZNXA 2F2VA 4J9IA 1FYNA 3REAB 1GL5A 4HVWA 3H0FA 2PNIA 1QKXA 1WI7A 1NLPC 1YWOA 1OV3A 5FW9A 2GBQA 1QKWA 1YWPA 2EGAA 4HVVA 3R6NA 1BBZA 2O9SA 3EG1A 2BZXA 1WXBA 5IXFA 2EPDA 1BU1A 3KFVA 3GBQA 2KGTA 2NWMA 4RTVA 4CC3A 1KIKA 2ROTA 2D1XA 2DNUA 1VA7A 1Z9QA 2L3QA 3RBBB 3C0CA 1TUDA 1X2QA 1RLPC 2KRNA 2LNHB 1AWXA 2ED0A 2C0OA 1NM7A 2RQTA 1UTIA 1G2BA 1M3AA 5IXBA 4LE9A 1FMKA 1MV3A 2A28A 2LP5A 4J9EA 3VS1A 3H41A 1E7OA 2J06A 2KT1A 4RTYA 2DL3A 2YDLA 1NYFA 1TUCA 5I11A 1ZUUA 1ARKA 2AZVA 1UE9A 2AKKA 2FPDA 2DRKA 1LCKA 4AG1C 5GJWB 1K1ZA 4RTXA 5IHKA
chains in the Genus database with same CATH superfamily
4XTVA 2CZ0B 1I8FA 3QUIA 3JB9I 3URGA 1XOVA 2CYZB 2CH4A 1MV0B 3UF4A 1X01A 2DVEA 1NJIC 3M54A 1KQSA 4MMKA 2MCNA 2HBWA 3ULRB 3JCMf 5CO7A 1K73U 2DJQA 2EKHA 3CCLT 4M7DD 2VWFA 4C8QG 4N4GA 1Y57A 1UG1A 3A8HB 4LNPA 5CQYA 1WNLA 2D0QB 2FZCB 4PLLA 3I5RA 2KK4A 4J9BA 1M2OA 3M4GA 4K11A 1OQKA 2KROA 5CKFA 1VQPQ 3VS4A 2DL5A 2NUPB 1LJOA 4M78F 2RD1A 2BZ8A 5I21A 2RI2A 4M77E 1C6VX 3BFMA 4JS5A 1NPPA 1PRLC 1AHJB 1DJ7B 2COZA 1Z9ZA 1Q86C 3MHXA 1AZGB 2K9GA 1K0XA 3QPHA 1ZUKA 2OI3A 4JJNK 4BI4A 1K76A 2LZ6B 3NPFA 2ZPEB 3EG3A 2HD0A 4A4GA 4QQ6A 2BE7D 2CREA 2X3WD 1KC8R 4MZTA 2DXCA 4RUGA 1R77A 2J6KA 4M7AE 3L2QA 2JMAA 4DBHA 2QGGA 4ESRA 2X4JA 4J9CA 1VOMA 1J3TA 2CKKA 1OPKA 4IUTA 3M56A 1RUWA 5GAMf 4E7LA 5GAN2 1W1FA 2BE9B 1MHNA 4BB7A 1WDXA 1VQNT 2MI6A 1RAEB 1WLPB 2CSIA 4KUDK 3PE0A 5LJ3g 3J81E 3L2ZA 3LLRA 2KR3A 1MNDA 2DFUA 2MF2A 2VV5A 1V29B 2K3YA 4A63B 2LQKA 4ZN3A 3LWIA 3VS5A 4EMKB 2D6FA 1T3LA 4OMPA 1QP2A 2FL7A 2FZGB 4IUPA 4N0AC 3RDVA 4LDUA 1QWEA 4AT1B 1UGRB 4C0DC 2DKGA 4GLKA 4NL2A 2K2VA 3CCEQ 5GAN5 1E6HA 4KGZB 2RK2A 4M77A 1BKBA 3CC4A 3FJ5A 4M7DA 5LJ5e 3ZL7C 3JB9G 1K8AC 1X43A 2RO0A 3CCMT 2I2LA 4ORZA 3TEEA 1QVFA 1G3TA 3CBOA 3WVDB 3V7SA 3DB3A 3QJYA 5LJ5d 1UJYA 3JCMg 5KYNA 1RAHB 1V1CA 4V2SA 2LX7A 2ZGWA 2F5TX 5LJ5j 2K57A 1KQ2A 2KRMA 4MDXA 2ZPHB 1IHWA 2MK5A 3A1PA 1A0NB 4BDYA 2QDLA 1UDLA 5J39A 3A5ZB 3CCRA 2P0QA 2X4XA 3G7ZA 4FT4A 2L0AA 1D0XA 2XDPA 1NYGA 4C5GA 1WA7A 1TSFA 1BYMA 1MMNA 1RACB 3CCLQ 2DX1A 4J9HA 2DIGA 4R0KA 3H0HA 4E2FB 3T9NA 1P92A 4XTYA 3ER0A 4PJJA 1E6GA 5KYWA 1OI1A 1WYXA 5LJ5f 3CCUA 1BI3A 2DL7A 1UEBA 2VGNA 2O4XA 4DBFA 3PT9A 4KRTA 3MCAB 1I07A 3NTIA 5GAMg 2E65A 4DEXA 1D0YA 2O01E 3HHTB 3TVTA 3PIPA 2L2PA 1RI9A 1Q82C 1WPYA 1H641 1W6XA 2EAYA 4MZMA 4XTUA 3CCVQ 3MKDA 4J8OA 2KEAA 1M30A 3SWNA 2PVDB 2HL3A 1AOJA 3OYFA 4M77D 5J26A 3S3MA 5GANf 2EYWA 3FJPA 2QEXQ 3CC4Q 4ZTFA 2EKOA 1ZSZB 3M0SA 3EFRA 1M27C 3E19A 3EHQA 1Y96A 1YITA 4C0DB 2A08A 4X1VA 3A8MB 4PJOA 3OA6A 3OY9A 1JEGA 3G71T 1JO8A 3I5SA 1QVGA 4IKFA 1YFNA 3UA6A 2R57A 4J9GA 1JXOA 4LUDA 3EG0A 4OMNA 1FWZA 1WIEA 2E12A 1SSHA 4YTLA 4BD3A 1RAFB 2O2OA 4R55A 2ECZA 2RH2A 4R56A 1SKUB 1VQLQ 3GF5A 5D6YA 1I5LA 4DEYA 4ZGDB 2EQUA 2LMJA 4JRQA 3PTAA 4DA4A 2HSPA 4JJCA 5GANe 3CCUT 4PJOC 2LDMA 2EQKA 5I2SA 1I81A 3L2UA 3CMEQ 1T0HA 3VV0A 2YLBA 2QA4T 5HK0A 2O4XB 3CCVT 1BK2A 3CBPA 5KYWB 1O75A 3AHUA 2XG8D 1SPKA 5GAOq 2H8HA 1BB9A 2HQXA 3CCJT 1KD1R 1NPRA 4C8QC 4QW2A 3ASKA 4AFSC 4LD6A 1ZQ1A 2A37A 1YJNA 2VYTA 1M9SA 4HCBA 1WQ7A 3VUBA 4RG2A 2XMFA 1S72A 3CC2Q 3EFOB 4C0GA 2LRQA 4J9IA 2QXFA 1JB0E 3CPWA 3VU3C 2QTVA 1C0MA 3CXCA 3VUZA 1YJ9T 2ATCB 3JRZA 4OP0A 3QHSA 1QKXA 3VKIA 4PJLA 1Q7YC 2HKNA 4FYVB 2DETA 4NL3A 2LC4A 3R6NA 2V8KA 1BBZA 5IXFA 3CCRT 3KFVA 4XTWA 2NWMA 5GAN3 5FRNA 4PNOA 4DOVA 2XK0A 1M1FA 4FM4B 4F7UG 2D1XA 4KH1B 1ZA1B 3C0CA 3CPFA 2RI3A 2LCCA 2QA4Q 3GLXA 4LDWA 4CI0C 1VQKQ 2GFAA 1WJSA 3CMAQ 2QAZA 5FRMA 2KDSA 1NM7A 1G2BA 1M3AA 2A28A 2LP5A 3H41A 1RAIB 3P8BB 3P8HA 1ACMB 2DL3A 2P0PA 2YDLA 3EGDA 2AZVA 2AKKA 1VQ8Q 2DD4A 4AG1C 2MWOA 5GJWB 5IHKA 2RQWA 2NUZA 4DBRA 5D7UA 2QYZA 4HCKA 5LJ3d 4L59A 3E1SA 3ZBDA 2DEUA 2OAWA 1YIJT 1YJWQ 2YRDA 5FROA 1ZBJA 1IHVA 2DMOA 2HZYA 2CH4W 3EGDB 4Y91A 3HSBA 2JS0A 2RJCA 1LNXA 2ENMA 2CGHA 2DYBA 2DVJA 1VYUA 1K9MR 4MZPA 3E9FA 5GAMj 1Y07A 3M0PA 2JUFA 4C0ZA 2RHXA 1YN8A 3OYKA 4C8QF 5FU6C 2JNGA 3OYHA 2VXEA 1KQ1A 4HCCA 1Q86R 1OX8A 2QTXA 1W2BP 4A4KA 1NJIU 2JTEA 3OS5A 3JV3A 1IGUA 4RMOA 2FEIA 2FHDA 3CC7T 2JMCA 1LPLA 4OB0B 2QEXA 2OTJQ 1OOTA 4C5EA 4M78B 3RERA 4HVUA 1B7TA 3KBGA 2ZZDA 1QW1A 1N8RU 2ZPFB 1LVKA 2E5QA 2QA4A 2EWNA 4M75F 4X34A 2KQWA 4J7FA 4C92G 3CCQA 1AWJA 2SRCA 2LVMA 3VS7A 3CBMA 4HA8A 2W0ZA 1VQ4A 1VQMQ 8AT1B 2CSQA 3JAME 2HEQA 4JZ3A 3CCVA 4RTZA 1Q81C 3RNJA 2MWPA 1ZA2B 1G3YA 1SHGA 1PRMC 3M0RA 3A8GB 1WGSA 3BDUA 4M75C 1Q86U 5KYYA 4PJOE 2NUTB 1QVFS 4QVDA 5FU7B 2RN8A 4C0FA 1PSFA 1IRXA 2O88A 1T0JA 3PIOA 4ZTJA 1ZHIA 5KYXA 1G83A 1ZX6A 2YHTA 4O6JA 1K9AA 1YJWT 2FRWA 1QP3A 3TSZA 4FYXB 3UDCA 4EPCA 1EFNA 1PD1A 1U1TA 1UGVA 1OZ3A 4IURA 1V76A 4GBQA 2DEQA 2QASA 1WHHA 4CRIA 1UHFA 5CKBA 5FU7C 3P8DA 3OW2P 2AT1B 2CDTA 4QT7A 1YBYA 2EQJA 2EVRA 3VS3A 4RKUE 3FLGA 3RR6A 1VQ4T 2PUKB 3CC2A 1JJ2P 3OSSC 1JBMA 5M9OA 2CP6A 4BUGA 4M4ZA 2D8HA 2KE9A 1BIBA 2OX7A 3G6ET 3SHWA 2RF0A 1TTHB 2CP5A 2LJ0A 2DA9A 5HY6A 1NZ9A 2K4YA 1K8AU 1VUBA 4M78D 5CKHA 2KXDA 4A4FA 2DYIA 1YCYA 4L6V5 3CC2T 3ME9A 3C94A 1G5VA 4AFZC 2DJZA 1G3WA 2DILA 4CC2A 1N6AA 3MEWA 4M75D 4PJNA 3FB9A 4M7AA 3PVLA 5AYFA 2JT4A 1KJWA 3OMGA 3TQ7P 4MMLA 4XU3A 4NS5A 4E7HA 2X9HA 4PJOB 1KQSS 1GCQC 1GRIA 3OMCA 2J6FA 1AWOA 5CQXA 4XQ3A 2JJ9A 1VQMT 4HCZA 2LJ1A 3JB9D 4OMOA 2DZ9A 5LJ5h 4KGXB 4M75B 3VYHB 3CCSA 3CMAT 4KULA 1JRIA 4F14A 2ZPBB 1S72Q 2LQNA 4X9CA 1ZSGA 3HFNA 5J3BA 1LOJA 2JM8A 1GFCA 3JCMQ 1KFZA 1IXDA 2EW3A 2A36A 1BI2A 2DBKA 1N8RR 1VQ9T 3RKWA 2YUOA 2ABLA 2QI2A 2X4YA 4QKUA 4AG2C 2OTJA 4M7DG 4IIOA 4XU2A 2DTOA 1VQ7T 3I56Q 3JCMP 2RPNA 4LDVA 5IN1A 4KBMB 3CPWP 3VS6A 3EG9B 1VQ9Q 1SRMA 4B9XA 3ZEHA 2V26A 3CD6Q 2ZAEA 4KUIA 3EFSA 2K3BA 4C5HA 1Y0MA 5I22A 3JB9F 5GAOm 2F2WA 5GJVB 3PFSA 2GGRA 3CC4T 2CT4A 3O8VA 3NTHA 1AWWA 1K8AR 2JM9A 1UUEA 4QQDA 