1WISA

Solution structure of the fifth fniii domain from human kiaa1514 protein
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
124
structure length
124
Chain Sequence
b'GSSGSSGTISSGVPPELPGPPTNLGISNIGPRSVTLQFRPGYDGKTSISRWLVEAQVGVVGEGEEWLLIHQLSNEPDARSMEVPDLNPFTCYSFRMRQVNIVGTSPPSQPSRKIQTLQSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords KIAA1514 protein
publication title Solution structure of the fifth FNIII domain from human KIAA1514 protein
rcsb
source organism Homo sapiens
molecule tags Structural genomics, unknown function
total genus 8
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2004-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00041 fn3 Fibronectin type III domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1wisA01
1P1ZA 3V4UH 2H9GA 4R0LC 3MLTB 4HKXB 3L7FA 1J0JA 4HUWA 3EFDL 3T77A 1QO3A 1DVFB 1PGRB 1UC6A 3NFPB 3W81A 5C09D 1UCBL 3UJJH 1T1YB 3MCLH 4UILL 3WEXA 5CEZL 3PDOB 2CIIB 2AQ3A 1LO3L 4NN5B 2PCPB 5D7LE 5E9DE 1YEJL 4JDTH 4HIIA 3FO9B 2R0WL 4JFFE 43CAB 1KC5H 2YBRB 2EKSB 2VN7A 2FEDC 4EVNB 1LEIA 4UIMB 1KUMA 3LVEA 3MLVH 4MDIB 1T66D 1I1RA 2HKHL 4PJIB 4PREA 2ADJA 4XWGL 3CH8A 1XIWB 1Y18B 2H6PB 4KDVA 3FQXB 3PGDB 1OP3K 5HGAA 4GUPA 2J8UF 1ULVA 4PV8B 1KPRB 4XPGL 3HI5L 3HNTL 2C7UB 3QEQB 4WEUD 3ZYZA 1RIVL 1CLZH 5GS0C 1QR1A 2AVGA 3EDDA 4M93C 1XCTA 1KTLB 1VCAA 3UDWC 3DYPA 5EOTB 5C0JB 1YN6B 5IEHB 2IANE 2QSQA 4NSKB 5C0AD 1CG9A 4RGNE 4U1NB 3B3IA 4V2BA 1A6TB 3LV3B 3MV8E 4XPFL 3QCVL 2AJYH 5IVZA 3ILPA 3VRLF 2XWTA 1KJ2H 4YEFA 1I7ZA 4R26L 2DAVA 3IJSB 4RNRB 3DIFB 1BBJB 3B2UD 4Y1AE 4D8PB 4WO4D 5ICYA 3VU2A 2KBGA 3BIKA 2IQAB 3OQ3B 4QXUL 2LABA 5A43C 4Q6IB 4XCYA 3F8UB 3TH3T 1JZ4A 3MLSL 4WEBL 3UPAA 1H9VA 2EYRA 1I4FA 3VFNA 2WMPA 5HHOD 3T0ED 2DWEB 3GBLA 3FT3A 1Q72L 1T7WA 3F7YB 3ZTJG 1TPXB 2WLZA 1RHHB 3QWOA 5BOPA 3I9GH 1ZVSB 4OCWH 4X6BA 1E6OL 2I60H 4OZGB 4QRPA 1MLBB 3B9KD 5D5MB 2JIXD 4Y2OA 3VG9C 3QIBB 4HJGA 3OL2A 1NBZB 5D1XA 4XB8A 3OKDB 3MGAA 1FYTD 2VDPL 1HE7A 5EZIL 3GGWA 4PRHB 5FF6B 1BREA 2F5BH 2V5YA 3CSGA 1S3KH 4YUEH 4WFED 2HMIC 3VDBA 4IHOA 3CLFL 2OL3L 4PJ8C 2RFXB 1EVUA 4G8IA 3MLYH 4MMZC 3D0LA 3AXLB 2V2XA 3MROA 2XZAH 4I5BA 1LP9E 2Z4QA 3HRPA 3WS6A 3AB0C 4FOMA 3NIFE 4WI9A 1JCKA 3U0WH 1Q0XH 1NDGB 1MAML 1PQZB 2D7TH 4NRZB 2UVFA 2CO7B 3GJFH 4PJDE 5H2BB 3THMH 1FFOA 5CUSH 5BV7L 1BECA 1WZLA 1DDHA 3LKPA 5GRJH 3F58L 4LSTL 4LIQE 1U8IB 4WWKA 4NGHH 4BJLA 1CLYL 1CN4A 3MLTA 1N5AB 3VWJD 3X14B 3RIAF 2A6IB 3NFPA 1S9WB 3BKJL 1KTKE 1LD9B 1T1YA 3MLXH 4G6KL 3PDOA 2NY4C 4K2UL 2GAZB 4Y5XA 3HAEH 4U6YA 2PCPA 4ONHB 4XHJD 4UBDD 4R97C 1HHKB 3FO9A 1WZ1H 1QHPA 1SJEB 2BJML 3HZMB 1A4KB 2DD8L 4HS3B 5FUZH 4I9WD 3TT1L 1GPOH 43CAA 4YXKL 4EDWH 5D7IB 2EKSA 3VXMA 4EVNA 4IDJH 1OAKL 4UIMA 4PBWD 5C2BL 3MRFA 4MDIA 3A6CH 2EH7H 1LO2H 3CVHB 5I0ZA 4U1KB 4RMSA 5C0CB 1XIWA 1YJDH 1P7QB 2H6PA 3FQXA 3PGDA 3KPRB 1FIEA 1S7UB 1FL6A 4PV8A 1KPRA 4BZ1L 1CFVL 4N5UA 4HGMA 5MP6H 3QEQA 2WQ8A 4RISH 4TRPH 4C59B 4X4ZA 3QEGH 2VZSA 4J3TA 4PJ7E 4PRAB 3CU1A 2AAVA 3PDGA 4JFDD 1KTLA 4ZOCA 3HNSL 4UINH 5FGBC 2NY5C 3S5LB 1YN6A 1QBML 5DMJB 5IEHA 7CGTA 3WLWC 4OM1H 4NSKA 5DA0B 3TWCH 5LBSH 5LGHH 3A6BL 1KOAA 3NCEB 3O81A 3WS6C 4U1NA 2VAAA 4X6CF 3EYSL 2GFBB 3UMTA 3UTSB 2ZOLB 3QUZD 2ZCLL 3LV3A 1I7RA 2V2TB 2MKWA 2WWMD 3BFOA 4RNRA 3IJSA 5ABDE 5HVWA 3DIFA 3L5XL 1BBJA 4D8PA 4MD0B 2DI7A 4WWKC 2HFEA 4AEFA 1MHPH 2IQAA 1FCCA 4P4RB 1K2DB 1RK1B 1A3LL 3MV9B 4Q6IA 3NCYP 4HXBH 4MQSB 3S96A 1BF8A 3C8KB 4YX2H 5T3XD 1IGJA 3RDTC 1D5XB 4L8SB 5AD0A 1F3RB 1U3YA 2L4OA 2DWEA 3RGHA 1CDBA 1J87A 4O4YH 4X0KA 3HC4H 4Y5XC 3F7YA 3KYKH 2C1PB 5E4EC 1RHHA 3V7MA 4M1DL 1ZVSA 1NCAH 4OZGA 2MHAB 5D5MA 1LNUA 3QIBA 3D5OF 1NBZA 1S5IL 1ZXQA 4FQLL 3OKDA 4XCNB 5IBUG 3ARFD 4J1UA 1NGQH 4BM7A 4W4NA 3QULA 3VXSD 4PRHA 5FF6A 3TESA 4GRMB 4QHUB 5DJAB 4HT1L 4GRLD 3KLHC 2R0LH 1UEMA 3LPWA 5I1LB 4FXGB 5L2KE 2F53D 3CMGA 3X13B 5HHXL 2I07B 2I5YH 4M61B 5L88H 2YZ1A 1RVFH 3RWCA 2I9LA 1BD2B 3CXDH 2RAMA 3QG7H 1CU4L 1JMZA 2EXWD 3KNBB 4D9LL 1NDGA 1PQZA 4NRZA 5MI0C 5BMFL 1G6RA 1X5YA 1ZVYA 3BPNB 2APWA 2NZ9D 2Q86B 1I3UA 2P24B 1LK3L 2VITA 4NN7B 1RD6A 1KJVB 3IU4H 3BPOB 1QFWI 4HXAH 1HQ4B 4GG6E 2GUOB 2PYEA 1N5AA 1X5IA 4PB9L 1I85A 3HZKB 2RQ8A 4KRMB 3X14A 1AGBA 2A6IA 3LOWA 2DQEH 1S9WA 1FVCA 4WI2A 3V0AC 3EYVA 1LD9A 3B43A 1G0YR 1P6AB 2XA8L 5KSBE 1CICB 1W0VB 4JKKA 1MFBH 2GAZA 5T5NF 5IT2H 4ONHA 3RIAK 3ULUD 3MREB 5FYJL 4YHPB 3CDYA 4NP4H 1HHKA 1GRWA 4RBPH 1SJEA 1KIPB 3HZMA 4FQQA 1A4KA 4HS3A 4JFYB 4XNZB 3NBNA 2V6HA 1FL5B 3QJFB 5D7IA 4ZD3L 1TPXC 3B8YA 3ARBD 4K7PY 2BNRD 1JWSB 3TJHD 1CWVA 3BDBA 4W70A 1OAZL 1JGEB 1VACB 2OTWB 2NX5D 3CVHA 4U1KA 4MCYB 4WUUE 4Z5RB 5C0CA 5HHVH 3RA7H 1P7QA 1OAYH 1OQOA 3BE1L 3KPRA 4EUPB 1C08B 1QSEA 1S7UA 4ZDHB 2WNGA 5T1MB 3MBXH 5GGQH 3VH8B 2NXYB 2R9HD 5GRXG 4KVNL 1A1NB 5FECB 1YC8A 5IMKB 2QQLH 3BQUD 1NC2D 1UZ8B 2QSTA 3UTQB 4KI1A 2PO6B 3SGDH 4MXVE 3MXWH 4JR9L 3EKCA 4N8PA 1W72B 3UTTD 1OD9A 1SBSL 3M17B 1T3FB 1Y0LB 3UTSA 2ZOLA 4XBGA 3M8OH 3HRZB 2DTML 2V2TA 1XMWA 3LDBB 1EX0A 1IC5L 4OCXH 1U3HC 1YUHB 1TZGL 4X6FA 1PY9A 1L0QA 4YXHL 3HNVL 1G9EA 1A5FH 1QTYT 5J9PB 4J3WA 3KJ6H 3MJ9L 4YJZL 4P4RA 4Z7WF 