1WITA

Twitchin immunoglobulin superfamily domain (igsf module) (ig 18'), nmr, minimized average structure
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
93
structure length
93
Chain Sequence
LKPKILTASRKIKIKAGFTHNLEVDFIGAPDPTATWTVGDSGAALAPELLVDAKSSTTSIFFPSAKRADSGNYKLKVKNELGEDEAIFEVIVQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and stability of an immunoglobulin superfamily domain from twitchin, a muscle protein of the nematode Caenorhabditis elegans.
pubmed doi rcsb
source organism Caenorhabditis elegans
molecule tags Muscle protein
molecule keywords TWITCHIN 18TH IGSF MODULE
total genus 11
structure length 93
sequence length 93
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 1996-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07679 I-set Immunoglobulin I-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1witA00
1AE6H 1AD0A 3BKML 1QFWL 3TO2A 5IB4A 5IKCA 5BS0B 1C12B 5GJTH 1Z6JT 5DEFA 4FQQA 3BE1H 5DLML 4ELKB 5C0GA 1CLOL 3QNZB 1TQCC 5E9DE 3H9ZA 3FB8A 3GKZA 1YY9C 5I1DB 4QXUH 5CGMA 3OJDA 4RCAA 1JK8B 4P3DB 1KNOB 4NJ9H 3LS4L 5LG1A 1AC0A 1QR1A 5D71H 2EICA 1HHHB 1FNLA 4IRSC 5CZVL 1VFOA 3TCXA 2VO5A 2CDEA 4HKJA 4YXKH 3G08A 4YHYB 4S11A 3BH9B 2XA8H 2AK4D 5E6IC 4MNGE 3PWVB 2XY1A 1QSEA 3GGWA 2RR3A 4JO2L 4LDEB 1CS6A 4ZPTA 4Z77A 1U3YA 4K07A 3K2UH 5E2VL 4KHXL 5DC4B 1HHHA 5T1DH 4P3CL 3MRMB 1JGVL 1FL6A 4LEXH 5FUOL 1MUJA 4H0HB 4NBZB 3OKOA 4P5TC 1D5BB 3F8UB 1GJIA 1BVZA 1S9VB 3PDGA 5E2UH 3B9KD 1FBIH 3T0EB 2D7NA 5LBSL 1B3JA 1JWMA 2XTJB 5JPMB 2O5XH 2XQBH 3L3GB 3JWOC 1TCMA 3OXRB 2X1PA 2Y7QB 3BAEH 2CK0H 4P9HC 5E8DL 3S35X 4OM0H 4AG4L 3EFDL 3O3DB 1V7NL 4ZMAT 1MNUH 1QTYT 2AJUH 4JM2A 4LGPB 3Q6FA 5JQHC 1X5KA 5DRZB 3V0VA 3RL2A 5DHXB 5C08D 3NIDF 5EU4B 4PJAE 2QSVA 43C9B 3VWJA 4DGYL 5D6CA 2UUDK 5IM7B 1A4JB 1I8MB 3BPOC 3ZMRA 1BQSA 3P73B 1BVKA 2DOCA 5C0RH 3V7AG 