4EMKA 4E7SA 4XU1A 2LCLA 1M3BA 4HKEA 2MMPA 1VQLA 2FPFA 5IT9E 1X69A 3OYNA 1W4SA 2BUDA 2XIDA 3MO8A 2L3SA 1OPLA 3VRYA 4M75G 3KXTA 3I55A 4RTUA 1R0CB 3QIIA 3V8KA 4C8QB 2AHJB 3VRZA 4F7UF 4E7ZA 3OYBA 2VB6A 2RQVA 4M75E 3UWNA 2XICA 2X51A 1PHTA 4FU6A 1WFWA 4C92B 1G8XA 1AVZC 3EG2A 4OMLA 1X6OA 3M0UA 2LQ8A 5ECAA 2QG9B 5GAN6 4VUBA 1KHIA 4Y92A 4JUVA 2DZCA 3UPUA 4OMMA 2GNCA 1VQ9A 2B8AA 4PJOF 2K5LA 3QG1A 5FLXE 5LJ3j 5LJ3e 1VQOT 1HD3A 2C0TA 2JXBA 4KGVB 2COYA 4RTWA 1QCFA 4QQGA 1K9MU 4WTOB 4ZNXA 4ZGJB 1N9RA 3REAB 1GL5A 1OZ2A 2E6NA 2XDBA 4PJOG 2KVQG 3CCQT 3QZ5B 1NLPC 1YWOA 5FW9A 2GBQA 3MP6A 1YWPA 2E10A 4FW2A 5D6WA 4HVVA 3QDRB 4F7UE 2BZXA 1WXBA 2CP3A 6AT1B 2QDYB 2HL5C 5KYUA 5C6SA 3OYLA 4LDYA 2RHIA 1OU8A 5GAOn 4BDZA 5KCHA 2L3RA 4F7UB 2ROTA 1RL2A 1WHMA 1WHJA 5LL6S 2XKOC 4XTXA 2L3QA 5KYYB 1TUDA 1UB4A 4C8QD 1SSFA 2K3XA 1AWXA 2DXTA 1C1AA 1YI2T 3CD6T 5A0LA 1MV3A 2GF7A 2E6ZA 5KYXB 1E7OA 3HL8A 2KT1A 1H3ZA 1NYFA 2A0FB 3QJ6A 1ZUUA 3SDZA 5A0GA 2FPDA 3G4SA 4BY6C 2HMAA 1K1ZA 3JCMV 4C92C 2YXYA 2R5AA 3HRSA 2KY9A 2DTHA 1HJDA 5FWCA 2F5KA 1NG2A 1YHQQ 3NHNA 4D8DA 2QQAA 4FT2A 1YJ9Q 1R0BG 4F16A 2ZCFB 1VQPA 2DBMA 2HAXA 2CP0A 2ED1A 2VASA 1WHLA 2XHCA 1U5SA 4JPBW 4PLIA 3G71Q 3THKA 4EMHA 2G6FX 2FZKB 2EQMA 1UGSB 2CP7A 2H3EB 1IREB 4X9DA 3GP8A 2D0NA 4PFZA 2XDDA 2M1HA 3IQLA 4PFOA 3VJPA 1PCXA 5HCKA 2LJ3A 2KYMA 1QVGS 3HRUA 5GANh 1PNJA 3PMIA 4PK4A 2BTTA 3M57A 3L2VA 4HXJA 2DD5A 3EG9A 4F7UA 5CR2A 4M7DB 4J9DA 3EFOA 5L23A 4M77G 2PQWA 4M7DE 1N8RC 3OYMA 2EQIA 1YJNQ 1YP5A 2GCXA 2PUOB 3QYGB 2CP2A 3OYIA 1VQOA 1M3CA 1RADB 2E1HA 2LX9A 1WHGA 2MPXC 1D3BA 3FDRA 3S3OA 3CCQQ 2DLPA 2P84A 3QSUA 4RG8A 2VC8A 4CC4B 2Y4YA 2WSFE 3KUFA 2RJDA 5LJ3f 4AFUC 4CC7A 2SEMA 4EMGA 3OBWA 1XQHA 1SRLA 4BE2A 1RLQC 4DOWA 3I56T 2O31A 1X6BA 2KRSA 2HNIA 4D6WA 3FC3A 3OW2A 2HDAA 3EHRA 1IO6A 1PG5B 2PVGB 1YCSB 4J6XA 1VIEA 3OQ5A 2KBTA 2L5QA 4PFPA 4FW1A 2AKLA 4OGCA 3CCJA 2KYBA 4ANJA 3OS1A 3CPWS 2FG0A 3NTKA 1RI0A 1W70A 4LDXA 3QYHB 1GXIE 3CCUQ 2E41A 5HK3A 1TWBA 2RM4A 2LQWA 4BE0A 2VXFA 2EGEA 4J6YA 4PL6A 4M7DF 3QWXX 4FYYB 2DM1A 4N0AA 2K6DA 3PMTA 1NLOC 1X27A 1AT1B 1TH7A 3DLLA 4E47A 3FEOA 3V7CA 1ZUYA 2I0NA 5L8RE 1M8VA 3RESA 3DKMA 1WHKA 3J7AF 1ABOA 3CCJQ 5GMKh 1GFDA 2QQRA 5DY9A 1YIJQ 3EH2A 3SWNB 4JJBA 1Q7YU 2J05A 1WZOA 4M7DC 2KMTA 4Z88A 5GAN8 4EDUA 4OMQA 2CUBA 2A3LA 1D1CA 3M59A 2OAUA 3X28B 2XU8A 2DTIA 2P0KA 3M9QA 4LD9K 2HSEB 2JN0A 2O9VA 4IUQA 4XU0A 1BIAA 1TUGB 1KD1C 4RCCA 2QGFB 3BY7A 3G6EQ 2KXCA 3VYGA 3X24B 1OULA 1Y71A 4IUUA 2EYXA 3MPUB 2EJ9A 2G3RA 5CK9A 3GPLA 3ZFJA 4BI8B 2CT3A 3CXCP 2EYYA 1VQ5Q 4J83A 4HT8A 2DL4A 3HPWA 2JZ2A 1I0CA 1PKTA 1JJ2S 3CMEA 5HKCA 3LH0A 1TXQA 1FMVA 1CKAA 1RAGB 1UFFA 4C92E 3JCMJ 1YJWA 2DERA 5CAIA 1RAAB 1KD1U 4FYWB 3OYEA 3WVEB 1PWTA 2DF6A 2DE0X 2OTLQ 1QVFP 3SFMA 1QWFA 3EGUA 2FYKA 2VGMA 1UHCA 3G1JA 2EBPA 4C5IA 3M0QA 1VQ4Q 1U06A 4LN2A 1VYTA 2AK5A 1VQ8T 3JCMb 1GCPA 2ZPGB 1RABB 1MNEA 2YRCA 2RK1A 2F1LA 4J9FA 2JTFA 3OYYA 3UATA 2CZ7B 1M1KC 1KHCA 2GTOA 5GMKj 2PZ1A 1VIFA 1UGQB 5FWBA 2R58A 4XK8E 4DBQA 3RMQA 2RI5A 2ROLA 3EGXA 5IHNA 4MDWA 1U3OA 1W2BS 2W10A 2FRYA 4JJDA 4B6MA 3NMZC 1VQKA 1VQ5A 4C92F 5IAYA 2PU9B 2D8JA 4A54A 4OB1B 5GANd 2K5IA 3MJXA 1KSWA 4ELZC 3C12A 3MEUA 2E3IA 2YT6A 5GAMd 1JXMA 4LXCA 3I9QA 3OSVA 1VQMA 2LNVA 3OYGA 1QMCA 1F1BB 2Y90A 1PKSA 3H9NA 1ZLMA 1Q81R 2QQ9A 2M0YA 4M7AF 1H92A 4JRKA 4EIKA 2M9UA 3PGGA 1BI0A 2H3JA 4OB2B 4OF1A 3WXMB 2HQHA 1M1KR 4E7JA 2V1RA 1X6GA 4AFQC 3LGFA 2FPEA 4IUVA 2X3XD 4AMCA 1HYOA 2OJ2A 1S1NA 3CC7A 2KAFA 4ZGEB 4M7AC 4JDSA 1CKBA 3LW5E 1QCNA 2HCKA 1I5OB 4FCYA 2PTKA 5D6XA 4BACA 2OTJT 3HKSA 2EYZA 1FXXA 3RKYA 5GMKi 2F2VA 1YHQT 1FYNA 1D3BB 2CS7A 1TOVA 2MYSA 5A2QE 5CKDA 5GAN4 4C8QA 4ELYC 3H0FA 2V8IA 3JSCA 4A4HA 1WI7A 1M90U 1OV3A 2P4TA 4XAXB 2EGAA 1KK7A 3DB4A 5KE3A 1NJIR 3TCJA 3LGLA 4M77C 2EPDA 1M1KU 4OVAA 2KGTA 5GANg 3JCMX 1KIKA 3X20B 3L2RA 1M4ZA 1KC8C 1Z9QA 3FIFA 3RKXA 1WQWA 3RBBB 1D1BA 3G6EA 2C06A 2LNHB 2HKQB 2C0OA 1ZSZC 2M16A 2HBPA 1TU0B 2NYSA 4LE9A 1PSEA 4BY6B 5IXBA 2E4HA 4J9EA 3QZ9B 3VS1A 1XNIA 3M4YA 2YLCA 4JRIA 1TUCA 5I11A 1MMDA 2CZ1B 1ARKA 1D0ZA 1TS9A 5CIUA 3OW2S 4P5NA 2DRKA 1LCKA 5GMKm 3HP9A 4Z02A 4RTXA 3CCMA 1WJQA 3Q1JA 1M5Q1 2FO0A 2DRMA 2L3PA 3REBB 1VQ7A 2ESWA 1X2KA 3JCMW 2QK0A 4M78C 1B34A 1HSQA 1ZSZA 1KC8U 3PNWC 2AZSA 4JRPA 4GLMA 2IG0A 3CCET 2FB7A 2IVWA 3O5ZA 2K79A 1B07A 1N5ZA 3VS2A 1OEBA 3QKJA 4O5VA 3M55A 1AZEA 3OYDA 1SF9A 3G71A 1K4US 1VQLT 2EIFA 2L89A 3X25B 4RTTA 1TG0A 3LYIA 4BE1A 1VQKT 5EG2A 5GAMe 2RNAA 5GMKe 1H3HA 3I35A 2K7AA 5C0MA 4PJMA 2YWWA 1K73C 2RQUA 2A7YA 2B86A 2RHZA 3CCRQ 1YITT 4A4EA 5GMKl 4N4IA 2WACA 2RHYA 2JW4A 2YSQA 1Q95G 1VQNA 3SWNC 2XD0A 2MIOA 3M5AA 3TSWA 4OGEA 2ZPIB 2OTLT 1SHFA 3BW1A 3CD6A 1UJ0A 4HT9A 5GAMh 5IH2A 3MP8A 4LUEA 3SD4A 5LJ3h 3U23A 1SG5A 5KE2A 2JVVA 3QDFA 4JS4A 3JCMh 1M90R 4M7AG 1PD0A 4JLIA 1D09B 4UC4A 1JJ2A 4XTZA 3G4ST 3CQTA 1D1AA 5GAOp 4FSSA 1SEMA 1HK9A 1VQ6T 4ATOA 1QQJA 2LTOA 5GAN7 3HFOA 1T3SA 1ZBXA 2QQSA 5GAOl 4J6WA 1K73R 5KH6A 1UGPB 3TU4K 1QVGP 3MP1A 1AEYA 2V1QA 1VQ6Q 1GBQA 4L5GA 1Y96B 3JCMc 4EMKC 4J5YA 4GY5A 4B9WA 3H6ZA 2BZYA 3EH1A 1MUZA 1NEBA 2JS2A 2CUDA 3SEMA 4QVCA 4C8QE 3M58A 2E64A 2YUNA 2AIRB 3SB2A 2BIVA 1YIJA 1EZZB 2K2MA 1M1GA 4E6RA 5DLQE 1QLYA 3EGXB 1UECA 2R5MA 2NLUA 2D9TA 1YJ9A 3VS0A 3E2UA 5DM7R 5FU6B 4N4HA 2YUPA 9ATCB 4KH0B 1K0SA 4PJOD 1WXUA 3F70A 1YI2A 4KT0E 2YRVA 5I2MA 3CXCS 2YUQA 2EYQA 3M53A 1VQ6A 2DL8A 4FIBA 1JU5C 2M0OA 1Q82U 2EJFA 2KT8A 2RHUA 5DLOA 1VYVA 2M51A 1VQNQ 3AT1B 4OB3B 1GBRA 1HXDA 3NGPA 3FRNA 3TREA 2JTMA 4DQ2A 4Z89A 1M8MA 3QWYA 4BI3A 1WXTA 4D8KA 2X4WA 3UA7A 3DLMA 1QCOA 4JZ4A 2DAQA 3CCLA 1Q81U 3A98A 3QO3A 1BCMA 3L2WA 4TVRA 2GQIA 3BDLA 2DO3A 1VQ5T 2NUTA 3C4SA 3MEAA 4M77B 2KNBB 2X35A 2RMOA 3GNFB 3OB9A 4PKCC 3QBYA 