1WIHA

Solution structure of rsgi ruh-021, a domain ii of ribosome recycling factor from mouse cdna
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
84
structure length
84
Chain Sequence
GSSGSSGLDHITVVTADGKVALNQIGQISMKSPQVILVNMASFPECTAAAIKAIRESGMNLNPEVEGTLIRVPIPKVTSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords mitochondrial ribosome recycling factor
publication title Solution structure of RSGI RUH-021, a domain II of ribosome recycling factor from Mouse cDNA
rcsb
source organism Mus musculus
molecule tags Structural genomics, unknown function
total genus 9
structure length 84
sequence length 84
ec nomenclature
pdb deposition date 2004-05-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.40 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 1wihA00
2Y3PA 5JVOA 2XCRB 3FOFA 2ZFZA 1XXBA 1EH1A 3OREA 4KB4A 2P5MA 2PHCB 3LPXA 1EK8A 1ZVUA 5CJ9A 3LAJA 1IS1A 1GE9A 1F9NA 4J3NA 1BGWA 1BJTA 4DDQA 3MMLB 1B4AA 3VA7A 3NUHA 4KC6A 1DD5A 1WQFA 3BUEA 4KB2A 4KDDA 2KWAA 3L4KA 3ERED 2XCQA 4GFQA 3L4JA 4KAWX 2RGRA 3CAGA 2XCOA 1ISEA 1AB4A 3FOEA 1WQGA 1B4BA 1XXCA 3V4GA 4FM9A 1XXAA 4G0VA 1WQHA 3OPFA 3QX3A 4G0WA 1WIHA 4G0UA 3LAPA 3FHZA 3OEPA
chains in the Genus database with same CATH superfamily
2JA7C 3HOUK 4A3KC 3GSIA 1EK8A 4YG2A 4AH6A 3GTOA 1WORA 4MEXA 3M4OC 2ZUEA 3NUHA 3S1QC 3GEIA 5IYDC 1TWFK 1Y1VA 1I50C 3HOVK 4BLAA 3L4JA 4BBRK 1XZQB 4RMFA 1F7UA 4KM8A 4G7OA 3FOEA 1K83C 4M1XA 2Y0SD 4A3KK 2XCRB 3S15K 4A3JK 3S1MC 1EI6A 5L46A 2PMZL 4C3IK 4LJZA 2NVQK 4A3EC 3M4OK 1I6HK 4DDQA 2PA8D 5E68A 3CQZA 3ERED 3GTQA 2E2HC 3GIRA 4OIOA 3FKIC 4G0UA 1IW7A 2A6EA 2JA7A 5JVOA 3K7AC 3S14K 4A93K 4A3DC 2P5MA 1IL2A 3GTLC 2NVXA 1JOEA 4PAAA 2R7ZC 1JQWA 3BP8C 3TFHA 4GTCA 4KN7A 4YFXA 5C4JK 1I50A 2XCQA 3HOXK 2A6HA 5CHPA 5D4DA 2GSOA 3HOYK 4YFKA 3T02A 1K83A 2VUMC 2R92K 2BE5A 4KM9A 1VLOA 4KASA 1TWGC 4XSZA 5IOTA 3JSTA 4WILA 4C3HK 3AD7C 4XLPA 3S17C 4A3CC 1GE9A 2A68A 2A69A 1JVIA 3GEEA 3AQOA 3DXJA 1Y1VC 4KAWX 1EQRA 4BY7C 1TWCA 2VUMK 1B4BA 1C0AA 2NVTK 4LK0A 3FKIA 5HL8A 4XSXA 4KMUA 4FZBA 1O29A 3HKZD 2JA6C 4GTBA 5CJ9A 2R7ZA 1XZPA 4QIWD 5M5YK 1DCHA 1HQMA 3GTOK 3I4NC 2R93A 1YNNA 1WOSA 1Y1VK 4BY7K 4AYBD 1O2FB 5C44C 2B63C 5IP7C 5FLMK 2V6UA 4OINA 1IQ0A 