3L3OA 5FEBA 2M8XA 2XKSA 4TSBH 3UTTA 3ORJA 3IJHA 2RQ8A 3QXTA 1CGVA 2YHGA 1GGCH 3P11L 1QEWA 4Y19D 4ESKA 1CK0H 4I0PB 4E41B 1ZLSL 5HHQA 4EI6A 3DIFA 3BPNB 4LU5H 4AIXA 2UWEB 4U0RB 3AU1A 1L0QA 5MENA 3KPNA 1AGCB 1BOYA 3BH8A 4Q9BA 1LEKA 4ZO6A 2JJUA 3SKMA 1BGXL 5ALBH 1IKNC 4F7TB 1MQKL 4YIQB 4MDJB 1J1OH 5DUML 3S3SA 4OD1L 1QYGH 3PQYB 2I27N 3MLSL 5F97E 3SDAC 4IDJL 2W65B 1F6AA 5GRWA 1RK0A 4CKVX 3LEXA 3WUWA 4TNWK 1JYNA 1OTSC 4Z7VB 4NZUL 1I3GH 5I6XC 1T6VN 1IC7L 4ELMF 3MRPB 4DGIL 3UBXI 2NY4D 3HZYB 3RVVD 3U7WH 2R2EA 4RMRA 2J8UA 3PWPE 2VE6A 3UMTA 4HJJH 2X1QA 5TDNB 4R0LB 1A22B 4OZFH 1OWWA 4IRZL 5E2WH 3UDWA 2MQ0A 3QO0B 4XCNA 4JFYB 4X8JB 1NAKL 3U82B 1AD9B 2F19L 5B22A 2W38A 5ADOL 1N5AA 3I75B 4WFHE 2Z35B 4HCRH 2NY3B 6FABH 4FABH 1U9KA 3AMKA 5IQ7H 3DI3B 5CD3B 5I66A 4Q9QH 5TE6H 1IT9H 1CICA 5KS9A 3NZ8B 1QRNE 1FGVL 1A9BB 3BDXA 5DXWA 1H8NA 2BSED 2H26B 3DGGB 1EAPA 3VWKB 4PG9B 1RK1B 1A14L 2R1XA 1V7MH 3EUUA 3G6DH 4M4PA 3GMQB 1A6VL 3RIAF 4YHPA 2OZ4A 3VMNA 3U0PA 3VFGL 1RV6X 3MLZL 4X83A 2CPCA 3WXVH 2VDPH 4X6EA 3RUGA 4R26L 3B3IB 2MSPA 5CGYD 2OL3L 1I85A 5A40E 5A1AA 5C3LD 2C9AA 3VMOA 5IBLD 1Q1JL 3KPLA 1IEBB 4PJ9A 2V5YA 5F21B 5I76A 1EMTL 3CFJB 4FFVD 4YHOH 1GGIL 5L9DH 3B2UC 4PJHB 2DQIH 1FNSL 3BKJH 1QLEL 1PJ9A 1PLGH 3REWA 4U31A 3KYMB 5E8PA 5DA4A 2AW2A 1FVEB 4XNUH 4NC0B 3QDMB 4BK4A 1PBYA 4P2QB 1LO5B 4RWYL 2YBRA 3JWNC 2YRPA 4HGMA 4OLVL 5KZCB 1ZLUH 3K4ZA 3H7BA 1IC4H 1R6VA 4JN2A 4HV8A 1WTGT 3QRGH 5CWSA 1QBML 4O2CA 3QFJE 4KDVA 1NKRA 4LSVL 1MWAA 4XTRC 4YHZH 3QNYA 5IMOA 3ROLA 1DLHA 3EOYG 4MYWB 1VFBA 1KULA 5MEPA 3GSOA 4R0LC 4X4XB 2P7TB 5FYLL 2NW2A 1JGEA 3ZYOA 1ZT1A 1QNZL 3ZE2E 5ICZA 4MJ5B 2V7NA 5CWSB 1U8MA 2YEZB 5GIRB 3GMNB 5E99L 2BRRL 2F5BL 4BZ2H 4OFVA 3CPLA 4EUPG 3VFTB 4DZBA 2GT9A 3ZHKA 3VFPB 1CD8A 3OKLB 5D7JB 5DJ6A 4U1GB 3ECBB 1U8NA 1QR4A 3ZLQC 5EOTA 5D2LB 3PQYE 3FO0L 4KROD 4O9HL 1LEGB 1OGAD 3WS3A 3JSSA 