1WIHA

Solution structure of rsgi ruh-021, a domain ii of ribosome recycling factor from mouse cdna
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
84
structure length
84
Chain Sequence
GSSGSSGLDHITVVTADGKVALNQIGQISMKSPQVILVNMASFPECTAAAIKAIRESGMNLNPEVEGTLIRVPIPKVTSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of RSGI RUH-021, a domain II of ribosome recycling factor from Mouse cDNA
rcsb
source organism Mus musculus
molecule tags Structural genomics, unknown function
molecule keywords mitochondrial ribosome recycling factor
total genus 9
structure length 84
sequence length 84
ec nomenclature
pdb deposition date 2004-05-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.40 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 1wihA00
3V4GA 2XCOA 1DD5A 5JVOA 4G0VA 1WQHA 1ZVUA 3LAJA 3FOEA 3L4JA 1B4BA 3BUEA 3ERED 2P5MA 1BGWA 4FM9A 3OEPA 2KWAA 3OPFA 3LAPA 4G0WA 3CAGA 1XXAA 4KC6A 3NUHA 3L4KA 1XXCA 2Y3PA 2XCRB 3FOFA 2XCQA 4J3NA 3OREA 4KAWX 5CJ9A 2RGRA 4G0UA 3MMLB 1GE9A 1XXBA 1EH1A 1AB4A 1ISEA 3FHZA 3VA7A 4GFQA 2PHCB 2ZFZA 1B4AA 4KDDA 1WQFA 1WIHA 4KB2A 3LPXA 4DDQA 3QX3A 1WQGA 1BJTA 1IS1A 1EK8A 1F9NA 4KB4A
chains in the Genus database with same CATH superfamily
4A3LC 2V6SA 4A3DC 1BGWA 4BLAA 1O26A 3A8KA 4A3GC 4C3JC 3HOUK 3GTGC 1I6HC 2PMZL 2JA6A 4AH6A 3S2DC 4MEYA 1WOSA 4Y52C 5M5XK 3S17K 1BS2A 3AH5A 4KARA 1Y1WK 1ZBSA 4XLNA 5TMFA 1F93A 4QJVA 2XCOA 1YNNA 4PABA 1TWFK 1DCHA 4QIWD 4QIWL 4OIPA 1ZYRA 5C4XC 4A3EK 1K83A 1F7VA 1DCPA 1TWFC 2NVQK 3N0CA 4XCHA 2VUMC 3A8IA 5JFEA 3GTOA 3G4AA 2PPBA 2R92A 3PO3K 3JSTA 2R93A 4KB4A 3LAPA 3HOYK 1ZQ1C 4KMHA 3GTPC 2NVYC 1ZVUA 3GTPK 1J6VA 5IOTA 1TWGK 2CFAB 3AQOA 2B63A 2E2JC 1IQ0A 1IBAA 4LJZA 4G7ZA 2PMZD 1GE9A 1O27A 1AB4A 3HOZC 2V6UA 5M5YK 3DXJA 5M5WK 2NVXK 4GFQA 4A3CK 3BP3A 4KB2A 1JOEA 1I50K 3QX3A 1BJTA 4XSZA 2GAGC 4BY1C 3HOYC 4BKWA 1TWHA 3S1NK 4LR2A 2E2IC 4BBRC 4A3JC 1USMA 1VJEA 4G0WA 3S1QK 3N0BA 4KN4A 5CJ9A 1I3QA 3S1RC 4BY1K 2BE5A 3GTOC 4GTCA 1HI9A 1IE0A 2JA6C 3GTGA 4A3LK 3S14K 1I6HK 3RZOC 1G51A 1F7UA 1V5VA 3VA7A 5IYDK 1TWGA 4YFNA 3GTPA 4YFXA 3GTGK 3PO2C 4C3IK 2JH3A 4C3JK 1I3QK 2R93K 5E68A 1PJ7A 4JK1A 1YX2A 1C0AA 4YFKA 1YNJA 3OEPA 3GTJC 2R92K 3S17C 4A3IK 4ILDA 2KWAA 3ADAC 