1WIHA

Solution structure of rsgi ruh-021, a domain ii of ribosome recycling factor from mouse cdna
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
84
structure length
84
Chain Sequence
b'GSSGSSGLDHITVVTADGKVALNQIGQISMKSPQVILVNMASFPECTAAAIKAIRESGMNLNPEVEGTLIRVPIPKVTSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords mitochondrial ribosome recycling factor
publication title Solution structure of RSGI RUH-021, a domain II of ribosome recycling factor from Mouse cDNA
rcsb
source organism Mus musculus
molecule tags Structural genomics, unknown function
total genus 9
structure length 84
sequence length 84
ec nomenclature
pdb deposition date 2004-05-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.40 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 1wihA00
1BJTA 1B4AA 3OPFA 1ZVUA 1XXBA 2P5MA 3L4KA 2KWAA 4G0WA 3V4GA 1IS1A 3NUHA 4GFQA 3VA7A 1AB4A 4KB2A 4G0UA 2XCOA 2Y3PA 1XXCA 3FOFA 3FOEA 3L4JA 3MMLB 1WQGA 3OEPA 4KC6A 1B4BA 3CAGA 4KAWX 1ISEA 1WQFA 4FM9A 1EH1A 1BGWA 3LAJA 4KDDA 1EK8A 1WIHA 2XCRB 4KB4A 3OREA 2XCQA 4J3NA 2PHCB 3ERED 2ZFZA 1WQHA 5CJ9A 2RGRA 4G0VA 3QX3A 3BUEA 1XXAA 5JVOA 1DD5A 1F9NA 4DDQA 3LPXA 1GE9A 3LAPA 3FHZA
chains in the Genus database with same CATH superfamily
1KQ4A 2R92K 1O2FB 1TWAC 3N3YA 2JA5C 4C3IC 3S16K 1TWHA 2XCOA 5IOSA 3PO3K 4GTBA 3GTPA 2B63A 4GTCA 4FM9A 2VUMC 3IPJA 1Y1VA 4LOWA 2YU9A 3HKZL 1J6WA 3GTJC 3RZOK 3S2HC 1SFOC 1WOSA 2JA6C 2E2HA 1YNJA 5IP9K 2NVTK 1XXBA 4KM9A 5TMFA 3JSTA 4C45A 4GTLA 3GTMK 3FKIC 3S1NK 1O28A 3M3YK 3TTGA 2BE5A 3A8IA 1B4BA 5FJ8K 1R9TK 4MEXA 1UV7A 3GTKK 4A3KC 5IYCC 1ZBSA 3H0GK 4GTEA 4QIWD 4WILA 3BUEA 3I4NK 4BBSC 1TWGK 3LAPA 3K7AK 1IE0A 4WJ3M 1TWHK 1XPPA 4NOIA 3T00A 2KWAA 4OIRA 1WCMC 2V6TA 4A3MC 2CW0A 1XZQB 4KB2A 4XCHA 4KARA 2PMZL 3S1RC 1Y1VK 4Q5SA 1O24A 1EH1A 2YU9K 3S17K 3S14C 4A3BC 3Q3QA 2E2IK 2NVXA 4BBRC 2FQTA 1TWCA 2JH3A 2E2HK 1I3QA 4C3JK 5FLMC 