1WIEA

Solution structure of the first sh3 domain of kiaa0318 protein
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
96
structure length
96
Chain Sequence
GSSGSSGTSKQRYSGKVHLCVARYSYNPFDGPNENPEAELPLTAGKYLYVYGDMDEDGFYEGELLDGQRGLVPSNFVDFVQDNESRLASTSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIM binding protein 2
publication title Solution structure of the first SH3 domain of KIAA0318 protein
rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 5
structure length 96
sequence length 96
ec nomenclature
pdb deposition date 2004-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14604 SH3_9 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1wieA01
1X2KA 1YNZA 3R6NA 3UF4A 3REBB 2DILA 4OMNA 2JMCA 2PTKA 2ENMA 2DBMA 1UJYA 1SSHA 2RF0A 4J9CA 4HVWA 1CSKA 3UATA 1HSQA 1RI9A 1VYUA 2J05A 2FEIA 2DL3A 2KEAA 3U23A 4ESRA 2ABLA 2L3SA 2D8JA 2O2OA 2LZ6B 4LE9A 3VS0A 2FPEA 1XOVA 1G2BA 2DNUA 5I22A 2ED0A 2FRYA 1UJ0A 2A36A 2LQNA 4J9IA 1RLPC 2ROTA 4DEXA 3TSWA 3EG1A 2YUPA 1X43A 2J6OA 4A63B 4CC2A 4CC3A 2YSQA 3FJ5A 2DL4A 3TSZA 4F14A 4RTYA 5IXFA 1QWFA 5GJVB 2A28A 2KRMA 2D8HA 4CC4B 3H0IA 1QLYA 1ZUYA 4RUGA 1SHFA 4HVVA 1JU5C 3I5RA 3UA7A 4HCKA 1GCPA 4Y92A 1X6GA 4GBQA 2RQTA 2DF6A 2LJ0A 2HEQA 3SHWA 2LCSA 1MV0B 1UTIA 5HCKA 4F16A 1RLQC 2MCNA 1JQQA 1AZEA 2JW4A 4RTTA 1QKWA 4J9FA 2M51A 4R0KA 4IIOA 1JO8A 2O9VA 1QKXA 2GTOA 2LJ1A 4EIKA 1N5ZA 1GCQA 2KNBB 4Z8AA 4AFUC 3UA6A 3M0UA 2E5KA 3EG3A 2C0TA 3VRYA 1E6HA 1UHFA 3PE0A 4LNPA 2YUNA 1M3CA 3EGUA 3QWXX 1BBZA 1T0HA 3O5ZA 2PZ1A 2KR3A 2EYWA 2EVRA 2FRWA 3NHNA 4J9DA 1IO6A 1AWOA 2YT6A 1YWPA 1Y0MA 2BTTA 2DLPA 2ROLA 1KJWA 2KRNA 1SPKA 2CH4W 2GBQA 1K1ZA 2KE9A 3H41A 4OMPA 1MUZA 1NM7A 1M3AA 2YUQA 2LNHB 1WFWA 2JMAA 5FW9A 4AFQC 3VS4A 1WLPB 1WXTA 3EHRA 2HBWA 2RNAA 1W1FA 3VS7A 2X3XD 1BB9A 1J3TA 1I0CA 2LQWA 2EQIA 1K0SA 2A08A 2X3WD 2ECZA 2KBTA 1H3HA 4AG1C 2JS0A 4OMMA 5IHIA 4FSSA 3NGPA 2GNCA 2OJ2A 2FPDA 2ESWA 5L23A 2B86A 1WX6A 3EG0A 1PWTA 1JEGA 4E6RA 1T3LA 1U06A 2PNIA 2L3QA 1RUWA 4OMLA 1UUEA 1AZGB 1GBQA 1AD5A 2EGAA 2HCKA 3EHQA 4RTUA 2KT1A 1S1NA 1M8MA 4JJBA 2EYYA 2JXBA 1K0XA 2D0NA 2KXCA 2J06A 2JM9A 1A0NB 2EGEA 1AWWA 2I0NA 3JV3A 3VS5A 4J9EA 4LN2A 4Z89A 1KSWA 2JTEA 4LUEA 2K6DA 1SRLA 2F2VA 3VS3A 2O31A 4KRTA 4J9BA 2OI3A 4RTVA 2YDLA 1GBRA 2NUZA 1NLPC 4LUDA 2DX1A 4GLMA 2CT3A 2F2XA 1HD3A 1LCKA 1GRIA 1PKSA 1NEGA 2DVJA 4HXJA 5IHKA 5FWBA 1YWOA 3ZL7C 2DL7A 3M0TA 1GL5A 2KYBA 2DRMA 2HDAA 3C0CA 1GCQC 2C0OA 2RMOA 2J6FA 3IQLA 1NG2A 1UFFA 1WI7A 2L3PA 1SHGA 4JJCA 1OEBA 2DMOA 2DA9A 1T0JA 2W10A 4QT7A 1NYFA 2FO0A 5IHNA 1PHTA 2J6KA 2LMJA 3EG2A 2LX7A 2EPDA 1CKBA 2MIOA 1JXOA 1B07A 2K3BA 2RN8A 4IIMA 1WYXA 2D1XA 1UECA 1AWXA 1QCFA 2DL8A 2VWFA 2AKLA 3I5SA 2MOXA 1KIKA 1UDLA 1WA7A 3H0FA 1TUCA 2EGCA 3I9QA 3M0RA 1NEBA 3ULRB 1OPLA 2LJ3A 1FYNA 2EYXA 2GGRA 2CSIA 2JM8A 5IXBA 3VRZA 3RNJA 4J9GA 2DRKA 1JXMA 2DYBA 4AFZC 4F17A 2K2MA 1H92A 1WIEA 3LH5A 1PRMC 2CUBA 1EFNA 2RQUA 1K76A 1I1JA 2DJQA 1TUDA 2RQRA 2YUOA 1AOJA 4CC7A 1UE9A 1AEYA 1M27C 4ORZA 1WXUA 4HVUA 2K9GA 3M0SA 4X1VA 2SEMA 2L2PA 2GTJA 2XMFA 2FG0A 4RTWA 2KROA 2KYMA 4WCIA 1KFZA 1UGVA 1UG1A 2G6FX 3PVLA 5GJWB 1H8KA 1OV3A 1NYGA 3KFVA 2SRCA 4M4ZA 5FWCA 2AZVA 1ZUKA 4JPBW 2F2WA 1BU1A 1K4US 2AK5A 3SEMA 1I07A 2BZ8A 4JZ3A 2GQIA 3RBBB 1VYTA 1X2QA 1YCSB 4JJDA 3THKA 1ARKA 4DEYA 2VVKA 5EC7A 4JZ4A 2EW3A 4RTZA 2EYZA 1GFDA 1PRLC 3VS1A 1ABQA 1NLOC 1Y57A 2A37A 2O88A 1FMKA 1ZBJA 2EBPA 3H0HA 1VYVA 1YN8A 1WDXA 2CREA 5IH2A 2K7AA 3M0QA 2RQWA 1K9AA 3NPFA 3A98A 2KGTA 1VA7A 1W70A 1PKTA 1TG0A 1ABOA 2DBKA 1HJDA 1ZX6A 2RQVA 3VS6A 2KT8A 1ZSGA 1UHCA 5I11A 3GBQA 2O9SA 1ZUUA 2J7IA 1M30A 2M0YA 4OMQA 2CUDA 4AFSC 1B3QA 2BZXA 2CDTA 2AZSA 2KRSA 3VS2A 4RTXA 1WXBA 3CQTA 1E7OA 1X27A 1U3OA 2JS2A 2V1QA 4D8KA 4Z88A 1AWJA 1G83A 2EKHA 2QDLA 1OPKA 3TVTA 4ZNXA 2ED1A 2V1RA 2CH4A 2HSPA 2CSQA 3M0PA 1T3SA 1Z9QA 2AKKA 2W0ZA 3I35A 1Z9ZA 2JT4A 3REAB 2FPFA 1SEMA 1QWEA 3QWYA 1AVZC 1W6XA 2C0IA 2IIMA 1X69A 2DE0X 4D8DA 2K79A 1X6BA 2DM1A 1CKAA 1PNJA 1E6GA 4OMOA 2LP5A 2P4RA 1U5SA 2RPNA 2KXDA 3PVQA 1M3BA 3NMZC 1BK2A 2H8HA 1MV3A 2DL5A 1V1CA 1YP5A 5ECAA 2BZYA 1ZLMA 1OOTA 1GFCA 2VKNA 2NWMA 2L0AA 1SRMA 2CT4A 2OAWA 4J9HA 4K11A 4AG2C
chains in the Genus database with same CATH superfamily
5GAN5 1W4SA 1YNZA 1K73C 2E5QA 3REBB 2DILA 2XHCA 1VQLA 1K9MU 4C8QD 4JRIA 5A0GA 2VB6A 4J9CA 4HVWA 1HSQA 5CKFA 1VYUA 2FEIA 2CP5A 3A8LB 1WHLA 1MMGA 2ZCFB 1PD1A 3WXMB 2O2OA 5GAOm 4LE9A 1VQ6A 1XOVA 3UWNA 1QVFA 5I22A 2NLUA 1UJ0A 2LQNA 4J9IA 3QPHA 1RLPC 3HFNA 1X43A 2J6OA 1M1KU 1B34A 4CC2A 4BB7A 2FVUA 3GIBA 3TSZA 4LDWA 1QWFA 5GAOl 4PJJA 3E2UA 4JLIA 1XQHA 2DK3A 1XNIA 2MPXC 1R0BG 3OW2A 1NJIC 4HVVA 1SG5A 3SB2A 1C0MA 2X4JA 3UA7A 4HCKA 4BE0A 4C5GA 3JCMe 1WHHA 2RHYA 5LJ3f 6AT1B 2RQTA 2DF6A 3SHWA 1MV0B 2LT4A 5GAN2 1WNLA 1IZ6A 3CCQA 4M7DC 3CCRA 4PKCC 1UGSB 1M9SA 5GAOr 4PJLA 1QKWA 4R0KA 4EMKA 1KD1C 2HAXA 3QG1A 2QI2A 4FYWB 2KVQG 4Z8AA 1VQOA 4VUBA 5LJ5g 2C0TA 1UHFA 4BY6C 1N9SA 4WTOB 3M4GA 2PUKB 1OZ3A 3FDRA 2EVRA 4J7IA 5GANe 1YITT 2BTTA 2DLPA 1QVGP 5A0DA 3OMGA 4ZTFA 1VQ7Q 1MUZA 3HL8A 1M3AA 4MZTA 4Y91A 2OTJT 2NYSA 2YUQA 2RB6A 1U1SA 1M8VA 5FW9A 4J6XA 2D9TA 1VQKA 2QDYB 1W1FA 2JZ2A 2WSCE 2OAUA 4M78F 3VS7A 1JJ2P 3L42A 2LQ8A 2ZPGB 2ECZA 3KUFA 5J26A 1H3HA 2NUTB 4QVZA 4AG1C 3CXCA 2EYQA 3EFRA 5IHIA 1LNXA 5GMKm 3JCMV 3RESA 2DXUA 3QYHB 1YJWQ 2GNCA 5L23A 1WQWA 1PWTA 1YI2Q 5DY9A 2P0PA 5D6XA 2L3QA 4M75C 4OMLA 1UUEA 1AZGB 1GBQA 1AD5A 2HCKA 4JJBA 1R0CB 3MHXA 2EYYA 1K0XA 2KXCA 2M1HA 2WSFE 1VQ8T 2HQHA 5GMKl 3RERA 2CP0A 2F5KA 2JOYA 2CZ0B 3VS5A 1UEBA 4C0DC 5L8RE 4Z89A 2JTEA 4LUEA 2OTLQ 4M7AG 2KY9A 3MPUB 1SRLA 1OU8A 1WHGA 1VQ5Q 3EFSA 2YDLA 2NUZA 4LUDA 4M7AA 3GNFB 1HD3A 1LCKA 5CAIA 1SSFA 2DVJA 3ZL7C 4X34A 4JUVA 4ATOA 3DB4A 1VQ9T 3M0TA 1GL5A 3RMQA 2D0QB 4C8QF 2EKOA 1NG2A 1WI7A 1YJNT 3TQ7P 2K2VA 2OTJA 3OBWA 2E70A 3X26B 2DA9A 1T0JA 2NUPA 3L2ZA 3JCMb 1M5Q1 1OYXA 2LMJA 4B6MA 4C5HA 1QW1A 1ZQ1A 2L5QA 2R58A 4ZGEB 3I55Q 3CCUT 1CKBA 5CQYA 5CKBA 2QGGA 1M90R 1SKUB 4ZN3A 3I5SA 4C92G 1EZZB 5GAMf 3L2UA 1G3WA 2EGCA 1B7TA 1NEBA 4C92A 2EYXA 4FL6A 1W2BA 4O5VA 3ZBDA 4BI4A 2EQJA 2LT1A 5C6SA 2LRQA 4PJOB 4AFZC 3HKSA 2K2MA 1VQ8A 3V8LA 3CPWS 4OMFB 2DD4A 2RQUA 