4FSXA 1K9MC 2F69A 4Q5WA 1B3QA 4J7IA 3GOXA 5EC7A 1BI1A 2Y4XA 3OYCA 4IIMA 3CCMQ 2LT4A 1Q82R 1YNZA 3UT1A 4WF2A 2WSCE 1S72T 1NEGA 4M78E 2EGCA 2GTJA 2BKDN 2VKNA 3N5BB 2P4RA 4JLGA 3G4SQ 1R8OB 2LT1A 5CKEA 1WX6A 3JCMe 2J6OA 1YI2Q 2RA2A 7AT1B 3S3NA 2GQVA 1W2BA 2J7IA 1N9SA 2PVOB 3CCEA 1U8RA 1VQOQ 4E7KA 4Z8AA 2E3HA 2LCSA 2Z0WA 1I1JA 1CSKA 3JCMd 3CMAA 3CCST 5CCAA 2WSEE 1N27A 1GCQA 3MEVA 4F04B 5CVIA 3L1AA 2HQEA 2VUBA 3RUXA 2RQRA 2MOXA 3JB9J 5KYUB 2VVKA 4C92D 1H8KA 1G3SA 1U1SA 3C95A 3E9GA 4F17A 1XJWB 4FL6A 3A8LB 1M2VA 2E70A 4OMFB 8ATCB 3D7SB 1X75C 2NUPA 5IHIA 3HRTA 3R6OA 4ZN1A 3META 3CMET 2XI9A 2L8DA 3QXEB 3LH5A 2E5KA 3L42A 1Q7YR 3OYJA 1IZ6A 2FVUA 2EJGA 3H0IA 3A8OB 4NOYA 2DXBA 3M0TA 1JQQA 1YHQA 3PVQA 2RB6A 1IB8A 3RMSA 3V8LA 1PC0A 1ABQA 2V8JA 2JOYA 4II1A 1PM3A 3I56A 1OYXA 2F2XA 3RIRA 3CEYA 2IIMA 2KI7A 2QEXT 2M02A 1I4K1 3INZA 3NFCA 2QQBA 4WCIA 1OU9A 3BE3A 5AT1B 4A53A 2DPPB 3OYAA 1AD5A 2C0IA 1IGQA 3OBYA 3V8JA 1M90C 1VQ8A 1BCOA 4M78G 4HVWA 5GANj 2K5FA 2OTLA 3H8ZA 3I55T 2CZ6B 3J80E 2PNIA 4M78A 1EX4A 3X26B 1QKWA 4RCBA 3GIBA 2O9SA 3EAEA 3EG1A 3LX7A 2KSSA 1M2VB 5A0DA 1NE8A 4M7AD 1BU1A 4M75A 2GFUA 3GBQA 3I55Q 1B34B 1NBEB 3HTRA 4RTVA 1VQPT 4Y28E 4CC3A 3JB9H 2DK3A 3LWHA 3CCSQ 2RJFA 1WJRA 2DNUA 1VA7A 1Y7XA 2MAMA 1X2QA 1RLPC 2KRNA 1KQSP 2COWA 5KCOA 2IPOB 3CC7Q 2ED0A 2DXUA 1MGQA 4M77F 1MMGA 1FMWA 1YJNT 2RQTA 1UTIA 1FMKA 1O9SA 1EIFA 5LJ5g 2DIQA 4M7AB 2J06A 4QVZA 3OS0A 4RTYA 5GAOr 1OX9A 3S6WA 4ME7A 1MMAA 1VQ7Q 1UE9A 1QVPA 1YITQ 3V7RA 4C92A 4E7IA 1FX7A 1KG1A 1XTDA 2RJEA 2EFIA 3OS2A 3GNGA
chains in the Genus database with same CATH topology
2RQWA 1HJDA 5FWCA 1NG2A 2FO0A 2NUZA 3NHNA 1XOVA 4HCKA 2CH4A 1MV0B 3UF4A 2DRMA 4D8DA 2L3PA 3REBB 2ESWA 2OAWA 1X2KA 4F16A 2DBMA 3ULRB 2MCNA 2HBWA 1ZBJA 1HSQA 2ED1A 2DMOA 2DJQA 2EKHA 2AZSA 2CH4W 2VWFA 1U5SA 2JS0A 4JPBW 4GLMA 2ENMA 3THKA 2G6FX 2DYBA 2DVJA 1VYUA 1Y57A 1UG1A 4LNPA 3I5RA 2K79A 3O5ZA 4J9BA 1B07A 1N5ZA 2D0NA 4K11A 3VS2A 3M0PA 2KROA 3IQLA 1OEBA 3VS4A 2DL5A 5HCKA 1YN8A 2LJ3A 1AZEA 2KYMA 1K4US 1PNJA 2BZ8A 4RTTA 1TG0A 2BTTA 4HXJA 1PRLC 2RNAA 1Z9ZA 4J9DA 1H3HA 1AZGB 2K9GA 1K0XA 3I35A 5L23A 1ZUKA 2K7AA 2JTEA 3JV3A 2OI3A 2FEIA 2JMCA 1K76A 2RQUA 2EQIA 2LZ6B 3NPFA 3EG3A 1YP5A 2B86A 1OOTA 2CREA 2X3WD 4HVUA 2JW4A 4RUGA 2YSQA 2J6KA 1M3CA 2JMAA 1AWJA 2MIOA 4ESRA 2SRCA 4J9CA 3TSWA 2DLPA 1J3TA 1SHFA 1OPKA 3VS7A 1UJ0A 1RUWA 4CC4B 2W0ZA 5IH2A 4AFUC 4LUEA 3U23A 4CC7A 2SEMA 2CSQA 1W1FA 2HEQA 1SRLA 4JZ3A 1RLQC 4RTZA 2O31A 1WDXA 1X6BA 2KRSA 3RNJA 2HDAA 3EHRA 1IO6A 1WLPB 2CSIA 1SHGA 1YCSB 3PE0A 3CQTA 1PRMC 3M0RA 2KBTA 2AKLA 2KYBA 4FSSA 2RN8A 1SEMA 2KR3A 2O88A 4A63B 1T0JA 1T3SA 2FG0A 1W70A 3VS5A 1T3LA 4OMPA 1G83A 1ZX6A 1K9AA 2FRWA 3TSZA 2LQWA 1EFNA 2EGEA 1QWEA 2V1QA 1UGVA 1AEYA 3QWXX 4GBQA 2DM1A 1GBQA 2K6DA 1NLOC 1UHFA 1X27A 2BZYA 1MUZA 1ZUYA 1E6HA 2CDTA 2I0NA 4QT7A 1NEBA 2EVRA 2JS2A 3VS3A 2CUDA 3SEMA 1ABOA 2YUNA 3FJ5A 1GFDA 2K2MA 3ZL7C 1X43A 4E6RA 1QLYA 1UECA 4JJBA 2J05A 4ORZA 3VS0A 4M4ZA 2D8HA 2KE9A 4Z88A 3SHWA 2RF0A 4OMQA 2CUBA 2LJ0A 2DA9A 2YUPA 1K0SA 1WXUA 1UJYA 2O9VA 2KXDA 2YUQA 1V1CA 2DL8A 2LX7A 1JU5C 4AFZC 4CC2A 2DILA 2KRMA 2KXCA 2KT8A 1VYVA 2M51A 1A0NB 3PVLA 2JT4A 2EYXA 2QDLA 1GBRA 1UDLA 1KJWA 3NGPA 4Z89A 1M8MA 2L0AA 3QWYA 2CT3A 1WXTA 1NYGA 4D8KA 3UA7A 1WA7A 2EYYA 1GCQC 1GRIA 2J6FA 2DX1A 4JZ4A 2DL4A 4J9HA 4R0KA 1AWOA 3H0HA 1I0CA 1PKTA 3A98A 1E6GA 2LJ1A 4OMOA 1WYXA 2DL7A 2GQIA 1CKAA 4KRTA 4F14A 1I07A 2LQNA 1UFFA 1ZSGA 2KNBB 2RMOA 1PWTA 2JM8A 2DF6A 4DEXA 1GFCA 1KFZA 1B3QA 2DE0X 3TVTA 2EW3A 2A36A 2L2PA 5EC7A 2DBKA 1QWFA 1RI9A 3EGUA 4IIMA 2YUOA 2ABLA 1UHCA 1YNZA 2EBPA 3M0QA 4AG2C 1NEGA 1U06A 1W6XA 2EGCA 4IIOA 2GTJA 2VKNA 1VYTA 4LN2A 2AK5A 2P4RA 2RPNA 1GCPA 2KEAA 1M30A 3VS6A 1AOJA 1SRMA 4J9FA 1WX6A 2J6OA 3UATA 2EYWA 2K3BA 1Y0MA 2J7IA 5I22A 2GTOA 2F2WA 2PZ1A 3M0SA 5GJVB 1M27C 4Z8AA 2GGRA 3EHQA 2CT4A 5FWBA 2LCSA 2A08A 4X1VA 1AWWA 1I1JA 2JM9A 1CSKA 1UUEA 1JEGA 2ROLA 1GCQA 1M3BA 1JO8A 2FPFA 3I5SA 1X69A 5IHNA 3UA6A 2RQRA 2MOXA 1U3OA 2VVKA 4J9GA 1JXOA 4LUDA 3EG0A 2L3SA 1H8KA 2FRYA 1WIEA 2W10A 4JJDA 4OMNA 1OPLA 3NMZC 3VRYA 1SSHA 4RTUA 2D8JA 4F17A 1KSWA 2O2OA 2ECZA 2YT6A 1JXMA 3I9QA 5IHIA 3VRZA 4DEYA 2LMJA 2HSPA 2RQVA 4JJCA 1PKSA 1ZLMA 2M0YA 1H92A 3LH5A 2E5KA 1PHTA 1WFWA 4EIKA 1T0HA 3H0IA 1AVZC 1BK2A 3EG2A 2V1RA 3M0TA 1JQQA 3PVQA 4OMLA 1X6GA 4AFQC 2FPEA 3M0UA 1ABQA 5ECAA 2X3XD 1SPKA 4Y92A 2F2XA 2OJ2A 2H8HA 2IIMA 1BB9A 4OMMA 1S1NA 2GNCA 4AFSC 1CKBA 2HCKA 4WCIA 2A37A 2PTKA 1HD3A 2C0TA 2JXBA 4RTWA 1QCFA 1AD5A 2XMFA 2C0IA 2EYZA 4ZNXA 2F2VA 4J9IA 1FYNA 3REAB 1GL5A 4HVWA 3H0FA 2PNIA 1QKXA 1WI7A 1NLPC 1YWOA 1OV3A 5FW9A 2GBQA 1QKWA 1YWPA 2EGAA 4HVVA 3R6NA 1BBZA 2O9SA 3EG1A 2BZXA 1WXBA 5IXFA 2EPDA 1BU1A 3KFVA 3GBQA 2KGTA 2NWMA 4RTVA 4CC3A 1KIKA 2ROTA 2D1XA 2DNUA 1VA7A 1Z9QA 2L3QA 3RBBB 3C0CA 1TUDA 1X2QA 1RLPC 2KRNA 2LNHB 1AWXA 2ED0A 2C0OA 1NM7A 2RQTA 1UTIA 1G2BA 1M3AA 5IXBA 4LE9A 1FMKA 1MV3A 2A28A 2LP5A 4J9EA 3VS1A 3H41A 1E7OA 2J06A 2KT1A 4RTYA 2DL3A 2YDLA 1NYFA 1TUCA 5I11A 1ZUUA 1ARKA 2AZVA 1UE9A 2AKKA 2FPDA 2DRKA 1LCKA 4AG1C 5GJWB 1K1ZA 4RTXA 5IHKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RQW A;  1HJD A;  5FWC A;  1NG2 A;  2FO0 A;  2NUZ A;  3NHN A;  1XOV A;  4HCK A;  2CH4 A;  1MV0 B;  3UF4 A;  2DRM A;  4D8D A;  2L3P A;  3REB B;  2ESW A;  2OAW A;  1X2K A;  4F16 A;  2DBM A;  3ULR B;  2MCN A;  2HBW A;  1ZBJ A;  1HSQ A;  2ED1 A;  2DMO A;  2DJQ A;  2EKH A;  2AZS A;  2CH4 W;  2VWF A;  1U5S A;  2JS0 A;  4JPB W;  4GLM A;  2ENM A;  3THK A;  2G6F X;  2DYB A;  2DVJ A;  1VYU A;  1Y57 A;  1UG1 A;  4LNP A;  3I5R A;  2K79 A;  3O5Z A;  4J9B A;  1B07 A;  1N5Z A;  2D0N A;  4K11 A;  3VS2 A;  3M0P A;  2KRO A;  3IQL A;  1OEB A;  3VS4 A;  