4XSXA 1WOOA 1O29A 4AYBD 3S15C 5E68A 4KMUA 4A3LC 3FOEA 1Y1WK 3OEPA 3CAGA 3S1QC 3HOYC 3GTGC 1L0WA 3GTLK 3RZDC 1TWFK 4KB4A 1K83K 4BLAA 3PO2C 3CQZA 5C3EC 4YFNA 5IP7K 1I6HC 1ZQ1C 1BJTA 5IYDK 2NVYA 1RU0A 1O27A 1TWAA 4LQYA 2JA5A 4A3DK 3G4AA 1XZQA 3GTQC 3HOZC 1VRQC 4A3EC 1O25A 3TFIA 2NVXK 1TWCK 2JA7A 1I3QK 4KDDA 3BP8C 3S0XA 1JQWA 2XCRB 4G7OA 2VUMA 1XXAA 2R92C 4KMDA 3GTJA 1SFOA 4GTAA 3S16C 2JA6A 4BY7K 4ILDA 3PO3C 2PPBA 5IOQA 4BY1K 4C2MK 4BKWA 4KAWX 2EBBA 2NVQK 1ISEA 3CQZK 3HOXK 2JA8K 4Q4ZA 2V6SA 3RZOC 4BXXK 1I6VA 4PABA 1DCOA 4LLGA 3GTOA 5IP9C 2NVTC 1I50K 1EQRA 1B4AA 4G0WA 4X6AK 1IQ0A 3GTMC 2Y3PA 1PJ6A 3S1NC 3TFHA 4JK1A 2O5IA 2FQOA 4QIWL 3M3YC 2JA7K 3S1MK 3GIRA 1R9TC 1V5VA 1XZPB 3GTKC 3H0GC 4XLPA 3ERED 4XLNA 3I4NC 2R93K 5JVOA 1TWGC 4KMAA 3WODA 3K7AC 1TWHC 2RH6A 2R7ZA 3V4GA 4P5AA 4P9SA 1IBAA 2E2JC 4C3HK 3GTPK 4WJ4A 3A8KA 2B63K 3MMLB 1Y1VC 1ZYRA 1IL2A 2GAHC 1VLOA 2YU9C 3S17C 3H3VL 4KASA 5CHPA 3LAJA 2E2IC 4QJVB 4AYBL 5C44K 1PJ7A 3OREA 2E2HC 3SZYA 3GTGA 1WQHA 4C3JC 3GTOK 2A6EA 4YFKA 3GSIA 5L46A 4P5BA 5C4XK 4A3JK 3H3VD 4A3FK 3M4OK 4Y52C 1Y1WC 3N0BA 5IYBK 4LR2A 4A3IK 2D6FC 2PA8D 3GTLC 3GTQA 1WQFA 4YG2A 1TWFC 1F93A 2ZUEA 1K83C 1WIHA 4RMFA 1XZPA 1DCPA 2PHCB 4AH6A 5IP7C 1BS2A 5FLMK 4O2DA 5IORA 2R7ZK 5IYDC 1F7UA 2R92A 4A3DC 1XXCA 3FOFA 5M3MK 4A3GK 3T02A 3DXJA 1WQGA 4LK1A 1TWCC 2A68A 1I3QC 1VH2A 1BGWA 4XSZA 4A93K 1EK8A 5C4JK 3HOVK 4BLBA 5CJ9A 4QJVA 3HOUK 3QX3A 1O26A 3LPXA 4OINA 3HOWK 4BY7C 1SMYA 4OIQA 4Y7NK 4FZBA 4BY1C 4C2MC 1USOA 4MEYA 2NVQC 3CQZC 2GAGC 3FKIA 3HOXC 2JA8C 1F7VA 4A3CK 4J3NA 4GTFA 4YFXA 4BXXC 3H0GA 1INNA 4PAAA 2NVYK 2WB1D 3S2DK 2WAQD 1I50C 3FHZA 3I4MK 3HXAA 3AQOA 1TWGA 2V6UA 1TWAK 2JA5K 1IS1A 3GDZA 4X6AC 4C3IK 4G0UA 5TMCA 4GTDA 2JA7C 1WOPA 3S1MC 1JVIA 1WCMA 1WSVA 3G4CA 3GEHA 1VJEA 1C0AA 2VUMK 1USMA 4KN7A 3AQPA 2R93C 2P8TA 2E2IA 3S2HK 3GTJK 4DDQA 1SFOK 2JA6K 3T01A 2P5MA 1O2BA 3VA7A 4C3HC 3GTPC 2GSUA 1DCHA 3AH5A 