1I1JA 4M78G 3M53A 4LDUA 2QEXT 3PIPA 2JVVA 3QZ5B 1UE9A 1OZ2A 1G5VA 4M78A 4EMHA 2GTJA 3CCJQ 3DB3A 1QMCA 2DD5A 1UGVA 2KK4A 1Y7XA 2CP6A 2XU8A 1WHMA 2ZPHB 4IUPA 2JN0A 1NYGA 1YHQQ 3MEAA 5A0LA 3SD4A 4OGCA 2PUOB 1ZUKA 1Y71A 2VV5A 2E1HA 2F2WA 1NPPA 3KBGA 1N8RR 3CCLA 3RBBB 1YCSB 2E3HA 4OB1B 3GLXA 1H3ZA 2EQKA 1Q86C 4EDUA 1M1KC 3HFOA 4E7SA 4RTZA 4LD6A 1ZA2B 4NS5A 1ABQA 4E7ZA 3QSUA 1VIEA 1RAFB 4C0GA 3A8MB 1IXDA 3CC7T 3R6OA 2P0QA 3M0QA 3JRZA 2GFUA 2EJGA 1VQPQ 2QA4Q 2RHIA 3OYAA 2DBKA 1WZOA 1ZSZA 2E3IA 2RQVA 4HCZA 2HNIA 3PNWC 1TOVA 3X25B 3CCVT 2QEXA 2M9UA 5I11A 3GBQA 1XJWB 4M7AE 3VUZA 2RJDA 3OS2A 4NOYA 3CC4Q 2PU9B 4R55A 1B3QA 2BZXA 3GF5A 2MWPA 4BUGA 1WXBA 3QDFA 3CQTA 1HYOA 1X27A 2K5FA 1Q82C 3CC2A 3SWNC 1AWJA 1G83A 2EKHA 4ZNXA 1YCYA 4FYVB 3FIFA 2ZPEB 1Z9QA 3I35A 2OX7A 4M77G 3CCET 4BI8B 2KAFA 1SEMA 3L2QA 1BKBA 1Q95G 1D09B 1W6XA 1AVZC 2C0IA 2DE0X 4C8QB 4M77A 2DETA 1KQ2A 1KD1R 1X6BA 1H641 3JCMJ 4RKUE 1VQNT 4FIBA 2P4RA 3OMCA 1G3YA 2RPNA 2E12A 3A1PA 1M3BA 8AT1B 3QIIA 3V7CA 1V1CA 2BZYA 2NWMA 3QJ6A 1LOJA 2CT4A 5GMKj 4K11A 4AG2C 4C92E 4OB3B 3EGDB 3LGFA 3CC7A 4M7AD 2JMCA 1BIAA 4XU1A 2PTKA 1UJYA 1SSHA 5IAYA 2RF0A 3FJPA 3KXTA 5LJ3h 1CSKA 4EPCA 1RI9A 2DL3A 2KEAA 2RI2A 2CP3A 2A0FB 2LZ6B 2FPEA 1KG1A 2FRYA 4M78E 2A36A 2VYTA 4DEXA 3TSWA 1RAEB 3EG1A 1SF9A 1ZBXA 4DQ2A 1I5LA 2VXEA 3BFMA 1PD0A 3FJ5A 4A4KA 2VGNA 3JCMf 3ASKA 2R5MA 3UT1A 4HT8A 2X4YA 4N4HA 2QAZA 1YIJQ 4HKEA 2FZKB 4N0AC 3CCEA 4C92D 2D6FA 5DLQE 3CEYA 1X6GA 3FB9A 4Y28E 3C12A 4ZGDB 2F1LA 2KQWA 1VQNA 2LCSA 3GNGA 5HCKA 5LJ5j 1RLQC 3OYCA 2MCNA 2A7YA 1JQQA 4FT4A 2GCXA 5CK9A 4JS5A 2O9VA 2GTOA 5GANf 3S6WA 4LDVA 4BDZA 4JRQA 2KNBB 3TU4K 4AFUC 3UA6A 1Q81C 1YJ9Q 3M0UA 1QVGA 2DTIA 3EG3A 1Y96B 3EGUA 4AT1B 4A4FA 3QWXX 2PZ1A 2KR3A 4KGVB 2EWNA 1VQ7T 2QQSA 4MDXA 1AWOA 1D1AA 4M7DF 5LJ3g 5GAOq 2ROLA 3VKIA 1P92A 2DPPB 4FU6A 2GBQA 3V7RA 1N6AA 1NM7A 2E65A 3QZ9B 2O4XA 2PVGB 3JB9G 1VQ4A 2LNHB 3DLLA 3VS4A 1WXTA 2A3LA 3OYFA 2P4TA 1KHIA 2RNAA 4C0FA 2ZAEA 2X3XD 1J3TA 1I0CA 3G71Q 3PMIA 1YJWT 2A08A 5GAN4 3OYJA 3MEWA 3N5BB 2DXCA 4C5IA 2AT1B 1NBEB 5CCAA 4OMMA 4M77E 1G3TA 2LDMA 3LYIA 2QG9B 3MEUA 4OB0B 2FPDA 3ZFJA 3EG0A 2DAQA 3G6EA 3OS0A 3NTHA 4Z02A 4JJNK 2BKDN 2YRDA 1T3LA 1RL2A 2KT1A 5HK0A 1M8MA 2OTLT 2JXBA 2D0NA 2O4XB 3PIOA 1VQ5T 2JM9A 1FX7A 2XI9A 4J9EA 3OYNA 4D6WA 2COZA 3QYGB 2K6DA 2BIVA 1I4K1 2F2VA 3VS3A 2QYZA 4J9BA 4RTVA 1NLPC 2QGFB 5GAMh 5DM7R 2F2XA 3LH0A 4OVAA 2DXTA 1GRIA 1PCXA 1PKSA 5FU7C 1KQSS 2HKQB 5HK3A 3FLGA 4M75F 1QCOA 4EMKC 1YWOA 3BW1A 2DYIA 4P5NA 3JCMc 4BD3A 1VQMQ 4KUIA 3OYDA 4PJOF 4FW2A 1Q86R 2XIDA 2ZPIB 4A54A 4BDYA 1O9SA 3EAEA 4JJCA 3I55T 1VQLQ 3HPWA 4BI3A 3VYHB 2BE7D 2K3YA 1TXQA 2LX7A 1YJWA 2NUTA 5LJ3d 1VQ6Q 4A4HA 1B07A 3LLRA 4IIMA 3C94A 2FYKA 1OX9A 5FROA 1UECA 2VWFA 2AKLA 2MOXA 1Y07A 3H0FA 2LX9A 3PFSA 3ULRB 1OPLA 1QP2A 1V76A 2LJ3A 1JJ2S 1V29B 2P84A 2XICA 3CMAQ 4J9GA 1KHCA 1JXMA 3CCST 1AT1B 3OYKA 2DZ9A 2LCLA 3OYGA 4F17A 1WIEA 1BYMA 2QK0A 2YWWA 3M5AA 2E6ZA 3LH5A 1EFNA 3BDUA 2E4HA 2Y90A 1TUDA 1Q82R 2JTFA 1RACB 2YUOA 3CCJT 4DOWA 1AEYA 4FT2A 4OGEA 4ORZA 1WXUA 4AMCA 3A5ZB 1YHQT 4RTWA 5GAOn 1K8AC 3TCJA 5GAMg 1KFZA 3CCRQ 3PVLA 3J80E 1H8KA 1OV3A 1QVFS 2AHJB 2QTXA 2ZPFB 4M7DB 1O75A 1WHKA 2FZCB 2VUBA 1VQOQ 4M7AC 3I55A 2V8JA 4J8OA 2BZ8A 4JZ3A 2EIFA 5HY6A 1VYTA 1X2QA 2MK5A 1S72Q 5D6YA 4JJDA 3DLMA 3NFCA 1ARKA 5KCOA 4DEYA 2VVKA 2E6NA 1VIFA 4E7KA 3BDLA 1GFDA 1PRLC 3VS1A 5CR2A 1NLOC 2O88A 2A37A 1OX8A 4BY6B 3LWHA 3OW2S 5FRMA 4KBMB 3H0HA 1VYVA 1YITA 1VQPT 1R77A 2QA4T 4Q5WA 4PJOG 2K7AA 4PNOA 2XG8D 2DO3A 2XD0A 2MI6A 4MMKA 2RQWA 2MMPA 3E1SA 2B8AA 1VQKQ 5KYXB 4PJOA 2RM4A 2KGTA 2RJCA 1TG0A 3CCSA 1M90U 5LJ5d 1ABOA 2YXYA 5CVIA 1ZX6A 3VS6A 4HCCA 1D0YA 2QQAA 2Z0WA 1IRXA 3MO8A 3CC4T 2H3JA 3JCMQ 3OYYA 5AYFA 4BE1A 1MHNA 2O9SA 3HSBA 1BIBA 1ZUUA 4C92C 2M0YA 3X20B 1U8RA 4AFSC 3JB9D 4L5GA 1BCOA 2GQVA 3GPLA 1U3OA 2EJ9A 2QDLA 4OF1A 3RMSA 2V1RA 4EMGA 2HSPA 4RCBA 4M75B 9ATCB 2RI5A 3JB9J 1Z9ZA 3REAB 4M78C 2FPFA 1KC8C 3NTKA 2YRCA 2QXFA 3DKMA 2IIMA 3BY7A 4C0DB 2CS7A 4JRKA 4MZMA 3CCMQ 2KMTA 2GF7A 4OMOA 3MP6A 3OB9A 1TTHB 3JCMh 3PVQA 1Q81R 4PJMA 5GAMd 4GY5A 1IGQA 1MV3A 1Q7YC 2ZPBB 3CXCS 1OOTA 2K5LA 3CBPA 5GMKe 1N8RU 2WSEE 2OAWA 4J9HA 2KSSA 1X2KA 3R6NA 1K9MC 1BI2A 1VQ9A 2G3RA 2QA4A 4OB2B 3PGGA 4IUTA 2R57A 2ENMA 4MMLA 4PL6A 4ZGJB 3UATA 1YJNA 5KYNA 3CPWP 3JB9I 5GAN7 4O6JA 3U23A 3VU3C 4ESRA 5KCHA 3RKXA 3VS0A 3QUIA 1TWBA 1G2BA 2ED0A 1K73R 5FU6C 5GANh 5KYWB 3CCUA 2C06A 4ME7A 2DL4A 4F14A 2DVEA 4RTYA 4FCYA 5IXFA 1YIJT 1ZSZC 2KRMA 2D8HA 5EG2A 3JSCA 4CC4B 3G7ZA 4C8QG 4KH0B 3FC3A 1ZUYA 4A4EA 1SHFA 1MNDA 4C8QA 1PM3A 3I5RA 3H8ZA 2HBPA 5GAN3 2RK1A 3E19A 4GBQA 2DXBA 1KK7A 3EH2A 3CMEQ 5LJ5e 2QQRA 1UTIA 4F16A 1UB4A 5KYUB 2YHTA 4DBFA 2JW4A 1YJ9T 2VC8A 5KE2A 4J6WA 2M51A 4J9FA 2BE9B 3JCMg 1NJIR 2LJ1A 5J39A 1KD1U 3EGDA 4M77C 1N5ZA 1GCQA 3EGXB 3A8HB 5LJ3j 2PQWA 2E5KA 1E6HA 4XU3A 3PE0A 4LNPA 4PJOE 2YUNA 1TU0B 3CCLQ 1W2BS 3O5ZA 5I21A 2XDDA 3I56Q 2EYWA 2V8KA 4XK8E 2FRWA 3NHNA 1IO6A 2GFAA 4FM4B 1BI3A 2JTMA 1Y0MA 2KRNA 2E64A 3X28B 1SPKA 2CH4W 3H41A 2KE9A 1ZHIA 3FRNA 1R8OB 3VJPA 4CRIA 1BCMA 3G71T 4JLGA 2JMAA 3SWNA 4AFQC 5GANg 1QCNA 3OYBA 4C0ZA 3EHRA 2HBWA 1BB9A 1K0SA 2X3WD 1UGQB 4ZTJA 4FSSA 1XTDA 1WQ7A 2JJ9A 3QDRB 5HKCA 5M9OA 1TUGB 1X01A 3NGPA 2ESWA 1WX6A 3EFOB 4LDYA 4E6RA 3CCVA 5GAN8 4PFZA 3S3MA 1RUWA 2DTHA 2HL3A 3CC2Q 1TS9A 3HP9A 1S1NA 2KDSA 4FYYB 4KULA 4ELYC 2DFUA 3RUXA 1YJ9A 2J06A 2EQMA 1A0NB 1D3BB 2EGEA 5CKDA 2I0NA 4IUQA 3SWNB 4LN2A 4FSXA 1WPYA 1RABB 2CYZB 1KSWA 1K8AR 3L2VA 1Y96A 2KI7A 3D7SB 4KRTA 2OI3A 2JUFA 1GBRA 2DX1A 4GLMA 4RCCA 1VQMT 2PVDB 3OQ5A 1OI1A 2RHZA 4HXJA 4RMOA 2XDBA 2LC4A 5IHKA 3JAME 3P8DA 2KYBA 2DRMA 1VQLT 2C0OA 2RMOA 1WJSA 5KH6A 2LCCA 4QQ6A 3QXEB 5FLXE 1OEBA 2DMOA 3V8KA 3CD6Q 4PLIA 4QT7A 4FW1A 1VQ6T 5IHNA 2FO0A 1QVPA 1PHTA 5IN1A 4M78D 2J6KA 4DBQA 1D0ZA 3S3OA 4BACA 4F7UF 2EPDA 3MP1A 1JXOA 4C8QE 4CI0C 2RN8A 1WYXA 3S3NA 2D1XA 3C4SA 1QCFA 1KIKA 1UDLA 4GLKA 2EFIA 2IPOB 3HHTB 1WA7A 3C95A 3G4SQ 5IT9E 3CMAT 3JB9H 4XTYA 1NPRA 3I9QA 3M0RA 2JM8A 1VUBA 2CZ7B 3EH1A 3INZA 2Y4YA 3VRZA 4IURA 2X51A 4B9XA 2DIGA 2ZZDA 3SDZA 3TEEA 2DYBA 3A8OB 1BI0A 1LVKA 1K76A 2JNGA 5GAMj 2RQRA 1AOJA 3OS5A 