1GZPB 3IDXH 2XACC 3EYSH 3N1GC 4YBLC 3ARED 3RVXD 3STZA 1UWGL 5FUZH 3UZVB 1BZ9A 5ESVA 4RMTA 2DS4A 1T3FB 4ODWA 4XP4L 1DZBA 4M7LH 3MV8D 4LLVB 1EK3A 5HI3C 4OM1L 1ZVHA 1CD1B 4R6UA 2HP4A 3A6BH 1T66C 2V2XA 4ODVL 3ZDYF 1NGZA 1KUMA 2JB5L 1NAMB 1FH5L 4JDVA 4ODTL 1H3VA 4M6NH 3GI8H 1RFDL 2FJFA 3AU1B 2E7LA 1Y0LB 3BH8B 5KN5A 4M1DH 4KQ3L 3AUVA 1CIUA 1NDGB 3ZT6A 4KROB 1T1YA 1O7VA 1UZ8B 5IW6A 1RULL 4PJGB 3IU4H 1ORSB 5JQ6H 3QHFH 1KJMB 5JHDA 1QD0A 2HVKB 1P2CA 1S9XA 2D7QA 1XF5B 3MV8A 4G8EB 3EOAB 4KAQL 4UILL 5T1LA 3BUYA 1N5YH 4HUWA 3RWHB 5CHNB 2IG2H 4YFDB 3MRFA 4ZO7A 3LRHA 1WIPA 2KKQA 4G6AC 3PWNB 1KELL 1LP9E 1OAXL 1SJVA 4JVPA 2QSTA 4UT9L 2Z8VC 2XXCB 1X6NA 4GS7B 4JFOA 3KYNA 5EG6C 4NFBA 4XP6L 2Z8WC 3DROB 2VXQL 2Z31C 4GKNA 4F33A 1RUKL 1GXEA 3V5HB 4QRRB 3D0LB 3KLDA 1G9EA 2DWEA 1XGPB 1MRDH 2PYFA 3D0VA 2P5WA 3A6CL 3CXDL 1JWMB 3ELAT 2ZCLH 1B9ZA 1UG9A 4MHHI 4HG4K 5K9KB 3CFCH 1NBQA 5B39G 5C0BA 2DM2A 2CLVA 4OGXL 1MCKA 2OQJB 4JRYB 3MRCA 1N4XH 5C2UB 3NPSC 4AEIH 2VZOA 4MDIB 1B4JH 5JDJA 1FZOA 4OCRL 4OD2B 1YY8A 5C0CA 5FOBB 1I8LA 2CRYA 2PXYC 3QO1B 2NXYB 5L2JA 3BZEB 3TNMB 4MLSA 2GUOA 2AK1H 2YD1A 4DK3A 3DTXA 4QRTA 2A9NL 2G9HA 4J6RH 1QSED 3OR6A 1IBGH 2Y6SC 1WWCA 2EYTA 3LKRA 4CW1A 1CG9A 4FTVE 3N06B 3HMXA 2DJUA 5FXCH 3IJHB 1S7QB 4QRPB 3MV8B 4OCNC 2NW3A 4XC3H 5HYJB 1I1AA 2FATL 4OQTH 1GHFH 4HC1L 1KLGB 2DDQL 4KK6D 1BFOA 3GKWL 3Q48A 4O2FA 4K94C 3Q3GA 4KJWD 3H3PH 1FAIH 1UCBL 3VFNB 7CGTA 5T1KA 2AJXL 5JA8B 3LS5H 1PX3A 4E42A 5IGXH 1A1OA 4EXKA 3PABB 1Z5LA 3WXWH 3PUCA 2GJZA 4NRZB 1KCLA 4KK9D 4D2NA 3LKPB 2PN5A 5IB5A 3JV5A 2O5YH 4W81A 1U8KB 4ZFGH 1CLZL 3BPLC 2IADB 4ELME 2X9XA 3WIIL 1K6QH 4OZHE 3CFBB 4WTZA 3V4PH 4Z7NE 1JV5B 3I2CH 3IXAA 3ARQA 2XZAH 1A1OB 4F58H 3AY4C 4ZUVB 1HH9A 2DYPA 3FQXB 4OB5L 2JKXA 4YBLB 4S1DC 4NDMA 2Q8AL 1XZ0B 3V6FA 5IMLA 1UJTA 4ZSOA 1L6ZA 5DEZA 3WDIA 1UH2A 1XCQB 4YHKH 5ITFB 4EOWH 4LKCB 2R29H 