1I85C 1K2DA 1RK1A 3MV9A 4H1LH 4AJ0A 3C8KA 4P46B 3E2HB 5B8CB 1D5XA 1HH9A 1SJHB 3DI3B 3PIQB 3QXUA 3HI1A 2ADIB 4UOW1 1TETH 2P1YA 4MA1B 1TMCB 4HS8L 4MHHG 5D7SH 2C1PA 4O51A 2OYPA 5ITBH 3SEPA 5CJQL 2DI8A 2MHAA 1XR8B 1NCUA 3LPFA 4MAUL 5DWUH 4QHMB 4DGIL 3TA3D 2D4DA 4XCNA 1GGUA 5BVPH 5IROA 3ZHKA 2VLJD 2EDHA 3BSZH 5FEBA 5FO8A 4GRMA 2FO4B 4QHUA 1SEQL 4OLUL 4CMHB 5DJAA 3D85D 3DBXB 3CAFA 2H32A 3ESUF 3Q48A 5TF1L 5I1LA 3I50H 4IRSC 4JKMA 2HT2D 4Q6YA 1U8QB 4KC3B 4MJIE 1PVHA 3O6FB 3W5MA 1P9MA 5HGHB 1JNJA 2I07A 4M61A 5ICXB 3BKYH 1BD2A 4OLEA 4JJHA 3KNBA 5JUEH 4KUCD 3BN9D 3S97C 5KSUB 4AY0A 5J1TC 1OSPH 4BSWB 4CRPA 4U6VL 4XVTL 2Q86A 3P2TA 4S1QH 2P24A 4LOUD 2CMRL 3OSKA 1NCWH 4L1DA 1P84K 3P0YH 4TNWF 3OAUH 1KJVA 3L3GA 4JFED 1HQ4A 1P4BL 4Y19D 4WY7H 2GUOA 3QIUD 4LCYB 5DD6B 3HZKA 5D8JL 1FNFA 2PTUA 3VGFA 1IGIH 1VFOA 1WBZA 3AUVA 1HWGB 3QXDB 1CICA 1W0VA 3S35H 3W5NA 4ONFL 2R29L 3QUMB 5EZOL 1I3RB 2CLZB 2Q3AA 1OLLA 2AJXH 4WJ5B 4R8WL 3MREA 1QLEL 5T3ZL 3O4LD 2ZWLT 4YHPA 5CZVH 4JFYA 1KIPA 2ZUUA 3P9WB 3QJFA 4O2FA 4I18B 1UWXH 1JWSA 3MOQA 2P8MA 4G9FD 2Y6SC 1JGEA 4G9DA 1VACA 3ZKMD 4K55A 2OTWA 5IW6B 4LASH 1CD0A 4XH2A 4S1DC 4Z5RA 5A40E 3G5ZA 4LU5L 3QFJA 5DHVH 1RURH 2CKBL 3FFCD 5TQ2L 4EUPA 4MJ6B 5IROC 4ZDHA 5T1MA 3EYUH 1KENL 1VENA 3CXHJ 1IEAB 2QSCH 4IM8A 4JB9H 3VH8A 4CBPA 1K4DB 1G7MB 2NY5H 1JJUA 1NUGA 5JZ7D 5IMKA 3IRZA 5D70H 1IGCH 2E8YA 2YPLD 3QCTH 3L5HA 1UZ8A 3UTQA 5IOPB 2PO6A 3UCRA 1RMFL 4ZFOB 1W72A 1U95A 1JGLL 1Q0YH 3M17A 1MOEA 1T3FA 1Y0LA 2HWZL 2XKUA 3NFNB 2ZKHH 3LRHA 4XTRD 2MPAL 3AS3A 3HRZA 1MHHB 4M6ML 3V9FA 4KJWD 4OLYH 3BPNC 4OIAA 5EU3A 1DL7H 1AC0A 1X3DA 3KWWA 1G6VK 5F88B 1ODAA 4OQTA 2D7PA 2I27N 4G5ZL 4MLSA 4V1DB 3BPOC 3NIFF 3SKMB 4PRNB 5J9PA 1KPVB 2ICWB 3BT2H 25C8H 4DOHB 1MUJB 3CK0L 2CRMA 2LFGA 1WLHA 1N6QH 4P46A 4NJAH 1MF2H 1CGXA 1SJHA 4PJDF 3C9NB 3MOAL 4IEFB 5B8CA 4YHLH 4FXKB 3Q5YA 4D94A 5EU5B 1N0XH 3EYQC 2VLME 4UT9H 2ZG1A 1X7QB 2VOTA 3HE7D 2DQGL 4OKVB 3AY4A 1NMAH 3SDAB 4UTBL 3RVXC 1CGUA 4LCCB 4P9HL 1XR8A 3WIFB 1T4KB 5GGVY 2NY2B 5SV3A 3GMQB 4J12A 1V7NH 1MPAL 3ARXA 1QSFD 2FB4L 3E8UH 3R8QA 2A9NH 4Y8AA 1MIEH 3OKKA 3GK8H 3IDJA 2FO4A 1NJ9B 2XN9E 3VFSB 1FE8L 1K3IA 3FN0L 4ALAH 1AIFB 3BJLA 3JBG7 1FYHB 3HKFA 4R6UA 4B0MM 4L3EE 2XZQL 1U8QA 5CMAB 3UPRB 2HTLC 3O6FA 5IHZB 3DMMD 5HGHA 1TNMA 2NY6D 4H88L 8CGTA 1ZLUH 1EHNA 1MCWM 4UT6L 2LU7A 1CLCA 3DUHA 2PO6C 5DK2B 2X1OA 4JHZA 4KQ3H 5KSUA 4BSWA 1FC2D 2CJUH 4PJ7F 4QWWC 4PJAF 3X3FH 3LDBC 4JFPB 2Q8BL 4HGWB 4NCC2 4XGZB 4MAYB 1HKLH 1FG2A 5DO2D 2DQTH 4U0QB 3SDDA 1GIGL 1PSKL 4HKJB 4LCYA 3GDBA 1WWWX 2YUXA 5DD6A 2YSSB 4C57C 1JNNL 3QWRA 4Q2ZB 4YFLI 1CXKA 3QQ4B 3A6OA 4TNWK 3ZLQC 4EBQL 4JZNB 3DHMA 3QXDA 5IJVB 1ZANH 5B38B 1GZPB 2D0GA 4G6MH 2X10A 1A7RL 2RHEA 4FQ1H 4WJ5A 3UBXB 2HH0L 4MJ5B 3BZFB 3HCVB 4L9DA 2WLYA 1VGEL 3TH4T 4AZ8A 5SWSE 4Q9CA 1YMMA 3GNMH 4I18A 3K8MA 2J6EH 5CD5D 1AJ7L 5I74C 5I8KH 5GZND 4YLQT 5AYUL 4RGOH 3CGTA 4KKNA 4E5XB 5C6TH 5IW6A 5L7XH 4JY4A 4R4FL 1GGIL 3OJDB 4UTAH 1MY5A 2LTQC 1C16B 5I1GL 1CTOA 3G04A 1ZHLA 2CUMA 4MJ6A 1PD6A 5F9WB 5ANMB 1HHHB 2WUBH 5C0AB 3RVWD 1N7MH 3NPZB 4X83A 2YOCA 1IEAA 1JGUL 5F44A 1D5BB 4KJYB 3MUY1 1G7MA 3UC0L 3QXVA 4WV1B 2ZUQB 4F2MB 1A7BA 3UTZB 4XWOD 2P5ED 1NSNL 2DLFL 3UO1H 3QI9B 5J12C 1U8HB 3I84A 5DMKB 3UYRH 4L4TD 5IOPA 1IJ9A 1F8TH 4S11A 4ZFOA 5E8DL 3FO0L 4YHNB 3I6GB 5JHDB 4WO4B 5E4IA 2FIRT 1F02I 4QF1B 3NFNA 2APBA 4QLRA 5D7KD 1MHHA 4OAWB 2ESVE 5DVNA 4ZSOE 2JTDA 4XI5C 4Z77B 5HHMD 1HHJB 1UACH 4XMPL 2FLBT 1R5WA 1CVRA 2Z31B 5F3HB 5GS3A 4NN6C 1DQJB 1AD0B 4V1DA 1EA9C 1LO4H 2Z91B 4PRNA 3SKMA 5BZDB 1KPVA 2ICWA 3SDDC 4AM0B 3ZT5A 1MUJA 1JZ7A 4PJ9C 3KJ4C 4APQB 2VH5H 3LD8C 4ZS7L 5T1DH 3C9NA 2D7MA 1ACZA 4PJ5B 5A3IC 4FXKA 4OV5B 3HPLB 5EU5A 4FFZH 3NABH 3BGFB 5D1QB 1FYTB 1OTUC 2AQ2A 2I25N 3N9GL 1R3JB 3MUGB 4HEME 3W9DB 1NLDL 1X7QA 4JPWH 3CFDA 4OKVA 4GG6F 2Z8VC 3SDAA 2BVOB 3EFDH 3VMPA 1T4KA 3SO3C 3WIFA 3NMEA 2V7NB 5C9JB 1UCBH 3GMQA 1CK0L 1K8IB 1FFNB 2W38A 4CU6A 2MQ0A 2LVEA 4UILH 5KSBF 5CEZH 1F6AA 4BFBD 4GBXD 2QADC 1LO3H 4OF5A 5HYFA 3KPPA 4YHIA 1RU9L 1NJ9A 4YE4L 1A7NL 5F72S 4I3SL 1QBBA 1YEJH 3CZJA 5F89A 1AIFA 5B4MD 1NGWB 1TDQA 2R0WH 3CSYB 4OGAC 3S5LG 3Q6GL 2ITDB 4LLUB 4ZUUA 1SEBB 5CMAA 5DHYB 4JRYD 4PB0L 1NGZB 4D0DB 1N8ZB 2HKHH 2KQMA 2VLKD 2OZ4L 5LKNA 1X5GA 5HVFB 3ILQD 1J8HD 3DX8B 4P23B 1CT8B 3HI5H 2C4FU 3HNTH 5J11B 5C09A 2E7LA 1N2RB 1RIVH 2AXJA 3FT2A 1ACYL 1IKFL 3VFVB 4F3FB 1BLNB 2KZ1B 2NPLX 4N68A 4C56D 3QUXB 4HGWA 4XGZA 4MAYA 3PL6B 5TQ0L 3BHBB 2AJVL 4F9LA 1ZEAL 2YXFA 4HKJA 4MXVF 4MNQE 3WUWB 2OX5A 1V7MH 4JZNA 2Q1EA 1PG7W 5IJVA 5B38A 3WSQL 1KJMB 4K3EL 3VXME 4KKLC 2DI9A 3UBXA 3NCCB 4MJ5A 4P48A 3QCVH 1PZUB 3BZFA 4IRZL 3HCVA 5IQ7H 2J5LB 4DZ8A 2GQHA 4R26H 2EDTA 3OTTA 3QH3B 3QUYD 1DBKH 5FGCE 1E4KA 2NY0B 4Y8DC 4DEPB 4NHCL 1PEWA 3JZ7A 4RFOH 2YN3A 4M5ZH 4QXUH 4E5XA 3O9WD 1MCPH 3JSSA 2DMCA 3KPSE 4WW2A 4WEBH 1C16A 1FNEB 3R8BB 4DW2L 1F97A 4YXLH 4MS8C 4QNPE 4KHTL 5ANMA 1HHHA 5C0AA 4LGSB 3H2WA 1Q72H 1L9NA 1D5BA 4FXLA 1EHLH 3QRGL 4OF3A 5EB9A 2AI0L 4RFEB 3QSKB 4WV1A 3QUZB 4F9PA 4F2MA 1E6OH 5J6HA 3WNNA 3UTZA 1FHGA 3PWVB 5C0BE 4C58B 3QI9A 5FDYA 1U8HA 5DMKA 5KOMC 2XTJB 