2DL5 A;  5HCK A;  1YN8 A;  2LJ3 A;  1AZE A;  2KYM A;  1K4U S;  1PNJ A;  2BZ8 A;  4RTT A;  1TG0 A;  2BTT A;  4HXJ A;  1PRL C;  2RNA A;  1Z9Z A;  4J9D A;  1H3H A;  1AZG B;  2K9G A;  1K0X A;  3I35 A;  5L23 A;  1ZUK A;  2K7A A;  2JTE A;  3JV3 A;  2OI3 A;  2FEI A;  2JMC A;  1K76 A;  2RQU A;  2EQI A;  2LZ6 B;  3NPF A;  3EG3 A;  1YP5 A;  2B86 A;  1OOT A;  2CRE A;  2X3W D;  4HVU A;  2JW4 A;  4RUG A;  2YSQ A;  2J6K A;  1M3C A;  2JMA A;  1AWJ A;  2MIO A;  4ESR A;  2SRC A;  4J9C A;  3TSW A;  2DLP A;  1J3T A;  1SHF A;  1OPK A;  3VS7 A;  1UJ0 A;  1RUW A;  4CC4 B;  2W0Z A;  5IH2 A;  4AFU C;  4LUE A;  3U23 A;  4CC7 A;  2SEM A;  2CSQ A;  1W1F A;  2HEQ A;  1SRL A;  4JZ3 A;  1RLQ C;  4RTZ A;  2O31 A;  1WDX A;  1X6B A;  2KRS A;  3RNJ A;  2HDA A;  3EHR A;  1IO6 A;  1WLP B;  2CSI A;  1SHG A;  1YCS B;  3PE0 A;  3CQT A;  1PRM C;  3M0R A;  2KBT A;  2AKL A;  2KYB A;  4FSS A;  2RN8 A;  1SEM A;  2KR3 A;  2O88 A;  4A63 B;  1T0J A;  1T3S A;  2FG0 A;  1W70 A;  3VS5 A;  1T3L A;  4OMP A;  1G83 A;  1ZX6 A;  1K9A A;  2FRW A;  3TSZ A;  2LQW A;  1EFN A;  2EGE A;  1QWE A;  2V1Q A;  1UGV A;  1AEY A;  3QWX X;  4GBQ A;  2DM1 A;  1GBQ A;  2K6D A;  1NLO C;  1UHF A;  1X27 A;  2BZY A;  1MUZ A;  1ZUY A;  1E6H A;  2CDT A;  2I0N A;  4QT7 A;  1NEB A;  2EVR A;  2JS2 A;  3VS3 A;  2CUD A;  3SEM A;  1ABO A;  2YUN A;  3FJ5 A;  1GFD A;  2K2M A;  3ZL7 C;  1X43 A;  4E6R A;  1QLY A;  1UEC A;  4JJB A;  2J05 A;  4ORZ A;  3VS0 A;  4M4Z A;  2D8H A;  2KE9 A;  4Z88 A;  3SHW A;  2RF0 A;  4OMQ A;  2CUB A;  2LJ0 A;  2DA9 A;  2YUP A;  1K0S A;  1WXU A;  1UJY A;  2O9V A;  2KXD A;  2YUQ A;  1V1C A;  2DL8 A;  2LX7 A;  1JU5 C;  4AFZ C;  4CC2 A;  2DIL A;  2KRM A;  2KXC A;  2KT8 A;  1VYV A;  2M51 A;  1A0N B;  3PVL A;  2JT4 A;  2EYX A;  2QDL A;  1GBR A;  1UDL A;  1KJW A;  3NGP A;  4Z89 A;  1M8M A;  2L0A A;  3QWY A;  2CT3 A;  1WXT A;  1NYG A;  4D8K A;  3UA7 A;  1WA7 A;  2EYY A;  1GCQ C;  1GRI A;  2J6F A;  2DX1 A;  4JZ4 A;  2DL4 A;  4J9H A;  4R0K A;  1AWO A;  3H0H A;  1I0C A;  1PKT A;  3A98 A;  1E6G A;  2LJ1 A;  4OMO A;  1WYX A;  2DL7 A;  2GQI A;  1CKA A;  4KRT A;  4F14 A;  1I07 A;  2LQN A;  1UFF A;  1ZSG A;  2KNB B;  2RMO A;  1PWT A;  2JM8 A;  2DF6 A;  4DEX A;  1GFC A;  1KFZ A;  1B3Q A;  2DE0 X;  3TVT A;  2EW3 A;  2A36 A;  2L2P A;  5EC7 A;  2DBK A;  1QWF A;  1RI9 A;  3EGU A;  4IIM A;  2YUO A;  2ABL A;  1UHC A;  1YNZ A;  2EBP A;  3M0Q A;  4AG2 C;  1NEG A;  1U06 A;  1W6X A;  2EGC A;  4IIO A;  2GTJ A;  2VKN A;  1VYT A;  4LN2 A;  2AK5 A;  2P4R A;  2RPN A;  1GCP A;  2KEA A;  1M30 A;  3VS6 A;  1AOJ A;  1SRM A;  4J9F A;  1WX6 A;  2J6O A;  3UAT A;  2EYW A;  2K3B A;  1Y0M A;  2J7I A;  5I22 A;  2GTO A;  2F2W A;  2PZ1 A;  3M0S A;  5GJV B;  1M27 C;  4Z8A A;  2GGR A;  3EHQ A;  2CT4 A;  5FWB A;  2LCS A;  2A08 A;  4X1V A;  1AWW A;  1I1J A;  2JM9 A;  1CSK A;  1UUE A;  1JEG A;  2ROL A;  1GCQ A;  1M3B A;  1JO8 A;  2FPF A;  3I5S A;  1X69 A;  5IHN A;  3UA6 A;  2RQR A;  2MOX A;  1U3O A;  2VVK A;  4J9G A;  1JXO A;  4LUD A;  3EG0 A;  2L3S A;  1H8K A;  2FRY A;  1WIE A;  2W10 A;  4JJD A;  4OMN A;  1OPL A;  3NMZ C;  3VRY A;  1SSH A;  4RTU A;  2D8J A;  4F17 A;  1KSW A;  2O2O A;  2ECZ A;  2YT6 A;  1JXM A;  3I9Q A;  5IHI A;  3VRZ A;  4DEY A;  2LMJ A;  2HSP A;  2RQV A;  4JJC A;  1PKS A;  1ZLM A;  2M0Y A;  1H92 A;  3LH5 A;  2E5K A;  1PHT A;  1WFW A;  4EIK A;  1T0H A;  3H0I A;  1AVZ C;  1BK2 A;  3EG2 A;  2V1R A;  3M0T A;  1JQQ A;  3PVQ A;  4OML A;  1X6G A;  4AFQ C;  2FPE A;  3M0U A;  1ABQ A;  5ECA A;  2X3X D;  1SPK A;  4Y92 A;  2F2X A;  2OJ2 A;  2H8H A;  2IIM A;  1BB9 A;  4OMM A;  1S1N A;  2GNC A;  4AFS C;  1CKB A;  2HCK A;  4WCI A;  2A37 A;  2PTK A;  1HD3 A;  2C0T A;  2JXB A;  4RTW A;  1QCF A;  1AD5 A;  2XMF A;  2C0I A;  2EYZ A;  4ZNX A;  2F2V A;  4J9I A;  1FYN A;  3REA B;  1GL5 A;  4HVW A;  3H0F A;  2PNI A;  1QKX A;  1WI7 A;  1NLP C;  1YWO A;  1OV3 A;  5FW9 A;  2GBQ A;  1QKW A;  1YWP A;  2EGA A;  4HVV A;  3R6N A;  1BBZ A;  2O9S A;  3EG1 A;  2BZX A;  1WXB A;  5IXF A;  2EPD A;  1BU1 A;  3KFV A;  3GBQ A;  2KGT A;  2NWM A;  4RTV A;  4CC3 A;  1KIK A;  2ROT A;  2D1X A;  2DNU A;  1VA7 A;  1Z9Q A;  2L3Q A;  3RBB B;  3C0C A;  1TUD A;  1X2Q A;  1RLP C;  2KRN A;  2LNH B;  1AWX A;  2ED0 A;  2C0O A;  1NM7 A;  2RQT A;  1UTI A;  1G2B A;  1M3A A;  5IXB A;  4LE9 A;  1FMK A;  1MV3 A;  2A28 A;  2LP5 A;  4J9E A;  3VS1 A;  3H41 A;  1E7O A;  2J06 A;  2KT1 A;  4RTY A;  2DL3 A;  2YDL A;  1NYF A;  1TUC A;  5I11 A;  1ZUU A;  1ARK A;  2AZV A;  1UE9 A;  2AKK A;  2FPD A;  2DRK A;  1LCK A;  4AG1 C;  5GJW B;  1K1Z A;  4RTX A;  5IHK A; 
#chains in the Genus database with same CATH topology
 4XTV A;  2CZ0 B;  1I8F A;  3QUI A;  3JB9 I;  3URG A;  1XOV A;  2CYZ B;  2CH4 A;  1MV0 B;  3UF4 A;  1X01 A;  2DVE A;  1NJI C;  3M54 A;  1KQS A;  4MMK A;  2MCN A;  2HBW A;  3ULR B;  3JCM f;  5CO7 A;  1K73 U;  2DJQ A;  2EKH A;  3CCL T;  4M7D D;  2VWF A;  4C8Q G;  4N4G A;  1Y57 A;  1UG1 A;  3A8H B;  4LNP A;  5CQY A;  1WNL A;  2D0Q B;  2FZC B;  4PLL A;  3I5R A;  2KK4 A;  4J9B A;  1M2O A;  3M4G A;  4K11 A;  1OQK A;  2KRO A;  5CKF A;  1VQP Q;  3VS4 A;  2DL5 A;  2NUP B;  1LJO A;  4M78 F;  2RD1 A;  2BZ8 A;  5I21 A;  2RI2 A;  4M77 E;  1C6V X;  3BFM A;  4JS5 A;  1NPP A;  1PRL C;  1AHJ B;  1DJ7 B;  2COZ A;  1Z9Z A;  1Q86 C;  3MHX A;  1AZG B;  2K9G A;  1K0X A;  3QPH A;  1ZUK A;  2OI3 A;  4JJN K;  4BI4 A;  1K76 A;  2LZ6 B;  3NPF A;  2ZPE B;  3EG3 A;  2HD0 A;  4A4G A;  4QQ6 A;  2BE7 D;  2CRE A;  2X3W D;  1KC8 R;  4MZT A;  2DXC A;  4RUG A;  1R77 A;  2J6K A;  4M7A E;  3L2Q A;  2JMA A;  4DBH A;  2QGG A;  4ESR A;  2X4J A;  4J9C A;  1VOM A;  1J3T A;  2CKK A;  1OPK A;  4IUT