4PFOA 1M27C 2K5IA 3J7AF 4ANJA 1AHJB 1LJOA 4XAXB 3CCRT 4HVUA 3AHUA 1X75C 2ZGWA 4RG8A 2CP2A 3M0SA 1YI2T 4DA4A 2DIQA 2P0KA 3OA6A 2FB7A 2XMFA 2FG0A 2KYMA 4WCIA 3L2RA 1UG1A 2G6FX 1VQOT 1OULA 3T9NA 3KFVA 4M4ZA 4OP0A 4WF2A 3M59A 1I5OB 4B9WA 4QW2A 5FWCA 2AZVA 3RR6A 3HTRA 1S72T 4JPBW 2L3RA 2QQ9A 1BU1A 1K4US 2DEQA 3WVDB 3ER0A 1Q7YR 3SEMA 2XDPA 1C6VX 3X24B 3THKA 2X35A 1K9MR 2M02A 1Q86U 2EYZA 3BE3A 3FEOA 2L8DA 1FMKA 5KYYB 1ZBJA 3EG9B 2EBPA 3QBYA 1VQ7A 1EX4A 4LD9K 3CMAA 1YN8A 2ATCB 1VQKT 1FXXA 1VQ4Q 2CREA 4HCBA 4M7AF 2DTOA 4L6V5 2CGHA 2HZYA 3NPFA 2CZ6B 4UC4A 1M1KR 4M77D 4RG2A 2XKOC 2LVMA 1M1FA 1IGUA 4XU0A 4TVRA 1ZSGA 1QQJA 1RI0A 1UHCA 4F7UG 1QVGS 2Y4XA 2HD0A 5GAN6 2J7IA 3CPFA 1EIFA 2CUDA 2RHUA 2HMAA 3G6EQ 4F7UA 1KQSP 2CDTA 3P8HA 1YI2A 1B34B 1D1CA 2AZSA 4KGXB 3VYGA 4HA8A 1E7OA 2JS2A 2V1QA 4D8KA 3L2WA 2DJZA 4M7DG 2K57A 1OPKA 3TVTA 1M2VA 1Q82U 2CH4A 1HXDA 4M7DA 4XU2A 3CCMT 4V2SA 3M0PA 1T3SA 2K3XA 2JT4A 4NL3A 4KGZB 3E9GA 1S72A 2OTLA 3QWYA 3E9FA 2QASA 2V8IA 1X69A 1VQ5A 3CBMA 4C92F 2CP7A 1OQKA 4X9CA 4YTLA 1RAHB 1IB8A 2DM1A 1CKAA 1PNJA 1E6GA 1U1TA 5J3BA 4E47A 3H9NA 1U5SA 3F70A 4DOVA 3SFMA 2KXDA 4JRPA 2H8HA 3V8JA 2X9HA 5ECAA 1ZLMA 4PJNA 5CO7A 5FU7B 4F7UB 3MEVA 3CPWA 3ME9A 3M57A 5I2SA 4EMKB 3WVEB 1SRMA 4EIKA 3CCQQ 4KUDK 1IHWA 4MZPA 4IKFA 3UF4A 4OMNA 1M2VB 5LL6S 2F69A 5KYXA 2DBMA 2RA2A 1LPLA 1RAAB 5AT1B 1WJRA 3PT9A 2J05A 3P8BB 3CBOA 1WJQA 1PSFA 2LTOA 2ABLA 2L3SA 2D8JA 4QVDA 2DNUA 2ROTA 2YUPA 2IG0A 4A63B 5A2QE 4CC3A 3M58A 4C5EA 1NZ9A 1PG5B 2YSQA 4E7IA 4PJOC 1KQ1A 4MDWA 4N4IA 2XK0A 4LXCA 4M75G 5GJVB 3V7SA 2A28A 1QVFP 4M75A 5LJ5f 3H0IA 1QLYA 4J5YA 3CCMA 2RJFA 4RUGA 2DEUA 3CMET 1JU5C 1GCPA 4Y92A 4LDXA 3JCMX 2LJ0A 2HEQA 3OBYA 4E7LA 3CCJA 1I8FA 3RKWA 3OW2P 1AZEA 3LW5E 3MJXA 1YBYA 4RTTA 3ZEHA 4IIOA 3META 1JO8A 1QKXA 1YHQA 3CCLT 4XTWA 5LJ3e 3I56T 3VRYA 3QJYA 1Q81U 3OY9A 1M3CA 2DZCA 2HQXA 1BBZA 1T0HA 4M7AB 4QQGA 4J9DA 2YT6A 1YWPA 5GANj 2RD1A 1KJWA 2F5TX 2RJEA 2DKGA 5KYWA 1K1ZA 4OMPA 4QQDA 4F7UE 1YITQ 3OYMA 4M77F 4PK4A 5CIUA 5C0MA 1WFWA 2EQUA 4IUUA 1WLPB 1WGSA 3M54A 2HQEA 4DBRA 2NUPB 1VQPA 2OTJQ 4M7DE 3CCSQ 2LQWA 5CQXA 2EQIA 1K73U 1FWZA 2KBTA 4N4GA 1D0XA 3M55A 2JS0A 3RDVA 3A8GB 3OYHA 3CMEA 3CC2T 2VASA 2OJ2A 2B86A 3CC4A 2QTVA 1JEGA 2YLBA 1U06A 2PNIA 4C92B 5KYUA 1RAIB 2IVWA 4RTUA 3EHQA 2EGAA 3JCMP 3CXCP 2H3EB 4C8QC 1AWWA 3JV3A 2HL5C 3EGXA 4XQ3A 2COWA 4XTVA 3H6ZA 3I56A 4A4GA 2V26A 1RAGB 1VQ8Q 3M56A 2O31A 2RHXA 2HSEB 2CT3A 2RK2A 4M78B 2MWOA 2MF2A 1VOMA 1NJIU 1NEGA 5FWBA 2FHDA 2DL7A 4M7DD 2L89A 3RKYA 1MMDA 5I2MA 1I81A 2DERA 2HDAA 3C0CA 4BE2A 1GCQC 3CD6T 2J6FA 2O01E 4ELZC 3IQLA 3NTIA 3J81E 1TSFA 1UFFA 2L3PA 3QO3A 4XTUA 1VQ9Q 1SHGA 2PVOB 1G3SA 2E41A 2YRVA 2I2LA 2W10A 3LGLA 1NYFA 4M75E 1YJNQ 3OS1A 4FYXB 3RIRA 3EG2A 7AT1B 3LWIA 3G4ST 1ZA1B 2MIOA 4J6YA 1MNEA 1ACMB 2K3BA 4II1A 3L1AA 1UGPB 5FRNA 1FMWA 1AWXA 1N9RA 2DL8A 2X4WA 3HRUA 3EFOA 4PLLA 1TUCA 2RO0A 5GMKi 3CCUQ 5CKEA 4JS4A 1FYNA 2GGRA 2R5AA 2CSIA 2RH2A 5IXBA 5FU6B 2X4XA 3RNJA 4XTZA 5CKHA 2DRKA 4L59A 2COYA 1UGRB 1D3BA 5D7UA 3PMTA 1H92A 1PRMC 2CUBA 1ZSZB 1YIJA 5GAMe 3OYEA 2DJQA 4PFPA 4CC7A 1X6OA 1W2BP 2K4YA 1MMNA 2K9GA 3O8VA 3JB9F 4X1VA 2SEMA 2L2PA 2QEXQ 1D1BA 1JBMA 1NE8A 2KROA 4M75D 3MCAB 2FL7A 1K8AU 1PSEA 5GJWB 2FZGB 4PJOD 3M4YA 2SRCA 3CD6A 4E7HA 4F04B 1TH7A 3JCMW 3OYIA 1C1AA 1WHJA 2AK5A 3Q1JA 5KE3A 3MKDA 1I07A 4M77B 1PC0A 2GQIA 3UDCA 4J7FA 2QQBA 5EC7A 3AT1B 4JZ4A 1MMAA 1IREB 1M1GA 2EW3A 3G4SA 2CZ1B 1VQ4T 1Y57A 1BI1A 4DBHA 1M4ZA 1RADB 1M2OA 3G1JA 1WDXA 3HRSA 2AIRB 4R56A 3LX7A 1DJ7B 5IH2A 1QP3A 3JCMd 1JB0E 4ZN1A 5GMKh 4IUVA 1K9AA 1OU9A 2HKNA 1M90C 3A98A 3GP8A 1VA7A 1YFNA 1W70A 1PKTA 1FMVA 3G71A 1KQSA 3CC7Q 4KH1B 3OYLA 1HJDA 2KT8A 3G6ET 3URGA 2CKKA 5GAOp 4X9DA 8ATCB 4QVCA 3UPUA 2M0OA 1M30A 4N0AA 4E7JA 4OMQA 2BUDA 1JRIA 2MYSA 1G8XA 2EJFA 3GOXA 3CCVQ 2M16A 2KRSA 3VS2A 2E10A 4RTXA 3QKJA 1N27A 2LNVA 4Z88A 3MP8A 2ED1A 4J83A 2VXFA 5GANd 3M9QA 3HRTA 2CSQA 2AKKA 3QHSA 2W0ZA 3VV0A 1GXIE 2MAMA 4KT0E 1QWEA 1MGQA 4QKUA 3PTAA 1KC8U 2EAYA 2WACA 4D8DA 2K79A 2YLCA 2LQKA 3CCEQ 2LP5A 3VUBA 5DLOA 1JJ2A 4JDSA 4A53A 4XTXA 4NL2A 3CCQT 4E2FB 2VGMA 3NMZC 1BK2A 5KYYA 1F1BB 3TREA 2DL5A 4HT9A 3EG9A 1IHVA 1HK9A 1YP5A 2RI3A 1VQMA 1VQNQ 1N8RC 5D6WA 1Q7YU 1GFCA 2VKNA 5LJ5h 1KC8R 3OSSC 2L0AA 3OSVA
chains in the Genus database with same CATH topology
1X2KA 1YNZA 3R6NA 3UF4A 3REBB 2DILA 4OMNA 2JMCA 2PTKA 2ENMA 2DBMA 1UJYA 1SSHA 2RF0A 4J9CA 4HVWA 1CSKA 3UATA 1HSQA 1RI9A 1VYUA 2J05A 2FEIA 2DL3A 2KEAA 3U23A 4ESRA 2ABLA 2L3SA 2D8JA 2O2OA 2LZ6B 4LE9A 3VS0A 2FPEA 1XOVA 1G2BA 2DNUA 5I22A 2ED0A 2FRYA 1UJ0A 2A36A 2LQNA 4J9IA 1RLPC 2ROTA 4DEXA 3TSWA 3EG1A 2YUPA 1X43A 2J6OA 4A63B 4CC2A 4CC3A 2YSQA 3FJ5A 2DL4A 3TSZA 4F14A 4RTYA 5IXFA 1QWFA 5GJVB 2A28A 2KRMA 2D8HA 4CC4B 3H0IA 1QLYA 1ZUYA 4RUGA 1SHFA 4HVVA 1JU5C 3I5RA 3UA7A 4HCKA 1GCPA 4Y92A 1X6GA 4GBQA 2RQTA 2DF6A 2LJ0A 2HEQA 3SHWA 2LCSA 1MV0B 1UTIA 5HCKA 4F16A 1RLQC 2MCNA 1JQQA 1AZEA 2JW4A 4RTTA 1QKWA 4J9FA 2M51A 4R0KA 4IIOA 1JO8A 2O9VA 1QKXA 2GTOA 2LJ1A 4EIKA 1N5ZA 1GCQA 2KNBB 4Z8AA 4AFUC 3UA6A 3M0UA 2E5KA 3EG3A 2C0TA 3VRYA 1E6HA 1UHFA 3PE0A 4LNPA 2YUNA 1M3CA 3EGUA 3QWXX 1BBZA 1T0HA 3O5ZA 2PZ1A 2KR3A 2EYWA 2EVRA 2FRWA 3NHNA 4J9DA 1IO6A 1AWOA 2YT6A 1YWPA 1Y0MA 2BTTA 2DLPA 2ROLA 1KJWA 2KRNA 1SPKA 2CH4W 2GBQA 1K1ZA 2KE9A 3H41A 4OMPA 1MUZA 1NM7A 1M3AA 2YUQA 2LNHB 1WFWA 2JMAA 5FW9A 4AFQC 3VS4A 1WLPB 1WXTA 3EHRA 2HBWA 2RNAA 1W1FA 3VS7A 2X3XD 1BB9A 1J3TA 1I0CA 2LQWA 2EQIA 1K0SA 2A08A 2X3WD 2ECZA 2KBTA 1H3HA 4AG1C 2JS0A 4OMMA 5IHIA 4FSSA 3NGPA 2GNCA 2OJ2A 2FPDA 2ESWA 5L23A 2B86A 1WX6A 3EG0A 1PWTA 1JEGA 4E6RA 1T3LA 1U06A 2PNIA 2L3QA 1RUWA 4OMLA 1UUEA 1AZGB 1GBQA 1AD5A 2EGAA 2HCKA 3EHQA 4RTUA 2KT1A 1S1NA 1M8MA 4JJBA 2EYYA 2JXBA 1K0XA 2D0NA 2KXCA 2J06A 2JM9A 1A0NB 2EGEA 1AWWA 2I0NA 3JV3A 3VS5A 4J9EA 4LN2A 4Z89A 1KSWA 2JTEA 4LUEA 2K6DA 1SRLA 2F2VA 3VS3A 2O31A 4KRTA 4J9BA 2OI3A 4RTVA 2YDLA 1GBRA 2NUZA 1NLPC 4LUDA 2DX1A 4GLMA 2CT3A 2F2XA 1HD3A 1LCKA 1GRIA 1PKSA 1NEGA 2DVJA 4HXJA 5IHKA 5FWBA 1YWOA 3ZL7C 2DL7A 3M0TA 1GL5A 2KYBA 2DRMA 2HDAA 3C0CA 1GCQC 2C0OA 2RMOA 2J6FA 3IQLA 1NG2A 1UFFA 1WI7A 2L3PA 1SHGA 4JJCA 1OEBA 2DMOA 2DA9A 