3AD8C 4C45A 3M3YK 2GAHC 1TWHK 3TFJA 2JA5A 2O5JA 1ISEA 3HKZD 2JA8C 4KDDA 4ZH4A 4Y7NC 5FLMC 1PJ5A 2R93C 4XSXA 1Y1WA 2P5MA 1XZQB 5FLMK 5TMCA 2WAQD 5IYBK 3S16C 1IL2A 3S2HC 4XLPA 4OINA 3HOWC 1K83C 1J6XA 2E2JK 3MMLB 4BLBA 1O2AA 4MEXA 1PJ6A 3FHZA 4A3KC 2PHCB 2ZFZA 4KM9A 4NOIA 4QJVB 3H0GC 1O25A 3HOVC 2A68A 4A3GK 5C3EK 2JA7A 4C3HC 3HXAA 4KMUA 4LK1A 1Y1VC 2XCQA 1SFOA 2NVTC 4LOWA 1ZXOA 2R7ZA 3S15K 4GTBA 1WCMA 1EH1A 1O24A 3H3VL 2YU9A 5D4DA 5IP7C 3FKIK 2CW0A 4Y7NK 4BXXK 4LK0A 1XZPA 3AD7C 2JA6K 3V4GA 5IORA 3GTKK 3S15C 3FOEA 3FKIA 5EGHA 3RZOK 4LQYA 1O29A 2EBBA 3S0XA 3GSIA 4GTAA 3M3YC 3L4KA 3PO2K 4G7OA 1UV7A 1WCMK 4A3IC 4FZBA 4GTLA 3T01A 3TFIA 1SMYA 2Y0SL 5TJ3A 1VRQC 1IS1A 1DCOA 3CQZC 4X6AK 1DD5A 1TWCC 1I6VA 5IOSA 2V6TA 3HOZK 2GSOA 2D6FC 3NUHA 1XXCA 1BDFA 1WCMC 1INNA 1WOOA 3FOFA 3GTKA 3OREA 4GZYA 1I50C 2CFAA 2VUMA 5M3FK 3RZDC 5IP9K 5IYCC 1KQ4A 3TTGA 4GTEA 3WODA 1VGXA 3HOXK 1X31C 3H0GA 2NVYA 1HQMA 1WSVA 4X6AC 2PA8L 3GTMK 4M1XA 3T00A 5EGEA 1J98A 2E2HA 2PA8D 2WB1L 4A3CC 2XCRB 1IW7A 2JA5K 2ZUFA 2FQTA 2GSNA 1SFOC 4KMDA 3GEHA 1EI6A 1WIHA 3GTQK 1YCLA 5M3MK 4A3FC 4OIQA 1TWHC 5JVOA 3LAJA 3HOUC 1WORA 4YG2A 4C2MK 1R9TA 3GTMC 3GTJK 2NVQC 3GTKC 3FKIC 2GSUA 2JA7C 4Y52K 4Q4ZA 3K7AC 1I3QC 2Y3PA 2A6HA 4AYBD 4A3FK 1Y1VA 4KASA 5C4JK 4BY7K 5IYCK 5CHPA 3GEIA 2Y0SD 2WAQL 4KM8A 4O2DA 1TWCK 1WQFA 4P5BA 4DDQA 4A3BK 3GTLA 1F9NA 3AD9C 3N3YA 4AYBL 1WQHA 3HOWK 5C4JC 4BY7C 4C3IC 3S1MC 2E2HC 1TWCA 3OPFA 2NVXA 4OIOA 3K7AK 4A3KK 3HKZL 4GTDA 1WSRA 4KAWX 2JA5C 4G0UA 1XXBA 1RU0A 5C4XK 3I4NK 2B63K 4BBSK 5FJ8K 1TWAA 3S16K 5C3EC 3H3VD 1TWAK 3GIRA 3LPXA 1VLOA 2A6EA 1EK8A 5IYBC 4A3MK 1XPPA 4A93C 2WB1D 2W7VA 3L4JA 3ERED 5C44C 3GEEA 3GTQA 3I4NC 4WJ3M 2RH6A 1USOA 4GTFA 3GTOK 1WOPA 1XXAA 4BXXC 2RGRA 4MQ9A 4A3MC 3AQPA 3GTLK 1O28A 1I50A 5HL8A 1K83K 4P9SA 3T02A 5L46A 1O2FB 3GTLC 1B4AA 3EQLA 2ZUEA 4KN7A 3I4MK 1O2BA 1VH2A 1XZQA 4A3BC 1Y1VK 1L0WA 2A69A 3H0GK 3HOVK 4G0VA 2NVXC 3S1RK 3S2DK 4Q5SA 3GDZA 3GTJA 3S1QC 1R9TK 5IYDC 4KC6A 3M4OC 3Q3QA 3S1NC 4KATA 4A3DK 3G4CA 2R92C 3S14C 1J6WA 2NVTK 4C2MC 4A3EC 1WQGA 3M4OK 4WILA 2P8TA 4P5AA 3GTQC 4FM9A 2E2HK 4WJ4A 1Y1WC 1JVIA 1TWFA 4PAAA 3CAGA 1R9TC 3GTMA 2NVYK 3RZDK 2O5IA 4LLGA 4OIRA 3IPJA 1XZPB 3S1MK 3SZYA 5C44K 4GT9A 3SZZA 1TWAC 3TFHA 3CQZA 3HOXC 2VUMK 2E2IK 2E2IA 2JA8K 3S2HK 4RMFA 3CQZK 1B4BA 3A8JA 1EQRA 3BUEA 4G7HA 1JQWA 3PO3C 5IP9C 4KMAA 2B63C 4BBSC 2YU9K 2FQOA 1EFWA 4J3NA 2R7ZK 4C3HK 3I4MC 1SFOK 1TWGC 4A93K 5IP7K 2R7ZC 4BBRK 4A3JK 3BP8C 2YU9C 2JA7K 5IOQA