3HKZD 4KMHA 2O5JA 2B63C 1HI9A 4LK0A 3FKIK 1YCLA 1Y1WA 1HQMA 2CFAB 5C44C 3ADAC 1X31C 2A6HA 3GTOC 3GTLA 4A3KK 5IYCK 1J6VA 1TWFA 2ZUFA 1K83A 1F9NA 1VGXA 1ZXOA 4BBSK 5C4XC 4A3JC 1JOEA 3OPFA 4LJZA 2PA8L 3GEIA 3L4KA 4A3FC 5IOTA 3NUHA 4G7ZA 3M4OC 2E2JK 1WCMK 4A3MK 1PJ5A 5IYBC 4A3IC 1J98A 1J6XA 4KATA 1WSRA 2A69A 3S1RK 5M5XK 3AD9C 3SZZA 4MQ9A 1IW7A 3S14K 4A3BK 4GZYA 4BBRK 2RGRA 2PMZD 2R7ZC 1DD5A 1G51A 4M1XA 3GEEA 5M3FK 5D4DA 4OIPA 1AB4A 5HL8A 4A3GC 3S15K 3EQLA 4Y52K 2R93A 4KM8A 4A3LK 1O2AA 2Y0SL 2NVXC 4KN4A 3S1QK 4A93C 5C4JC 3HOVC 2GSOA 3HOYK 3GTGK 5JFEA 3RZDK 2CFAA 3HOUC 2ZFZA 3AD8C 2W7VA 3BP3A 3PO2K 4G0VA 5EGHA 1EI6A 1BDFA 5C3EK 3N0CA 1GE9A 3AD7C 3HOWC 2Y0SD 1EFWA 3A8JA 1I6HK 5M5YK 5EGEA 1ZVUA 1I50A 1YNNA 4GFQA 1YX2A 4Y7NC 4G7HA 5M5WK 3L4JA 4OIOA 3GTQK 3HOZK 4KC6A 2WB1L 2WAQL 4A3EK 3GTMA 3TFJA 5TJ3A 1WORA 4A3CC 2GSNA 2XCQA 1R9TA 4GT9A 2NVYC 3S2DC 3GTKA 3I4MC 4ZH4A
chains in the Genus database with same CATH topology
1BJTA 1KQ4A 2NVYA 3N3YA 4P5BA 1O27A 2P5MA 1O2BA 4C3IC 3VA7A 4C3HC 1TWAA 1TWHA 2GSUA 2XCOA 3AH5A 4LQYA 4KMHA 5IOSA 2JA5A 4GTBA 3G4AA 3N0BA 3GTPA 4LR2A 1O25A 2B63A 1Y1WA 4GTCA 3GTQA 1WQFA 2CFAB 4FM9A 2JA7A 4KDDA 3S0XA 1WIHA 1Y1VA 2XCRB 3GTLA 2PHCB 2YU9A 2VUMA 1TWFA 1XXAA 1K83A 1F9NA 5IORA 1ZXOA 2E2HA 4KMDA 3GTJA 3OPFA 1SFOA 3L4KA 1XXBA 4GTAA 4KM9A 2R92A 5IOTA 3NUHA 2JA6A 4ILDA 4GTLA 1XXCA 3FOFA 1O28A 5IOQA 4KATA 1WQGA 4BKWA 1B4BA 4KAWX 1ISEA 1BGWA 1EK8A 1ZBSA 4BLBA 2RGRA 4GTEA 5CJ9A 3QX3A 3BUEA 1DD5A 1O26A 3LPXA 3LAPA 3GTOA 4M1XA 1B4AA 2KWAA 4G0WA 1AB4A 4KB2A 2Y3PA 4KARA 4FZBA 4KM8A 4C2MC 1O2AA 1O24A 1EH1A 3FKIA 2GSOA 3Q3QA 2NVXA 5JFEA 1TWCA 2CFAA 2JH3A 4GTFA 4J3NA 2ZFZA 3ERED 1I3QA 4G0VA 5EGHA 5JVOA 3H0GA 4KMAA 3N0CA 1GE9A 3FHZA 1O29A 3AQOA 5EGEA 1TWGA 1ZVUA 2RH6A 2R7ZA 1I50A 3V4GA 1IS1A 4GFQA 4P5AA 4G0UA 4GTDA 3FOEA 3L4JA 1WCMA 3MMLB 3G4CA 3OEPA 4KC6A 3CAGA 3GTMA 4KASA 5CHPA 5TJ3A 3LAJA 2GSNA 4KB4A 