1T0JA 2W10A 4QT7A 1NYFA 2FO0A 5IHNA 1PHTA 2J6KA 2LMJA 3EG2A 2LX7A 2EPDA 1CKBA 2MIOA 1JXOA 1B07A 2K3BA 2RN8A 4IIMA 1WYXA 2D1XA 1UECA 1AWXA 1QCFA 2DL8A 2VWFA 2AKLA 3I5SA 2MOXA 1KIKA 1UDLA 1WA7A 3H0FA 1TUCA 2EGCA 3I9QA 3M0RA 1NEBA 3ULRB 1OPLA 2LJ3A 1FYNA 2EYXA 2GGRA 2CSIA 2JM8A 5IXBA 3VRZA 3RNJA 4J9GA 2DRKA 1JXMA 2DYBA 4AFZC 4F17A 2K2MA 1H92A 1WIEA 3LH5A 1PRMC 2CUBA 1EFNA 2RQUA 1K76A 1I1JA 2DJQA 1TUDA 2RQRA 2YUOA 1AOJA 4CC7A 1UE9A 1AEYA 1M27C 4ORZA 1WXUA 4HVUA 2K9GA 3M0SA 4X1VA 2SEMA 2L2PA 2GTJA 2XMFA 2FG0A 4RTWA 2KROA 2KYMA 4WCIA 1KFZA 1UGVA 1UG1A 2G6FX 3PVLA 5GJWB 1H8KA 1OV3A 1NYGA 3KFVA 2SRCA 4M4ZA 5FWCA 2AZVA 1ZUKA 4JPBW 2F2WA 1BU1A 1K4US 2AK5A 3SEMA 1I07A 2BZ8A 4JZ3A 2GQIA 3RBBB 1VYTA 1X2QA 1YCSB 4JJDA 3THKA 1ARKA 4DEYA 2VVKA 5EC7A 4JZ4A 2EW3A 4RTZA 2EYZA 1GFDA 1PRLC 3VS1A 1ABQA 1NLOC 1Y57A 2A37A 2O88A 1FMKA 1ZBJA 2EBPA 3H0HA 1VYVA 1YN8A 1WDXA 2CREA 5IH2A 2K7AA 3M0QA 2RQWA 1K9AA 3NPFA 3A98A 2KGTA 1VA7A 1W70A 1PKTA 1TG0A 1ABOA 2DBKA 1HJDA 1ZX6A 2RQVA 3VS6A 2KT8A 1ZSGA 1UHCA 5I11A 3GBQA 2O9SA 1ZUUA 2J7IA 1M30A 2M0YA 4OMQA 2CUDA 4AFSC 1B3QA 2BZXA 2CDTA 2AZSA 2KRSA 3VS2A 4RTXA 1WXBA 3CQTA 1E7OA 1X27A 1U3OA 2JS2A 2V1QA 4D8KA 4Z88A 1AWJA 1G83A 2EKHA 2QDLA 1OPKA 3TVTA 4ZNXA 2ED1A 2V1RA 2CH4A 2HSPA 2CSQA 3M0PA 1T3SA 1Z9QA 2AKKA 2W0ZA 3I35A 1Z9ZA 2JT4A 3REAB 2FPFA 1SEMA 1QWEA 3QWYA 1AVZC 1W6XA 2C0IA 2IIMA 1X69A 2DE0X 4D8DA 2K79A 1X6BA 2DM1A 1CKAA 1PNJA 1E6GA 4OMOA 2LP5A 2P4RA 1U5SA 2RPNA 2KXDA 3PVQA 1M3BA 3NMZC 1BK2A 2H8HA 1MV3A 2DL5A 1V1CA 1YP5A 5ECAA 2BZYA 1ZLMA 1OOTA 1GFCA 2VKNA 2NWMA 2L0AA 1SRMA 2CT4A 2OAWA 4J9HA 4K11A 4AG2C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X2K A;  1YNZ A;  3R6N A;  3UF4 A;  3REB B;  2DIL A;  4OMN A;  2JMC A;  2PTK A;  2ENM A;  2DBM A;  1UJY A;  1SSH A;  2RF0 A;  4J9C A;  4HVW A;  1CSK A;  3UAT A;  1HSQ A;  1RI9 A;  1VYU A;  2J05 A;  2FEI A;  2DL3 A;  2KEA A;  3U23 A;  4ESR A;  2ABL A;  2L3S A;  2D8J A;  2O2O A;  2LZ6 B;  4LE9 A;  3VS0 A;  2FPE A;  1XOV A;  1G2B A;  2DNU A;  5I22 A;  2ED0 A;  2FRY A;  1UJ0 A;  2A36 A;  2LQN A;  4J9I A;  1RLP C;  2ROT A;  4DEX A;  3TSW A;  3EG1 A;  2YUP A;  1X43 A;  2J6O A;  4A63 B;  4CC2 A;  4CC3 A;  2YSQ A;  3FJ5 A;  2DL4 A;  3TSZ A;  4F14 A;  4RTY A;  5IXF A;  1QWF A;  5GJV B;  2A28 A;  2KRM A;  2D8H A;  4CC4 B;  3H0I A;  1QLY A;  1ZUY A;  4RUG A;  1SHF A;  4HVV A;  1JU5 C;  3I5R A;  3UA7 A;  4HCK A;  1GCP A;  4Y92 A;  1X6G A;  4GBQ A;  2RQT A;  2DF6 A;  2LJ0 A;  2HEQ A;  3SHW A;  2LCS A;  1MV0 B;  1UTI A;  5HCK A;  4F16 A;  1RLQ C;  2MCN A;  1JQQ A;  1AZE A;  2JW4 A;  4RTT A;  1QKW A;  4J9F A;  2M51 A;  4R0K A;  4IIO A;  1JO8 A;  2O9V A;  1QKX A;  2GTO A;  2LJ1 A;  4EIK A;  1N5Z A;  1GCQ A;  2KNB B;  4Z8A A;  4AFU C;  3UA6 A;  3M0U A;  2E5K A;  3EG3 A;  2C0T A;  3VRY A;  1E6H A;  1UHF A;  3PE0 A;  4LNP A;  2YUN A;  1M3C A;  3EGU A;  3QWX X;  1BBZ A;  1T0H A;  3O5Z A;  2PZ1 A;  2KR3 A;  2EYW A;  2EVR A;  2FRW A;  3NHN A;  4J9D A;  1IO6 A;  1AWO A;  2YT6 A;  1YWP A;  1Y0M A;  2BTT A;  2DLP A;  2ROL A;  1KJW A;  2KRN A;  1SPK A;  2CH4 W;  2GBQ A;  1K1Z A;  2KE9 A;  3H41 A;  4OMP A;  1MUZ A;  1NM7 A;  1M3A A;  2YUQ A;  2LNH B;  1WFW A;  2JMA A;  5FW9 A;  4AFQ C;  3VS4 A;  1WLP B;  1WXT A;  3EHR A;  2HBW A;  2RNA A;  1W1F A;  3VS7 A;  2X3X D;  1BB9 A;  1J3T A;  1I0C A;  2LQW A;  2EQI A;  1K0S A;  2A08 A;  2X3W D;  2ECZ A;  2KBT A;  1H3H A;  4AG1 C;  2JS0 A;  4OMM A;  5IHI A;  4FSS A;  3NGP A;  2GNC A;  2OJ2 A;  2FPD A;  2ESW A;  5L23 A;  2B86 A;  1WX6 A;  3EG0 A;  1PWT A;  1JEG A;  4E6R A;  1T3L A;  1U06 A;  2PNI A;  2L3Q A;  1RUW A;  4OML A;  1UUE A;  1AZG B;  1GBQ A;  1AD5 A;  2EGA A;  2HCK A;  3EHQ A;  4RTU A;  2KT1 A;  1S1N A;  1M8M A;  4JJB A;  2EYY A;  2JXB A;  1K0X A;  2D0N A;  2KXC A;  2J06 A;  2JM9 A;  1A0N B;  2EGE A;  1AWW A;  2I0N A;  3JV3 A;  3VS5 A;  4J9E A;  4LN2 A;  4Z89 A;  1KSW A;  2JTE A;  4LUE A;  2K6D A;  1SRL A;  2F2V A;  3VS3 A;  2O31 A;  4KRT A;  4J9B A;  2OI3 A;  4RTV A;  2YDL A;  1GBR A;  2NUZ A;  1NLP C;  4LUD A;  2DX1 A;  4GLM A;  2CT3 A;  2F2X A;  1HD3 A;  1LCK A;  1GRI A;  1PKS A;  1NEG A;  2DVJ A;  4HXJ A;  5IHK A;  5FWB A;  1YWO A;  3ZL7 C;  2DL7 A;  3M0T A;  1GL5 A;  2KYB A;  2DRM A;  2HDA A;  3C0C A;  1GCQ C;  2C0O A;  2RMO A;  2J6F A;  3IQL A;  1NG2 A;  1UFF A;  1WI7 A;  2L3P A;  1SHG A;  4JJC A;  1OEB A;  2DMO A;  2DA9 A;  1T0J A;  2W10 A;  4QT7 A;  1NYF A;  2FO0 A;  5IHN A;  1PHT A;  2J6K A;  2LMJ A;  3EG2 A;  2LX7 A;  2EPD A;  1CKB A;  2MIO A;  1JXO A;  1B07 A;  2K3B A;  2RN8 A;  4IIM A;  1WYX A;  2D1X A;  1UEC A;  1AWX A;  1QCF A;  2DL8 A;  2VWF A;  2AKL A;  3I5S A;  2MOX A;  1KIK A;  1UDL A;  1WA7 A;  3H0F A;  1TUC A;  2EGC A;  3I9Q A;  3M0R A;  1NEB A;  3ULR B;  1OPL A;  2LJ3 A;  1FYN A;  2EYX A;  2GGR A;  2CSI A;  2JM8 A;  5IXB A;  3VRZ A;  3RNJ A;  4J9G A;  2DRK A;  1JXM A;  2DYB A;  4AFZ C;  4F17 A;  2K2M A;  1H92 A;  1WIE A;  3LH5 A;  1PRM C;  2CUB A;  1EFN A;  2RQU A;  1K76 A;  1I1J A;  2DJQ A;  1TUD A;  2RQR A;  2YUO A;  1AOJ A;  4CC7 A;  1UE9 A;  1AEY A;  1M27 C;  4ORZ A;  1WXU A;  4HVU A;  2K9G A;  3M0S A;  4X1V A;  2SEM A;  2L2P A;  2GTJ A;  2XMF A;  2FG0 A;  4RTW A;  2KRO A;  2KYM A;  4WCI A;  1KFZ A;  1UGV A;  1UG1 A;  2G6F X;  3PVL A;  5GJW B;  1H8K A;  1OV3 A;  1NYG A;  3KFV A;  2SRC A;  4M4Z A;  5FWC A;  2AZV A;  1ZUK A;  4JPB W;  2F2W A;  1BU1 A;  1K4U S;  2AK5 A;  3SEM A;  1I07 A;  2BZ8 A;  4JZ3 A;  2GQI A;  3RBB B;  1VYT A;  1X2Q A;  1YCS B;  4JJD A;  3THK A;  1ARK A;  4DEY A;  2VVK A;  5EC7 A;  4JZ4 A;  2EW3 A;  4RTZ A;  2EYZ A;  1GFD A;  1PRL C;  3VS1 A;  1ABQ A;  1NLO C;  1Y57 A;  2A37 A;  2O88 A;  1FMK A;  1ZBJ A;  2EBP A;  3H0H A;  1VYV A;  1YN8 A;  1WDX A;  2CRE A;  5IH2 A;  2K7A A;  3M0Q A;  2RQW A;  1K9A A;  3NPF A;  3A98 A;  2KGT A;  1VA7 A;  1W70 A;  1PKT A;  1TG0 A;  1ABO A;  2DBK A;  1HJD A;  1ZX6 A;  2RQV A;  3VS6 A;  2KT8 A;  1ZSG A;  1UHC A;  5I11 A;  3GBQ A;  2O9S A;  1ZUU A;  2J7I A;  1M30 A;  2M0Y A;  4OMQ A;  2CUD A;  4AFS C;  1B3Q A;  2BZX A;  2CDT A;  2AZS A;  2KRS A;  3VS2 A;  4RTX A;  1WXB A;  3CQT A;  1E7O A;  1X27 A;  1U3O A;  2JS2 A;  2V1Q A;  4D8K A;  4Z88 A;  1AWJ A;  1G83 A;  2EKH A;  2QDL A;  1OPK A;  3TVT A;  4ZNX A;  2ED1 A;  2V1R A;  2CH4 A;  2HSP A;  2CSQ A;  3M0P A;  1T3S A;  1Z9Q A;  2AKK A;  2W0Z A;  3I35 A;  1Z9Z A;  2JT4 A;  3REA B;  2FPF A;  1SEM A;  1QWE A;  3QWY A;  1AVZ C;  1W6X A;  2C0I A;  2IIM A;  1X69 A;  2DE0 X;  4D8D A;  2K79 A;  1X6B A;  2DM1 A;  1CKA A;  1PNJ A;  1E6G A;  4OMO A;  2LP5 A;  2P4R A;  1U5S A;  2RPN A;  2KXD A;  3PVQ A;  1M3B A;  3NMZ C;  1BK2 A;  2H8H A;  1MV3 A;  2DL5 A;  1V1C A;  1YP5 A;  5ECA A;  2BZY A;  1ZLM A;  1OOT A;  1GFC A;  2VKN A;  2NWM A;  2L0A A;  1SRM A;  2CT4 A;  2OAW A;  4J9H A;  4K11 A;  4AG2 C; 