5I1HL 3WNKA 4GKZB 5E56A 3ULVC 3LCYA 4UV7L 3QISA 5I17B 4YHNA 2VDPH 1U2CA 3I6GA 4CADB 4WO4A 2DM3A 3ALWA 5E94B 5EZIH 5I19H 4QF1A 4MXQD 3I6KB 4NZJA 1T7YA 4K3HA 4OAWA 5D2NA 4O58L 1EHXA 3CLFH 4Z77A 2OL3H 5EU6E 1P5UA 1VDGA 3DX7A 2J8HA 2VQ1B 1HHJA 4P2OB 1QPXA 4WENB 1FLRL 3REWB 3H42H 5F1IB 2PXYD 3WDJA 4LF3B 5F3HA 3GSWB 3O6ML 2FJFB 3O45A 5INDA 3A0OA 1DQJA 1AD0A 2L0DA 2Z91A 5BZDA 4JQIL 1CQKA 4F9LC 4AM0A 1IAII 1B9ZA 4APQA 1JPGB 4E0RB 4EOWL 4LCWD 1MAMH 5FM8A 2VLRD 4ONGL 3HPLA 4PRIE 5BV7H 3FRUB 3DGCR 3F58H 1FYTA 1R3JA 3W9DA 4LSTH 3VXSB 4HWBH 1LDSA 3GMMB 4XX1E 4Z95H 5BO1L 2BVOA 4DGVL 3ZE2E 4GRLB 4K3JL 4IDLA 4LCIL 4HJJL 4M62L 2G2RA 4ODSL 3BKJH 2F53B 1U8JB 1BMGA 1FFQA 1FFNA 4G6KH 3TBYB 4FP8L 4K2UH 2BHYA 4WW2C 5FHAL 1NGWA 2BJMH 2DD8H 3CSYA 3TT1H 5F7YC 2EICA 4YXKH 3MRPB 1D9KC 3WD5L 3LQZA 1OAKH 1EAJA 5C2BH 1K4CB 1NGZA 2ZUQC 4WV1C 4F9PC 4D0DA 4LPWA 5DVLA 2D03L 1MQKL 4XPTL 3RUGF 3WFEH 1WFTA 1GJIA 4OLVL 2KZWA 4WUKL 3DX8A 3MRNB 3DURB 3VWJA 4P23A 3B2UC 4BZ1H 1CFVH 1CT8A 2PYEE 4NWTH 1KB9J 5JW3L 3OKEB 1N2RA 5CGMA 1J86A 4F3FA 1BLNA 4R7NB 3MRHB 5D2NC 1T03L 1I1CA 3RWJA 3HNSH 3QUXA 5J6GB 2ZP0T 3V8CA 1QBMH 3T0EC 1JRHI 3WUWA 1WTGT 1XF4A 3A6BH 1LO5A 1S7XB 5FYKL 5D6CB 4Z7UF 3RJQB 4QHKI 5F7HA 3EYSH 2BNRB 4P2RD 1IGTA 5J7CC 5C7XL 3QEUB 2HG5B 2BVYA 3BZEB 1KJMA 3MJ7B 5DJXB 2NX5B 5SWZD 3B9KC 3T3PE 1CXEA 1AGFB 4IRJD 2DTSA 3PDDA 2UY6A 3SGJA 1I3GL 5BW7C 3NH7H 3QH3A 3L5XH 3RGVC 3P4NA 1G7QB 2PYFB 2XY2A 4PYHA 4JRXE 4XNQB 1UFUA 4KI5F 4D0CB 3CNKA 1I3VA 1A3LH 4U4BA 5DK0B 5I16B 4X4YB 3OKLB 2IBGA 3MRRB 3MGOA 1FNEA 1SVZA 5DVOA 2RBLA 1QFOA 3OZ9L 5K9JL 3LB6D 2XQYK 1K6QL 1X9QA 3CFCL 1P2CB 3MCKB 4KROD 4RFEA 4M1DH 3QUZA 3AM8A 3RP1A 1EBAA 5HI4C 1JF6A 3ZKXC 1K8DB 2CLRB 4TOYH 1JF1B 1S5IH 4GKZA 4JO1L 2IAND 2MQCA 4FQLH 3O3AA 4MXWL 4RGND 4L5FL 5I17A 3D69B 4CADA 2AGJL 4Y4KC 3I6KA 2NQCA 3O2DA 2IH1B 5I8OH 4HW6A 1F4WL 3VWJC 4HT1H 3MV8D 3FQUB 4OZHA 1KEMH 3W2DL 3TO4D 3HZVB 2VQ1A 4RRPA 3V6OC 3IDUA 5LXGL 4YIQB 2F54E 2G75B 3REWA 5F1IA 4DAGL 3ZTJH 3GSWA 5GRVK 5HHXH 4IOSD 4TUJB 1MCIA 3IDYC 4ZUTB 1BQLL 3BIAX 4XHJC 1RUAL 5DMIL 3HI6L 3TEUA 2VZVA 2GJJA 2PF6A 1CU4H 1JPGA 4E0RA 4D9LH 1DQML 2ICEB 1E4JA 2VDOH 1G7HB 4DUVA 4JM2D 4QRRB 3SGKC 4TSCH 4Z9KB 3TM6A 1VFAB 1XF2B 3FRUA 3ARFA 1KYOK 3DGGB 1CZ8H 1LK3H 1BFVL 4HHAB 3VXSA 2C26A 3GMMA 2VLJB 4OCNC 5MEPB 3KXFD 1OGAB 2JLLA 4PB9H 4GRLA 5TJWK 4UV4L 5ALCL 1P7KB 2CH8A 1I9RH 5DGQA 2F53A 4U1GB 3RZCD 5EG6C 5FHBL 1U93A 3STLB 3P3YA 2BCKB 2Z8WC 2EZ0D 2B4CL 1QZ1A 4GJTB 5GPRA 3HE6D 4U6HA 3MRPA 4JGUA 4ZD3H 1E0OB 1CIDA 1K4CA 3MNVB 4N1EA 2PNDA 3AM8C 1OAZH 5ACLA 2BOBB 3ZSSA 4CAGA 2R8SL 3BJ91 4ODHL 4IOFD 2P43B 2WWMC 4M8QB 4MNGB 3PGFL 3BE1H 3MRNA 1GVIA 4DZBB 3TVMB 4NYLA 3OKEA 3JV6B 4R7NA 3MRHA 5HTSA 2AJSL 4OJFH 4P2CG 3VXUE 4D9RD 2UUDK 2W0FB 2WP3T 4TPRH 4CU8A 2EDBA 2E6JA 1WTLA 1CLOL 2OSLA 1WJ3A 4JR9H 4X8JB 4RAUB 5D6CA 1DANU 1SBSH 5DMGD 3W9EB 2BNRA 4PJGB 5EO0B 3U7WL 3QEUA 2HG5A 2E9WA 3BZEA 3FT4A 1CF8L 3MJ7A 3VWKD 2DTMH 5DJXA 3EOTL 2NX5A 2Y25A 5D72H 5LGJB 1AGFA 1UH4A 5DVMA 2NNAB 2BC4B 1TZGH 4W6WB 3V4PL 4X6DB 3ARFC 3DX6B 2AXHA 4HUUB 4YXHH 3HNVH 3BRFA 4XNQA 5J3HD 4LQFL 1T0MB 4S1SL 3C6SB 1DLHB 3MJ9H 4L9LC 2DWDB 3K8KA 1DTUA 4GRLC 5DK0A 2D7QA 4KDTC 5I16A 3GM0A 3OKLA 3MRRA 2YZ8A 1NAML 3N1PC 3NCJL 1X6NA 4OD2B 5DYOB 2EDLA 1P2CA 3MCKA 1J1XL 5BS0B 3ARDD 4HS8H 2QHRL 4POZD 5KSAC 4Y5YC 5TE7L 1V3KA 2HA1A 1KXQE 3TO2B 1ZLWK 3CVIL 2EXWC 3DO7A 3V52L 5CJQH 4OFYD 3EJJX 3P73B 4QOKB 5T5FH 2APVA 4MAUH 1K8DA 2CLRA 4DGIH 5M94B 2XXMB 1HCVA 2VZ3A 3U4EB 3I75B 2NZ9C 1RQ5A 3D69A 2JE8A 1UXWA 1X44A 4OB5L 5ERWB 3HG1E 2IH1A 3AREB 2FBOJ 1CBVL 1SEQH 4OLUH 2W1NA 3LS4L 2ZSVA 4WHCA 1AE6L 1TQCB 4N0YL 5TF1H 5ISZE 3HZVA 4AT6B 4RA0C 1H3XA 2G75A 2VKWA 4PLNC 4XNMB 2D9QB 2J8UB 4TUJA 2ARJB 4ZUTA 2IAMD 5KVGL 8FABB 5ESVB 2AXGB 5DQDL 2ATKB 2E6QA 5B38G 1QRND 3PXHA 1HZHL 2BRRL 2CRYA 4R96A 2ICEA 3I3BA 3UBXG 4LHUG 4CVZB 1YEFL 4QRRA 3ARBC 4JM4H 3TJHC 3W39A 1VFAA 5FYLL 1M05B 3TA3A 4U6VH 4RMQA 3B9VA 4XVTH 3MFFA 2XPGA 3DGGA 2CMRH 4NM4H 3SY0B 2VLJA 1KN4L 5MEPA 1CR9L 1FJ1B 1OGAA 5D8JH 3FONB 2FX8H 5C07B 1P7KA 2BVQB 5IR1B 2R9HC 4ZPTB 3SDCB 1RJLA 3R06A 1HXMB 1SMAA 3DJ9A 3DMMB 3STLA 4ONFH 1OM3H 3BP7B 1NGXB 3VFGL 2R29H 4M1GL 5DEFB 2DJSA 5EZOH 1EXUB 1I1AD 3BQUC 5A2FA 4R8WH 4WVRA 1QLEH 3QUML 5T3ZH 4M4RA 5J06A 2A83B 5IBLC 5C08B 2D31B 2VERN 1R3KB 3MNVA 3LQAL 1Z9LA 3ZMRA 4GXUN 1FNGB 2BOBA 2EE3A 2VNCA 1Q9KB 1R24B 4P59L 4X5XB 2WUCL 4LU5H 2PW2B 4M8QA 1VEPA 4P2QB 4OCRL 4Y19A 4MNGA 4MYWB 5BOZG 4PJFE 2CKBH 3QIUA 4LGRB 3TBTB 4K3DL 3FAWA 2XFXA 1L0YA 4DZBA 1KENH 3TVMA 2WSKA 4FG6D 1PG7X 1FNAA 5CEYB 1W2KT 3DOSA 2BP3A 3RX7A 5GSVB 4ODUB 4RAHA 2W0FA 4H8WL 5CZXD 3O4LA 3SE8L 5FXCH 1YPZE 1T2XA 2G5BB 1RMFH 2DF3A 4X8JA 3RI5K 3W9EA 1JGLH 4OZ4A 4PJGA 5EO0A 1SY6H 2JELL 2H26B 3P4MB 2HWZH 1YMME 5I8EB 1HWHB 2MPAH 4UNUA 3N1MC 4EN3C 2NY1D 1WVZA 2D4FA 4NQDE 1RZGB 3CFJA 2NNAA 5CJ5A 4Z0BL 3OKYA 5DD3L 1RIHH 5EUOE 3TA3C 5GIRB 2GTZB 1A3RL 4N90D 5KOVC 1MRDL 4LAQL 1OGTB 1T6WA 4G8GD 1JHTB 3DX6A 1OB1A 4HUUA 3TNNB 3HB3D 4U0RC 1T0MA 4G5ZH 5GSRA 3C6SA 1DLHA 3STBA 4CDGC 5IFJA 2KL6A 2E9JA 5F70A 5FYJE 2DWDA 3B5HA 3QDMB 2O5ZL 