3OREA 4BLAA 2XCQA 3AQPA 1R9TA 3GTGA 1WQHA 4C3JC 3CQZA 2E2IA 4GT9A 3GTKA 4DDQA 2R93A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BJT A;  1B4A A;  3OPF A;  1ZVU A;  1XXB A;  2P5M A;  3L4K A;  2KWA A;  4G0W A;  3V4G A;  1IS1 A;  3NUH A;  4GFQ A;  3VA7 A;  1AB4 A;  4KB2 A;  4G0U A;  2XCO A;  2Y3P A;  1XXC A;  3FOF A;  3FOE A;  3L4J A;  3MML B;  1WQG A;  3OEP A;  4KC6 A;  1B4B A;  3CAG A;  4KAW X;  1ISE A;  1WQF A;  4FM9 A;  1EH1 A;  1BGW A;  3LAJ A;  4KDD A;  1EK8 A;  1WIH A;  2XCR B;  4KB4 A;  3ORE A;  2XCQ A;  4J3N A;  2PHC B;  3ERE D;  2ZFZ A;  1WQH A;  5CJ9 A;  2RGR A;  4G0V A;  3QX3 A;  3BUE A;  1XXA A;  5JVO A;  1DD5 A;  1F9N A;  4DDQ A;  3LPX A;  1GE9 A;  3LAP A;  3FHZ A; 
#chains in the Genus database with same CATH topology
 1KQ4 A;  2R92 K;  1O2F B;  1TWA C;  3N3Y A;  2JA5 C;  4C3I C;  3S16 K;  1TWH A;  2XCO A;  5IOS A;  3PO3 K;  4GTB A;  3GTP A;  2B63 A;  4GTC A;  4FM9 A;  2VUM C;  3IPJ A;  1Y1V A;  4LOW A;  2YU9 A;  3HKZ L;  1J6W A;  3GTJ C;  3RZO K;  3S2H C;  1SFO C;  1WOS A;  2JA6 C;  2E2H A;  1YNJ A;  5IP9 K;  2NVT K;  1XXB A;  4KM9 A;  5TMF A;  3JST A;  4C45 A;  4GTL A;  3GTM K;  3FKI C;  3S1N K;  1O28 A;  3M3Y K;  3TTG A;  2BE5 A;  3A8I A;  1B4B A;  5FJ8 K;  1R9T K;  4MEX A;  1UV7 A;  3GTK K;  4A3K C;  5IYC C;  1ZBS A;  3H0G K;  4GTE A;  4QIW D;  4WIL A;  3BUE A;  3I4N K;  4BBS C;  1TWG K;  3LAP A;  3K7A K;  1IE0 A;  4WJ3 M;  1TWH K;  1XPP A;  4NOI A;  3T00 A;  2KWA A;  4OIR A;  1WCM C;  2V6T A;  4A3M C;  2CW0 A;  1XZQ B;  4KB2 A;  4XCH A;  4KAR A;  2PMZ L;  3S1R C;  1Y1V K;  4Q5S A;  1O24 A;  1EH1 A;  2YU9 K;  3S17 K;  3S14 C;  4A3B C;  3Q3Q A;  2E2I K;  2NVX A;  4BBR C;  2FQT A;  1TWC A;  2JH3 A;  2E2H K;  1I3Q A;  4C3J K;  5FLM C;  4XSX A;  1WOO A;  1O29 A;  4AYB D;  3S15 C;  5E68 A;  4KMU A;  4A3L C;  3FOE A;  1Y1W K;  3OEP A;  3CAG A;  3S1Q C;  3HOY C;  3GTG C;  1L0W A;  3GTL K;  