chains in the Genus database with same CATH topology
1DD5A 3L4JA 3ERED 1BGWA 3GTQA 3OEPA 5IOSA 4ILDA 2KWAA 2RH6A 4GTFA 2GSOA 4BLAA 1O26A 1XXAA 3NUHA 1XXCA 3GTKA 4C3JC 3FOFA 3OREA 2CFAA 2RGRA 2JA6A 2VUMA 2JA5A 3AQPA 1ISEA 1O28A 1I50A 1KQ4A 4GTEA 1B4AA 4KDDA 3AH5A 4KARA 1ZBSA 1O2BA 3H0GA 2NVYA 2XCOA 4G0VA 1Y1WA 2P5MA 4M1XA 3GTJA 5EGEA 1K83A 2E2HA 4KC6A 3Q3QA 2XCRB 3N0CA 4KATA 2GSNA 3MMLB 4BLBA 1O2AA 3G4CA 4KMDA 5JFEA 3FHZA 3GTOA 3G4AA 4C2MC 2PHCB 2ZFZA 4KM9A 2R92A 1WIHA 1O25A 1WQGA 2R93A 4KB4A 3LAPA 4P5AA 4KMHA 5JVOA 3LAJA 1ZVUA 2JA7A 4C3HC 4FM9A 1R9TA 5IOTA 2CFAB 3AQOA 2GSUA 1TWFA 2B63A 3GTMA 3CAGA 2Y3PA 2XCQA 1SFOA 1Y1VA 4KASA 1ZXOA 1GE9A 1O27A 2R7ZA 4GTBA 1WCMA 1EH1A 1AB4A 5CHPA 1O24A 4KM8A 4GFQA 2YU9A 4GT9A 1WQFA 4KB2A 4P5BA 4DDQA 3QX3A 3CQZA 1BJTA 3GTLA 1F9NA 3N3YA 2E2IA 3V4GA 5IORA 4BKWA 1WQHA 1TWHA 3FOEA 4C3IC 1B4BA 3BUEA 4LR2A 3FKIA 1TWCA 5EGHA 4KMAA 4LQYA 1O29A 3OPFA 2NVXA 3S0XA 4G0WA 3N0BA 4GTAA 3L4KA 4GTDA 4J3NA 4KAWX 4FZBA 5CJ9A 1I3QA 4G0UA 4GTCA 1XXBA 3GTGA 4GTLA 1TWAA 3VA7A 1TWGA 3LPXA 3GTPA 5TJ3A 1IS1A 1EK8A 2JH3A 5IOQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3V4G A;  2XCO A;  1DD5 A;  5JVO A;  4G0V A;  1WQH A;  1ZVU A;  3LAJ A;  3FOE A;  3L4J A;  1B4B A;  3BUE A;  3ERE D;  2P5M A;  1BGW A;  4FM9 A;  3OEP A;  2KWA A;  3OPF A;  3LAP A;  4G0W A;  3CAG A;  1XXA A;  4KC6 A;  3NUH A;  3L4K A;  1XXC A;  2Y3P A;  2XCR B;  3FOF A;  2XCQ A;  4J3N A;  3ORE A;  4KAW X;  5CJ9 A;  2RGR A;  4G0U A;  3MML B;  1GE9 A;  1XXB A;  1EH1 A;  1AB4 A;  1ISE A;  3FHZ A;  3VA7 A;  4GFQ A;  2PHC B;  2ZFZ A;  1B4A A;  4KDD A;  1WQF A;  1WIH A;  4KB2 A;  3LPX A;  4DDQ A;  3QX3 A;  1WQG A;  1BJT A;  1IS1 A;  1EK8 A;  1F9N A;  4KB4 A; 
#chains in the Genus database with same CATH topology