2YPLA 4NC2B 2HT2C 2EDRA 3OAZK 4L4TB 4U1GC 2YA2A 3MOAH 3WN5C 1N59A 4OZGF 4OD2A 5DYOA 5DJCB 5E6ZA 3UJTL 1PLGL 2GTWB 2R15A 4Q7DA 35C8L 1GZQB 2DQGH 4U1LB 4M7ZB 4Q9QL 3TO2A 4UTBH 1CGVA 3ZE2F 4P9HH 5IHBA 3BN9C 5HHMB 1EEQA 4TSBH 1J1PL 3FFDA 3I75A 4LOUC 4Y0GA 1MPAH 2ARWA 2FB4H 5ILTL 1RZ8B 2AJ3A 5ERWA 1U3JA 3QIUC 1FE8H 3FN0H 1T7ZA 1J0HA 1AR1D 4KKBD 3SDYL 1IVLA 4AT6A 2XZQH 4L8BA 1MFCL 1RZFH 2FSEA 3D39E 3WUWG 4H88H 2ARJA 2FGWL 3JV5A 4UT6H 8FABA 3RNKB 3HE7A 2AXGA 4QRSB 3SE9H 4KY1L 4CVZA 3O41B 1H5BB 1M05A 2D0FA 1H3WM 2PTTB 1NFDA 3AS1A 4PV9B 3ZKMC 2EDFA 4HLZG 4GBXB 1ZLVH 4X6CB 2Q8BH 1FLTX 1Q94A 3OAYH 4WU7B 1GIGH 1PSKH 1VGKB 4FS0A 2P49B 5I1CL 3JV4B 5C07A 2BVQA 5IR1A 4F58L 4ZPTA 3VGAB 4EBQH 1HXMA 4JRYB 5JZ7C 4MGXA 1XR9B 4JRWA 3DMMA 2ADFH 1QNZL 4OLXH 1NGXA 5DEFA 3IAQA 1A0QL 1A7RH 2HH0H 2VXTL 1BFSA 4IS6B 3ULVE 5JLZB 3T1FA 1VGEH 3O0RH 1KG0B 4NZDA 3MBEB 2XYCA 4JFHD 2A83A 4W68A 3IDIB 5D93C 4YDVB 4KQ4L 5E2WL 1R3KA 4FFYL 4D0BB 1PBYA 2F8XC 4MJID 5AYUH 4XTRC 2V9RA 4YAQA 1MCOL 1FNGA 2VSCA 2HLFD 1Q9KA 4R4FH 5C09E 4C56B 1GGIH 4M9OA 1KYOJ 2PW2A 4P2QA 3G08B 3LN5B 4Z7VA 5I1GH 3TBTA 3HMWL 2JJUA 1A4JA 3E1F1 3PWPB 1JGUH 4KRPB 2BY3A 5DFVD 1DR9A 3BDXA 3UC0H 4XP9L 1NSNH 5GSVA 2DLFH 5KTEL 2C1OA 4ODUA 3OXSB 3T2QA 4NQCB 1FRGL 3GFUA 3QUYB 3WL9B 1MI5E 3FO0H 4JO3L 5DUML 2EDWA 3OG4B 3HE7C 1XGUB 2H26A 3P4MA 2X89D 4LPCA 5I8EA 4EEEA 4KK5D 3QHTC 4ZTOL 3S37L 1RZGA 1YEHL 4A6YB 2LAAA 2GTZA 4XMPH 3WIHL 3R1GL 3N85L 3K4DA 2MKLC 3LKOB 4PPTA 43C9A 1OGTA 3TNNA 1ETZB 5HHPB 1KCKA 5FUOL 4YPJA 1GHFL 4MB3A 4LP4A 2BOCB 5T3ZE 4TUOB 3QDMA 5D1ZB 3ECBB 3QDHA 4W4OA 4QXWA 4WI6A 2VSDA 4N0FA 4L4TA 4ZS7H 4FTVE 5AYQA 5F6IC 2QV2A 4GMSL 5DJCA 1DEEB 3PQYE 3QUKB 4FQJL 2GTWA 1GGTA 2NY6C 1HYRC 3N9GH 3HZYB 1NLDH 1GZQA 4U1LA 3U1SL 1RUPH 5DD5H 1JFQL 1BFOB 3IYLW 1OP9A 1JI2A 5HI5D 2VDLH 2QHLA 3WFCH 1KLGA 5D2NE 3T04D 5IMMA 5F8QC 1CFSB 3CU7A 4ZQKB 2OXGA 5GS1C 1RZ8A 2GK0B 3QNYB 1BIIB 1OD7A 1Y6NR 5HHOE 3T0EE 5JTWA 5DO2C 3K2UL 1RU9H 4YE4H 1A7NH 1CS6A 1NCBL 1UXSA 1CVSC 5KS9E 4LCWB 4YDLC 4I48B 3HN3A 2B4CC 3B2VL 3Q6GH 5IJKA 4HH8A 2OK0L 1MH5B 5IGXL 5C0NC 3MSPA 1T04A 3VJ6B 2LV4A 4XPAL 2ILLA 1DSFL 1AC6A 1TVHB 4HDIB 3BZDA 4AEHL 1B3JA 4QRSA 2BHUA 5JPNA 5DEZA 5FYJU 4NZRL 4LRIA 2FEDD 4NNXB 2PR4L 3WNMA 5L6YH 3O41A 5GZNC 4YFEA 4NBZB 2PTTA 4U7KA 4PV9A 1ACYH 1IKFH 2VABA 4GBXA 4R2GB 3TFKD 1NPUA 2VDNH 4MZ3A 4WU7A 2X7LB 1ZEAH 3LN4B 1VGKA 2MOVA 3IS0X 4UDUA 3RKDC 5TDNB 1JL8A 3RVWC 3JV4A 2XQBH 5JDJA 3MO1A 4NKOB 1OWWA 4JRYA 3NGBC 1XR9A 2OLDA 3WSQH 3UEZA 4XWOC 3RBSA 1PKQB 2HKFL 4W4OC 3VXNB 1JWUB 2VLKA 2YEZB 4IRZH 3RL2B 4OBRA 4OUUB 4Z7WB 4LKXB 4PJXE 1AD9B 3C2AL 2EXYD 4AQ1B 4L3ED 4M5YH 3IDIA 3LAFA 1AO7B 4YDVA 1FPTH 4Y5VC 4NHCH 4ZNCD 4D0BA 2NCMA 4FMKA 3DRTB 4UAOB 1R3HB 1WITA 2YD6A 1L6XA 2CQVA 3V6OE 5I75B 1RUQL 2Y07L 4C56A 2QQNL 3G08A 3LN5A 1DCLA 2M26A 4DW2H 1UJ3B 3I02B 3OF6A 5E5UB 4PY8J 1CDYA 1UJTA 2R1YA 3QJHA 1CD9B 4KHTH 3NA9L 3PWPA 3ZDYE 5ESAA 1EGJA 3QRGH 1C7SA 1HI6B 2AI0H 3IKKA 4BFEA 4JJ5B 5A16B 3SGEH 3EAKA 3G6AB 5D7LB 5C0FB 4XBPB 3OXSA 5E9DB 2W0LA 3RHWF 1C5CH 4FQ2L 5E8EB 1U8NB 3OXRB 4JFFB 5CEXB 2DQJL 3QUYA 3WL9A 4UV7H 4G8EB 2HP4A 1HILA 1XGUA 1D5IH 5E8OA 5E2TL 3DXAD 2AJZB 3GMRB 4LRIC 1KBGH 2X5PA 4O58H 4AEIL 1FSKB 1CGWA 1S7TB 3MXVH 4HZLB 5TFSL 4A6YA 4G43B 4JFDE 3UYPA 5HJ3A 1FLRH 3M45A 1R3IL 5SWSD 2HN7B 1KELL 3LKOA 3WUZA 5CCKL 1ETZA 3O6MH 5HHPA 2OMNA 4KROB 3BMVA 1RSFA 1UVQB 4JQIH 2BOCA 3K8LA 4PJ8D 4TUOA 4DFHA 4BA8A 1I8IB 5D1ZA 3KGRA 3CFIC 5B4MC 5JQHC 3ECBA 2P8PB 1NUFA 4YC2B 4EOWH 1XF1A 3BGMB 3U2SA 3WO4B 3CX2A 4TUKH 3GSQB 1DEEA 2IANB 1A8JH 3QUKA 4KKCD 5IIEB 4RGNB 3EJZC 3HZYA 5DS8B 1MCBA 1QLRB 3ILQC 5BO1H 4DGVH 1BFOA 1RHFA 3C8HA 4FRWA 1JTPA 1C1EH 1OOAA 1ZSDB 3MV8B 4U1IA 4K3JH 5MERB 4LCIH 4U3XA 3MLVL 4ODSH 1KTRL 4UQ3B 3U9PL 4OZHE 2GYSA 2PXYA 4ZQKA 3V5DB 3FHAA 4FP8H 3WDHA 4Y1AB 4U1HB 2GK0A 5DMYA 1CD8A 1BJMA 5FHAH 1VFMA 3QB7C 5IMOB 4BFIB 3SBWA 4N8CH 2CDFB 5B3JE 4LCWA 1YECL 4I48A 1TNNA 3WD5H 5KW9L 3GIVB 3VI3E 1MH5A 2OQJB 3LQAC 1TVHA 4HDIA 4QRTB 5TDOA 1KIUA 1MQKH 1YY8B 2D03H 2FHBA 3U82B 5L0QB 5CJXC 3OKMB 4ZFFB 2EC9U 4OLVH 4NNXA 3IF1B 3DPBA 2X4OB 5EO9B 3O9WC 1NGPL 2C3XA 4UZGA 1T03H 5DZOA 1OF2B 4Y16D 3O11B 5D9SB 2X7LA 3Q5OA 3TZVD 3ALPA 4NQVA 5TDNA 5JW5B 2DKMA 3BKCH 1MVUA 5FYKH 3BO8B 5I9QB 4ZO8A 4NKOA 4KTYA 5C7XH 3L3JA 4S10A 1QACA 3K81A 1F5WA 4TNVF 1HINL 1PKQA 1LP9B 3T09A 4XAKD 4XBEL 1S9YB 1G7IB 4FQIL 2YEZA 3UZQA 4KJQD 1QPPA 1GSMA 3EJYD 4LKXA 1AD9A 1I3GH 2BFVL 2OI9C 5DK3A 3ZE1E 3SJVD 4HPOL 1AO7A 4ERSH 4PJDB 4G42B 4CVXB 3MJ8B 1R3LA 3M07A 2X44D 3EOAB 3MUZ1 4MXQC 5HYSB 1R3HA 5DJYB 4PRPD 1TZIB 5D96C 3MRBB 5JOEA 1IC1A 1UJ3A 3I02A 4F7EB 2PXYC 1MFNA 3OZ9H 3D0VB 3F62A 2PUQT 5I0DA 1K6QH 5K9JH 4H0IA 3VRJB 2Z35B 3C60B 1HI6A 1GGBL 2DBJA 4R4BB 4JJ5A 3VWKB 2GJ6D 4RMVA 5HDOA 1JYXA 3C09C 3G6AA 5D7LA 5C0FA 4XBPA 4OLZH 4JO1H 1CE1L 3OKOB 4P0DA 2JJVA 4K7FB 3PP4H 1U8NA 3CSPA 3OXRA 4MNQD 5E8EA 5CEXA 4MXWH 4MQXC 4Q0XL 4JLRB 1OSZA 2AGJH 3DV4B 3MCG1 3OPZL 1MVFA 2HJLB 2IFFL 1CFBA 4M7LH 4GKSB 3RHWK 3GMRA 1EHAA 1HXYA 1NBQA 5CUSL 1X5FA 2IALB 3NACL 3W2DH 1S7TA 3G5VB 3EYOA 2HN7A 3RWIB 2AEQL 4DAGH 2ORBH 