3RZD C;  1TWF K;  4KB4 A;  1K83 K;  4BLA A;  3PO2 C;  3CQZ A;  5C3E C;  4YFN A;  5IP7 K;  1I6H C;  1ZQ1 C;  1BJT A;  5IYD K;  2NVY A;  1RU0 A;  1O27 A;  1TWA A;  4LQY A;  2JA5 A;  4A3D K;  3G4A A;  1XZQ A;  3GTQ C;  3HOZ C;  1VRQ C;  4A3E C;  1O25 A;  3TFI A;  2NVX K;  1TWC K;  2JA7 A;  1I3Q K;  4KDD A;  3BP8 C;  3S0X A;  1JQW A;  2XCR B;  4G7O A;  2VUM A;  1XXA A;  2R92 C;  4KMD A;  3GTJ A;  1SFO A;  4GTA A;  3S16 C;  2JA6 A;  4BY7 K;  4ILD A;  3PO3 C;  2PPB A;  5IOQ A;  4BY1 K;  4C2M K;  4BKW A;  4KAW X;  2EBB A;  2NVQ K;  1ISE A;  3CQZ K;  3HOX K;  2JA8 K;  4Q4Z A;  2V6S A;  3RZO C;  4BXX K;  1I6V A;  4PAB A;  1DCO A;  4LLG A;  3GTO A;  5IP9 C;  2NVT C;  1I50 K;  1EQR A;  1B4A A;  4G0W A;  4X6A K;  1IQ0 A;  3GTM C;  2Y3P A;  1PJ6 A;  3S1N C;  3TFH A;  4JK1 A;  2O5I A;  2FQO A;  4QIW L;  3M3Y C;  2JA7 K;  3S1M K;  3GIR A;  1R9T C;  1V5V A;  1XZP B;  3GTK C;  3H0G C;  4XLP A;  3ERE D;  4XLN A;  3I4N C;  2R93 K;  5JVO A;  1TWG C;  4KMA A;  3WOD A;  3K7A C;  1TWH C;  2RH6 A;  2R7Z A;  3V4G A;  4P5A A;  4P9S A;  1IBA A;  2E2J C;  4C3H K;  3GTP K;  4WJ4 A;  3A8K A;  2B63 K;  3MML B;  1Y1V C;  1ZYR A;  1IL2 A;  2GAH C;  1VLO A;  2YU9 C;  3S17 C;  3H3V L;  4KAS A;  5CHP A;  3LAJ A;  2E2I C;  4QJV B;  4AYB L;  5C44 K;  1PJ7 A;  3ORE A;  2E2H C;  3SZY A;  3GTG A;  1WQH A;  4C3J C;  3GTO K;  2A6E A;  4YFK A;  3GSI A;  5L46 A;  4P5B A;  5C4X K;  4A3J K;  3H3V D;  4A3F K;  3M4O K;  4Y52 C;  1Y1W C;  3N0B A;  5IYB K;  4LR2 A;  4A3I K;  2D6F C;  2PA8 D;  3GTL C;  3GTQ A;  1WQF A;  4YG2 A;  1TWF C;  1F93 A;  2ZUE A;  1K83 C;  1WIH A;  4RMF A;  1XZP A;  1DCP A;  2PHC B;  4AH6 A;  5IP7 C;  1BS2 A;  5FLM K;  4O2D A;  5IOR A;  2R7Z K;  5IYD C;  1F7U A;  2R92 A;  4A3D C;  1XXC A;  3FOF A;  5M3M K;  4A3G K;  3T02 A;  3DXJ A;  1WQG A;  4LK1 A;  1TWC C;  2A68 A;  1I3Q C;  1VH2 A;  1BGW A;  4XSZ A;  4A93 K;  1EK8 A;  5C4J K;  