3GJFB 3STBA 3T77B 3ARVA 4QHKI 3QAZB 3SO3C 1AR2A 4M5ZL 4X7TB 3H9SB 5IVXF 4RZCA 2PW2B 4M9OA 4PJ7E 5KG9B 2I07A 4XNYH 2CDGB 4Z7OF 4RISH 3RKDD 4UOW1 1CGTA 2EC8A 1QFUL 4IRJB 5ID1A 1NCNA 3U30B 3V6BR 1I9IH 4NGHL 4EI5D 32C2A 5GHWL 3S34L 3T8XB 1INEH 2VXUH 4HEPG 4X9FA 3SQBA 3CVIL 1T7VA 4PG2A 3QDJB 1KIPB 4ZPVB 2B1HL 1AXTL 1YEJL 3ALPA 3HNTH 2NR6C 3CDCA 4KU1A 5DURD 5ISZD 2MPAH 1QSFB 5JPNB 2KQMA 1HSAA 4UIKH 2LE9A 3ZYIA 1I85C 2AJZA 4X6BB 1A2YA 2B0SH 3O45A 1B90A 2AJZB 4X6BA 4N5UA 1E28A 2LTQC 4C55A 5HHQB 5HHNB 3WO4B 4GAYA 3EYQC 4R97B 2QQNH 1Z0MA 4RGNB 4HT1H 1JHKL 5D5MA 3RVTC 4ZPVA 1F4HA 1F4AA 3S96B 4GXVH 1T1WA 4F7PB 3ZKMC 4UBDD 4XH2B 4TSAH 3MRNB 1LP9B 1D6EB 1IAKA 1TJGH 4X6DB 3NN8B 3EZ8A 4PGZA 4Z77B 1MJUH 4P4RA 4QNPE 1CGWA 5I74B 5FECB 4QLRA 1VKXB 2A1WH 3WFHA 5H35B 4OF6A 3BRDA 1OGTA 3FHAA 1I9RL 3WFEL 1IQWL 1RZFL 3H9SA 4DUVA 5E8NB 1IL1A 1QBBA 3SDCB 1UJ3B 3FQNA 5HTSA 2WWKO 5EZOL 4Y5VA 4G6KH 2P5WE 5EU5B 3I85A 4LSRH 1A7RL 3LKNB 1EAJA 1X4XA 3BP7B 3U1SH 3VXNA 5I1HL 3VXPB 3UROR 1KB9K 5EO9B 2Y6SD 2Y7QA 3HRPA 4BJLA 2VSCA 4APQA 5KSAA 3I3EA 5GGTH 5LXGH 4MA3A 4KMTH 3QCUH 2XZZA 1A7OL 3WIFB 4D0DA 4A6YL 1FP5A 3X14B 3SBWA 1C5DA 2VAAA 1B6UA 1KPVB 1F4WL 2DQCL 1F6LL 1E6OL 1LK2B 3HE7D 2R56L 4K9EH 1H0DB 3KJ4C 5C09A 2RIKA 3D9AL 2Y5TB 4G9DA 3S9DB 1BZ9B 3DI2B 1INQB 4ODXA 1R24B 4Q0XL 1INQA 3SQOL 3OJVC 1X7QA 1MF2L 1DE4B 4G5ZL 3MNWA 2A6JB 4OSUH 5HHVL 2BSTB 5D2NC 4OZGE 1IGMH 3I02B 3WLWC 3CU1A 4KHTH 4CMMB 2PYEB 2E9WA 2OYPA 3BKCH 3VXME 1RZJL 4N1HB 4JGJA 1N7ML 2V6HA 5EUKA 3RAJH 3IS0X 3CJJA 1SYVA 2HVJB 3TBTA 3F62A 3KDMB 1QSFD 2IFFL 1OQOA 1KCVL 1WTLA 4NNYA 1MI5E 3MREB 1EJ6A 1NMBL 4ZOBA 3KYKH 3O6KH 5AG8A 4GAFB 2DQUH 4LDLB 4AMKL 3CFKA 5HHXH 1U8KA 2IALA 3RRQA 5JXAH 3GBNH 3FFCE 3TBTB 4TQEH 1KJVA 1GZQB 4XB7A 3HG1A 5BQ7A 2D31B 4HUXB 4ZAKD 5CEZE 5I1IL 1MCOH 5F89A 4P2YA 4TYUA 4MXWL 4I2XE 4AL8H 2XWTA 2OZ4L 1I9EA 4F8QA 