5C4XC 2Y3PA 5IOQA 3HOWC 4Y7NK 2YU9A 4A3FC 5JFEA 4LR2A 2PHCB 2NVXC 2E2JK 2V6TA 2JA5K 1X31C 5IYCK 1ZXOA 3CQZK 1DD5A 3BUEA 5C44K 4KDDA 3GTPC 2WB1L 4LOWA 3GTQK 1ISEA 4C3JC 3PO2C 1WOPA 4A3GK 4Q5SA 4KMHA 3TFJA 1YX2A 4A3BK 1O26A 1WOOA 5C4XK 3S0XA 3S1RK 2JA7K 3N3YA 1BS2A 4A3FK 3FOFA 1XZPB 1O25A 1BDFA 2JA8C 1WCMC 5EGEA 2NVXK 4BY1C 2JA6A 1J98A 1IS1A 1F9NA 5TMFA 1TWHA 1V5VA 2O5IA 3S1QK 2GSNA 5IYDK 1ZBSA 1I50K 1I6VA 1PJ7A 4GTDA 4ILDA 2B63A 3EQLA 2CW0A 1K83K 4C2MC 1TWCC 1TWGA 1VRQC 4G0VA 3QX3A 5C3EC 5M5WK 4KB2A 4WJ4A 3S1MK 2JA8K 3G4AA 4BY1K 1EH1A 2WAQD 2V6SA 1I3QA 1YCLA 3TTGA 1ZVUA 3RZOC 4A3EK 1J6XA 3M3YC 5IP9C 2R93C 3GTPA 1R9TA 5FJ8K 2RGRA 1TWCK 2E2HK 1USMA 4JK1A 4KARA 3FKIK 5C3EK 1DCOA 3FHZA 1TWAC 3K7AK 2GAGC 3SZZA 4A3DK 1WCMA 1XXBA 4NOIA 2YU9C 3GTLK 3S1NC 3RZOK 1WSVA 2R7ZK 2PMZD 3BP3A 3A8JA 3GTKA 4GTFA 4C45A 4MEYA 4BBSC 3H3VL 4Q4ZA 4KMDA 1EFWA 2XCOA 1XXAA 3S2DC 1L0WA 1TWGK 3N0BA 3TFIA 2YU9K 3GTJA 3S1NK 4LK1A 4G7HA 3GTMA 4LLGA 4A3CK 3PO3C 3S17K 1DCPA 3S2HC 1BGWA 4BBSK 1TWHC 4KC6A 4OIRA 1KQ4A 2ZUFA 1SFOA 4BXXC 4A3LC 1O2BA 2Y0SL 3GTGA 1XXCA 2NVYA 3S2DK 2R92A 1WQHA 3OPFA 4Y52C 3OEPA 1TWAA 2PA8L 3PO3K 3S2HK 2JA6K 1I3QC 4GTEA 3LAJA 3HXAA 3I4NK 1TWHK 1IBAA 4GZYA 4GFQA 2GSUA 3T01A 2B63K 4BBRC 1R9TC 5IP7K 2CFAB 2E2IA 3IPJA 1XPPA 1F7VA 2FQTA 4Y52K 1ZYRA 3HOWK 3ADAC 3S15C 4A3IC 1WSRA 4A3JC 2JH3A 5IOSA 1I3QK 3GDZA 4C3IC 4BKWA 4QJVA 2NVQC 3SZYA 1BJTA 1I6HC 3MMLB 3S16C 1Y1WA 3GTKC 3GTPK 1WQFA 3L4KA 3HOZC 1R9TK 1F93A 4C3JK 5IORA 3PO2K 1RU0A 1WQGA 4P5AA 1ZQ1C 3H0GA 4XLNA 3G4CA 3LAPA 4P9SA 4A3IK 1O28A 1WCMK 3GTJC 3S14C 4A93C 5TMCA 4KATA 1IE0A 3GTMC 4KN4A 2JA5A 3S16K 4G7ZA 3GTKK 1UV7A 3HOZK 1B4AA 1HI9A 5C4JC 1TWFA 4ZH4A 2D6FC 3HOXC 1SFOC 4MQ9A 3WODA 4PABA 4C2MK 1INNA 3HOYC 3N0CA 2WB1D 4GTAA 3GTGC 2NVYC 4YFNA 4G0WA 2R92C 4X6AC 4XCHA 4BLBA 3HKZL 3GTJK 4QJVB 4QIWL 1G51A 1VGXA 3I4MC 3T00A 3GTMK 1SMYA 3LPXA 4C3HC 5M3MK 3M3YK 5IP9K 4AYBL 1O2AA 2R93K 2PPBA 1SFOK 1AB4A 3GTGK 2NVYK 2NVTC 4FM9A 2E2IC 3RZDC 4X6AK 4A3MC 1WIHA 2P8TA 1TWAK 2CFAA 5EGHA 3I4MK 2ZFZA 3A8IA 4KB4A 1J6VA 2EBBA 4P5BA 1VJEA 4OIPA 3AQPA 3GTOC 1O24A 3A8KA 4GTLA 3AH5A 2RH6A 1Y1WC 4WJ3M 1USOA 5IYBC 2E2HA 5TJ3A 2E2IK 1YNJA 3RZDK 4A3MK 5FLMC 2GAHC 3V4GA 1XZQA 3H0GC 3AD8C 4OIQA 2W7VA 4GT9A 1PJ5A 4Y7NC 3HOUC 3GTLA 1J6WA 3OREA 1PJ6A 1VH2A 4J3NA 2O5JA 2E2JC 2JA5C 1Y1WK 3VA7A 1O27A 5IYBK 3CQZC 5IYCC 2KWAA 4O2DA 4BXXK 1TWFC 2FQOA 5M5XK 3Q3QA 3CAGA 4LQYA 3HOVC 4A3LK 3GTQC 3H3VD 2VUMA 3AD9C 4A3GC 4KMAA 3H0GK 3GEHA 4A3BC 5M3FK 2WAQL 3S1RC