 4A3L C;  2V6S A;  4A3D C;  1BGW A;  4BLA A;  1O26 A;  3A8K A;  4A3G C;  4C3J C;  3HOU K;  3GTG C;  1I6H C;  2PMZ L;  2JA6 A;  4AH6 A;  3S2D C;  4MEY A;  1WOS A;  4Y52 C;  5M5X K;  3S17 K;  1BS2 A;  3AH5 A;  4KAR A;  1Y1W K;  1ZBS A;  4XLN A;  5TMF A;  1F93 A;  4QJV A;  2XCO A;  1YNN A;  4PAB A;  1TWF K;  1DCH A;  4QIW D;  4QIW L;  4OIP A;  1ZYR A;  5C4X C;  4A3E K;  1K83 A;  1F7V A;  1DCP A;  1TWF C;  2NVQ K;  3N0C A;  4XCH A;  2VUM C;  3A8I A;  5JFE A;  3GTO A;  3G4A A;  2PPB A;  2R92 A;  3PO3 K;  3JST A;  2R93 A;  4KB4 A;  3LAP A;  3HOY K;  1ZQ1 C;  4KMH A;  3GTP C;  2NVY C;  1ZVU A;  3GTP K;  1J6V A;  5IOT A;  1TWG K;  2CFA B;  3AQO A;  2B63 A;  2E2J C;  1IQ0 A;  1IBA A;  4LJZ A;  4G7Z A;  2PMZ D;  1GE9 A;  1O27 A;  1AB4 A;  3HOZ C;  2V6U A;  5M5Y K;  3DXJ A;  5M5W K;  2NVX K;  4GFQ A;  4A3C K;  3BP3 A;  4KB2 A;  1JOE A;  1I50 K;  3QX3 A;  1BJT A;  4XSZ A;  2GAG C;  4BY1 C;  3HOY C;  4BKW A;  1TWH A;  3S1N K;  4LR2 A;  2E2I C;  4BBR C;  4A3J C;  1USM A;  1VJE A;  4G0W A;  3S1Q K;  3N0B A;  4KN4 A;  5CJ9 A;  1I3Q A;  3S1R C;  4BY1 K;  2BE5 A;  3GTO C;  4GTC A;  1HI9 A;  1IE0 A;  2JA6 C;  3GTG A;  4A3L K;  3S14 K;  1I6H K;  3RZO C;  1G51 A;  1F7U A;  1V5V A;  3VA7 A;  5IYD K;  1TWG A;  4YFN A;  3GTP A;  4YFX A;  3GTG K;  3PO2 C;  4C3I K;  2JH3 A;  4C3J K;  1I3Q K;  2R93 K;  5E68 A;  1PJ7 A;  4JK1 A;  1YX2 A;  1C0A A;  4YFK A;  1YNJ A;  3OEP A;  3GTJ C;  2R92 K;  3S17 C;  4A3I K;  4ILD A;  2KWA A;  3ADA C;  3AD8 C;  4C45 A;  3M3Y K;  2GAH C;  1TWH K;  3TFJ A;  2JA5 A;  2O5J A;  1ISE A;  3HKZ D;  2JA8 C;  4KDD A;  4ZH4 A;  4Y7N C;  5FLM C;  1PJ5 A;  2R93 C;  4XSX A;  1Y1W A;  2P5M A;  1XZQ B;  5FLM K;  5TMC A;  2WAQ D;  5IYB K;  3S16 C;  1IL2 A;  3S2H C;  4XLP A;  4OIN A;  3HOW C;  1K83 C;  1J6X A;  2E2J K;  3MML B;  4BLB A;  1O2A A;  4MEX A;  1PJ6 A;  3FHZ A;  4A3K C;  2PHC B;  2ZFZ A;  4KM9 A;  4NOI A;  4QJV B;  3H0G C;  1O25 A;  3HOV C;  2A68 A;  4A3G K;  5C3E K;  2JA7 A;  4C3H C;  3HXA A;  4KMU A;  4LK1 A;  1Y1V C;  2XCQ A;  1SFO A;  2NVT C;  4LOW A;  1ZXO A;  2R7Z A;  3S15 K;  4GTB A;  1WCM A;  1EH1 A;  1O24 A;  3H3V L;  2YU9 A;  5D4D A;  5IP7 C;  3FKI K;  2CW0 A;  4Y7N K;  4BXX K;  4LK0 A;  1XZP A;  3AD7 C;  2JA6 K;  3V4G A;  5IOR A;  3GTK K;  3S15 C;  3FOE A;  3FKI A;  5EGH A;  3RZO K;  4LQY A;  1O29 A;  2EBB A;  3S0X A;  3GSI A;  4GTA A;  3M3Y C;  3L4K A;  3PO2 K;  4G7O A;  