1W0WB 3TYGL 2N56A 5I8CB 1RZJC 3OB0H 1BQLH 5I66B 3KLHD 1S7QB 1RUAH 3D25B 4PJ7B 5DMIH 1I8IA 3HI6H 3UTTE 4B5EA 2P8PA 1DQMH 4KUZL 3WJLA 4R90H 2IBZX 4YGVB 1WT5A 2NW3B 3GSQA 1DE4B 2IANA 3ZTNL 1XFPA 2VDKL 5DD1L 5IIEA 2ENYA 1JV5B 2DLHA 4XAWL 1WCQA 3BVNB 3IXAA 1BFVH 1WZ1L 4RAVB 5DS8A 1HEZB 5F1NB 5FUZL 5JHLL 1HSBB 5B39B 5C0BD 1ZSDA 3MV8A 3IS1X 3TO4A 4UV4H 2W60A 5DJZB 5ALCH 3HHRB 4UQ3A 1MHCA 2EH7L 1JVKA 3LRGA 5FHBH 3V5DA 1JPTL 1KULA 3BW9B 2N1KA 4Y1AA 4U1HA 2YD4A 4B53A 3NIGE 1LDPL 3ULVF 5IMOA 2B4CH 4HFWB 5J13C 2CDFA 5EU6D 3LHPL 4K3GA 4PLJD 3MRIB 5EOCL 4HJ0D 2X9XA 2R8SH 2OQJA 4QRTA 4ODHH 3HPJB 3S3PA 1EFXB 1YY8A 4IRJC 1P4LA 3OKMA 4ZFFA 3PGFH 3KXFA 4OV6F 2Z8SA 3FRPA 5C3TA 3IF1A 1NC4B 2X4OA 2EYTB 3KDMB 1ZGLB 5EO9A 1ZGLP 3JTSB 1TTGA 4U2ZA 5J1SC 4QHLB 2AJSH 4WI3A 3LKSB 1OF2A 3ARGC 3KYNB 2ADGB 2NLJA 3O11A 5C6WH 5GGRB 3INUL 1BPVA 1DBAL 1CLOH 5JW5A 3HE6A 3BO8A 5L2KB 5ADPL 3PJSB 4OGXL 4PTTB 4GXUM 4HXBL 3U7WH 1G9NL 1IE5A 3IFLH 4JEGB 3QIWB 1CF8H 1UH2A 1I8LA 1LP9A 1IKNC 3EOTH 4GSDL 1G7IA 3T4YB 3EO9L 4LBEB 3HC4L 1TCRB 4HK3J 2Z93B 3V4PH 1KJ2B 4WW2F 4TNVK 3MRLB 4ELME 2Q6WB 2NXZD 4JFEE 3E6FB 4KWUA 4Y19E 3SHSA 4G42A 4WGWB 3MJ8A 4LQFH 3RL1B 4OQTH 3GUTB 3ROLB 4S1SH 5HYSA 1T5WA 4XXDA 5JXEA 3DVIA 4OM0L 5DJYA 1U3HD 1TZIA 5HPMB 3MRBA 1MCEA 3TO4C 1NAMH 3NCJH 4GG6B 1NGQL 4F7EA 3D0VA 5EBMB 3QQ9D 3O4LE 4Y4HB 1J1XH 4CMMB 3B9DA 5FUCC 4OCLC 4I0PD 5TE7H 5KSBB 1ES0B 4JZOB 4R4BA 3CVIH 4GKNB 3VWKA 5GZOD 2PW1A 5HY9B 2NY1B 3CFBB 4G9FE 2WBWB 4JM2C 3MC0A 5JO5B 5L88L 3OKOA 3NPSC 4K7FA 4D2NA 1KFAH 2JB5L 3BX7C 3FFCE 3DV4A 2HJLA 3MUHL 4OB5H 2DMBA 1AGCB 2YS4A 1DQLH 3K80A 4GKSA 1DBML 1CBVH 2R2HB 1AE6H 1UB6B 4NZTL 2NY3D 5KS9F 2IALA 4N0YH 4WUUB 3GHBH 3G5VA 1FVDB 3L3HB 5SV4A 4OZIE 4ODVL 3RWIA 3RZCC 3LSOB 2YPLE 5CD3B 1W0WA 5JQ6H 5CEZD 5I8CA 4JRXD 5GRZA 3U46B 5I66A 2EZ0C 5KVGH 1S7QA 3D25A 1CL7H 4IRSD 4WIQA 5ALBL 3D3VE 1HZHH 2BRRH 4GAGL 3HE6C 2MQ3A 4HBQA 5I9QC 1YEFH 4YGVA 3GSVB 4PJCE 2NW3A 3GJFB 5I15L 4GS7C 3RY6A 1DE4A 1DQQB 3IDNB 5FYLH 4XVJL 1EO7A 1JV5A 3LEVL 1ORSB 4RAVA 4F15B 1HEZA 5F1NA 4IOFC 1G0DA 4LEOB 1KN4H 5DJ2B 1UYWH 1CR9H 4UOW0 3PXJA 1QRKA 4BYHA 5F7UA 3VE0B 4NM8L 5T1LB 2F8VA 3BW9A 3RA7L 2YD7A 1OAYL 3VFGH 4M1GH 1Q9LB 5EWIL 3HLAB 3HAEB 3QUMH 5B21A 2CK0L 4HFWA 4PJXF 4PYGA 1BFTA 1OP5K 4AG4L 3LRSB 5C8JB 2K7QA 1BWWA 3MRIA 3LQAH 4EI5D 4QRQB 1G84A 4P59H 3HPJA 1NFDE 2WUCH 3MXWL 5EO1B 4ZUSB 3SKNB 3CMOL 3P4OB 1CDHA 4XCEB 3RWHA 1UADC 1QSFE 1QYGH 4K3DH 4KZDL 1NC4A 2EYTA 3M8OL 3KDMA 2E27H 4M7JL 4UQ2B 5J3HC 3ZDYF 1ZGLA 2ERJB 1JPFB 3JTSA 2Q3ZA 1A3QA 1ONQB 4QHLA 1LEKB 3LKSA 5CINL 4MDJB 4BSVB 5BVJB 2ADGA 1CTNA 4YHOH 5GGRA 4H8WH 3L9RB 3S35X 3SE8H 2HFFA 5FO7B 5AZ2L 3ARDC 4POZC 4H26A 3PJSA 4PTTA 2JELH 4MJIB 3QIWA 4M3KB 4Q74A 2W9DH 5KJRH 3O4OC 4PS4L 1EIBA 5EPMB 2MCPL 4PY7B 3VRIB 4Z0BH 1TCRA 1XEDA 5DD3H 2R4SL 1OAUL 2Z93A 1A3RH 1KJ2A 4K07A 1MRDH 4LAQH 3MRLA 5E1AB 5T5NG 4M1CD 3Q6FA 3E6FA 4L8DB 4Z7VE 2R1WB 4XCFL 2AK1L 3GUTA 4YEEA 3RL1A 3QO1B 1FGVL 1WAAA 2FJGB 3FQTB 3UROR 1MFAL 3UZVB 2O5ZH 5EZLB 5F71A 5HPMA 4GQ9L 5HVHB 2G5RA 3IKCB 5EBMA 3UJTH 1PLGH 4Y4HA 4BZ2L 4CMMA 3MYZA 1M7XA 2HTKC 3JWDL 2C5DC 2IAMC 3IVKB 3IT8D 1WEJL 35C8H 3ET9F 5CLTA 4N8VB 1FZMB 5KSBA 4Q9QH 4JZOA 12E8L 4GKNA 1UA6L 2EIZA 3CFBA 4NQUA 3VGGA 1OY3B 2IPTH 5JO5A 1J1PH 3BKYL 4OZHF 2WK2A 3X11B 3OJ2C 5E95B 2VR4A 5JNYA 5ILTH 1H8OA 4ZPVB 2R2HA 4TULL 1UB6A 1JUFB 5B3JF 4WUUA 3SDYH 1FVDA 2E9IA 1MFCH 3LSOA 2P5EE 5CD3A 1TVDA 2V5TA 3VI3F 3OAUL 3VGDA 5FB8B 3K74B 1C5DB 4IMKC 5HYJB 3MV7E 4PTUB 3U9UA 3U46A 1I1AC 2FGWH 5IESL 3BP5B 2B5IC 4JCLA 1IGIL 2GCYA 4LDEB 4KY1H 4QXGL 3GSVA 5H94B 5D7KE 3GJFA 4JG1L 5CBEB 4IJ3B 5K9QI 4EKXA 4ELKA 4R0LB 4P3DB 1DQDL 4HQQL 5DDHB 4LEOA 4JG0L 2XV6B 5EC1A 3V7AE 2QR0B 1U8PB 5I1CH 2BSED 4KDWA 4YO0B 4HIXL 4ZFGL 4W6XB 1FC1A 4F58H 3ARQA 4Z7NE 3VE0A 1IC7H 5T1LA 1II4E 1QNZH 1F4AA 1A0QH 1Q9LA 5E6ID 2VXTH 3HAEA 5EBLB 4S0TD 3SCMC 1IRAY 4DGYL 4JB9L 5IBTL 3IFOB 4U1MB 3BH8B 4NO3B 3LRSA 1OL0A 4U33A 1ZWIB 5C8JA 4X4MA 1UQSB 2VZUA 3DNKA 5D70L 1I8MB 1VFBB 3ZDZE 5E2WH 4FFYH 3TN0D 3V4VH 1F4XL 3IFPA 3JVGA 4QRQA 1MCOH 1B0GA 3Q3GB 5K33A 2R39A 4NDMA 4BQBA 1T1WA 5DJ6B 4ZUSA 3P4OA 1DN0B 3CH1B 3RPIB 4XCEA 4XP6L 5F7NC 3HMWH 2NTFB 4LCUB 4U6XA 3ULUF 2A6KB 2ZKHL 3HB3C 1MJJB 4M93B 3EZJB 1IAIM 1JPFA 5MEOB 1DLFH 1DUYB 4NHUA 4OLYL 1LEKA 1I8KB 5EU4B 1MRFL 4RFNC 4XP9H 4BSVA 5BVJA 4PD4J 5KANI 3I3DA 4KRLB 1QVOA 3L9RA 2XN9B 3DROB 2E5EA 1AI1L 2A73B 2VLKE 4YHKL 5FO7A 1FRGH 1FCGA 2XG5A 4L3EB 3HUJA 1J8HE 4JO3H 4TTDD 1LVEA 4MJIA 1FNSL 3KLSA 1KCRH 4CUCA 3HMXL 4PGDB 1UGNA 3HTLX 5EPMA 1NMCC 1MCNA 4PP1C 1JZ2A 3S37H 4XC3L 4PY7A 1E6JL 3VRIA 1YEHH 5C0GA 5KVFL 5GGTA 3WIHH 5E1AA 3R1GH 3N85H 4AENA 5L2JB 4L8DA 2AEPL 1PYWB 4P3WA 3AMKA 2R1WA 5EDXA 4MNHA 5MHSD 5FUOH 4MQ7A 3L7FB 4HUWB 3QO1A 1GHFH 4AIOA 2FJGA 3T77B 2XWBB 4JQXA 1KGCD 2DLTA 1AR1C 4H1LB 4KKBC 3WKML 4YGAB 3VD5A 1HK6A 3IU3B 1BJ1H 1IGFL 4CVWA 3IKCA 4GMSH 4KJPC 3IJHB 5CJ8A 2KDGA 3IVKA 4NO0D 3U1SH 4N8VA 1FZMA 3N06B 1JFQH 1V3MA 5GRUH 5M95B 2FEEL 1KB5L 3VG9B 4BUHA 4O02L 5A3ID 3PG2A 5GXBB 4YQXL 1JYVA 2HVKB 2V17H 4PREB 5SWSB 2ZNXA 1WCBB 3LMJL 3SKOB 2XNAB 3FRPG 5JMRA 