A;  3M56 A;  1RUW A;  5GAM f;  4E7L A;  5GAN 2;  1W1F A;  2BE9 B;  1MHN A;  4BB7 A;  1WDX A;  1VQN T;  2MI6 A;  1RAE B;  1WLP B;  2CSI A;  4KUD K;  3PE0 A;  5LJ3 g;  3J81 E;  3L2Z A;  3LLR A;  2KR3 A;  1MND A;  2DFU A;  2MF2 A;  2VV5 A;  1V29 B;  2K3Y A;  4A63 B;  2LQK A;  4ZN3 A;  3LWI A;  3VS5 A;  4EMK B;  2D6F A;  1T3L A;  4OMP A;  1QP2 A;  2FL7 A;  2FZG B;  4IUP A;  4N0A C;  3RDV A;  4LDU A;  1QWE A;  4AT1 B;  1UGR B;  4C0D C;  2DKG A;  4GLK A;  4NL2 A;  2K2V A;  3CCE Q;  5GAN 5;  1E6H A;  4KGZ B;  2RK2 A;  4M77 A;  1BKB A;  3CC4 A;  3FJ5 A;  4M7D A;  5LJ5 e;  3ZL7 C;  3JB9 G;  1K8A C;  1X43 A;  2RO0 A;  3CCM T;  2I2L A;  4ORZ A;  3TEE A;  1QVF A;  1G3T A;  3CBO A;  3WVD B;  3V7S A;  3DB3 A;  3QJY A;  5LJ5 d;  1UJY A;  3JCM g;  5KYN A;  1RAH B;  1V1C A;  4V2S A;  2LX7 A;  2ZGW A;  2F5T X;  5LJ5 j;  2K57 A;  1KQ2 A;  2KRM A;  4MDX A;  2ZPH B;  1IHW A;  2MK5 A;  3A1P A;  1A0N B;  4BDY A;  2QDL A;  1UDL A;  5J39 A;  3A5Z B;  3CCR A;  2P0Q A;  2X4X A;  3G7Z A;  4FT4 A;  2L0A A;  1D0X A;  2XDP A;  1NYG A;  4C5G A;  1WA7 A;  1TSF A;  1BYM A;  1MMN A;  1RAC B;  3CCL Q;  2DX1 A;  4J9H A;  2DIG A;  4R0K A;  3H0H A;  4E2F B;  3T9N A;  1P92 A;  4XTY A;  3ER0 A;  4PJJ A;  1E6G A;  5KYW A;  1OI1 A;  1WYX A;  5LJ5 f;  3CCU A;  1BI3 A;  2DL7 A;  1UEB A;  2VGN A;  2O4X A;  4DBF A;  3PT9 A;  4KRT A;  3MCA B;  1I07 A;  3NTI A;  5GAM g;  2E65 A;  4DEX A;  1D0Y A;  2O01 E;  3HHT B;  3TVT A;  3PIP A;  2L2P A;  1RI9 A;  1Q82 C;  1WPY A;  1H64 1;  1W6X A;  2EAY A;  4MZM A;  4XTU A;  3CCV Q;  3MKD A;  4J8O A;  2KEA A;  1M30 A;  3SWN A;  2PVD B;  2HL3 A;  1AOJ A;  3OYF A;  4M77 D;  5J26 A;  3S3M A;  5GAN f;  2EYW A;  3FJP A;  2QEX Q;  3CC4 Q;  4ZTF A;  2EKO A;  1ZSZ B;  3M0S A;  3EFR A;  1M27 C;  3E19 A;  3EHQ A;  1Y96 A;  1YIT A;  4C0D B;  2A08 A;  4X1V A;  3A8M B;  4PJO A;  3OA6 A;  3OY9 A;  1JEG A;  3G71 T;  1JO8 A;  3I5S A;  1QVG A;  4IKF A;  1YFN A;  3UA6 A;  2R57 A;  4J9G A;  1JXO A;  4LUD A;  3EG0 A;  4OMN A;  1FWZ A;  1WIE A;  2E12 A;  1SSH A;  4YTL A;  4BD3 A;  1RAF B;  2O2O A;  4R55 A;  2ECZ A;  2RH2 A;  4R56 A;  1SKU B;  1VQL Q;  3GF5 A;  5D6Y A;  1I5L A;  4DEY A;  4ZGD B;  2EQU A;  2LMJ A;  4JRQ A;  3PTA A;  4DA4 A;  2HSP A;  4JJC A;  5GAN e;  3CCU T;  4PJO C;  2LDM A;  2EQK A;  5I2S A;  1I81 A;  3L2U A;  3CME Q;  1T0H A;  3VV0 A;  2YLB A;  2QA4 T;  5HK0 A;  2O4X B;  3CCV T;  1BK2 A;  3CBP A;  5KYW B;  1O75 A;  3AHU A;  2XG8 D;  1SPK A;  5GAO q;  2H8H A;  1BB9 A;  2HQX A;  3CCJ T;  1KD1 R;  1NPR A;  4C8Q C;  4QW2 A;  3ASK A;  4AFS C;  4LD6 A;  1ZQ1 A;  2A37 A;  1YJN A;  2VYT A;  1M9S A;  4HCB A;  1WQ7 A;  3VUB A;  4RG2 A;  2XMF A;  1S72 A;  3CC2 Q;  3EFO B;  4C0G A;  2LRQ A;  4J9I A;  2QXF A;  1JB0 E;  3CPW A;  3VU3 C;  2QTV A;  1C0M A;  3CXC A;  3VUZ A;  1YJ9 T;  2ATC B;  3JRZ A;  4OP0 A;  3QHS A;  1QKX A;  3VKI A;  4PJL A;  1Q7Y C;  2HKN A;  4FYV B;  2DET A;  4NL3 A;  2LC4 A;  3R6N A;  2V8K A;  1BBZ A;  5IXF A;  3CCR T;  3KFV A;  4XTW A;  2NWM A;  5GAN 3;  5FRN A;  4PNO A;  4DOV A;  2XK0 A;  1M1F A;  4FM4 B;  4F7U G;  2D1X A;  4KH1 B;  1ZA1 B;  3C0C A;  3CPF A;  2RI3 A;  2LCC A;  2QA4 Q;  3GLX A;  4LDW A;  4CI0 C;  1VQK Q;  2GFA A;  1WJS A;  3CMA Q;  2QAZ A;  5FRM A;  2KDS A;  1NM7 A;  1G2B A;  1M3A A;  2A28 A;  2LP5 A;  3H41 A;  1RAI B;  3P8B B;  3P8H A;  1ACM B;  2DL3 A;  2P0P A;  2YDL A;  3EGD A;  2AZV A;  2AKK A;  1VQ8 Q;  2DD4 A;  4AG1 C;  2MWO A;  5GJW B;  5IHK A;  2RQW A;  2NUZ A;  4DBR A;  5D7U A;  2QYZ A;  4HCK A;  5LJ3 d;  4L59 A;  3E1S A;  3ZBD A;  2DEU A;  2OAW A;  1YIJ T;  1YJW Q;  2YRD A;  5FRO A;  1ZBJ A;  1IHV A;  2DMO A;  2HZY A;  2CH4 W;  3EGD B;  4Y91 A;  3HSB A;  2JS0 A;  2RJC A;  1LNX A;  2ENM A;  2CGH A;  2DYB A;  2DVJ A;  1VYU A;  1K9M R;  4MZP A;  3E9F A;  5GAM j;  1Y07 A;  3M0P A;  2JUF A;  4C0Z A;  2RHX A;  1YN8 A;  3OYK A;  4C8Q F;  5FU6 C;  2JNG A;  3OYH A;  2VXE A;  1KQ1 A;  4HCC A;  1Q86 R;  1OX8 A;  2QTX A;  1W2B P;  4A4K A;  1NJI U;  2JTE A;  3OS5 A;  3JV3 A;  1IGU A;  4RMO A;  2FEI A;  2FHD A;  3CC7 T;  2JMC A;  1LPL A;  4OB0 B;  2QEX A;  2OTJ Q;  1OOT A;  4C5E A;  4M78 B;  3RER A;  4HVU A;  1B7T A;  3KBG A;  2ZZD A;  1QW1 A;  1N8R U;  2ZPF B;  1LVK A;  2E5Q A;  2QA4 A;  2EWN A;  4M75 F;  4X34 A;  2KQW A;  4J7F A;  4C92 G;  3CCQ A;  1AWJ A;  2SRC A;  2LVM A;  3VS7 A;  3CBM A;  4HA8 A;  2W0Z A;  1VQ4 A;  1VQM Q;  8AT1 B;  2CSQ A;  3JAM E;  2HEQ A;  4JZ3 A;  3CCV A;  4RTZ A;  1Q81 C;  3RNJ A;  2MWP A;  1ZA2 B;  1G3Y A;  1SHG A;  1PRM C;  3M0R A;  3A8G B;  1WGS A;  3BDU A;  4M75 C;  1Q86 U;  5KYY A;  4PJO E;  2NUT B;  1QVF S;  4QVD A;  5FU7 B;  2RN8 A;  4C0F A;  1PSF A;  1IRX A;  2O88 A;  1T0J A;  3PIO A;  4ZTJ A;  1ZHI A;  5KYX A;  1G83 A;  1ZX6 A;  2YHT A;  4O6J A;  1K9A A;  1YJW T;  2FRW A;  1QP3 A;  3TSZ A;  4FYX B;  3UDC A;  4EPC A;  1EFN A;  1PD1 A;  1U1T A;  1UGV A;  1OZ3 A;  4IUR A;  1V76 A;  4GBQ A;  2DEQ A;  2QAS A;  1WHH A;  4CRI A;  1UHF A;  5CKB A;  5FU7 C;  3P8D A;  3OW2 P;  2AT1 B;  2CDT A;  4QT7 A;  1YBY A;  2EQJ A;  2EVR A;  3VS3 A;  4RKU E;  3FLG A;  3RR6 A;  1VQ4 T;  2PUK B;  3CC2 A;  1JJ2 P;  3OSS C;  1JBM A;  5M9O A;  2CP6 A;  4BUG A;  4M4Z A;  2D8H A;  2KE9 A;  1BIB A;  2OX7 A;  3G6E T;  3SHW A;  2RF0 A;  1TTH B;  2CP5 A;  2LJ0 A;  2DA9 A;  5HY6 A;  1NZ9 A;  2K4Y A;  1K8A U;  1VUB A;  4M78 D;  5CKH A;  2KXD A;  4A4F A;  2DYI A;  1YCY A;  4L6V 5;  3CC2 T;  3ME9 A;  3C94 A;  1G5V A;  4AFZ C;  2DJZ A;  1G3W A;  2DIL A;  4CC2 A;  1N6A A;  3MEW A;  4M75 D;  4PJN A;  3FB9 A;  4M7A A;  3PVL A;  5AYF A;  2JT4 A;  1KJW A;  3OMG A;  3TQ7 P;  4MML A;  4XU3 A;  4NS5 A;  4E7H