#chains in the Genus database with same CATH topology
 5GAN 5;  1W4S A;  1YNZ A;  1K73 C;  2E5Q A;  3REB B;  2DIL A;  2XHC A;  1VQL A;  1K9M U;  4C8Q D;  4JRI A;  5A0G A;  2VB6 A;  4J9C A;  4HVW A;  1HSQ A;  5CKF A;  1VYU A;  2FEI A;  2CP5 A;  3A8L B;  1WHL A;  1MMG A;  2ZCF B;  1PD1 A;  3WXM B;  2O2O A;  5GAO m;  4LE9 A;  1VQ6 A;  1XOV A;  3UWN A;  1QVF A;  5I22 A;  2NLU A;  1UJ0 A;  2LQN A;  4J9I A;  3QPH A;  1RLP C;  3HFN A;  1X43 A;  2J6O A;  1M1K U;  1B34 A;  4CC2 A;  4BB7 A;  2FVU A;  3GIB A;  3TSZ A;  4LDW A;  1QWF A;  5GAO l;  4PJJ A;  3E2U A;  4JLI A;  1XQH A;  2DK3 A;  1XNI A;  2MPX C;  1R0B G;  3OW2 A;  1NJI C;  4HVV A;  1SG5 A;  3SB2 A;  1C0M A;  2X4J A;  3UA7 A;  4HCK A;  4BE0 A;  4C5G A;  3JCM e;  1WHH A;  2RHY A;  5LJ3 f;  6AT1 B;  2RQT A;  2DF6 A;  3SHW A;  1MV0 B;  2LT4 A;  5GAN 2;  1WNL A;  1IZ6 A;  3CCQ A;  4M7D C;  3CCR A;  4PKC C;  1UGS B;  1M9S A;  5GAO r;  4PJL A;  1QKW A;  4R0K A;  4EMK A;  1KD1 C;  2HAX A;  3QG1 A;  2QI2 A;  4FYW B;  2KVQ G;  4Z8A A;  1VQO A;  4VUB A;  5LJ5 g;  2C0T A;  1UHF A;  4BY6 C;  1N9S A;  4WTO B;  3M4G A;  2PUK B;  1OZ3 A;  3FDR A;  2EVR A;  4J7I A;  5GAN e;  1YIT T;  2BTT A;  2DLP A;  1QVG P;  5A0D A;  3OMG A;  4ZTF A;  1VQ7 Q;  1MUZ A;  3HL8 A;  1M3A A;  4MZT A;  4Y91 A;  2OTJ T;  2NYS A;  2YUQ A;  2RB6 A;  1U1S A;  1M8V A;  5FW9 A;  4J6X A;  2D9T A;  1VQK A;  2QDY B;  1W1F A;  2JZ2 A;  2WSC E;  2OAU A;  4M78 F;  3VS7 A;  1JJ2 P;  3L42 A;  2LQ8 A;  2ZPG B;  2ECZ A;  3KUF A;  5J26 A;  1H3H A;  2NUT B;  4QVZ A;  4AG1 C;  3CXC A;  2EYQ A;  3EFR A;  5IHI A;  1LNX A;  5GMK m;  3JCM V;  3RES A;  2DXU A;  3QYH B;  1YJW Q;  2GNC A;  5L23 A;  1WQW A;  1PWT A;  1YI2 Q;  5DY9 A;  2P0P A;  5D6X A;  2L3Q A;  4M75 C;  4OML A;  1UUE A;  1AZG B;  1GBQ A;  1AD5 A;  2HCK A;  4JJB A;  1R0C B;  3MHX A;  2EYY A;  1K0X A;  2KXC A;  2M1H A;  2WSF E;  1VQ8 T;  2HQH A;  5GMK l;  3RER A;  2CP0 A;  2F5K A;  2JOY A;  2CZ0 B;  3VS5 A;  1UEB A;  4C0D C;  5L8R E;  4Z89 A;  2JTE A;  4LUE A;  2OTL Q;  4M7A G;  2KY9 A;  3MPU B;  1SRL A;  1OU8 A;  1WHG A;  1VQ5 Q;  3EFS A;  2YDL A;  2NUZ A;  4LUD A;  4M7A A;  3GNF B;  1HD3 A;  1LCK A;  5CAI A;  1SSF A;  2DVJ A;  3ZL7 C;  4X34 A;  4JUV A;  4ATO A;  3DB4 A;  1VQ9 T;  3M0T A;  1GL5 A;  3RMQ A;  2D0Q B;  4C8Q F;  2EKO A;  1NG2 A;  1WI7 A;  1YJN T;  3TQ7 P;  2K2V A;  2OTJ A;  3OBW A;  2E70 A;  3X26 B;  2DA9 A;  1T0J A;  2NUP A;  3L2Z A;  3JCM b;  1M5Q 1;  1OYX A;  2LMJ A;  4B6M A;  4C5H A;  1QW1 A;  1ZQ1 A;  2L5Q A;  2R58 A;  4ZGE B;  3I55 Q;  3CCU T;  1CKB A;  5CQY A;  5CKB A;  2QGG A;  1M90 R;  1SKU B;  4ZN3 A;  3I5S A;  4C92 G;  1EZZ B;  5GAM f;  3L2U A;  1G3W A;  2EGC A;  1B7T A;  1NEB A;  4C92 A;  2EYX A;  4FL6 A;  1W2B A;  4O5V A;  3ZBD A;  4BI4 A;  2EQJ A;  2LT1 A;  5C6S A;  2LRQ A;  4PJO B;  4AFZ C;  3HKS A;  2K2M A;  1VQ8 A;  3V8L A;  3CPW S;  4OMF B;  2DD4 A;  2RQU A;  1I1J A;  4M78 G;  3M53 A;  4LDU A;  2QEX T;  3PIP A;  2JVV A;  3QZ5 B;  1UE9 A;  1OZ2 A;  1G5V A;  4M78 A;  4EMH A;  2GTJ A;  3CCJ Q;  3DB3 A;  1QMC A;  2DD5 A;  1UGV A;  2KK4 A;  1Y7X A;  2CP6 A;  2XU8 A;  1WHM A;  2ZPH B;  4IUP A;  2JN0 A;  1NYG A;  1YHQ Q;  3MEA A;  5A0L A;  3SD4 A;  4OGC A;  2PUO B;  1ZUK A;  1Y71 A;  2VV5 A;  2E1H A;  2F2W A;  1NPP A;  3KBG A;  1N8R R;  3CCL A;  3RBB B;  1YCS B;  2E3H A;  4OB1 B;  3GLX A;  1H3Z A;  2EQK A;  1Q86 C;  4EDU A;  1M1K C;  3HFO A;  4E7S A;  4RTZ A;  4LD6 A;  1ZA2 B;  4NS5 A;  1ABQ A;  4E7Z A;  3QSU A;  1VIE A;  1RAF B;  4C0G A;  3A8M B;  1IXD A;  3CC7 T;  3R6O A;  2P0Q A;  3M0Q A;  3JRZ A;  2GFU A;  2EJG A;  1VQP Q;  2QA4 Q;  2RHI A;  3OYA A;  2DBK A;  1WZO A;  1ZSZ A;  2E3I A;  2RQV A;  4HCZ A;  2HNI A;  3PNW C;  1TOV A;  3X25 B;  3CCV T;  2QEX A;  2M9U A;  5I11 A;  3GBQ A;  1XJW B;  4M7A E;  3VUZ A;  2RJD A;  3OS2 A;  4NOY A;  3CC4 Q;  2PU9 B;  4R55 A;  1B3Q A;  2BZX A;  3GF5 A;  2MWP A;  4BUG A;  1WXB A;  3QDF A;  3CQT A;  1HYO A;  1X27 A;  2K5F A;  1Q82 C;  3CC2 A;  3SWN C;  1AWJ A;  1G83 A;  2EKH A;  4ZNX A;  1YCY A;  4FYV B;  3FIF A;  2ZPE B;  1Z9Q A;  3I35 A;  2OX7 A;  4M77 G;  3CCE T;  4BI8 B;  2KAF A;  1SEM A;  3L2Q A;  1BKB A;  1Q95 G;  1D09 B;  1W6X A;  1AVZ C;  2C0I A;  2DE0 X;  4C8Q B;  4M77 A;  2DET A;  1KQ2 A;  1KD1 R;  1X6B A;  1H64 1;  3JCM J;  4RKU E;  1VQN T;  4FIB A;  2P4R A;  3OMC A;  1G3Y A;  2RPN A;  2E12 A;  3A1P A;  1M3B A;  8AT1 B;  3QII A;  3V7C A;  1V1C A;  2BZY A;  2NWM A;  3QJ6 A;  1LOJ A;  2CT4 A;  5GMK j;  4K11 A;  4AG2 C;  4C92 E;  4OB3 B;  3EGD B;  3LGF A;  3CC7 A;  4M7A D;  2JMC A;  1BIA A;  4XU1 A;  2PTK A;  1UJY A;  1SSH A;  5IAY A;  2RF0 A;  3FJP A;  3KXT A;  5LJ3 h;  1CSK A;  4EPC A;  1RI9 A;  2DL3 A;  2KEA A;  2RI2 A;  2CP3 A;  2A0F B;  2LZ6 B;  2FPE A;  1KG1 A;  2FRY A;  4M78 E;  2A36 A;  2VYT A;  4DEX A;  3TSW A;  1RAE B;  3EG1 A;  1SF9 A;  1ZBX A;  4DQ2 A;  1I5L A;  2VXE A;  3BFM A;  1PD0 A;  3FJ5 A;  4A4K A;  2VGN A;  3JCM f;  3ASK A;  2R5M A;  3UT1 A;  4HT8 A;  2X4Y A;  4N4H A;  2QAZ A;  1YIJ Q;  4HKE A;  2FZK B;  4N0A C;  3CCE A;  4C92 D;  2D6F A;  5DLQ E;  3CEY A;  1X6G A;  3FB9 A;  4Y28 E;  3C12 A;  4ZGD B;  2F1L A;  2KQW A;  1VQN A;  2LCS A;  3GNG A;  5HCK A;  5LJ5 j;  1RLQ C;  3OYC A;  2MCN A;  2A7Y A;  1JQQ A;  4FT4 A;  2GCX A;  5CK9 A;  4JS5 A;  2O9V A;  2GTO A;  5GAN f;  3S6W A;  4LDV A;  4BDZ A;  4JRQ A;  2KNB