1NANH 1BEYH 2WBJD 4WHTB 5HGAB 2EIDA 3NIGF 3K2UH 2FJHB 4PJ8B 1NCBH 2ENSA 3EBAA 1JUFA 3FN9A 4NQDD 2C3HA 3NTCL 3B2VH 2ERJC 3X3FL 1MREL 1XCTB 2OK0H 5C0RL 5IGXH 5FB8A 3AB0B 4M8VA 3U48A 1C5DA 4K94L 4XPAH 4CL7A 4TQEL 3BP5A 2X40A 1CDIA 4AEHH 3GSRB 1U92B 5JIHA 1B4RA 5F96L 4NKDB 3VCLB 3SKUD 1X5ZA 2DMKA 1ED3B 1U9KA 4J4PA 4X7FC 1C5BL 4R0LA 2XWTB 2H3NB 4P3DA 4A2LA 3NAAL 3T0VA 5HYSG 3D9AL 3QPQD 3WNPA 3GZKA 3RWDA 1OW0C 4GRWE 2J6EL 5ICZB 2VKXA 1VPOH 2ESVB 5HDBE 1UENA 4YO0A 4RGOL 4ZSOB 4DCQA 1I9IH 2VUOA 4YHYC 1WUNT 5CP3H 5DFVC 1RZ7L 2NY4B 1A6WL 1X4YA 4KUCF 2VLRE 1JZ5A 4KGLA 2EYRB 5IB2A 2ZSWB 1I4FB 3DRQB 4R97B 3VFNB 1YZZA 4OT1H 3I85A 5EBLA 1BZ9B 2J4WL 1BAFL 3QHZH 3IFOA 3C2AH 3BH8A 4NO3A 2R4RL 2E7HA 4HG4K 3O3DB 4ELMF 1ZWIA 4ZOAA 1I8MA 1NFKA 4OFDA 1VFBA 4HLZH 3PUCA 4KKLD 4YDKL 1MELA 4KK5C 3IGAA 4Y2DD 1RUQH 2Y07H 1F8TL 5DJ6A 2QQNH 3LN9A 3QZWB 1UEYA 3CH1A 3RPIA 2GY5A 3BPLC 3WFBL 2VZ1A 3LY6A 2NTFA 3HA0A 4LCUA 3NA9H 2A6KA 3IFNH 1MJJA 4FZ8H 4X7EC 1MCLA 5MEOA 1F42A 1DUYA 3UDWA 2DJUA 1I8KA 1GOHA 1UACL 4OGZA 4PJGF 1LILA 3CX5J 2YWYA 4ZTPL 2V2XB 2XN9A 3DROA 2VRAA 2A73A 5EBGA 3WNLA 3D18B 4FQ2H 4UNTA 2DQJH 3UYOD 4L3EA 1NEUA 1DZBA 2PETA 3DWTA 3UXFA 3E6HA 4PLKD 1PX4A 5E2TH 4NRYB 5E24E 5T1DL 1E4XL 4PGDA 1GGCL 3CDFA 3B83A 5TFSH 4GLRH 2CUHA 5B39G 2Y4SA 3HS0B 1KELH 5L2JA 4WWKB 5CCKH 3N1FC 1PYWA 5K9KA 2XXCB 4X5WB 2VDML 4OF8A 2XWBA 2SEBB 2AABL 2ED7A 3WHXA 3P0VL 1FDLL 3RDTB 4K8RH 4H1LA 3VGEA 1MWAL 4P2RE 1JZ6A 3RIFF 4XP4L 3SGEI 4URTB 3V5KA 2OS7A 2R2CA 3IU3A 4JFXA 4Y5XB 4TVPL 2UZYB 4U6YB 5SWZE 4MNQB 5E4EB 3IJHA 3SE4C 1RPQA 4RSVA 3RNQA 1IL1A 4RX4D 4XCCL 1FAIL 2EDXA 3DXAA 3QAZC 1FGNH 3VXMB 2KKQA 3MRFB 3J7HA 3U9PH 4PBVC 2HVKA 3QDAA 5SWSA 1WCBA 1KIRA 3OR6B 3SKOA 1X5HA 2XNAA 5FGCB 1MI5D 3K7UA 4WHTA 3TFKC 1QBLL 4MJ4A 2DQDL 2P8LB 1FL6B 2WIMA 2AKRB 2FJHA 4PJ8A 3GSXB 3DVNA 4XNXL 4EI6A 3KPSB 4MA7L 1YECH 3MRJB 4HAGA 5KW9H 3H7BB 2EYSB 2YD8A 1ADQL 3AS2A 4YPGB 4AIXA 2BSTB 5L8KB 1A2YB 1NFDF 3K4AA 5T3ZD 3F7RA 2DM7A 3GSRA 5MI0B 4WHYG 1D9KD 4NQSB 1U92A 2VAAB 1V7ML 2EXYC 2DJ4A 5C0BB 3FO2B 4NKDA 5FOBA 3VCLA 1FO0B 2EDYA 4FTVD 3T0XA 4PJHE 3C6LC 5E1HB 1F6LL 1I7RB 3PQYD 1ED3A 4LL9A 3TYFB 5J57B 4WRLA 1NGPH 1WK0A 4DK3A 5IQ7L 5I1IH 2H3NA 1DBKL 5ETUA 5ICZA 3T2PA 4RFOL 2ESVA 2HFEB 4ZSOA 5FUCE 4M5ZL 5EU6B 1MCPL 3VMNA 2C4FT 3S96B 1IGJB 1HINH 5MEND 1XCQB 2ZSWA 3DRQA 5I71C 4FHBD 4YXLL 5AD0B 2IMNA 4XBEH 4FQIH 2WIIB 1BZ9A 3EDFA 4X0KB 5I18L 1KN2H 4EJ1C 3GI8L 2BFVH 3F6LA 3P0GB 1EHLL 2F19L 3O3DA 4HPOH 3KYMB 4GH7B 1MJ8L 2QLVB 4Z7VF 5JA9A 1CYGA 1BJ1J 2O5XH 3KXFE 3DETD 4FQXC 4PRIB 4JN2B 3QPXL 2CRIA 1LNUB 1FVEB 4LPYA 5SX5K 5KN5A 3IB4A 3QZWA 3RGVD 4J1UB 4V2CB 4CN1A 3ISWA 3QULB 5I19L 4Y4FD 4NKIL 5EIIB 5IV2B 5FGBA 5I1EL 5BRZE 3PNWA 3JWDC 1GGBH 4KHXL 3MNZB 1U41A 3H42L 2BY2A 4NQED 3GSNL 2QBWA 1F11B 1CE1H 2P48B 3L3IB 3D18A 2HT4D 4KKCC 3RWCB 4POUB 1O5DT 1NMBL 3SJVA 2I9LB 4Q0XH 1T83C 1CFNB 3OPZH 2IFFH 4NPYB 5HI4D 3KHOA 4NRYA 1G6RB 4PRPA 1WSST 1U3HB 5EN2A 1OP3H 3NN8B 3NACH 5LGKA 1IGML 2B39A 2XA3A 2VITB 4XVSL 3PHOA 2AEQH 3HS0A 4Y4KD 3H7LA 2RR3A 4H5SB 2CR6A 4HWBL 4I2XA 5D6DC 4JPKH 4Z95L 3TYGH 4D9RE 4DUXA 2J1KA 2VN4A 2PYEB 4X5WA 5CS7A 1M1SA 1BIHA 5F6HJ 2SEBA 4JHWL 1AGBB 4P9ML 1FVCB 3RDTA 2GJ6A 3EYVB 3BRDA 4KUZH 4ZYKB 1FNHA 3HAEG 5F7LB 5GRWA 2XQYG 2VDKH 1WWCA 5DD1H 4MNQA 3ZTNH 2ED9A 5C2UB 4XAWH 2NW2B 2FLRT 3FOLB 3RIFK 3WHE0 1KV3A 4FQQB 4BK4A 3WFZA 5JHLH 5M7QA 5TE6L 2IQ9L 1CDUA 5E99L 2R2EB 2YHGA 1MFEL 3D2UB 5CWSB 4YHMH 2A1WL 3OR6A 1JPTH 3WFEL 1KEGL 1WZMA 4K7PL 4HCRA 2CK2A 4JRXB 4Y16C 1AXTH 2P8LA 1LWRA 5CHNB 2HFGL 1LDPH 1QSEB 3V2AR 2AKRA 1BJ8A 4IRSB 3TZVC 1EPFA 3GSXA 4NWTL 3JWOL 3KPSA 3HFML 5FGRA 3QXTA 3MRJA 3LHPH 2FECI 5EOCH 3F65A 3BWAA 3H7BA 3W0WE 2EYSA 4WFGE 1D3CA 1KCUL 4MD4B 4YPGA 3QP3A 2W9LA 2BSTA 4C83B 1A2YA 1FBIL 1BGXL 3VXPA 4KJQC 3EJYC 4M4PA 1EZVY 4F7TB 4NQSA 1INDL 5C0BA 4KRNA 3FO2A 1FORH 1JN6B 3HC0B 1NCDL 1FO0A 4XBGB 2BVTA 3QT2A 4G6JH 5MEQA 2YUWA 2XICA 4CU7A 3TYFA 3O3BA 4P4KD 4Y7MA 3IDGB 1TFHA 1TLKA 3NH7L 4X6FB 2HAZA 3RZWA 1QEWB 3INUH 3M1BB 4Q97A 1DBAH 4GW1B 5EU6A 2YUZA 4MCZB 4DKDC 1F45A 3KR3H 4J3SA 2VIRA 1QRNE 5ADPH 2F54B 4OGXH 1SMOA 1G9NH 1TITA 3ZKND 4LVOC 1T5XB 1XCQA 1HH9B 5EULV 4G6FD 4GSDH 3HI1B 3EO9H 1ZVHA 2WIIA 1MEXL 4N8VG 1QLFB 4O51B 3KYMA 3IRPX 2EEBA 1A02N 3BMWA 2FX9L 3FKUS 4JN2A 4PRIA 1KCSL 3DYMA 4OM0H 1FVEA 4TOYL 2UZIL 4P57B 4R9HA 4U1SB 5E0QA 5F1SA 4U1JB 1PY4A 5HHNB 3IAGC 5F97E 5F9JA 5FO8B 5I8OL 4JREC 4Z7OE 1I75A 4LARH 5EIIA 2H32B 5IV2A 1KEML 3T0BA 5KVMC 1J0YA 3MNZA 1IEBB 1KNOB 3H9YA 1J8KA 1F11A 1KACB 3L3IA 1TTFA 3QRFM 5DQ9A 2AXFB 2GT9B 5KSAD 1BVZA 2JB5H 4W81A 5DGRA 5DLML 3O6LL 1CFNA 3UAJD 4NPYA 4PRDB 2VDOL 5IFHL 1DBMH 2CLVB 3LIZL 4TSCL 1U3HA 3NN8A 4NZTH 1WAAE 1W8NA 1HH6B 2OL3B 1CZ8L 1DVFD 4ODVH 4OCMC 1TQBB 2F74B 1L7IH 1T0NB 1FV1B 2WZPD 4H5SA 3L3GB 1WBYB 1OCWL 3U4BL 2Y7QB 4I0CC 5ALBH 3C5ZC 1KLUA 2EDNA 2FWOB 1I9RL 1FZJB 4GAGH 5HHQB 1WBZB 4ZYKA 2B7DT 3VXUB 4NRXB 4PLJC 5I15H 3TBVA 5TGBB 4HJ0C 4XMKL 5AG8A 3B6SA 1JWMB 4XVJH 2RIKA 3O3EA 3LEVH 2X4PB 2NW2A 3FOLA 4N90E 4LFHG 4G8GE 3U36B 4O2FB 4HZAA 2R2EA 1P4IL 2H8PB 4GRWF 1XIWD 3D2UA 5C1MB 