1UV7 A;  1WCM K;  4A3I C;  4FZB A;  4GTL A;  3T01 A;  3TFI A;  1SMY A;  2Y0S L;  5TJ3 A;  1VRQ C;  1IS1 A;  1DCO A;  3CQZ C;  4X6A K;  1DD5 A;  1TWC C;  1I6V A;  5IOS A;  2V6T A;  3HOZ K;  2GSO A;  2D6F C;  3NUH A;  1XXC A;  1BDF A;  1WCM C;  1INN A;  1WOO A;  3FOF A;  3GTK A;  3ORE A;  4GZY A;  1I50 C;  2CFA A;  2VUM A;  5M3F K;  3RZD C;  5IP9 K;  5IYC C;  1KQ4 A;  3TTG A;  4GTE A;  3WOD A;  1VGX A;  3HOX K;  1X31 C;  3H0G A;  2NVY A;  1HQM A;  1WSV A;  4X6A C;  2PA8 L;  3GTM K;  4M1X A;  3T00 A;  5EGE A;  1J98 A;  2E2H A;  2PA8 D;  2WB1 L;  4A3C C;  2XCR B;  1IW7 A;  2JA5 K;  2ZUF A;  2FQT A;  2GSN A;  1SFO C;  4KMD A;  3GEH A;  1EI6 A;  1WIH A;  3GTQ K;  1YCL A;  5M3M K;  4A3F C;  4OIQ A;  1TWH C;  5JVO A;  3LAJ A;  3HOU C;  1WOR A;  4YG2 A;  4C2M K;  1R9T A;  3GTM C;  3GTJ K;  2NVQ C;  3GTK C;  3FKI C;  2GSU A;  2JA7 C;  4Y52 K;  4Q4Z A;  3K7A C;  1I3Q C;  2Y3P A;  2A6H A;  4AYB D;  4A3F K;  1Y1V A;  4KAS A;  5C4J K;  4BY7 K;  5IYC K;  5CHP A;  3GEI A;  2Y0S D;  2WAQ L;  4KM8 A;  4O2D A;  1TWC K;  1WQF A;  4P5B A;  4DDQ A;  4A3B K;  3GTL A;  1F9N A;  3AD9 C;  3N3Y A;  4AYB L;  1WQH A;  3HOW K;  5C4J C;  4BY7 C;  4C3I C;  3S1M C;  2E2H C;  1TWC A;  3OPF A;  2NVX A;  4OIO A;  3K7A K;  4A3K K;  3HKZ L;  4GTD A;  1WSR A;  4KAW X;  2JA5 C;  4G0U A;  1XXB A;  1RU0 A;  5C4X K;  3I4N K;  2B63 K;  4BBS K;  5FJ8 K;  1TWA A;  3S16 K;  5C3E C;  3H3V D;  1TWA K;  3GIR A;  3LPX A;  1VLO A;  2A6E A;  1EK8 A;  5IYB C;  4A3M K;  1XPP A;  4A93 C;  2WB1 D;  2W7V A;  3L4J A;  3ERE D;  5C44 C;  3GEE A;  3GTQ A;  3I4N C;  4WJ3 M;  2RH6 A;  1USO A;  4GTF A;  3GTO K;  1WOP A;  1XXA A;  4BXX C;  2RGR A;  4MQ9 A;  4A3M C;  3AQP A;  3GTL K;  1O28 A;  1I50 A;  5HL8 A;  1K83 K;  4P9S A;  3T02 A;  5L46 A;  1O2F B;  3GTL C;  1B4A A;  3EQL A;  2ZUE A;  4KN7 A;  3I4M K;  1O2B A;  1VH2 A;  1XZQ A;  4A3B C;  1Y1V K;  1L0W A;  2A69 A;  3H0G K;  3HOV K;  4G0V A;  2NVX C;  3S1R K;  3S2D K;  4Q5S A;  3GDZ A;  3GTJ A;  3S1Q C;  1R9T K;  5IYD C;  4KC6 A;  3M4O C;  3Q3Q A;  3S1N C;  4KAT A;  4A3D K;  3G4C A;  2R92 C;  3S14 C;  1J6W A;  2NVT K;  4C2M C;  4A3E C;  1WQG A;  3M4O K;  4WIL A;  2P8T A;  4P5A A;  3GTQ C;  4FM9 A;  2E2H K;  4WJ4 