B;  3TU4 K;  4AFU C;  3UA6 A;  1Q81 C;  1YJ9 Q;  3M0U A;  1QVG A;  2DTI A;  3EG3 A;  1Y96 B;  3EGU A;  4AT1 B;  4A4F A;  3QWX X;  2PZ1 A;  2KR3 A;  4KGV B;  2EWN A;  1VQ7 T;  2QQS A;  4MDX A;  1AWO A;  1D1A A;  4M7D F;  5LJ3 g;  5GAO q;  2ROL A;  3VKI A;  1P92 A;  2DPP B;  4FU6 A;  2GBQ A;  3V7R A;  1N6A A;  1NM7 A;  2E65 A;  3QZ9 B;  2O4X A;  2PVG B;  3JB9 G;  1VQ4 A;  2LNH B;  3DLL A;  3VS4 A;  1WXT A;  2A3L A;  3OYF A;  2P4T A;  1KHI A;  2RNA A;  4C0F A;  2ZAE A;  2X3X D;  1J3T A;  1I0C A;  3G71 Q;  3PMI A;  1YJW T;  2A08 A;  5GAN 4;  3OYJ A;  3MEW A;  3N5B B;  2DXC A;  4C5I A;  2AT1 B;  1NBE B;  5CCA A;  4OMM A;  4M77 E;  1G3T A;  2LDM A;  3LYI A;  2QG9 B;  3MEU A;  4OB0 B;  2FPD A;  3ZFJ A;  3EG0 A;  2DAQ A;  3G6E A;  3OS0 A;  3NTH A;  4Z02 A;  4JJN K;  2BKD N;  2YRD A;  1T3L A;  1RL2 A;  2KT1 A;  5HK0 A;  1M8M A;  2OTL T;  2JXB A;  2D0N A;  2O4X B;  3PIO A;  1VQ5 T;  2JM9 A;  1FX7 A;  2XI9 A;  4J9E A;  3OYN A;  4D6W A;  2COZ A;  3QYG B;  2K6D A;  2BIV A;  1I4K 1;  2F2V A;  3VS3 A;  2QYZ A;  4J9B A;  4RTV A;  1NLP C;  2QGF B;  5GAM h;  5DM7 R;  2F2X A;  3LH0 A;  4OVA A;  2DXT A;  1GRI A;  1PCX A;  1PKS A;  5FU7 C;  1KQS S;  2HKQ B;  5HK3 A;  3FLG A;  4M75 F;  1QCO A;  4EMK C;  1YWO A;  3BW1 A;  2DYI A;  4P5N A;  3JCM c;  4BD3 A;  1VQM Q;  4KUI A;  3OYD A;  4PJO F;  4FW2 A;  1Q86 R;  2XID A;  2ZPI B;  4A54 A;  4BDY A;  1O9S A;  3EAE A;  4JJC A;  3I55 T;  1VQL Q;  3HPW A;  4BI3 A;  3VYH B;  2BE7 D;  2K3Y A;  1TXQ A;  2LX7 A;  1YJW A;  2NUT A;  5LJ3 d;  1VQ6 Q;  4A4H A;  1B07 A;  3LLR A;  4IIM A;  3C94 A;  2FYK A;  1OX9 A;  5FRO A;  1UEC A;  2VWF A;  2AKL A;  2MOX A;  1Y07 A;  3H0F A;  2LX9 A;  3PFS A;  3ULR B;  1OPL A;  1QP2 A;  1V76 A;  2LJ3 A;  1JJ2 S;  1V29 B;  2P84 A;  2XIC A;  3CMA Q;  4J9G A;  1KHC A;  1JXM A;  3CCS T;  1AT1 B;  3OYK A;  2DZ9 A;  2LCL A;  3OYG A;  4F17 A;  1WIE A;  1BYM A;  2QK0 A;  2YWW A;  3M5A A;  2E6Z A;  3LH5 A;  1EFN A;  3BDU A;  2E4H A;  2Y90 A;  1TUD A;  1Q82 R;  2JTF A;  1RAC B;  2YUO A;  3CCJ T;  4DOW A;  1AEY A;  4FT2 A;  4OGE A;  4ORZ A;  1WXU A;  4AMC A;  3A5Z B;  1YHQ T;  4RTW A;  5GAO n;  1K8A C;  3TCJ A;  5GAM g;  1KFZ A;  3CCR Q;  3PVL A;  3J80 E;  1H8K A;  1OV3 A;  1QVF S;  2AHJ B;  2QTX A;  2ZPF B;  4M7D B;  1O75 A;  1WHK A;  2FZC B;  2VUB A;  1VQO Q;  4M7A C;  3I55 A;  2V8J A;  4J8O A;  2BZ8 A;  4JZ3 A;  2EIF A;  5HY6 A;  1VYT A;  1X2Q A;  2MK5 A;  1S72 Q;  5D6Y A;  4JJD A;  3DLM A;  3NFC A;  1ARK A;  5KCO A;  4DEY A;  2VVK A;  2E6N A;  1VIF A;  4E7K A;  3BDL A;  1GFD A;  1PRL C;  3VS1 A;  5CR2 A;  1NLO C;  2O88 A;  2A37 A;  1OX8 A;  4BY6 B;  3LWH A;  3OW2 S;  5FRM A;  4KBM B;  3H0H A;  1VYV A;  1YIT A;  1VQP T;  1R77 A;  2QA4 T;  4Q5W A;  4PJO G;  2K7A A;  4PNO A;  2XG8 D;  2DO3 A;  2XD0 A;  2MI6 A;  4MMK A;  2RQW A;  2MMP A;  3E1S A;  2B8A A;  1VQK Q;  5KYX B;  4PJO A;  2RM4 A;  2KGT A;  2RJC A;  1TG0 A;  3CCS A;  1M90 U;  5LJ5 d;  1ABO A;  2YXY A;  5CVI A;  1ZX6 A;  3VS6 A;  4HCC A;  1D0Y A;  2QQA A;  2Z0W A;  1IRX A;  3MO8 A;  3CC4 T;  2H3J A;  3JCM Q;  3OYY A;  5AYF A;  4BE1 A;  1MHN A;  2O9S A;  3HSB A;  1BIB A;  1ZUU A;  4C92 C;  2M0Y A;  3X20 B;  1U8R A;  4AFS C;  3JB9 D;  4L5G A;  1BCO A;  2GQV A;  3GPL A;  1U3O A;  2EJ9 A;  2QDL A;  4OF1 A;  3RMS A;  2V1R A;  4EMG A;  2HSP A;  4RCB A;  4M75 B;  9ATC B;  2RI5 A;  3JB9 J;  1Z9Z A;  3REA B;  4M78 C;  2FPF A;  1KC8 C;  3NTK A;  2YRC A;  2QXF A;  3DKM A;  2IIM A;  3BY7 A;  4C0D B;  2CS7 A;  4JRK A;  4MZM A;  3CCM Q;  2KMT A;  2GF7 A;  4OMO A;  3MP6 A;  3OB9 A;  1TTH B;  3JCM h;  3PVQ A;  1Q81 R;  4PJM A;  5GAM d;  4GY5 A;  1IGQ A;  1MV3 A;  1Q7Y C;  2ZPB B;  3CXC S;  1OOT A;  2K5L A;  3CBP A;  5GMK e;  1N8R U;  2WSE E;  2OAW A;  4J9H A;  2KSS A;  1X2K A;  3R6N A;  1K9M C;  1BI2 A;  1VQ9 A;  2G3R A;  2QA4 A;  4OB2 B;  3PGG A;  4IUT A;  2R57 A;  2ENM A;  4MML A;  4PL6 A;  4ZGJ B;  3UAT A;  1YJN A;  5KYN A;  3CPW P;  3JB9 I;  5GAN 7;  4O6J A;  3U23 A;  3VU3 C;  4ESR A;  5KCH A;  3RKX A;  3VS0 A;  3QUI A;  1TWB A;  1G2B A;  2ED0 A;  1K73 R;  5FU6 C;  5GAN h;  5KYW B;  3CCU A;  2C06 A;  4ME7 A;  2DL4 A;  4F14 A;  2DVE A;  4RTY A;  4FCY A;  5IXF A;  1YIJ T;  1ZSZ C;  2KRM A;  2D8H A;  5EG2 A;  3JSC A;  4CC4 B;  3G7Z A;  4C8Q G;  4KH0 B;  3FC3 A;  1ZUY A;  4A4E A;  1SHF A;  1MND A;  4C8Q A;  1PM3 A;  3I5R A;  3H8Z A;  2HBP A;  5GAN 3;  2RK1 A;  3E19 A;  4GBQ A;  2DXB A;  1KK7 A;  3EH2 A;  3CME Q;  5LJ5 e;  2QQR A;  1UTI A;  4F16 A;  1UB4 A;  5KYU B;  2YHT A;  4DBF A;  2JW4 A;  1YJ9 T;  2VC8 A;  5KE2 A;  4J6W A;  2M51 A;  4J9F A;  2BE9 B;  3JCM g;  1NJI R;  2LJ1 A;  5J39 A;  1KD1 U;  3EGD A;  4M77 C;  1N5Z A;  1GCQ A;  3EGX B;  3A8H B;  5LJ3 j;  2PQW A;  2E5K A;  1E6H A;  4XU3 A;  3PE0 A;  4LNP A;  4PJO E;  2YUN A;  1TU0 B;  3CCL Q;  1W2B S;  3O5Z A;  5I21 A;  2XDD A;  3I56 Q;  2EYW A;  2V8K A;  4XK8 E;  2FRW A;  3NHN A;  1IO6 A;  2GFA A;  4FM4 B;  1BI3 A;  2JTM A;  1Y0M A;  2KRN A;  2E64 A;  3X28 B;  1SPK A;  2CH4 W;  3H41 A;  2KE9 A;  1ZHI A;  3FRN A;  1R8O B;  3VJP A;  4CRI A;  1BCM A;  3G71 T;  4JLG A;  2JMA A;  3SWN A;  4AFQ C;  5GAN g;  1QCN A;  3OYB A;  4C0Z A;  3EHR A;  2HBW A;  1BB9 A;  1K0S A;  2X3W D;  1UGQ B;  4ZTJ A;  4FSS A;  1XTD A;  1WQ7 A;  2JJ9 A;  3QDR B;  5HKC A;  5M9O A;  1TUG B;  1X01 A;  3NGP A;  2ESW A;  1WX6 A;  3EFO B;  4LDY A;  4E6R A;  3CCV A;  5GAN 8;  4PFZ A;  3S3M A;  1RUW A;  2DTH A;  2HL3 A;  3CC2 Q;  1TS9 A;  3HP9 A;  1S1N A;  2KDS A;  4FYY B;  4KUL A;  4ELY C;  2DFU A;  3RUX A;  1YJ9 A;  2J06 A;  2EQM A;  1A0N B;  1D3B B;  2EGE A;  5CKD A;  2I0N A;  4IUQ A;  3SWN B;  4LN2 A;  4FSX A;  1WPY A;  1RAB B;  2CYZ B;  1KSW A;  1K8A R;  3L2V A;  1Y96 A;  2KI7 A;  3D7S B;  4KRT A;  2OI3 A;  2JUF A;  1GBR A;  2DX1 A;  4GLM A;  4RCC A;  1VQM T;  2PVD B;  3OQ5 A;  1OI1 A;  2RHZ A;  4HXJ A;  4RMO A;  2XDB A;  2LC4 A;  5IHK A;  3JAM E;  3P8D A;  2KYB A;  2DRM A;  1VQL T;  2C0O A;  2RMO A;  1WJS A;  5KH6 A;  2LCC A;  4QQ6 A;  3QXE B;  5FLX E;  1OEB A;  2DMO A;  3V8K A;  3CD6 Q;  4PLI A;  4QT7 A;  4FW1 A;  1VQ6 T;  