chains in the Genus database with same CATH topology
4FZBA 1O28A 1WCMA 1XXBA 1O29A 4KATA 1EK8A 4GTBA 5CJ9A 2R7ZA 2JA5A 3GTOA 3GTKA 2R93A 4GTFA 1B4AA 3NUHA 1TWFA 1Y1VA 4BLAA 4KMDA 3L4JA 4KM8A 2XCOA 3FOEA 3N0CA 4M1XA 4GTAA 1XXAA 4G0WA 4BLBA 2Y3PA 3N0BA 5IOQA 2XCRB 3GTJA 2YU9A 5JFEA 4LR2A 2PHCB 3GTMA 3LPXA 4C3HC 1BGWA 4DDQA 1O2AA 4KC6A 1ZXOA 1KQ4A 3CQZA 1DD5A 3BUEA 3ERED 4KDDA 1SFOA 1ISEA 3GTQA 1AB4A 4C3JC 1O2BA 4KMHA 3GTGA 1XXCA 2NVYA 4FM9A 1O26A 2R92A 1WQHA 3OPFA 3S0XA 4G0UA 1WIHA 3OEPA 3N3YA 2JA7A 1TWAA 5JVOA 2CFAA 3FOFA 5EGHA 1O25A 2ZFZA 5EGEA 4KB4A 2P5MA 2NVXA 4P5BA 2JA6A 4GTEA 3LAJA 1IS1A 1F9NA 3AQPA 1TWHA 1O24A 4GTCA 2GSNA 1ZBSA 3AH5A 4GTLA 2RH6A 1I50A 4GTDA 4ILDA 2XCQA 4GFQA 2GSUA 2B63A 5CHPA 2E2HA 5TJ3A 2CFAB 2GSOA 2E2IA 4C2MC 1K83A 3V4GA 4G0VA 3QX3A 4KM9A 4KB2A 4KASA 4GT9A 3G4AA 5IOTA 3GTLA 2JH3A 1EH1A 3OREA 5IOSA 1I3QA 4C3IC 4BKWA 1ZVUA 1GE9A 4J3NA 1BJTA 3MMLB 1Y1WA 3VA7A 1O27A 1WQFA 3L4KA 3GTPA 2KWAA 1R9TA 3AQOA 2RGRA 4KAWX 3Q3QA 3CAGA 4LQYA 5IORA 1TWCA 1WQGA 1B4BA 4P5AA 2VUMA 4KMAA 3H0GA 4KARA 3FKIA 3G4CA 3LAPA 3FHZA 1TWGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Y3P A;  5JVO A;  2XCR B;  3FOF A;  2ZFZ A;  1XXB A;  1EH1 A;  3ORE A;  4KB4 A;  2P5M A;  2PHC B;  3LPX A;  1EK8 A;  1ZVU A;  5CJ9 A;  3LAJ A;  1IS1 A;  1GE9 A;  1F9N A;  4J3N A;  1BGW A;  1BJT A;  4DDQ A;  3MML B;  1B4A A;  3VA7 A;  3NUH A;  4KC6 A;  1DD5 A;  1WQF A;  3BUE A;  4KB2 A;  4KDD A;  2KWA A;  3L4K A;  3ERE D;  2XCQ A;  4GFQ A;  3L4J A;  4KAW X;  2RGR A;  3CAG A;  2XCO A;  1ISE A;  1AB4 A;  3FOE A;  1WQG A;  1B4B A;  1XXC A;  3V4G A;  4FM9 A;  1XXA A;  4G0V A;  1WQH A;  3OPF A;  3QX3 A;  4G0W A;  1WIH A;  4G0U A;  3LAP A;  3FHZ A;  3OEP A; 
#chains in the Genus database with same CATH topology