4F8TA 5I1CH 1P5UA 4GKNB 4LQFH 4HUVA 2E8YA 1JN6B 1ETZA 4MHHG 3TV3L 4U05A 4GAGH 4X98B 1XFPA 4PRDB 4HLZG 1LD9B 4U6XB 4CL7A 4XPBH 3OL2A 3KHOA 4KQ4H 4HFWB 4UZGA 4LNRA 1JL8A 3O4LA 1QSEE 5DDHB 4I48B 5DYOB 4G80A 4PRIE 3FT2B 3TBVA 1FIGL 1BHGA 1UZ6F 4JDTL 5GRJL 3ME0A 1MFAH 1A4KB 4PJIF 4PY7A 4DKEL 1JF6A 4YHPB 4FQXD 4LAQL 3WJJA 1LP9F 1A3LH 3IDGA 1XF2B 4ZUWB 1E4JA 4L4JA 4HPOL 3NZHL 4WEBL 5F3BB 1RZGB 1XCTA 3LPWA 5GZND 4O02L 4PS4H 4Z8FL 5F9WB 4MA8H 1GYAA 4XVJH 2I9LA 3P4LA 1VHPA 3ARWA 2QQKL 3L3KB 1EFXA 1WC7A 2DB8A 1I1AC 4AIOA 3FOLB 4RFEA 5MERB 1XR9B 3GSXA 1N64H 2OXGA 5ETUA 1QR1B 3MQIA 1H5BA 4YEEA 5GGRA 1U58A 4WNQB 2OTWB 2WBJB 5FYJD 3RA7H 8FABB 4K7PH 1KIPA 1PD6A 2XTJD 3SDAB 1GIGL 3VGFA 1MJ7H 1TQCB 5EA0L 1I9JH 5FYJE 2DLTA 3DXAA 5J7CC 1QKZL 4YHIB 5AZ2L 2HWZL 1QO3A 4WFHD 5FGCB 3GSXB 1S7WB 5ETUB 1IAIL 2RJMA 2VN7A 1MI5D 2BERA 4D0BA 4X7SL 2VN4A 1F8TL 1MCPH 5HI5C 3D39B 2NW2B 3HMXL 1YEHH 2V7HA 4KJPC 3T4AA 1FG2B 4FFVC 3DROA 4F33B 1JGEB 3QEQD 4X5XB 4G9FE 3B5GA 4MQ7B 1VPOH 2HLFD 5DJZB 2APBA 4QHMA 3KR3H 3WSQH 5EN2A 3OKKB 4Y5YB 3QR2A 3RWDB 3T2NH 2AI0H 2GJ6D 3NOIA 3UJJL 4C59B 4MA1C 4QXGH 3L5IA 3NH7L 3DVFA 3QPXL 5FO8B 1Q72L 2NY7L 4YAQA 1D3CA 3TIEB 5DHVH 1OLZA 5K9JH 3OZ9L 4LSDA 2HJLB 2JIXD 5ANME 1A1MA 5L0QC 1TZHA 1B6DA 4LSTH 2I60L 1U41A 3VWJB 4FQCH 2NXZD 3S97C 5CJOH 3FOMB 5GGQL 4DQOH 1U6AH 2CIIA 4PP1D 1M4KA 4POYA 5C0EA 2G5BB 1T1WB 1U3HA 5IG7B 3WS6A 4OLUL 2HJLA 1I8KA 2HFGL 2VQ1B 3RY6C 4CVZA 4TOYH 2F54B 5CJBA 4P2OD 3DOSA 2HFFB 2ICWJ 4X4ZA 3U79A 5IESL 2EH7H 4OLZH 4XHJC 2HKHL 4FQ1L 2R0WL 2GTZA 5GPRA 2ED9A 3ROOA 4KZDH 1R3IL 2W1NA 1DQMH 1RJLB 4JZJB 4PRNB 3KPQA 2YD2A 2X4PB 1NANI 2YPKA 4NPYB 1PYWA 5J0BA 4GKSA 4LHJB 2NNAA 4XNZC 5E1AA 3SCMB 3TESA 3KXFA 5EZLB 3S3JA 3LQAC 4EQ2A 3B9DA 5D7SH 2NY1B 3OBAA 4LCYB 4ZTOL 4GMSH 3V6OA 1AGFB 1MFEL 2FGWL 3G04A 4WWID 2ZUYA 1C1EH 3G04B 2BVQB 1S7TB 1AQKL 4JFFD 4N5EC 