5IHN A;  2FO0 A;  1QVP A;  1PHT A;  5IN1 A;  4M78 D;  2J6K A;  4DBQ A;  1D0Z A;  3S3O A;  4BAC A;  4F7U F;  2EPD A;  3MP1 A;  1JXO A;  4C8Q E;  4CI0 C;  2RN8 A;  1WYX A;  3S3N A;  2D1X A;  3C4S A;  1QCF A;  1KIK A;  1UDL A;  4GLK A;  2EFI A;  2IPO B;  3HHT B;  1WA7 A;  3C95 A;  3G4S Q;  5IT9 E;  3CMA T;  3JB9 H;  4XTY A;  1NPR A;  3I9Q A;  3M0R A;  2JM8 A;  1VUB A;  2CZ7 B;  3EH1 A;  3INZ A;  2Y4Y A;  3VRZ A;  4IUR A;  2X51 A;  4B9X A;  2DIG A;  2ZZD A;  3SDZ A;  3TEE A;  2DYB A;  3A8O B;  1BI0 A;  1LVK A;  1K76 A;  2JNG A;  5GAM j;  2RQR A;  1AOJ A;  3OS5 A;  4PFO A;  1M27 C;  2K5I A;  3J7A F;  4ANJ A;  1AHJ B;  1LJO A;  4XAX B;  3CCR T;  4HVU A;  3AHU A;  1X75 C;  2ZGW A;  4RG8 A;  2CP2 A;  3M0S A;  1YI2 T;  4DA4 A;  2DIQ A;  2P0K A;  3OA6 A;  2FB7 A;  2XMF A;  2FG0 A;  2KYM A;  4WCI A;  3L2R A;  1UG1 A;  2G6F X;  1VQO T;  1OUL A;  3T9N A;  3KFV A;  4M4Z A;  4OP0 A;  4WF2 A;  3M59 A;  1I5O B;  4B9W A;  4QW2 A;  5FWC A;  2AZV A;  3RR6 A;  3HTR A;  1S72 T;  4JPB W;  2L3R A;  2QQ9 A;  1BU1 A;  1K4U S;  2DEQ A;  3WVD B;  3ER0 A;  1Q7Y R;  3SEM A;  2XDP A;  1C6V X;  3X24 B;  3THK A;  2X35 A;  1K9M R;  2M02 A;  1Q86 U;  2EYZ A;  3BE3 A;  3FEO A;  2L8D A;  1FMK A;  5KYY B;  1ZBJ A;  3EG9 B;  2EBP A;  3QBY A;  1VQ7 A;  1EX4 A;  4LD9 K;  3CMA A;  1YN8 A;  2ATC B;  1VQK T;  1FXX A;  1VQ4 Q;  2CRE A;  4HCB A;  4M7A F;  2DTO A;  4L6V 5;  2CGH A;  2HZY A;  3NPF A;  2CZ6 B;  4UC4 A;  1M1K R;  4M77 D;  4RG2 A;  2XKO C;  2LVM A;  1M1F A;  1IGU A;  4XU0 A;  4TVR A;  1ZSG A;  1QQJ A;  1RI0 A;  1UHC A;  4F7U G;  1QVG S;  2Y4X A;  2HD0 A;  5GAN 6;  2J7I A;  3CPF A;  1EIF A;  2CUD A;  2RHU A;  2HMA A;  3G6E Q;  4F7U A;  1KQS P;  2CDT A;  3P8H A;  1YI2 A;  1B34 B;  1D1C A;  2AZS A;  4KGX B;  3VYG A;  4HA8 A;  1E7O A;  2JS2 A;  2V1Q A;  4D8K A;  3L2W A;  2DJZ A;  4M7D G;  2K57 A;  1OPK A;  3TVT A;  1M2V A;  1Q82 U;  2CH4 A;  1HXD A;  4M7D A;  4XU2 A;  3CCM T;  4V2S A;  3M0P A;  1T3S A;  2K3X A;  2JT4 A;  4NL3 A;  4KGZ B;  3E9G A;  1S72 A;  2OTL A;  3QWY A;  3E9F A;  2QAS A;  2V8I A;  1X69 A;  1VQ5 A;  3CBM A;  4C92 F;  2CP7 A;  1OQK A;  4X9C A;  4YTL A;  1RAH B;  1IB8 A;  2DM1 A;  1CKA A;  1PNJ A;  1E6G A;  1U1T A;  5J3B A;  4E47 A;  3H9N A;  1U5S A;  3F70 A;  4DOV A;  3SFM A;  2KXD A;  4JRP A;  2H8H A;  3V8J A;  2X9H A;  5ECA A;  1ZLM A;  4PJN A;  5CO7 A;  5FU7 B;  4F7U B;  3MEV A;  3CPW A;  3ME9 A;  3M57 A;  5I2S A;  4EMK B;  3WVE B;  1SRM A;  4EIK A;  3CCQ Q;  4KUD K;  1IHW A;  4MZP A;  4IKF A;  3UF4 A;  4OMN A;  1M2V B;  5LL6 S;  2F69 A;  5KYX A;  2DBM A;  2RA2 A;  1LPL A;  1RAA B;  5AT1 B;  1WJR A;  3PT9 A;  2J05 A;  3P8B B;  3CBO A;  1WJQ A;  1PSF A;  2LTO A;  2ABL A;  2L3S A;  2D8J A;  4QVD A;  2DNU A;  2ROT A;  2YUP A;  2IG0 A;  4A63 B;  5A2Q E;  4CC3 A;  3M58 A;  4C5E A;  1NZ9 A;  1PG5 B;  2YSQ A;  4E7I A;  4PJO C;  1KQ1 A;  4MDW A;  4N4I A;  2XK0 A;  4LXC A;  4M75 G;  5GJV B;  3V7S A;  2A28 A;  1QVF P;  4M75 A;  5LJ5 f;  3H0I A;  1QLY A;  4J5Y A;  3CCM A;  2RJF A;  4RUG A;  2DEU A;  3CME T;  1JU5 C;  1GCP A;  4Y92 A;  4LDX A;  3JCM X;  2LJ0 A;  2HEQ A;  3OBY A;  4E7L A;  3CCJ A;  1I8F A;  3RKW A;  3OW2 P;  1AZE A;  3LW5 E;  3MJX A;  1YBY A;  4RTT A;  3ZEH A;  4IIO A;  3MET A;  1JO8 A;  1QKX A;  1YHQ A;  3CCL T;  4XTW A;  5LJ3 e;  3I56 T;  3VRY A;  3QJY A;  1Q81 U;  3OY9 A;  1M3C A;  2DZC A;  2HQX A;  1BBZ A;  1T0H A;  4M7A B;  4QQG A;  4J9D A;  2YT6 A;  1YWP A;  5GAN j;  2RD1 A;  1KJW A;  2F5T X;  2RJE A;  2DKG A;  5KYW A;  1K1Z A;  4OMP A;  4QQD A;  4F7U E;  1YIT Q;  3OYM A;  4M77 F;  4PK4 A;  5CIU A;  5C0M A;  1WFW A;  2EQU A;  4IUU A;  1WLP B;  1WGS A;  3M54 A;  2HQE A;  4DBR A;  2NUP B;  1VQP A;  2OTJ Q;  4M7D E;  3CCS Q;  2LQW A;  5CQX A;  2EQI A;  1K73 U;  1FWZ A;  2KBT A;  4N4G A;  1D0X A;  3M55 A;  2JS0 A;  3RDV A;  3A8G B;  3OYH A;  3CME A;  3CC2 T;  2VAS A;  2OJ2 A;  2B86 A;  3CC4 A;  2QTV A;  1JEG A;  2YLB A;  1U06 A;  2PNI A;  4C92 B;  5KYU A;  1RAI B;  2IVW A;  4RTU A;  3EHQ A;  2EGA A;  3JCM P;  3CXC P;  2H3E B;  4C8Q C;  1AWW A;  3JV3 A;  2HL5 C;  3EGX A;  4XQ3 A;  2COW A;  4XTV A;  3H6Z A;  3I56 A;  4A4G A;  2V26 A;  1RAG B;  1VQ8 Q;  3M56 A;  2O31 A;  2RHX A;  2HSE B;  2CT3 A;  2RK2 A;  4M78 B;  2MWO A;  2MF2 A;  1VOM A;  1NJI U;  1NEG A;  5FWB A;  2FHD A;  2DL7 A;  4M7D D;  2L89 A;  3RKY A;  1MMD A;  5I2M A;  1I81 A;  2DER A;  2HDA A;  3C0C A;  4BE2 A;  1GCQ C;  3CD6 T;  2J6F A;  2O01 E;  4ELZ C;  3IQL A;  3NTI A;  3J81 E;  1TSF A;  1UFF A;  2L3P A;  3QO3 A;  4XTU A;  1VQ9 Q;  1SHG A;  2PVO B;  1G3S A;  2E41 A;  2YRV A;  2I2L A;  2W10 A;  3LGL A;  1NYF A;  4M75 E;  1YJN Q;  3OS1 A;  4FYX B;  3RIR A;  3EG2 A;  7AT1 B;  3LWI A;  3G4S T;  1ZA1 B;  2MIO A;  4J6Y A;  1MNE A;  1ACM B;  2K3B A;  4II1 A;  3L1A A;  1UGP B;  5FRN A;  1FMW A;  1AWX A;  1N9R A;  2DL8 A;  2X4W A;  3HRU A;  3EFO A;  4PLL A;  1TUC A;  2RO0 A;  5GMK i;  3CCU Q;  5CKE A;  4JS4 A;  1FYN A;  2GGR A;  2R5A A;  2CSI A;  2RH2 A;  5IXB A;  5FU6 B;  2X4X A;  3RNJ A;  4XTZ A;  5CKH A;  2DRK A;  4L59 A;  2COY A;  1UGR B;  1D3B A;  5D7U A;  3PMT A;  1H92 A;  1PRM C;  2CUB A;  1ZSZ B;  1YIJ A;  5GAM e;  3OYE A;  2DJQ A;  4PFP A;  4CC7 A;  1X6O A;  1W2B P;  2K4Y A;  1MMN A;  2K9G A;  3O8V A;  3JB9 F;  4X1V A;  2SEM A;  2L2P A;  2QEX Q;  1D1B A;  1JBM A;  1NE8 A;  2KRO A;  4M75 D;  3MCA B;  2FL7 A;  1K8A U;  1PSE A;  5GJW B;  2FZG B;  4PJO D;  3M4Y A;  2SRC A;  3CD6 A;  4E7H A;  4F04 B;  1TH7 A;  3JCM W;  3OYI A;  1C1A A;  1WHJ A;  2AK5 A;  3Q1J A;  5KE3 A;  3MKD A;  1I07 A;  4M77 B;  1PC0 A;  2GQI A;  3UDC A;  4J7F A;  2QQB A;  5EC7 A;  3AT1 B;  4JZ4 A;  1MMA A;  1IRE B;  1M1G A;  2EW3 A;  3G4S A;  2CZ1 B;  1VQ4 T;  1Y57 A;  1BI1 A;  4DBH A;  1M4Z A;  1RAD B;  1M2O A;  3G1J A;  1WDX A;  3HRS A;  2AIR B;  4R56 A;  3LX7 A;  1DJ7 B;  5IH2 A;  1QP3 A;  3JCM d;  1JB0 E;  4ZN1 A;  5GMK h;  4IUV A;  1K9A A;  1OU9 A;  2HKN A;  1M90 C;  3A98 A;  3GP8 A;  1VA7 A;  1YFN A;  1W70 A;  1PKT A;  1FMV A;  3G71 A;  1KQS A;  3CC7 Q;  4KH1 B;  3OYL A;  1HJD A;  2KT8 A;  3G6E T;  3URG A;  2CKK A;  5GAO p;  4X9D A;  8ATC B;  4QVC A;  3UPU A;  2M0O A;  1M30 A;  4N0A A;  4E7J A;  4OMQ A;  2BUD A;  1JRI A;  2MYS A;  1G8X A;  2EJF A;  3GOX A;  3CCV Q;  2M16 A;  2KRS A;  3VS2 A;  2E10 A;  4RTX A;  3QKJ A;  1N27 A;  2LNV A;  4Z88 A;  3MP8 A;  2ED1 A;  4J83 A;  2VXF A;  5GAN d;  3M9Q A;  3HRT A;  2CSQ A;  2AKK A;  3QHS A;  2W0Z A;  3VV0 A;  1GXI E;  2MAM A;  4KT0 E;  1QWE A;  1MGQ A;  4QKU A;  3PTA A;  1KC8 U;  2EAY A;  2WAC A;  4D8D A;  2K79 A;  2YLC A;  2LQK A;  3CCE Q;  2LP5 A;  3VUB A;  5DLO A;  1JJ2 A;  4JDS A;  4A53 A;  4XTX A;  4NL2 A;  3CCQ T;  4E2F B;  2VGM A;  3NMZ C;  1BK2 A;  5KYY A;  1F1B B;  3TRE A;  2DL5 A;  4HT9 A;  3EG9 A;  1IHV A;  1HK9 A;  1YP5 A;  2RI3 A;  1VQM A;  1VQN Q;  1N8R C;  5D6W A;  1Q7Y U;  1GFC A;  2VKN A;  5LJ5 h;  1KC8 R;  3OSS C;  2L0A A;  3OSV A; 