 2JA7 C;  3HOU K;  4A3K C;  3GSI A;  1EK8 A;  4YG2 A;  4AH6 A;  3GTO A;  1WOR A;  4MEX A;  3M4O C;  2ZUE A;  3NUH A;  3S1Q C;  3GEI A;  5IYD C;  1TWF K;  1Y1V A;  1I50 C;  3HOV K;  4BLA A;  3L4J A;  4BBR K;  1XZQ B;  4RMF A;  1F7U A;  4KM8 A;  4G7O A;  3FOE A;  1K83 C;  4M1X A;  2Y0S D;  4A3K K;  2XCR B;  3S15 K;  4A3J K;  3S1M C;  1EI6 A;  5L46 A;  2PMZ L;  4C3I K;  4LJZ A;  2NVQ K;  4A3E C;  3M4O K;  1I6H K;  4DDQ A;  2PA8 D;  5E68 A;  3CQZ A;  3ERE D;  3GTQ A;  2E2H C;  3GIR A;  4OIO A;  3FKI C;  4G0U A;  1IW7 A;  2A6E A;  2JA7 A;  5JVO A;  3K7A C;  3S14 K;  4A93 K;  4A3D C;  2P5M A;  1IL2 A;  3GTL C;  2NVX A;  1JOE A;  4PAA A;  2R7Z C;  1JQW A;  3BP8 C;  3TFH A;  4GTC A;  4KN7 A;  4YFX A;  5C4J K;  1I50 A;  2XCQ A;  3HOX K;  2A6H A;  5CHP A;  5D4D A;  2GSO A;  3HOY K;  4YFK A;  3T02 A;  1K83 A;  2VUM C;  2R92 K;  2BE5 A;  4KM9 A;  1VLO A;  4KAS A;  1TWG C;  4XSZ A;  5IOT A;  3JST A;  4WIL A;  4C3H K;  3AD7 C;  4XLP A;  3S17 C;  4A3C C;  1GE9 A;  2A68 A;  2A69 A;  1JVI A;  3GEE A;  3AQO A;  3DXJ A;  1Y1V C;  4KAW X;  1EQR A;  4BY7 C;  1TWC A;  2VUM K;  1B4B A;  1C0A A;  2NVT K;  4LK0 A;  3FKI A;  5HL8 A;  4XSX A;  4KMU A;  4FZB A;  1O29 A;  3HKZ D;  2JA6 C;  4GTB A;  5CJ9 A;  2R7Z A;  1XZP A;  4QIW D;  5M5Y K;  1DCH A;  1HQM A;  3GTO K;  3I4N C;  2R93 A;  1YNN A;  1WOS A;  1Y1V K;  4BY7 K;  4AYB D;  1O2F B;  5C44 C;  2B63 C;  5IP7 C;  5FLM K;  2V6U A;  4OIN A;  1IQ0 A;  5C4X C;  2Y3P A;  5IOQ A;  3HOW C;  4Y7N K;  2YU9 A;  4A3F C;  5JFE A;  4LR2 A;  2PHC B;  2NVX C;  2E2J K;  2V6T A;  2JA5 K;  1X31 C;  5IYC K;  1ZXO A;  3CQZ K;  1DD5 A;  3BUE A;  5C44 K;  4KDD A;  3GTP C;  2WB1 L;  4LOW A;  3GTQ K;  1ISE A;  4C3J C;  3PO2 C;  1WOP A;  4A3G K;  4Q5S A;  4KMH A;  3TFJ A;  1YX2 A;  4A3B K;  1O26 A;  1WOO A;  5C4X K;  3S0X A;  3S1R K;  2JA7 K;  3N3Y A;  1BS2 A;  4A3F K;  3FOF A;  1XZP B;  1O25 A;  1BDF A;  2JA8 C;  1WCM C;  5EGE A;  2NVX K;  4BY1 C;  2JA6 A;  1J98 A;  1IS1 A;  1F9N A;  5TMF A;  1TWH A;  1V5V A;  2O5I A;  3S1Q K;  2GSN A;  5IYD K;  1ZBS A;  1I50 K;  1I6V A;  1PJ7 A;  4GTD A;  4ILD A;  2B63 A;  3EQL A;  2CW0 A;  1K83 K;  4C2M C;  1TWC C;  1TWG A;  1VRQ C;  4G0V A;  3QX3 A;  5C3E C;  5M5W K;  4KB2 A;  4WJ4 A;  3S1M K;  2JA8 K;  3G4A A;  4BY1 K;  1EH1 A;  2WAQ D;  2V6S A;  1I3Q A;  1YCL A;  3TTG A;  1ZVU A;  3RZO C;  4A3E K;  1J6X A;  3M3Y C;  5IP9 C;  2R93 C;  