3HOV K;  4BLB A;  5CJ9 A;  4QJV A;  3HOU K;  3QX3 A;  1O26 A;  3LPX A;  4OIN A;  3HOW K;  4BY7 C;  1SMY A;  4OIQ A;  4Y7N K;  4FZB A;  4BY1 C;  4C2M C;  1USO A;  4MEY A;  2NVQ C;  3CQZ C;  2GAG C;  3FKI A;  3HOX C;  2JA8 C;  1F7V A;  4A3C K;  4J3N A;  4GTF A;  4YFX A;  4BXX C;  3H0G A;  1INN A;  4PAA A;  2NVY K;  2WB1 D;  3S2D K;  2WAQ D;  1I50 C;  3FHZ A;  3I4M K;  3HXA A;  3AQO A;  1TWG A;  2V6U A;  1TWA K;  2JA5 K;  1IS1 A;  3GDZ A;  4X6A C;  4C3I K;  4G0U A;  5TMC A;  4GTD A;  2JA7 C;  1WOP A;  3S1M C;  1JVI A;  1WCM A;  1WSV A;  3G4C A;  3GEH A;  1VJE A;  1C0A A;  2VUM K;  1USM A;  4KN7 A;  3AQP A;  2R93 C;  2P8T A;  2E2I A;  3S2H K;  3GTJ K;  4DDQ A;  1SFO K;  2JA6 K;  3T01 A;  2P5M A;  1O2B A;  3VA7 A;  4C3H C;  3GTP C;  2GSU A;  1DCH A;  3AH5 A;  3HKZ D;  4KMH A;  2O5J A;  2B63 C;  1HI9 A;  4LK0 A;  3FKI K;  1YCL A;  1Y1W A;  1HQM A;  2CFA B;  5C44 C;  3ADA C;  1X31 C;  2A6H A;  3GTO C;  3GTL A;  4A3K K;  5IYC K;  1J6V A;  1TWF A;  2ZUF A;  1K83 A;  1F9N A;  1VGX A;  1ZXO A;  4BBS K;  5C4X C;  4A3J C;  1JOE A;  3OPF A;  4LJZ A;  2PA8 L;  3GEI A;  3L4K A;  4A3F C;  5IOT A;  3NUH A;  4G7Z A;  3M4O C;  2E2J K;  1WCM K;  4A3M K;  1PJ5 A;  5IYB C;  4A3I C;  1J98 A;  1J6X A;  4KAT A;  1WSR A;  2A69 A;  3S1R K;  5M5X K;  3AD9 C;  3SZZ A;  4MQ9 A;  1IW7 A;  3S14 K;  4A3B K;  4GZY A;  4BBR K;  2RGR A;  2PMZ D;  2R7Z C;  1DD5 A;  1G51 A;  4M1X A;  3GEE A;  5M3F K;  5D4D A;  4OIP A;  1AB4 A;  5HL8 A;  4A3G C;  3S15 K;  3EQL A;  4Y52 K;  2R93 A;  4KM8 A;  4A3L K;  1O2A A;  2Y0S L;  2NVX C;  4KN4 A;  3S1Q K;  4A93 C;  5C4J C;  3HOV C;  2GSO A;  3HOY K;  3GTG K;  5JFE A;  3RZD K;  2CFA A;  3HOU C;  2ZFZ A;  3AD8 C;  2W7V A;  3BP3 A;  3PO2 K;  4G0V A;  5EGH A;  1EI6 A;  1BDF A;  5C3E K;  3N0C A;  1GE9 A;  3AD7 C;  3HOW C;  2Y0S D;  1EFW A;  3A8J A;  1I6H K;  5M5Y K;  5EGE A;  1ZVU A;  1I50 A;  1YNN A;  4GFQ A;  1YX2 A;  4Y7N C;  4G7H A;  5M5W K;  3L4J A;  4OIO A;  3GTQ K;  3HOZ K;  4KC6 A;  2WB1 L;  2WAQ L;  4A3E K;  3GTM A;  3TFJ A;  5TJ3 A;  1WOR A;  4A3C C;  2GSN A;  2XCQ A;  1R9T A;  4GT9 A;  2NVY C;  3S2D C;  3GTK A;  3I4M C;  4ZH4 A; 