A;  1Y1W C;  1JVI A;  1TWF A;  4PAA A;  3CAG A;  1R9T C;  3GTM A;  2NVY K;  3RZD K;  2O5I A;  4LLG A;  4OIR A;  3IPJ A;  1XZP B;  3S1M K;  3SZY A;  5C44 K;  4GT9 A;  3SZZ A;  1TWA C;  3TFH A;  3CQZ A;  3HOX C;  2VUM K;  2E2I K;  2E2I A;  2JA8 K;  3S2H K;  4RMF A;  3CQZ K;  1B4B A;  3A8J A;  1EQR A;  3BUE A;  4G7H A;  1JQW A;  3PO3 C;  5IP9 C;  4KMA A;  2B63 C;  4BBS C;  2YU9 K;  2FQO A;  1EFW A;  4J3N A;  2R7Z K;  4C3H K;  3I4M C;  1SFO K;  1TWG C;  4A93 K;  5IP7 K;  2R7Z C;  4BBR K;  4A3J K;  3BP8 C;  2YU9 C;  2JA7 K;  5IOQ A; 
#chains in the Genus database with same CATH homology
 1DD5 A;  3L4J A;  3ERE D;  1BGW A;  3GTQ A;  3OEP A;  5IOS A;  4ILD A;  2KWA A;  2RH6 A;  4GTF A;  2GSO A;  4BLA A;  1O26 A;  1XXA A;  3NUH A;  1XXC A;  3GTK A;  4C3J C;  3FOF A;  3ORE A;  2CFA A;  2RGR A;  2JA6 A;  2VUM A;  2JA5 A;  3AQP A;  1ISE A;  1O28 A;  1I50 A;  1KQ4 A;  4GTE A;  1B4A A;  4KDD A;  3AH5 A;  4KAR A;  1ZBS A;  1O2B A;  3H0G A;  2NVY A;  2XCO A;  4G0V A;  1Y1W A;  2P5M A;  4M1X A;  3GTJ A;  5EGE A;  1K83 A;  2E2H A;  4KC6 A;  3Q3Q A;  2XCR B;  3N0C A;  4KAT A;  2GSN A;  3MML B;  4BLB A;  1O2A A;  3G4C A;  4KMD A;  5JFE A;  3FHZ A;  3GTO A;  3G4A A;  4C2M C;  2PHC B;  2ZFZ A;  4KM9 A;  2R92 A;  1WIH A;  1O25 A;  1WQG A;  2R93 A;  4KB4 A;  3LAP A;  4P5A A;  4KMH A;  5JVO A;  3LAJ A;  1ZVU A;  2JA7 A;  4C3H C;  4FM9 A;  1R9T A;  5IOT A;  2CFA B;  3AQO A;  2GSU A;  1TWF A;  2B63 A;  3GTM A;  3CAG A;  2Y3P A;  2XCQ A;  1SFO A;  1Y1V A;  4KAS A;  1ZXO A;  1GE9 A;  1O27 A;  2R7Z A;  4GTB A;  1WCM A;  1EH1 A;  1AB4 A;  5CHP A;  1O24 A;  4KM8 A;  4GFQ A;  2YU9 A;  4GT9 A;  1WQF A;  4KB2 A;  4P5B A;  4DDQ A;  3QX3 A;  3CQZ A;  1BJT A;  3GTL A;  1F9N A;  3N3Y A;  2E2I A;  3V4G A;  5IOR A;  4BKW A;  1WQH A;  1TWH A;  3FOE A;  4C3I C;  1B4B A;  3BUE A;  4LR2 A;  3FKI A;  1TWC A;  5EGH A;  4KMA A;  4LQY A;  1O29 A;  3OPF A;  2NVX A;  3S0X A;  4G0W A;  3N0B A;  4GTA A;  3L4K A;  4GTD A;  4J3N A;  4KAW X;  4FZB A;  5CJ9 A;  1I3Q A;  4G0U A;  4GTC A;  1XXB A;  3GTG A;  4GTL A;  1TWA A;  3VA7 A;  1TWG A;  3LPX A;  3GTP A;  5TJ3 A;  1IS1 A;  1EK8 A;  2JH3 A;  5IOQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...