A;  2X9H A;  4PJO B;  1KQS S;  1GCQ C;  1GRI A;  3OMC A;  2J6F A;  1AWO A;  5CQX A;  4XQ3 A;  2JJ9 A;  1VQM T;  4HCZ A;  2LJ1 A;  3JB9 D;  4OMO A;  2DZ9 A;  5LJ5 h;  4KGX B;  4M75 B;  3VYH B;  3CCS A;  3CMA T;  4KUL A;  1JRI A;  4F14 A;  2ZPB B;  1S72 Q;  2LQN A;  4X9C A;  1ZSG A;  3HFN A;  5J3B A;  1LOJ A;  2JM8 A;  1GFC A;  3JCM Q;  1KFZ A;  1IXD A;  2EW3 A;  2A36 A;  1BI2 A;  2DBK A;  1N8R R;  1VQ9 T;  3RKW A;  2YUO A;  2ABL A;  2QI2 A;  2X4Y A;  4QKU A;  4AG2 C;  2OTJ A;  4M7D G;  4IIO A;  4XU2 A;  2DTO A;  1VQ7 T;  3I56 Q;  3JCM P;  2RPN A;  4LDV A;  5IN1 A;  4KBM B;  3CPW P;  3VS6 A;  3EG9 B;  1VQ9 Q;  1SRM A;  4B9X A;  3ZEH A;  2V26 A;  3CD6 Q;  2ZAE A;  4KUI A;  3EFS A;  2K3B A;  4C5H A;  1Y0M A;  5I22 A;  3JB9 F;  5GAO m;  2F2W A;  5GJV B;  3PFS A;  2GGR A;  3CC4 T;  2CT4 A;  3O8V A;  3NTH A;  1AWW A;  1K8A R;  2JM9 A;  1UUE A;  4QQD A;  4EMK A;  4E7S A;  4XU1 A;  2LCL A;  1M3B A;  4HKE A;  2MMP A;  1VQL A;  2FPF A;  5IT9 E;  1X69 A;  3OYN A;  1W4S A;  2BUD A;  2XID A;  3MO8 A;  2L3S A;  1OPL A;  3VRY A;  4M75 G;  3KXT A;  3I55 A;  4RTU A;  1R0C B;  3QII A;  3V8K A;  4C8Q B;  2AHJ B;  3VRZ A;  4F7U F;  4E7Z A;  3OYB A;  2VB6 A;  2RQV A;  4M75 E;  3UWN A;  2XIC A;  2X51 A;  1PHT A;  4FU6 A;  1WFW A;  4C92 B;  1G8X A;  1AVZ C;  3EG2 A;  4OML A;  1X6O A;  3M0U A;  2LQ8 A;  5ECA A;  2QG9 B;  5GAN 6;  4VUB A;  1KHI A;  4Y92 A;  4JUV A;  2DZC A;  3UPU A;  4OMM A;  2GNC A;  1VQ9 A;  2B8A A;  4PJO F;  2K5L A;  3QG1 A;  5FLX E;  5LJ3 j;  5LJ3 e;  1VQO T;  1HD3 A;  2C0T A;  2JXB A;  4KGV B;  2COY A;  4RTW A;  1QCF A;  4QQG A;  1K9M U;  4WTO B;  4ZNX A;  4ZGJ B;  1N9R A;  3REA B;  1GL5 A;  1OZ2 A;  2E6N A;  2XDB A;  4PJO G;  2KVQ G;  3CCQ T;  3QZ5 B;  1NLP C;  1YWO A;  5FW9 A;  2GBQ A;  3MP6 A;  1YWP A;  2E10 A;  4FW2 A;  5D6W A;  4HVV A;  3QDR B;  4F7U E;  2BZX A;  1WXB A;  2CP3 A;  6AT1 B;  2QDY B;  2HL5 C;  5KYU A;  5C6S A;  3OYL A;  4LDY A;  2RHI A;  1OU8 A;  5GAO n;  4BDZ A;  5KCH A;  2L3R A;  4F7U B;  2ROT A;  1RL2 A;  1WHM A;  1WHJ A;  5LL6 S;  2XKO C;  4XTX A;  2L3Q A;  5KYY B;  1TUD A;  1UB4 A;  4C8Q D;  1SSF A;  2K3X A;  1AWX A;  2DXT A;  1C1A A;  1YI2 T;  3CD6 T;  5A0L A;  1MV3 A;  2GF7 A;  2E6Z A;  5KYX B;  1E7O A;  3HL8 A;  2KT1 A;  1H3Z A;  1NYF A;  2A0F B;  3QJ6 A;  1ZUU A;  3SDZ A;  5A0G A;  2FPD A;  3G4S A;  4BY6 C;  2HMA A;  1K1Z A;  3JCM V;  4C92 C;  2YXY A;  2R5A A;  3HRS A;  2KY9 A;  2DTH A;  1HJD A;  5FWC A;  2F5K A;  1NG2 A;  1YHQ Q;  3NHN A;  4D8D A;  2QQA A;  4FT2 A;  1YJ9 Q;  1R0B G;  4F16 A;  2ZCF B;  1VQP A;  2DBM A;  2HAX A;  2CP0 A;  2ED1 A;  2VAS A;  1WHL A;  2XHC A;  1U5S A;  4JPB W;  4PLI A;  3G71 Q;  3THK A;  4EMH A;  2G6F X;  2FZK B;  2EQM A;  1UGS B;  2CP7 A;  2H3E B;  1IRE B;  4X9D A;  3GP8 A;  2D0N A;  4PFZ A;  2XDD A;  2M1H A;  3IQL A;  4PFO A;  3VJP A;  1PCX A;  5HCK A;  2LJ3 A;  2KYM A;  1QVG S;  3HRU A;  5GAN h;  1PNJ A;  3PMI A;  4PK4 A;  2BTT A;  3M57 A;  3L2V A;  4HXJ A;  2DD5 A;  3EG9 A;  4F7U A;  5CR2 A;  4M7D B;  4J9D A;  3EFO A;  5L23 A;  4M77 G;  2PQW A;  4M7D E;  1N8R C;  3OYM A;  2EQI A;  1YJN Q;  1YP5 A;  2GCX A;  2PUO B;  3QYG B;  2CP2 A;  3OYI A;  1VQO A;  1M3C A;  1RAD B;  2E1H A;  2LX9 A;  1WHG A;  2MPX C;  1D3B A;  3FDR A;  3S3O A;  3CCQ Q;  2DLP A;  2P84 A;  3QSU A;  4RG8 A;  2VC8 A;  4CC4 B;  2Y4Y A;  2WSF E;  3KUF A;  2RJD A;  5LJ3 f;  4AFU C;  4CC7 A;  2SEM A;  4EMG A;  3OBW A;  1XQH A;  1SRL A;  4BE2 A;  1RLQ C;  4DOW A;  3I56 T;  2O31 A;  1X6B A;  2KRS A;  2HNI A;  4D6W A;  3FC3 A;  3OW2 A;  2HDA A;  3EHR A;  1IO6 A;  1PG5 B;  2PVG B;  1YCS B;  4J6X A;  1VIE A;  3OQ5 A;  2KBT A;  2L5Q A;  4PFP A;  4FW1 A;  2AKL A;  4OGC A;  3CCJ A;  2KYB A;  4ANJ A;  3OS1 A;  3CPW S;  2FG0 A;  3NTK A;  1RI0 A;  1W70 A;  4LDX A;  3QYH B;  1GXI E;  3CCU Q;  2E41 A;  5HK3 A;  1TWB A;  2RM4 A;  2LQW A;  4BE0 A;  2VXF A;  2EGE A;  4J6Y A;  4PL6 A;  4M7D F;  3QWX X;  4FYY B;  2DM1 A;  4N0A A;  2K6D A;  3PMT A;  1NLO C;  1X27 A;  1AT1 B;  1TH7 A;  3DLL A;  4E47 A;  3FEO A;  3V7C A;  1ZUY A;  2I0N A;  5L8R E;  1M8V A;  3RES A;  3DKM A;  1WHK A;  3J7A F;  1ABO A;  3CCJ Q;  5GMK h;  1GFD A;  2QQR A;  5DY9 A;  1YIJ Q;  3EH2 A;  3SWN B;  4JJB A;  1Q7Y U;  2J05 A;  1WZO A;  4M7D C;  2KMT A;  4Z88 A;  5GAN 8;  4EDU A;  4OMQ A;  2CUB A;  2A3L A;  1D1C A;  3M59 A;  2OAU A;  3X28 B;  2XU8 A;  2DTI A;  2P0K A;  3M9Q A;  4LD9 K;  2HSE B;  2JN0 A;  2O9V A;  4IUQ A;  4XU0 A;  1BIA A;  1TUG B;  1KD1 C;  4RCC A;  2QGF B;  3BY7 A;  3G6E Q;  2KXC A;  3VYG A;  3X24 B;  1OUL A;  1Y71 A;  4IUU A;  2EYX A;  3MPU B;  2EJ9 A;  2G3R A;  5CK9 A;  3GPL A;  3ZFJ A;  4BI8 B;  2CT3 A;  3CXC P;  2EYY A;  1VQ5 Q;  4J83 A;  4HT8 A;  2DL4 A;  3HPW A;  2JZ2 A;  1I0C A;  1PKT A;  1JJ2 S;  3CME A;  5HKC A;  3LH0 A;  1TXQ A;  1FMV A;  1CKA A;  1RAG B;  1UFF A;  4C92 E;  3JCM J;  1YJW A;  2DER A;  5CAI A;  1RAA B;  1KD1 U;  4FYW B;  3OYE A;  3WVE B;  1PWT A;  2DF6 A;  2DE0 X;  2OTL Q;  1QVF P;  3SFM A;  1QWF A;  3EGU A;  2FYK A;  2VGM A;  1UHC A;  3G1J A;  2EBP A;  4C5I A;  3M0Q A;  1VQ4 Q;  1U06 A;  4LN2 A;  1VYT A;  2AK5 A;  1VQ8 T;  3JCM b;  1GCP A;  2ZPG B;  1RAB B;  1MNE A;  2YRC A;  2RK1 A;  2F1L A;  4J9F A;  2JTF A;  3OYY A;  3UAT A;  2CZ7 B;  1M1K C;  1KHC A;  2GTO A;  5GMK j;  2PZ1 A;  1VIF A;  1UGQ B;  5FWB A;  2R58 A;  4XK8 E;  4DBQ A;  3RMQ A;  2RI5 A;  2ROL A;  3EGX A;  5IHN A;  4MDW A;  1U3O A;  1W2B S;  2W10 A;  2FRY A;  4JJD A;  4B6M A;  3NMZ C;  1VQK A;  1VQ5 A;  4C92 F;  5IAY A;  2PU9 B;  2D8J A;  4A54 A;  4OB1 B;  5GAN d;  2K5I A;  3MJX A;  1KSW A;  4ELZ C;  3C12 A;  3MEU A;  2E3I A;  