3GTP A;  1R9T A;  5FJ8 K;  2RGR A;  1TWC K;  2E2H K;  1USM A;  4JK1 A;  4KAR A;  3FKI K;  5C3E K;  1DCO A;  3FHZ A;  1TWA C;  3K7A K;  2GAG C;  3SZZ A;  4A3D K;  1WCM A;  1XXB A;  4NOI A;  2YU9 C;  3GTL K;  3S1N C;  3RZO K;  1WSV A;  2R7Z K;  2PMZ D;  3BP3 A;  3A8J A;  3GTK A;  4GTF A;  4C45 A;  4MEY A;  4BBS C;  3H3V L;  4Q4Z A;  4KMD A;  1EFW A;  2XCO A;  1XXA A;  3S2D C;  1L0W A;  1TWG K;  3N0B A;  3TFI A;  2YU9 K;  3GTJ A;  3S1N K;  4LK1 A;  4G7H A;  3GTM A;  4LLG A;  4A3C K;  3PO3 C;  3S17 K;  1DCP A;  3S2H C;  1BGW A;  4BBS K;  1TWH C;  4KC6 A;  4OIR A;  1KQ4 A;  2ZUF A;  1SFO A;  4BXX C;  4A3L C;  1O2B A;  2Y0S L;  3GTG A;  1XXC A;  2NVY A;  3S2D K;  2R92 A;  1WQH A;  3OPF A;  4Y52 C;  3OEP A;  1TWA A;  2PA8 L;  3PO3 K;  3S2H K;  2JA6 K;  1I3Q C;  4GTE A;  3LAJ A;  3HXA A;  3I4N K;  1TWH K;  1IBA A;  4GZY A;  4GFQ A;  2GSU A;  3T01 A;  2B63 K;  4BBR C;  1R9T C;  5IP7 K;  2CFA B;  2E2I A;  3IPJ A;  1XPP A;  1F7V A;  2FQT A;  4Y52 K;  1ZYR A;  3HOW K;  3ADA C;  3S15 C;  4A3I C;  1WSR A;  4A3J C;  2JH3 A;  5IOS A;  1I3Q K;  3GDZ A;  4C3I C;  4BKW A;  4QJV A;  2NVQ C;  3SZY A;  1BJT A;  1I6H C;  3MML B;  3S16 C;  1Y1W A;  3GTK C;  3GTP K;  1WQF A;  3L4K A;  3HOZ C;  1R9T K;  1F93 A;  4C3J K;  5IOR A;  3PO2 K;  1RU0 A;  1WQG A;  4P5A A;  1ZQ1 C;  3H0G A;  4XLN A;  3G4C A;  3LAP A;  4P9S A;  4A3I K;  1O28 A;  1WCM K;  3GTJ C;  3S14 C;  4A93 C;  5TMC A;  4KAT A;  1IE0 A;  3GTM C;  4KN4 A;  2JA5 A;  3S16 K;  4G7Z A;  3GTK K;  1UV7 A;  3HOZ K;  1B4A A;  1HI9 A;  5C4J C;  1TWF A;  4ZH4 A;  2D6F C;  3HOX C;  1SFO C;  4MQ9 A;  3WOD A;  4PAB A;  4C2M K;  1INN A;  3HOY C;  3N0C A;  2WB1 D;  4GTA A;  3GTG C;  2NVY C;  4YFN A;  4G0W A;  2R92 C;  4X6A C;  4XCH A;  4BLB A;  3HKZ L;  3GTJ K;  4QJV B;  4QIW L;  1G51 A;  1VGX A;  3I4M C;  3T00 A;  3GTM K;  1SMY A;  3LPX A;  4C3H C;  5M3M K;  3M3Y K;  5IP9 K;  4AYB L;  1O2A A;  2R93 K;  2PPB A;  1SFO K;  1AB4 A;  3GTG K;  2NVY K;  2NVT C;  4FM9 A;  2E2I C;  3RZD C;  4X6A K;  4A3M C;  1WIH A;  2P8T A;  1TWA K;  2CFA A;  5EGH A;  3I4M K;  2ZFZ A;  3A8I A;  4KB4 A;  1J6V A;  2EBB A;  4P5B A;  1VJE A;  4OIP A;  3AQP A;  3GTO C;  1O24 A;  3A8K A;  4GTL A;  3AH5 A;  2RH6 A;  