4MAYB 4TNVF 5A3IC 3TO4C 4QOKA 5CZKA 2VE6B 1CGXA 4WWKC 1KB5L 3QBTB 5MHSD 5DWUH 3RGVB 1YY8B 3MCLL 4Y1AA 1NCCH 3IB4A 3PP4H 5D7KD 3WFCH 3MJ7A 3QUYB 4X80L 1KN2H 3TA3B 4OI8A 1AKJB 1U3JA 1CQKA 4Z7VA 3D1MC 4YQXL 4G9DB 1YN7A 1GCFA 2VLKB 3CSBA 4WDIA 1JHTA 5D2NA 3RHWF 3B4NA 5E9DB 1CFQA 3LN4A 3X13A 5BMFL 3RIFF 1N59B 1CWVA 3KPTA 5IG7A 1VDGA 3EO1A 1T4KB 4QT5A 1PDKA 2VZSA 4GW4B 5LGHH 2KQNA 2RBLA 4FFZH 3WIHL 4PJEA 3I50L 2EDWA 4XBPA 1IJ9A 1HHIA 3W11D 3SDYL 5EUOA 2QQQA 4M8VA 3IXTA 3U0PB 2BDNH 3ARFB 3GRWL 1FC2D 2D7TH 5I8OL 4YPJA 1EHAA 2JB6A 2A83B 1DDHB 1KLGA 3KPLB 5C0BD 5IMMA 1MHEB 3MV7D 3UYRH 4OI7A 3TBVB 3X3GH 1U8HA 3TPUA 4PYHA 5E6ZA 3UDWC 1U8HB 5CP3A 3RTQB 2DQDH 5KSBE 4Y2DA 1NAML 3QIUD 3GSRB 3RU8L 3SKNB 1FN4B 2JB6B 1RJYA 4EIZC 5EOQL 1RJZA 2VLRE 3NN8A 2HA1A 3N85L 5FHBH 3TVMD 5IMKA 4NJAL 3PQYA 2W9EH 2Z93B 2ZOKB 1DQLL 4ZDHB 5JMOC 2EYSA 5FYJH 3HC3H 3P4OB 1XGRB 3WHE0 5GGTA 3H3KA 1X44A 2D0HA 1NGXA 1CIDA 2CDFB 1F6FB 2FX9L 1P4BL 1PW3A 5T3XD 3RHWK 1S9VA 4LLYA 5DQ9A 3RDTD 3GSNB 3ZDYE 1YNTA 4LIQH 1OAZH 1NCDH 1DVFB 5SWSA 4KUCD 3EOTH 3P4OA 5EBWA 4BFIA 3ARPA 1MHCA 1ZKAA 2PUQT 4XNMA 3WJJC 2C5DC 1LO3H 3PE9A 1D7FA 2BMKA 3U36A 1J8HB 2GT9B 4HWBA 3TH2T 2C3GA 4HQQH 1FNGB 1T5WB 3HR5B 4GQ9H 2AGJL 5CJQH 2ZSVB 2VERN 3P4NA 43C9A 1RMFL 4POZC 4PFEA 4S10A 4KROC 3WE6B 1GL4B 3SGEI 3EFFA 3PWLA 1BBDH 4LSQH 3B5TA 1MHPL 1YPZE 4ZUUA 3QDJD 4U6YA 1XF2A 1X7QB 3D5OF 3VXUB 2NY2B 2HTKC 1KJ3L 4L8SA 5I1EH 1XGQB 4N0YH 5BXFB 1KCRL 3BD4A 1F3RB 3VMPA 2WNGA 4HH9A 5KAQF 1JI1A 2GTZB 2YBRB 3SE9L 3CC5A 4PP2B 3U4EA 4GMTL 5SWZA 4P23B 2ZNWA 2FD6L 4PJ7F 5CBAA 3WL9A 4LHUB 3BQUB 4MB5A 3MV7B 4X7DC 5EOCL 1YEKH 3FTGB 5DSCB 1TZGL 4O2CB 5CSBA 4LARH 3VA6A 1N0LA 1SJEB 4L29B 2VJXA 2FEDC 4TRPH 4TTDC 3MLYL 1N6VA 1OWRM 4JPVH 5CEYB 4HMDA 1BLNA 4LPYA 1QRKA 2LQRA 2OI9B 1HQ4A 2GFBB 3L3JB 3OJMB 3EYQD 4U1HB 3VGEA 4HH8A 2VDQL 4OV6F 4OZHF 2PO6C 1BFVH 