2YT6 A;  5GAM d;  1JXM A;  4LXC A;  3I9Q A;  3OSV A;  1VQM A;  2LNV A;  3OYG A;  1QMC A;  1F1B B;  2Y90 A;  1PKS A;  3H9N A;  1ZLM A;  1Q81 R;  2QQ9 A;  2M0Y A;  4M7A F;  1H92 A;  4JRK A;  4EIK A;  2M9U A;  3PGG A;  1BI0 A;  2H3J A;  4OB2 B;  4OF1 A;  3WXM B;  2HQH A;  1M1K R;  4E7J A;  2V1R A;  1X6G A;  4AFQ C;  3LGF A;  2FPE A;  4IUV A;  2X3X D;  4AMC A;  1HYO A;  2OJ2 A;  1S1N A;  3CC7 A;  2KAF A;  4ZGE B;  4M7A C;  4JDS A;  1CKB A;  3LW5 E;  1QCN A;  2HCK A;  1I5O B;  4FCY A;  2PTK A;  5D6X A;  4BAC A;  2OTJ T;  3HKS A;  2EYZ A;  1FXX A;  3RKY A;  5GMK i;  2F2V A;  1YHQ T;  1FYN A;  1D3B B;  2CS7 A;  1TOV A;  2MYS A;  5A2Q E;  5CKD A;  5GAN 4;  4C8Q A;  4ELY C;  3H0F A;  2V8I A;  3JSC A;  4A4H A;  1WI7 A;  1M90 U;  1OV3 A;  2P4T A;  4XAX B;  2EGA A;  1KK7 A;  3DB4 A;  5KE3 A;  1NJI R;  3TCJ A;  3LGL A;  4M77 C;  2EPD A;  1M1K U;  4OVA A;  2KGT A;  5GAN g;  3JCM X;  1KIK A;  3X20 B;  3L2R A;  1M4Z A;  1KC8 C;  1Z9Q A;  3FIF A;  3RKX A;  1WQW A;  3RBB B;  1D1B A;  3G6E A;  2C06 A;  2LNH B;  2HKQ B;  2C0O A;  1ZSZ C;  2M16 A;  2HBP A;  1TU0 B;  2NYS A;  4LE9 A;  1PSE A;  4BY6 B;  5IXB A;  2E4H A;  4J9E A;  3QZ9 B;  3VS1 A;  1XNI A;  3M4Y A;  2YLC A;  4JRI A;  1TUC A;  5I11 A;  1MMD A;  2CZ1 B;  1ARK A;  1D0Z A;  1TS9 A;  5CIU A;  3OW2 S;  4P5N A;  2DRK A;  1LCK A;  5GMK m;  3HP9 A;  4Z02 A;  4RTX A;  3CCM A;  1WJQ A;  3Q1J A;  1M5Q 1;  2FO0 A;  2DRM A;  2L3P A;  3REB B;  1VQ7 A;  2ESW A;  1X2K A;  3JCM W;  2QK0 A;  4M78 C;  1B34 A;  1HSQ A;  1ZSZ A;  1KC8 U;  3PNW C;  2AZS A;  4JRP A;  4GLM A;  2IG0 A;  3CCE T;  2FB7 A;  2IVW A;  3O5Z A;  2K79 A;  1B07 A;  1N5Z A;  3VS2 A;  1OEB A;  3QKJ A;  4O5V A;  3M55 A;  1AZE A;  3OYD A;  1SF9 A;  3G71 A;  1K4U S;  1VQL T;  2EIF A;  2L89 A;  3X25 B;  4RTT A;  1TG0 A;  3LYI A;  4BE1 A;  1VQK T;  5EG2 A;  5GAM e;  2RNA A;  5GMK e;  1H3H A;  3I35 A;  2K7A A;  5C0M A;  4PJM A;  2YWW A;  1K73 C;  2RQU A;  2A7Y A;  2B86 A;  2RHZ A;  3CCR Q;  1YIT T;  4A4E A;  5GMK l;  4N4I A;  2WAC A;  2RHY A;  2JW4 A;  2YSQ A;  1Q95 G;  1VQN A;  3SWN C;  2XD0 A;  2MIO A;  3M5A A;  3TSW A;  4OGE A;  2ZPI B;  2OTL T;  1SHF A;  3BW1 A;  3CD6 A;  1UJ0 A;  4HT9 A;  5GAM h;  5IH2 A;  3MP8 A;  4LUE A;  3SD4 A;  5LJ3 h;  3U23 A;  1SG5 A;  5KE2 A;  2JVV A;  3QDF A;  4JS4 A;  3JCM h;  1M90 R;  4M7A G;  1PD0 A;  4JLI A;  1D09 B;  4UC4 A;  1JJ2 A;  4XTZ A;  3G4S T;  3CQT A;  1D1A A;  5GAO p;  4FSS A;  1SEM A;  1HK9 A;  1VQ6 T;  4ATO A;  1QQJ A;  2LTO A;  5GAN 7;  3HFO A;  1T3S A;  1ZBX A;  2QQS A;  5GAO l;  4J6W A;  1K73 R;  5KH6 A;  1UGP B;  3TU4 K;  1QVG P;  3MP1 A;  1AEY A;  2V1Q A;  1VQ6 Q;  1GBQ A;  4L5G A;  1Y96 B;  3JCM c;  4EMK C;  4J5Y A;  4GY5 A;  4B9W A;  3H6Z A;  2BZY A;  3EH1 A;  1MUZ A;  1NEB A;  2JS2 A;  2CUD A;  3SEM A;  4QVC A;  4C8Q E;  3M58 A;  2E64 A;  2YUN A;  2AIR B;  3SB2 A;  2BIV A;  1YIJ A;  1EZZ B;  2K2M A;  1M1G A;  4E6R A;  5DLQ E;  1QLY A;  3EGX B;  1UEC A;  2R5M A;  2NLU A;  2D9T A;  1YJ9 A;  3VS0 A;  3E2U A;  5DM7 R;  5FU6 B;  4N4H A;  2YUP A;  9ATC B;  4KH0 B;  1K0S A;  4PJO D;  1WXU A;  3F70 A;  1YI2 A;  4KT0 E;  2YRV A;  5I2M A;  3CXC S;  2YUQ A;  2EYQ A;  3M53 A;  1VQ6 A;  2DL8 A;  4FIB A;  1JU5 C;  2M0O A;  1Q82 U;  2EJF A;  2KT8 A;  2RHU A;  5DLO A;  1VYV A;  2M51 A;  1VQN Q;  3AT1 B;  4OB3 B;  1GBR A;  1HXD A;  3NGP A;  3FRN A;  3TRE A;  2JTM A;  4DQ2 A;  4Z89 A;  1M8M A;  3QWY A;  4BI3 A;  1WXT A;  4D8K A;  2X4W A;  3UA7 A;  3DLM A;  1QCO A;  4JZ4 A;  2DAQ A;  3CCL A;  1Q81 U;  3A98 A;  3QO3 A;  1BCM A;  3L2W A;  4TVR A;  2GQI A;  3BDL A;  2DO3 A;  1VQ5 T;  2NUT A;  3C4S A;  3MEA A;  4M77 B;  2KNB B;  2X35 A;  2RMO A;  3GNF B;  3OB9 A;  4PKC C;  3QBY A;  4FSX A;  1K9M C;  2F69 A;  4Q5W A;  1B3Q A;  4J7I A;  3GOX A;  5EC7 A;  1BI1 A;  2Y4X A;  3OYC A;  4IIM A;  3CCM Q;  2LT4 A;  1Q82 R;  1YNZ A;  3UT1 A;  4WF2 A;  2WSC E;  1S72 T;  1NEG A;  4M78 E;  2EGC A;  2GTJ A;  2BKD N;  2VKN A;  3N5B B;  2P4R A;  4JLG A;  3G4S Q;  1R8O B;  2LT1 A;  5CKE A;  1WX6 A;  3JCM e;  2J6O A;  1YI2 Q;  2RA2 A;  7AT1 B;  3S3N A;  2GQV A;  1W2B A;  2J7I A;  1N9S A;  2PVO B;  3CCE A;  1U8R A;  1VQO Q;  4E7K A;  4Z8A A;  2E3H A;  2LCS A;  2Z0W A;  1I1J A;  1CSK A;  3JCM d;  3CMA A;  3CCS T;  5CCA A;  2WSE E;  1N27 A;  1GCQ A;  3MEV A;  4F04 B;  5CVI A;  3L1A A;  2HQE A;  2VUB A;  3RUX A;  2RQR A;  2MOX A;  3JB9 J;  5KYU B;  2VVK A;  4C92 D;  1H8K A;  1G3S A;  1U1S A;  3C95 A;  3E9G A;  4F17 A;  1XJW B;  4FL6 A;  3A8L B;  1M2V A;  2E70 A;  4OMF B;  8ATC B;  3D7S B;  1X75 C;  2NUP A;  5IHI A;  3HRT A;  3R6O A;  4ZN1 A;  3MET A;  3CME T;  2XI9 A;  2L8D A;  3QXE B;  3LH5 A;  2E5K A;  3L42 A;  1Q7Y R;  3OYJ A;  1IZ6 A;  2FVU A;  2EJG A;  3H0I A;  3A8O B;  4NOY A;  2DXB A;  3M0T A;  1JQQ A;  1YHQ A;  3PVQ A;  2RB6 A;  1IB8 A;  3RMS A;  3V8L A;  1PC0 A;  1ABQ A;  2V8J A;  2JOY A;  4II1 A;  1PM3 A;  3I56 A;  1OYX A;  2F2X A;  3RIR A;  3CEY A;  2IIM A;  2KI7 A;  2QEX T;  2M02 A;  1I4K 1;  3INZ A;  3NFC A;  2QQB A;  4WCI A;  1OU9 A;  3BE3 A;  5AT1 B;  4A53 A;  2DPP B;  3OYA A;  1AD5 A;  2C0I A;  1IGQ A;  3OBY A;  3V8J A;  1M90 C;  1VQ8 A;  1BCO A;  4M78 G;  4HVW A;  5GAN j;  2K5F A;  2OTL A;  3H8Z A;  3I55 T;  2CZ6 B;  3J80 E;  2PNI A;  4M78 A;  1EX4 A;  3X26 B;  1QKW A;  4RCB A;  3GIB A;  2O9S A;  3EAE A;  3EG1 A;  3LX7 A;  2KSS A;  1M2V B;  5A0D A;  1NE8 A;  4M7A D;  1BU1 A;  4M75 A;  2GFU A;  3GBQ A;  3I55 Q;  1B34 B;  1NBE B;  3HTR A;  4RTV A;  1VQP T;  4Y28 E;  4CC3 A;  3JB9 H;  2DK3 A;  3LWH A;  3CCS Q;  2RJF A;  1WJR A;  2DNU A;  1VA7 A;  1Y7X A;  2MAM A;  1X2Q A;  1RLP C;  2KRN A;  1KQS P;  2COW A;  5KCO A;  2IPO B;  3CC7 Q;  2ED0 A;  2DXU A;  1MGQ A;  4M77 F;  1MMG A;  1FMW A;  1YJN T;  2RQT A;  1UTI A;  1FMK A;  1O9S A;  1EIF A;  5LJ5 g;  2DIQ A;  4M7A B;  2J06 A;  4QVZ A;  3OS0 A;  4RTY A;  5GAO r;  1OX9 A;  3S6W A;  4ME7 A;  1MMA A;  1VQ7 Q;  1UE9 A;  1QVP A;  1YIT Q;  3V7R A;  4C92 A;  4E7I A;  1FX7 A;  1KG1 A;  1XTD A;  2RJE A;  2EFI A;  3OS2 A;  3GNG A; 