2P8MB 3GRWL 4AEEA 1MJUL 5D71L 1UG9A 4G9DB 5CWSA 5DA4A 1PFCA 1AHWC 4XH2B 4NM8H 2XWJB 3FAXA 3G5ZB 3QEQD 2HVJB 3QFJB 3MOBL 1U36A 4JRXA 5GQBA 5CHNA 1YQ2A 2DIJA 2IG2L 5EWIH 2OCFD 4IRSA 1OARL 1S78C 4E41E 2CK0H 1JRHL 4AG4H 2NZIA 3BXNB 1H15B 4OJFL 1A7QL 1HHGB 2JCCA 4HUNB 4TPRL 4F8TA 5AAWA 4MD4A 4U7MA 4C83A 3KPTA 1ZA3A 3CMOH 1YNLL 1U95B 4F7TA 5IBLD 3TV3L 2DYPB 4P5TC 2IJ0C 4HIEB 1KLFA 2NXZC 1JN6A 3HC0A 4KZDH 3P11L 4M7JH 4AIZA 4X9HA 2FD6H 5GGRY 1N3NB 5D72L 1CE6B 5KSVB 1UKTA 3IDGA 5EU3B 5CINH 3KWWB 4K71C 4J7RA 3HG1B 1QEWA 3M1BA 2X9YA 4GW1A 3QQ9C 1NL0L 5AZ2H 4MCZA 4H1LG 5ISZB 5GRVL 2FBJL 4JZJC 5CZKA 3WLBB 2F54A 4I0PC 2AK4E 2XG4A 4I3RL 5GZOC 1T5XA 4X4ME 4PS4H 1AP2B 1X5KA 1ZA6B 3MLPA 2MCPH 4JAMB 4O2CA 5HPOA 5E7FA 2VXUL 4FNLH 2R4SH 1OAUH 1QLFA 5DFTA 3QIBD 5I74B 1AXSB 4LPTA 4XCFH 2AK1H 1N64L 1FGVH 1TJGL 4EN3D 5T5FL 1MFAH 2LTQB 4L4JA 2NY3C 4P57A 5AEAA 2IPUG 4GQ9H 3U83A 4U1SA 4U1JA 3GBNL 2D0HA 1A9EB 3MRDA 5GGVL 5HHNA 3OKKB 3IDJB 4BZ2H 1OVZA 3JWDH 5AZEL 2W59A 1WEJH 3SDXE 3RU8L 4JFHE 3HUJE 4Z6AT 5IB1B 4JQVC 5J12B 1CD1B 12E8H 5I1JH 1IEBA 1KNOA 1U91B 1UA6H 1FZOB 1JI1A 3MV11 5ADOL 3C87A 4HUMB 4NCDA 1AY1L 2AXFA 2GT9A 1V05A 5EOCJ 3ZDXE 1A6VL 1IAOB 1NQBA 1J1OL 4PRDA 2OR7A 2CLVA 5JXAL 4TULH 1G0XA 2EIEA 4JM4L 4OCYL 5CSGA 3REVB 1HH6A 2OL3A 4NO2A 4UB0L 3MACL 5IB3A 2XIDA 4NN6B 4PJFB 4NM4L 2F74A 1T0NA 1FV1A 1WBYA 1FG2B 2VLLB 1U6AL 3SDDB 4M6NL 2Y7QA 3AROA 1LE5B 5IESH 4NZUL 4NO0B 4PJ9B 3KJ4B 4HD9A 2FX8L 3T2NL 3LD8B 2FWOA 4KKAC 1FZJA 5HHQA 4QXGH 3VXUA 4NRXA 4NNPL 1MCRA 1OM3L 4JG1H 4ODTL 4PJHF 5TGBA 1YPZB 1JWMA 4EI5C 4S1RL 4HC1L 1B6DA 1EEUA 2EDQA 2X4PA 3ARTA 1TZHB 1DQDH 4HQQH 1YMMB 3G6JE 3SO3B 4JG0H 3U36A 4NNYB 4WTZA 2H8PA 5C0CD 3X17A 1P7QD 4NQDB 4HIXH 3KPRD 3QZWG 4ZFGH 4F37F 4JY4B 1FIGL 5C6PB 5EUOB 4YFLF 4UIKL 2QADB 1R5IB 2XWJA 1DFBL 2HVJA 4JM2F 3G04B 1ZHLB 1UM5L 3ZYJA 3BZ4B 4RMUA 4DGYH 4LLVB 1INEH 4F33A 4MMXC 5IBTH 5FYKD 1IILE 4K9EL 4YFDB 1BM3L 1H15A 2J7LA 3BXNA 4LLDB 2X4UB 1HHGA 4OSUL 1F4XH 4X5LA 5AAMA 4HK0B 3D3VD 3T0WA 2DYPA 4XP6H 4HIEA 1SY6L 4M1CC 4NT6A 2PTVA 1MCWW 4A2MA 3SOBL 2HRLA 2ZOKB 2YD9A 5GS0L 1N3NA 3RY5A 1T80A 1CE6A 5KSVA 2B1AL 3RWGB 1MRFH 1RIHL 1OTSC 4O9HL 5E6IA 3MV9D 2P7TB 1R5WB 3ARWA 1G7JB 3HG1A 4RDQF 4LVHC 2Q20A 4CJ1A 1TQBC 5E5RB 1AI1H 1LP9F 2ITCB 3QDJE 3LH2L 4YHKH 3FZUD 5ISZA 1QOKA 1RK0A 3TH2T 1F4YL 3TBSA 3WLBA 5SX4I 1CXLA 4RQQB 4FA8A 1FNSH 3D39B 5C70A 1A7OL 3MLWL 3HMXH 1PKOA 1AP2A 1ZA6A 2CRZA 1WGOA 4JAMA 5TH2B 4LSVL 1URLA 4XC3H 1E6JH 1REIA 3ZO0A 5KVFH 5BV7C 2DQFA 3BYYA 1AXSA 4M7LT 2BRQA 3CFDB 3MYJB 3VRLE 2AEPH 1B2WL 5KAQF 2ZPKL 4HFUL 1HNGA 3RVTD 5EU7C 3VFMB 3D48R 2EDOA 4JDZB 4TSBL 2AS5M 3WKMH 4ZODA 3SE3A 1F6AB 2D2OA 1IGFH 1A9EA 3KPPB 4WI5A 4YHIB 4XP1H 3ZKQD 2IBZY 4JDVA 5CFHA 3KAAA 4GAFB 5F89B 2OJEA 2CPCA 2VAJA 2XKSA 4X9FA 4XP5L 5IB1A 4UNVA 6FABL 1CD1A 4PRBA 4ZUUB 3KVQA 2DQUL 1U91A 1KB5H 3KYAA 1JTOA 1RZFL 1FZOA 4O02H 4KZEL 3G5XB 2HLAB 4YQXH 2GSIB 5KVEL 2CSPA 3LMJH 1YC7A 3SE9L 1IAOA 2DN7A 5IVOA 1JHLL 2OBGA 1A6ZA 3D87B 4EQ2A 1JTTA 4HKBB 4XNYH 5C09B 3REVA 3ARZA 3FT2B 3NTCH 1MREH 3KG5A 4PJFA 1T1ZB 3JWOC 3EGSB 5C0RH 2VUYA 3DARA 2VLLA 4K94H 1LE5A 4TQEH 5I1AB 5E6IC 1CICD 2WANA 4NO0A 4PJ9A 1FZKB 5JPMA 2AEWA 1FN4B 2R23A 4LSRL 5F96H 1SM3L 3DXAE 5C0ND 2ADFL 5HBBA 4OLXL 4QHNB 3TN0C 1IQWL 1YPZA 3O2VH 4M00A 5FM5M 2ZCKH 1J5OL 5JW4N 1MI5B 1C5BH 1BVKB 4DZ8B 1TZHA 3O0RL 4ZO9A 2Y36L 3NAAH 1NANI 3D9AH 4NNYA 3MODH 4YHZL 2CDEB 4NQDA 4OUOA 3CFEB 1D6EB 3PP3K 4XX1G 5EUOA 1RZ7H 1A6WH 4IMLA 1R5IA 2YA0A 1PDKA 3MR9B 4WW2B 3DYOA 1B6UA 3RKDD 3SE3C 4F37K 3BZ4A 2R1XB 4LLVA 4NWUL 1XGRB 2J4WH 1BAFH 1D9KB 4I13B 2R4RH 3QDGE 3JTTA 5J1AB 2BDNL 4TTDC 5J6HB 4FTVB 4LLDA 2X4UA 4NUGL 2W07A 3PQYB 1HDMB 3S36L 4YDKH 3MV7D 1X5LA 4HK0A 3WFBH 2GHWB 4G80A 4ZNEA 4EQ3A 3ES6A 1IAKB 4YNYB 4Z7OF 1NDMB 2ZOKA 2EDDA 5D2NB 2YD1A 2VZTA 3DX7B 3RWGA 3UTPE 1TCMA 5IVXE 5E2UL 4HUKB 3T0EB 5HHOB 2P7TA 5D2LA 1G7JA 1VHPA 4ZTPH 1A7PH 3O45B 5INDB 2ITCA 5I1DB 1EEYA 5KS9B 2FGZA 2YKLL 1WISA 2F58H 2M1KA 3AS0A 1BHGA 2G9HB 4KGJA 1U8MB 4RQQA 3D39A 3B9KB 4F7PB 1E4XH 2JIXB 4JY6B 3L5WB 1Q8MA 1GGCH 5JW4Q 5TH2A 1WAAF 3STZB 3RGVB 1O7VA 1QBAA 2GY7B 2A38A 3MYJA 1RUPL 5DD5L 5J4MA 2WBJC 3IJYB 2VDMH 2JJSA 3VFMA 2AABH 1M71A 2G2RB 2VDLL 3C08H 3MJ9A 3WFCL 4JDZA 4WI4A 3WJJA 3P0VH 1FDLH 1MWAH 2DS4A 4QT5B 1D7FA 2V5RA 2WW8A 4XP4H 1XGQB 3OR7B 2UWEE 1OTTC 1VFUA 4XAKE 2FDBP 1EO8L 1H8NA 3A67L 4TVPH 2X6MA 2ZG3A 3O6FD 3C5SB 4XCCH 3SJVE 1FAIH 3ZKXB 1SJVA 3LQZB 4DUWA 2C3VB 3ULSB 3EO1B 3G5XA 2HLAA 4PRPE 2I26N 4PJXB 2GSIA 5FYLD 5GHWL 3EJZD 1GCFA 4Y4KB 4LQ1A 1QBLH 2DQDH 3VWJB 1L4IA 4I2XE 3QPQC 5DT1L 5L6YL 4KU1A 1Z3GL 3LS5L 4HKBA 4XNXH 2JB6B 3DSFL 4LLQB 4MA7H 1T7XA 1G9MH 1T1ZA 3RWJB 2GJ6E 3EGSA 1YQVL 3IDYB 3PF2A 2VDNL 3BD4A 1MCSA 1ADQH 1SYSA 5I1AA 4ESKA 4RX4A 1UM4L 1XF4B 4KMLB 1LO5B 4PLOB 1FZKA 2XQBL 1FN4A 4Z78A 3D6GA 2VR9A 1O0VA 3KHQA 1IGTB 3VXRE 2P5WE 3QEHB 4G7YL 4QHNA 4I3GA 1NGYB 1ZK9A 5EUKB 3V79C 4RGMC 2X4QB 1MI5A 4Y2DC 3F6IA 1YEIL 3T65B 1BVKA 4M5YL 1C12B 3P4NB 3P9LB 2C4XA 1FPTL 1T89C 2CDEA 4L29B 1A9BB 1D6EA 3CFEA 1Y6MR 5ESQB 5JR1L 4JFDB 1G7LB 2JJSC 3MR9A 3WJJC 3MGOB 3JUYA 1P84J 