1Y1W C;  4WJ3 M;  1USO A;  5IYB C;  2E2H A;  5TJ3 A;  2E2I K;  1YNJ A;  3RZD K;  4A3M K;  5FLM C;  2GAH C;  3V4G A;  1XZQ A;  3H0G C;  3AD8 C;  4OIQ A;  2W7V A;  4GT9 A;  1PJ5 A;  4Y7N C;  3HOU C;  3GTL A;  1J6W A;  3ORE A;  1PJ6 A;  1VH2 A;  4J3N A;  2O5J A;  2E2J C;  2JA5 C;  1Y1W K;  3VA7 A;  1O27 A;  5IYB K;  3CQZ C;  5IYC C;  2KWA A;  4O2D A;  4BXX K;  1TWF C;  2FQO A;  5M5X K;  3Q3Q A;  3CAG A;  4LQY A;  3HOV C;  4A3L K;  3GTQ C;  3H3V D;  2VUM A;  3AD9 C;  4A3G C;  4KMA A;  3H0G K;  3GEH A;  4A3B C;  5M3F K;  2WAQ L;  3S1R C; 
#chains in the Genus database with same CATH homology
 4FZB A;  1O28 A;  1WCM A;  1XXB A;  1O29 A;  4KAT A;  1EK8 A;  4GTB A;  5CJ9 A;  2R7Z A;  2JA5 A;  3GTO A;  3GTK A;  2R93 A;  4GTF A;  1B4A A;  3NUH A;  1TWF A;  1Y1V A;  4BLA A;  4KMD A;  3L4J A;  4KM8 A;  2XCO A;  3FOE A;  3N0C A;  4M1X A;  4GTA A;  1XXA A;  4G0W A;  4BLB A;  2Y3P A;  3N0B A;  5IOQ A;  2XCR B;  3GTJ A;  2YU9 A;  5JFE A;  4LR2 A;  2PHC B;  3GTM A;  3LPX A;  4C3H C;  1BGW A;  4DDQ A;  1O2A A;  4KC6 A;  1ZXO A;  1KQ4 A;  3CQZ A;  1DD5 A;  3BUE A;  3ERE D;  4KDD A;  1SFO A;  1ISE A;  3GTQ A;  1AB4 A;  4C3J C;  1O2B A;  4KMH A;  3GTG A;  1XXC A;  2NVY A;  4FM9 A;  1O26 A;  2R92 A;  1WQH A;  3OPF A;  3S0X A;  4G0U A;  1WIH A;  3OEP A;  3N3Y A;  2JA7 A;  1TWA A;  5JVO A;  2CFA A;  3FOF A;  5EGH A;  1O25 A;  2ZFZ A;  5EGE A;  4KB4 A;  2P5M A;  2NVX A;  4P5B A;  2JA6 A;  4GTE A;  3LAJ A;  1IS1 A;  1F9N A;  3AQP A;  1TWH A;  1O24 A;  4GTC A;  2GSN A;  1ZBS A;  3AH5 A;  4GTL A;  2RH6 A;  1I50 A;  4GTD A;  4ILD A;  2XCQ A;  4GFQ A;  2GSU A;  2B63 A;  5CHP A;  2E2H A;  5TJ3 A;  2CFA B;  2GSO A;  2E2I A;  4C2M C;  1K83 A;  3V4G A;  4G0V A;  3QX3 A;  4KM9 A;  4KB2 A;  4KAS A;  4GT9 A;  3G4A A;  5IOT A;  3GTL A;  2JH3 A;  1EH1 A;  3ORE A;  5IOS A;  1I3Q A;  4C3I C;  4BKW A;  1ZVU A;  1GE9 A;  4J3N A;  1BJT A;  3MML B;  1Y1W A;  3VA7 A;  1O27 A;  1WQF A;  3L4K A;  3GTP A;  2KWA A;  1R9T A;  3AQO A;  2RGR A;  4KAW X;  3Q3Q A;  3CAG A;  4LQY A;  5IOR A;  1TWC A;  1WQG A;  1B4B A;  4P5A A;  2VUM A;  4KMA A;  3H0G A;  4KAR A;  3FKI A;  3G4C A;  3LAP A;  3FHZ A;  1TWG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...