#chains in the Genus database with same CATH homology
 2RQW A;  1HJD A;  5FWC A;  1NG2 A;  2FO0 A;  2NUZ A;  3NHN A;  1XOV A;  4HCK A;  2CH4 A;  1MV0 B;  3UF4 A;  2DRM A;  4D8D A;  2L3P A;  3REB B;  2ESW A;  2OAW A;  1X2K A;  4F16 A;  2DBM A;  3ULR B;  2MCN A;  2HBW A;  1ZBJ A;  1HSQ A;  2ED1 A;  2DMO A;  2DJQ A;  2EKH A;  2AZS A;  2CH4 W;  2VWF A;  1U5S A;  2JS0 A;  4JPB W;  4GLM A;  2ENM A;  3THK A;  2G6F X;  2DYB A;  2DVJ A;  1VYU A;  1Y57 A;  1UG1 A;  4LNP A;  3I5R A;  2K79 A;  3O5Z A;  4J9B A;  1B07 A;  1N5Z A;  2D0N A;  4K11 A;  3VS2 A;  3M0P A;  2KRO A;  3IQL A;  1OEB A;  3VS4 A;  2DL5 A;  5HCK A;  1YN8 A;  2LJ3 A;  1AZE A;  2KYM A;  1K4U S;  1PNJ A;  2BZ8 A;  4RTT A;  1TG0 A;  2BTT A;  4HXJ A;  1PRL C;  2RNA A;  1Z9Z A;  4J9D A;  1H3H A;  1AZG B;  2K9G A;  1K0X A;  3I35 A;  5L23 A;  1ZUK A;  2K7A A;  2JTE A;  3JV3 A;  2OI3 A;  2FEI A;  2JMC A;  1K76 A;  2RQU A;  2EQI A;  2LZ6 B;  3NPF A;  3EG3 A;  1YP5 A;  2B86 A;  1OOT A;  2CRE A;  2X3W D;  4HVU A;  2JW4 A;  4RUG A;  2YSQ A;  2J6K A;  1M3C A;  2JMA A;  1AWJ A;  2MIO A;  4ESR A;  2SRC A;  4J9C A;  3TSW A;  2DLP A;  1J3T A;  1SHF A;  1OPK A;  3VS7 A;  1UJ0 A;  1RUW A;  4CC4 B;  2W0Z A;  5IH2 A;  4AFU C;  4LUE A;  3U23 A;  4CC7 A;  2SEM A;  2CSQ A;  1W1F A;  2HEQ A;  1SRL A;  4JZ3 A;  1RLQ C;  4RTZ A;  2O31 A;  1WDX A;  1X6B A;  2KRS A;  3RNJ A;  2HDA A;  3EHR A;  1IO6 A;  1WLP B;  2CSI A;  1SHG A;  1YCS B;  3PE0 A;  3CQT A;  1PRM C;  3M0R A;  2KBT A;  2AKL A;  2KYB A;  4FSS A;  2RN8 A;  1SEM A;  2KR3 A;  2O88 A;  4A63 B;  1T0J A;  1T3S A;  2FG0 A;  1W70 A;  3VS5 A;  1T3L A;  4OMP A;  1G83 A;  1ZX6 A;  1K9A A;  2FRW A;  3TSZ A;  2LQW A;  1EFN A;  2EGE A;  1QWE A;  2V1Q A;  1UGV A;  1AEY A;  3QWX X;  4GBQ A;  2DM1 A;  1GBQ A;  2K6D A;  1NLO C;  1UHF A;  1X27 A;  2BZY A;  1MUZ A;  1ZUY A;  1E6H A;  2CDT A;  2I0N A;  4QT7 A;  1NEB A;  2EVR A;  2JS2 A;  3VS3 A;  2CUD A;  3SEM A;  1ABO A;  2YUN A;  3FJ5 A;  1GFD A;  2K2M A;  3ZL7 C;  1X43 A;  4E6R A;  1QLY A;  1UEC A;  4JJB A;  2J05 A;  4ORZ A;  3VS0 A;  4M4Z A;  2D8H A;  2KE9 A;  4Z88 A;  3SHW A;  2RF0 A;  4OMQ A;  2CUB A;  2LJ0 A;  2DA9 A;  2YUP A;  1K0S A;  1WXU A;  1UJY A;  2O9V A;  2KXD A;  2YUQ A;  1V1C A;  2DL8 A;  2LX7 A;  1JU5 C;  4AFZ C;  4CC2 A;  2DIL A;  2KRM A;  2KXC A;  2KT8 A;  1VYV A;  2M51 A;  1A0N B;  3PVL A;  2JT4 A;  2EYX A;  2QDL A;  1GBR A;  1UDL A;  1KJW A;  3NGP A;  4Z89 A;  1M8M A;  2L0A A;  3QWY A;  2CT3 A;  1WXT A;  1NYG A;  4D8K A;  3UA7 A;  1WA7 A;  2EYY A;  1GCQ C;  1GRI A;  2J6F A;  2DX1 A;  4JZ4 A;  2DL4 A;  4J9H A;  4R0K A;  1AWO A;  3H0H A;  1I0C A;  1PKT A;  3A98 A;  1E6G A;  2LJ1 A;  4OMO A;  1WYX A;  2DL7 A;  2GQI A;  1CKA A;  4KRT A;  4F14 A;  1I07 A;  2LQN A;  1UFF A;  1ZSG A;  2KNB B;  2RMO A;  1PWT A;  2JM8 A;  2DF6 A;  4DEX A;  1GFC A;  1KFZ A;  1B3Q A;  2DE0 X;  3TVT A;  2EW3 A;  2A36 A;  2L2P A;  5EC7 A;  2DBK A;  1QWF A;  1RI9 A;  3EGU A;  4IIM A;  2YUO A;  2ABL A;  1UHC A;  1YNZ A;  2EBP A;  3M0Q A;  4AG2 C;  1NEG A;  1U06 A;  1W6X A;  2EGC A;  4IIO A;  2GTJ A;  2VKN A;  1VYT A;  4LN2 A;  2AK5 A;  2P4R A;  2RPN A;  1GCP A;  2KEA A;  1M30 A;  3VS6 A;  1AOJ A;  1SRM A;  4J9F A;  1WX6 A;  2J6O A;  3UAT A;  2EYW A;  2K3B A;  1Y0M A;  2J7I A;  5I22 A;  2GTO A;  2F2W A;  2PZ1 A;  3M0S A;  5GJV B;  1M27 C;  4Z8A A;  2GGR A;  3EHQ A;  2CT4 A;  5FWB A;  2LCS A;  2A08 A;  4X1V A;  1AWW A;  1I1J A;  2JM9 A;  1CSK A;  1UUE A;  1JEG A;  2ROL A;  1GCQ A;  1M3B A;  1JO8 A;  2FPF A;  3I5S A;  1X69 A;  5IHN A;  3UA6 A;  2RQR A;  2MOX A;  1U3O A;  2VVK A;  4J9G A;  1JXO A;  4LUD A;  3EG0 A;  2L3S A;  1H8K A;  2FRY A;  1WIE A;  2W10 A;  4JJD A;  4OMN A;  1OPL A;  3NMZ C;  3VRY A;  1SSH A;  4RTU A;  2D8J A;  4F17 A;  1KSW A;  2O2O A;  2ECZ A;  2YT6 A;  1JXM A;  3I9Q A;  5IHI A;  3VRZ A;  4DEY A;  2LMJ A;  2HSP A;  2RQV A;  4JJC A;  1PKS A;  1ZLM A;  2M0Y A;  1H92 A;  3LH5 A;  2E5K A;  1PHT A;  1WFW A;  4EIK A;  1T0H A;  3H0I A;  1AVZ C;  1BK2 A;  3EG2 A;  2V1R A;  3M0T A;  1JQQ A;  3PVQ A;  4OML A;  1X6G A;  4AFQ C;  2FPE A;  3M0U A;  1ABQ A;  5ECA A;  2X3X D;  1SPK A;  4Y92 A;  2F2X A;  2OJ2 A;  2H8H A;  2IIM A;  1BB9 A;  4OMM A;  1S1N A;  2GNC A;  4AFS C;  1CKB A;  2HCK A;  4WCI A;  2A37 A;  2PTK A;  1HD3 A;  2C0T A;  2JXB A;  4RTW A;  1QCF A;  1AD5 A;  2XMF A;  2C0I A;  2EYZ A;  4ZNX A;  2F2V A;  4J9I A;  1FYN A;  3REA B;  1GL5 A;  4HVW A;  3H0F A;  2PNI A;  1QKX A;  1WI7 A;  1NLP C;  1YWO A;  1OV3 A;  5FW9 A;  2GBQ A;  1QKW A;  1YWP A;  2EGA A;  4HVV A;  3R6N A;  1BBZ A;  2O9S A;  3EG1 A;  2BZX A;  1WXB A;  5IXF A;  2EPD A;  1BU1 A;  3KFV A;  3GBQ A;  2KGT A;  2NWM A;  4RTV A;  4CC3 A;  1KIK A;  2ROT A;  2D1X A;  2DNU A;  1VA7 A;  1Z9Q A;  2L3Q A;  3RBB B;  3C0C A;  1TUD A;  1X2Q A;  1RLP C;  2KRN A;  2LNH B;  1AWX A;  2ED0 A;  2C0O A;  1NM7 A;  2RQT A;  1UTI A;  1G2B A;  1M3A A;  5IXB A;  4LE9 A;  1FMK A;  1MV3 A;  2A28 A;  2LP5 A;  4J9E A;  3VS1 A;  3H41 A;  1E7O A;  2J06 A;  2KT1 A;  4RTY A;  2DL3 A;  2YDL A;  1NYF A;  1TUC A;  5I11 A;  1ZUU A;  1ARK A;  2AZV A;  1UE9 A;  2AKK A;  2FPD A;  2DRK A;  1LCK A;  4AG1 C;  5GJW B;  1K1Z A;  4RTX A;  5IHK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...