#chains in the Genus database with same CATH homology
 1BJT A;  1KQ4 A;  2NVY A;  3N3Y A;  4P5B A;  1O27 A;  2P5M A;  1O2B A;  4C3I C;  3VA7 A;  4C3H C;  1TWA A;  1TWH A;  2GSU A;  2XCO A;  3AH5 A;  4LQY A;  4KMH A;  5IOS A;  2JA5 A;  4GTB A;  3G4A A;  3N0B A;  3GTP A;  4LR2 A;  1O25 A;  2B63 A;  1Y1W A;  4GTC A;  3GTQ A;  1WQF A;  2CFA B;  4FM9 A;  2JA7 A;  4KDD A;  3S0X A;  1WIH A;  1Y1V A;  2XCR B;  3GTL A;  2PHC B;  2YU9 A;  2VUM A;  1TWF A;  1XXA A;  1K83 A;  1F9N A;  5IOR A;  1ZXO A;  2E2H A;  4KMD A;  3GTJ A;  3OPF A;  1SFO A;  3L4K A;  1XXB A;  4GTA A;  4KM9 A;  2R92 A;  5IOT A;  3NUH A;  2JA6 A;  4ILD A;  4GTL A;  1XXC A;  3FOF A;  1O28 A;  5IOQ A;  4KAT A;  1WQG A;  4BKW A;  1B4B A;  4KAW X;  1ISE A;  1BGW A;  1EK8 A;  1ZBS A;  4BLB A;  2RGR A;  4GTE A;  5CJ9 A;  3QX3 A;  3BUE A;  1DD5 A;  1O26 A;  3LPX A;  3LAP A;  3GTO A;  4M1X A;  1B4A A;  2KWA A;  4G0W A;  1AB4 A;  4KB2 A;  2Y3P A;  4KAR A;  4FZB A;  4KM8 A;  4C2M C;  1O2A A;  1O24 A;  1EH1 A;  3FKI A;  2GSO A;  3Q3Q A;  2NVX A;  5JFE A;  1TWC A;  2CFA A;  2JH3 A;  4GTF A;  4J3N A;  2ZFZ A;  3ERE D;  1I3Q A;  4G0V A;  5EGH A;  5JVO A;  3H0G A;  4KMA A;  3N0C A;  1GE9 A;  3FHZ A;  1O29 A;  3AQO A;  5EGE A;  1TWG A;  1ZVU A;  2RH6 A;  2R7Z A;  1I50 A;  3V4G A;  1IS1 A;  4GFQ A;  4P5A A;  4G0U A;  4GTD A;  3FOE A;  3L4J A;  1WCM A;  3MML B;  3G4C A;  3OEP A;  4KC6 A;  3CAG A;  3GTM A;  4KAS A;  5CHP A;  5TJ3 A;  3LAJ A;  2GSN A;  4KB4 A;  3ORE A;  4BLA A;  2XCQ A;  3AQP A;  1R9T A;  3GTG A;  1WQH A;  4C3J C;  3CQZ A;  2E2I A;  4GT9 A;  3GTK A;  4DDQ A;  2R93 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...