4YDJA 2R1XA 3BEWA 1C7TA 3MZTA 5I18H 1XGRA 2Y5EA 1D9KA 3GI8H 2IH3A 1E4WL 2F19H 5LWYH 4H0GA 5J1AA 5DJ0B 1MJ8H 1JZ8A 4FTVA 2UZXB 3MPCA 3MQIA 1RJYB 4KTEL 4PLKC 3QPXH 3PQYA 1HDMA 3ZT6A 4JFOB 2WWKT 1C5CL 4GMTL 3O3AB 4LIQH 5ELIA 1DBJH 5JOPD 2CKBA 1D5IL 5TPWL 1OT2A 4NKIH 1IAKA 4YNYA 1KBGL 4JVPA 1BBDL 1NDMA 2NY7L 1RI8A 3SDXF 4OZHB 1YNTA 4J3UA 5I1EH 4V1DD 1EH9A 3HUJF 3MXVL 2Q7NA 3O2WL 4KHXH 3MV01 4RIRA 4G6FB 5HHOA 3T0EA 5E2VL 2LU3A 3GSNH 3MLZL 2ZUWA 3MJGX 1TVBB 5I1DA 1IQDB 5KS9A 4FFWD 1NMBH 3CDGB 4NJ9H 3LZFH 2G9HA 1WQVT 3ZDXF 3CCHB 5D7JC 4ETQB 1U8MA 2IC2A 3B9KA 4F7PA 4JY6A 2JIXA 3BAEL 3L5WA 5HSFA 4TUKL 1G6RL 4R4ND 5LCVH 5BW7A 3STZA 3RGVA 4FMFA 1Z5LB 1IGMH 3ARFB 4MQXD 2NY2D 4XVSH 2XKNB 4ZAKC 5IB4B 4KTDL 3IJYA 2CUIA 4L9LB 3OKNB 4PG2C 1C1EL 4BQCA 1R6VA 3CPLB 2K1MA 4JHWH 4K23H 4P9MH 4IIQB 4QT5A 4NQEA 4EUPG 1K3ZA 1XGQA 3OR7A 2FRGP 1U93B 3OGOE 3QQ3A 5FV2A 3VH8G 5IVNA 3QFDB 5KSAB 4JFQB 4G8FB 4Y5YB 4N8CL 5I6XC 1JGDB 2ARJQ 3C5SA 1R0AL 3MA7B 2NYYC 4U6HB 1VEMA 5TE6H 2IQ9H 5E99H 1RAMA 1VERA 4I0KA 2C3VA 1MFEH 3ULSA 1KIQB 3EO1A 5ACMA 3WE6A 2P4AB 1B4JL 2MMXA 1N5YL 1KJ3L 1KSRA 1EO5A 4PJXA 2A1WH 2KQNA 4Y4KA 3RY4A 1RV6X 3CVHL 1KEGH 4K7PH 2EEDA 4ZXBD 1QD0A 3Q1SL 1ZHBB 2HFGH 3CLEL 4X80L 5L8JB 4MAYD 5DTFB 4LP5A 3V6OA 3L3OA 3QXWA 4NYLB 2JB6A 3JWOH 3HFMH 3PABB 4LLQA 4KI5C 1F13A 4RWYL 3NZ8A 4LLYB 1F4HA 2EEAA 2Y5TB 4K9EC 5FA3A 3VXTB 1KCUH 2X1WL 2OSLB 1DUZB 3IETA 1FBIH 1BGXH 1U8OB 2OTUB 2RB8A 3BKCL 4NOBA 5FKPA 5C0DB 2CD0A 2KH2B 2X9WA 4LHUD 5C86A 3SGKA 1X5XA 3T3ME 1INDH 3FCTB 3ARBB 1QA9B 3GJFK 1NCDH 4HV8B 3QEHA 4UI2A 2YK1L 3FT4B 4NIKB 1NGYA 3DETC 3QCUH 1ZAGA 5EUKA 1HKFA 2MWCA 2X4QA 1F90L 3MMEA 3T65A 5FCUL 1ZHNB 2V9TA 5I73C 3V5HA 1C12A 5KBNC 2K3TA 4PJEE 4ERSL 5CEZE 2GJZA 3P9LA 5CILH 3P30L 4Y4FC 2EC9T 4J3XA 5H37G 4TVPE 4L29A 4DN3H 1A9BA 3BDYH 3GI9L 4AQOA 5ESQA 4HGKC 4HKZA 2FL5A 3L7EB 4JFDA 1G7LA 3ARGD 3BQUB 2B0SH 5LG1A 1NC2B 4UOJA 4WHYH 1XGPB 2JCCE 1MEXH 3GHEL 3QI9D 3UTTB 1ZT1B 3RTQC 2HT4C 1HIML 3W11D 3DECA 1EVTC 5DJ0A 2EH8L 1TJHL 5HDQL 4M02A 3ALXA 1BOGB 2A9ML 3U30C 4HWNA 3DO7B 2FX9H 1RJYA 3ABZA 3MRKA 1KCSH 4KK9D 3KLDA 3ARPA 5JHDD 1EEZB 4JFOA 4P4KA 2UZIH 4OLZL 4P9HC 2FH8A 1PEZA 3GMLB 3PP4L 4DFIA 1M6OB 3BP4B 1UXWB 1KCLA 3E3QC 2X05A 4PJBA 1TTUA 5DRWB 2Q7YA 2O5YL 4M7LL 5CGYC 5BJTB 2Z31D 2ZSVB 2W0KA 3GMPB 1IAIH 4RCAA 4XB7A 2C9AA 1EV2E 4X98A 2DOCA 2YWZA 2ORBL 4APQD 2DM4A 2GK2A 1TVBA 1IQDA 4PJ5D 1IGYB 3CDGA 5DLMH 4P5KB 3O6LH 2VDRH 4QTHB 3CCHA 5DUPH 4R96B 1KF9B 4ETQA 5D1QD 4EN3B 2QQKH 5IFHH 1GH7A 4R90L 3LIZH 5FM5O 5FCSH 1QUNA 3RVUD 3PWJB 3W39B 4CKVX 3TA3B 1INQA 4OFKA 3MFFB 1Z5LA 2BY1A 2XPGB 4LVNC 4NBXB 2XKNA 4U0RB 5IB4A 1OCWH 4MJ2A 3U4BH 1B90A 4L9LA 1A1MB 3OKNA 4BQ9A 3D85B 2ZUXA 4LSUL 3CPLA 4KDTA 4IIQA 1P5VA 1RJLB 3WN5B 3R06B 3VGHA 1NKRA 4LK4A 2WQRA 4J6RL 4XMKH 3WXVL 2DKSA 3TCLA 1VADA 2VE6B 1D5MA 3QFDA 1BZQK 4JFQA 4G8FA 4Y5YA 5CSBA 5J8OA 5KSAA 1JGDA 3MA7A 5BRZD 4G6AC 4CW1A 4M9PA 1MRCL 4OFPA 3BP6B 3GIZL 1P4IH 1YMHB 3H3PL 1KIQA 3GRWH 2LQRA 3JXAA 4HKXA 1MJUH 4JKPL 5D71H 3CXHK 3W82A 4P23D 3KPMB 1DVFA 5CAYB 1SVCP 1ITBB 4ELMB 3LKNB 4P4KC 4JFEB 4Y19B 3MOBH 3QIUB 1HN1A 1ZHBA 2XFXB 2IG2H 1KXVC 2CIIA 3QUXD 3RQ3A 1OARH 1JGVL 5DTFA 3PL6D 3EIFA 1JRHH 1U8LB 2ZUSA 3PABA 4LPVA 4LLYA 1L7TL 1EUUA 1A7QH 2YBRA 3WYRA 2Y5TA 2E6PA 4YBLC 3ZKNC 1TENA 3F7PC 3O4LB 3VXTA 4YZFE 4OZFB 3H9SE 4LSPH 2BERA 1DUZA 1XGTB 2OTUA 1U8OA 4ZUVB 2OZ4A 2W92A 2VDQL 5C0DA 4BH8B 1YNLH 4PJIA 3TV3H 3FCTA 3ARBA 4OZ4B 2DLGA 1W72L 3QG6B 5DRNB 3WMSA 1QA9A 3OV6A 1UM6L 1Y18A 4G9FB 5D1XC 4HV8A 3IFLL 3P11H 5EU7E 1JE6A 1F6FB 1U0QA 1MJ7L 3NOIA 4XXCA 2FATL 2R69L 2NY0D 4N0UE 2C7UA 3BKML 3CFJB 3FFCB 4LLMB 1ZHNA 5IVXF 4PJAE 1OB1B 4OQTL 5GSRB 3DVGB 5EOTA 3VGBA 5C0JA 1NL0H 5IFJB 2FBJH 3L7EA 1PX3A 4OZIB 4KMTL 2Z9TA 2ATPB 2EECA 2YPLB 3BQUA 4IIQC 4I3RH 1KPUB 3SQOH 1NC2A 4Z76B 3GKZA 1N59B 1XGPA 2W0PA 3ZE0E 1A6TA 2VXUH 4RBPK 4P3CL 3K1DA 3UTTA 3SGDI 1ZT1A 3D3VB 1QG3A 2F5AL 4MSWB 5D93B 2XTJD 1JNLL 1IT9L 1Z9SA 5GGTH 3L5IA 4PJCB 1BOGA 1N64H 3UAJC 5DEGB 1TJGH 3W0WD 4JKWA 1OAXH 5LAXB 4MZ2A 4WFGD 1EEZA 3CSBA 1S5HB 1FAKT 3FFDB 3GMLA 1KFAL 4DVRL 4P49A 1M6OA 3BP4A 1DVFC 2UWEF 3GBNH 2E9BA 2AJ3B 5GGVH 5DRWA 4P2OD 6CGTA 2AJUH 1DQLL 5BJTA 1NBVL 5AZEH 4X9IA 5JMOC 3QWQB 3GMPA 3AU1B 4NN5C 4KFZC 3RU8H 4OI9A 2BNQE 3GHBL 1MQ8A 4HIJB 4XC1L 4L8BB 1H3VA 4K8RD 2HYMA 2FSEB 5JQ6L 1N6UA 2HTKD 4ENED 5ADOH 1MLBA 1AY1H 3TGXA 3HE7B 1IGYA 1CL7L 1LGVA 4P5KA 4QTHA 1A6VH 4B7IA 1J1OH 4EN3A 4X7SL 1XIWC 2D7OA 3PWJA 5JXAH 4KV5E 2XZCL 4OCYH 2WWKO 1NFDB 3FN3A 4UB0H 3MACH 4XXCC 1DBBL 1QSFB 1Z9OA 5HYIA 2RFXA 4OD1L 1AKJD 1Q94B 1U6AH 3I6LE 4M6NH 1A1MA 1TXKA 1UYWL 4MLIA 3AXLA 3D85A 4GFTB 4NZUH 2UUDH 1VB9A 4PFEA 1NH6A 3T2NH 1RZKL 5L8LB 2BVPB 3WN5A 2FYYB 5F6IB 1ITCA 4NNPH 3S34L 4ODTH 2NY6B 3CUPB 4OTXL 5EA0L 4S1RH 4HC1H 5H2BA 5FKAB 2VE6A 3S3JA 4HMDA 4XT1C 3T1FB 3S88L 3NVQA 1U8IA 3BP6A 5MHSE 1F58L 2OP4L 1YMHA 2DLIA 1WBXB 4YAQB 1FIGH 1NAKL 3KPMA 1KGCE 3MA9L 4TSAL 4UIKH 5GS1B 5C71A 5EFIB 4ELMA 1EJ6A 3LKNA 2IPUK 1DFBH 4JFEA 4M48H 4Z7VB 2E3VA 1QYGL 4P5MB 4HMCA 4Q6IC 1UM5H 4QNPF 3VFOB 1A4JB 2WBKA 1F3DH 2G60H 4YDLB 2E27L</