#chains in the Genus database with same CATH homology
 1X2K A;  1YNZ A;  3R6N A;  3UF4 A;  3REB B;  2DIL A;  4OMN A;  2JMC A;  2PTK A;  2ENM A;  2DBM A;  1UJY A;  1SSH A;  2RF0 A;  4J9C A;  4HVW A;  1CSK A;  3UAT A;  1HSQ A;  1RI9 A;  1VYU A;  2J05 A;  2FEI A;  2DL3 A;  2KEA A;  3U23 A;  4ESR A;  2ABL A;  2L3S A;  2D8J A;  2O2O A;  2LZ6 B;  4LE9 A;  3VS0 A;  2FPE A;  1XOV A;  1G2B A;  2DNU A;  5I22 A;  2ED0 A;  2FRY A;  1UJ0 A;  2A36 A;  2LQN A;  4J9I A;  1RLP C;  2ROT A;  4DEX A;  3TSW A;  3EG1 A;  2YUP A;  1X43 A;  2J6O A;  4A63 B;  4CC2 A;  4CC3 A;  2YSQ A;  3FJ5 A;  2DL4 A;  3TSZ A;  4F14 A;  4RTY A;  5IXF A;  1QWF A;  5GJV B;  2A28 A;  2KRM A;  2D8H A;  4CC4 B;  3H0I A;  1QLY A;  1ZUY A;  4RUG A;  1SHF A;  4HVV A;  1JU5 C;  3I5R A;  3UA7 A;  4HCK A;  1GCP A;  4Y92 A;  1X6G A;  4GBQ A;  2RQT A;  2DF6 A;  2LJ0 A;  2HEQ A;  3SHW A;  2LCS A;  1MV0 B;  1UTI A;  5HCK A;  4F16 A;  1RLQ C;  2MCN A;  1JQQ A;  1AZE A;  2JW4 A;  4RTT A;  1QKW A;  4J9F A;  2M51 A;  4R0K A;  4IIO A;  1JO8 A;  2O9V A;  1QKX A;  2GTO A;  2LJ1 A;  4EIK A;  1N5Z A;  1GCQ A;  2KNB B;  4Z8A A;  4AFU C;  3UA6 A;  3M0U A;  2E5K A;  3EG3 A;  2C0T A;  3VRY A;  1E6H A;  1UHF A;  3PE0 A;  4LNP A;  2YUN A;  1M3C A;  3EGU A;  3QWX X;  1BBZ A;  1T0H A;  3O5Z A;  2PZ1 A;  2KR3 A;  2EYW A;  2EVR A;  2FRW A;  3NHN A;  4J9D A;  1IO6 A;  1AWO A;  2YT6 A;  1YWP A;  1Y0M A;  2BTT A;  2DLP A;  2ROL A;  1KJW A;  2KRN A;  1SPK A;  2CH4 W;  2GBQ A;  1K1Z A;  2KE9 A;  3H41 A;  4OMP A;  1MUZ A;  1NM7 A;  1M3A A;  2YUQ A;  2LNH B;  1WFW A;  2JMA A;  5FW9 A;  4AFQ C;  3VS4 A;  1WLP B;  1WXT A;  3EHR A;  2HBW A;  2RNA A;  1W1F A;  3VS7 A;  2X3X D;  1BB9 A;  1J3T A;  1I0C A;  2LQW A;  2EQI A;  1K0S A;  2A08 A;  2X3W D;  2ECZ A;  2KBT A;  1H3H A;  4AG1 C;  2JS0 A;  4OMM A;  5IHI A;  4FSS A;  3NGP A;  2GNC A;  2OJ2 A;  2FPD A;  2ESW A;  5L23 A;  2B86 A;  1WX6 A;  3EG0 A;  1PWT A;  1JEG A;  4E6R A;  1T3L A;  1U06 A;  2PNI A;  2L3Q A;  1RUW A;  4OML A;  1UUE A;  1AZG B;  1GBQ A;  1AD5 A;  2EGA A;  2HCK A;  3EHQ A;  4RTU A;  2KT1 A;  1S1N A;  1M8M A;  4JJB A;  2EYY A;  2JXB A;  1K0X A;  2D0N A;  2KXC A;  2J06 A;  2JM9 A;  1A0N B;  2EGE A;  1AWW A;  2I0N A;  3JV3 A;  3VS5 A;  4J9E A;  4LN2 A;  4Z89 A;  1KSW A;  2JTE A;  4LUE A;  2K6D A;  1SRL A;  2F2V A;  3VS3 A;  2O31 A;  4KRT A;  4J9B A;  2OI3 A;  4RTV A;  2YDL A;  1GBR A;  2NUZ A;  1NLP C;  4LUD A;  2DX1 A;  4GLM A;  2CT3 A;  2F2X A;  1HD3 A;  1LCK A;  1GRI A;  1PKS A;  1NEG A;  2DVJ A;  4HXJ A;  5IHK A;  5FWB A;  1YWO A;  3ZL7 C;  2DL7 A;  3M0T A;  1GL5 A;  2KYB A;  2DRM A;  2HDA A;  3C0C A;  1GCQ C;  2C0O A;  2RMO A;  2J6F A;  3IQL A;  1NG2 A;  1UFF A;  1WI7 A;  2L3P A;  1SHG A;  4JJC A;  1OEB A;  2DMO A;  2DA9 A;  1T0J A;  2W10 A;  4QT7 A;  1NYF A;  2FO0 A;  5IHN A;  1PHT A;  2J6K A;  2LMJ A;  3EG2 A;  2LX7 A;  2EPD A;  1CKB A;  2MIO A;  1JXO A;  1B07 A;  2K3B A;  2RN8 A;  4IIM A;  1WYX A;  2D1X A;  1UEC A;  1AWX A;  1QCF A;  2DL8 A;  2VWF A;  2AKL A;  3I5S A;  2MOX A;  1KIK A;  1UDL A;  1WA7 A;  3H0F A;  1TUC A;  2EGC A;  3I9Q A;  3M0R A;  1NEB A;  3ULR B;  1OPL A;  2LJ3 A;  1FYN A;  2EYX A;  2GGR A;  2CSI A;  2JM8 A;  5IXB A;  3VRZ A;  3RNJ A;  4J9G A;  2DRK A;  1JXM A;  2DYB A;  4AFZ C;  4F17 A;  2K2M A;  1H92 A;  1WIE A;  3LH5 A;  1PRM C;  2CUB A;  1EFN A;  2RQU A;  1K76 A;  1I1J A;  2DJQ A;  1TUD A;  2RQR A;  2YUO A;  1AOJ A;  4CC7 A;  1UE9 A;  1AEY A;  1M27 C;  4ORZ A;  1WXU A;  4HVU A;  2K9G A;  3M0S A;  4X1V A;  2SEM A;  2L2P A;  2GTJ A;  2XMF A;  2FG0 A;  4RTW A;  2KRO A;  2KYM A;  4WCI A;  1KFZ A;  1UGV A;  1UG1 A;  2G6F X;  3PVL A;  5GJW B;  1H8K A;  1OV3 A;  1NYG A;  3KFV A;  2SRC A;  4M4Z A;  5FWC A;  2AZV A;  1ZUK A;  4JPB W;  2F2W A;  1BU1 A;  1K4U S;  2AK5 A;  3SEM A;  1I07 A;  2BZ8 A;  4JZ3 A;  2GQI A;  3RBB B;  1VYT A;  1X2Q A;  1YCS B;  4JJD A;  3THK A;  1ARK A;  4DEY A;  2VVK A;  5EC7 A;  4JZ4 A;  2EW3 A;  4RTZ A;  2EYZ A;  1GFD A;  1PRL C;  3VS1 A;  1ABQ A;  1NLO C;  1Y57 A;  2A37 A;  2O88 A;  1FMK A;  1ZBJ A;  2EBP A;  3H0H A;  1VYV A;  1YN8 A;  1WDX A;  2CRE A;  5IH2 A;  2K7A A;  3M0Q A;  2RQW A;  1K9A A;  3NPF A;  3A98 A;  2KGT A;  1VA7 A;  1W70 A;  1PKT A;  1TG0 A;  1ABO A;  2DBK A;  1HJD A;  1ZX6 A;  2RQV A;  3VS6 A;  2KT8 A;  1ZSG A;  1UHC A;  5I11 A;  3GBQ A;  2O9S A;  1ZUU A;  2J7I A;  1M30 A;  2M0Y A;  4OMQ A;  2CUD A;  4AFS C;  1B3Q A;  2BZX A;  2CDT A;  2AZS A;  2KRS A;  3VS2 A;  4RTX A;  1WXB A;  3CQT A;  1E7O A;  1X27 A;  1U3O A;  2JS2 A;  2V1Q A;  4D8K A;  4Z88 A;  1AWJ A;  1G83 A;  2EKH A;  2QDL A;  1OPK A;  3TVT A;  4ZNX A;  2ED1 A;  2V1R A;  2CH4 A;  2HSP A;  2CSQ A;  3M0P A;  1T3S A;  1Z9Q A;  2AKK A;  2W0Z A;  3I35 A;  1Z9Z A;  2JT4 A;  3REA B;  2FPF A;  1SEM A;  1QWE A;  3QWY A;  1AVZ C;  1W6X A;  2C0I A;  2IIM A;  1X69 A;  2DE0 X;  4D8D A;  2K79 A;  1X6B A;  2DM1 A;  1CKA A;  1PNJ A;  1E6G A;  4OMO A;  2LP5 A;  2P4R A;  1U5S A;  2RPN A;  2KXD A;  3PVQ A;  1M3B A;  3NMZ C;  1BK2 A;  2H8H A;  1MV3 A;  2DL5 A;  1V1C A;  1YP5 A;  5ECA A;  2BZY A;  1ZLM A;  1OOT A;  1GFC A;  2VKN A;  2NWM A;  2L0A A;  1SRM A;  2CT4 A;  2OAW A;  4J9H A;  4K11 A;  4AG2 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...