3O2VH 4XPTH 5JOFB 3NA9H 4WIQA 5KANI 4JFPB 4LSPL 1NJ9B 3NIDE 2EC9T 5KVDH 3RZCB 5TGBB 5KZCD 1P4LB 3C2SA 3EDDA 4DZBB 1A02N 1WT5A 1TXKA 4RFNC 1F45A 1HILA 5DJ8A 3BFOA 3ZKQD 3VG9C 1ZSDB 1HXMA 5SWZE 3SKMB 4AIZB 3OKOB 5DMKB 1YUHA 2CGRH 3DX8A 3MROB 4P9MH 1NFDE 1ACYH 5F3HB 1VSCA 1WBZA 4LCYA 2ADFL 4ZD3L 5F3HA 3HFMH 4MS8C 3PWUA 5BVPH 1OOAA 3KS0J 3J8F7 2XWBB 1JWUA 1OM3H 4J3VA 1QEWB 2DQJH 2Y4SA 4KWUA 2X4QA 4WV1C 4NC1C 4Z0BH 5D7LB 1TJIH 4FXLA 5JOEA 5L8LB 2BOCA 1EO8H 5DJCA 4OLEA 1T20A 5J57B 5C7XH 5M95B 1AR1D 1Q9KB 5JLZA 2F54A 5IB2A 3MNWB 3BEWB 3KHQA 5GS0H 4K94L 3MRDB 1EJOL 4EZMA 1JWUB 4R2GD 4M5YH 3R06A 3DHJA 1MH5B 4PRIA 2CIIB 4C56E 3MRJB 2AEPL 1RUAL 2G5BA 2ITDB 1RZKH 1X5AA 1HYSC 3N1FC 4JJ5B 3MRKA 3TT3L 4HX1A 2NX5D 1MVUA 4PJHA 4JKPL 1HDMA 1QPPA 2W60B 4ZO8A 4CRPA 5J6GB 4N0CC 3GSRA 4N8VG 4Z76A 5GJSL 5IHBA 4XCCH 3CVHB 2ZUSA 3HC4H 3QEGL 4FQIH 5D7LD 3ARXA 4HFUL 4U6HA 1ZV5A 3UPCA 3BYYA 3V0WH 5KVEL 3JTSA 2ID5A 4G43B 4PLNC 3FO9B 1VENA 4OCXH 1XH3B 3GMLA 1NGWA 1QSFE 2FNBA 5JW4Q 5DEGB 1EUUA 1CZ8H 3HUJB 3RWEB 5AAWA 1ZHBA 3K1DA 1A7QL 5DS8A 3PGFH 1S9WB 4PJXE 4X6CE 1DQJB 2RHEA 5JNYB 4JANA 3VFUA 2DBLH 3TBWB 3QPQC 4NQUA 3V8OA 4M62H 5HDOA 1JZ4A 3I9GL 4OAWA 1X5FA 3BGMB 5L7XH 3X13B 1Y18A 1A0QH 4M8QB 5IR1B 5DJDA 1EEUA 2QBWA 4I2XB 3JV4A 4LSUH 4JREB 4LVOB 4NFCA 3U7AA 4I48A 2GSIB 3MRDA 1A8JH 4GRWE 5IBLC 3MRIA 4JPKL 3LOWA 5DVOA 4PJ7B 5KTEL 3ARGC 1L0YA 3KYOB 1IGTA 1LO4H 1UVQB 3LRGA 4OCWH 1F4XL 3FOLA 1IGFL 4IRJA 3RVWC 1HKLL 3FCTB 2NXYC 5LQBL 1E4KA 4NN6C 4G6ML 5TE4H 5ISZA 4JLRA 1FNFA 2VIRA 1TQBC 1KJ2H 7FABH 3RY4A 4YHMH 5IJKA 1J10A 3QDJA 2I9LB 2AEIT 2BMKB 4U7SA 3OGCB 1X5YA 1P6FA 1ZS8A 3FFCD 2NQCA 3M07A 4ZXBD 4R4FH 3N1QC 1DBJH 3MBED 5ICYA 2VXVH 4WUUB 3V6ZA 1KN4H 4AEHL 4ODHL 2P8MB 3IJSB 3PIQB 4WW1A 5EPMA 1XT5A 1ED3A 3BZ4A 1G6RA 4F15C 4QHUB 1MREH 1TVBB 1XGTB 4GW1A 3RTQA 3VFRB 1I1CA 4BFGA 2VXVL 4MX7B 3EDEA 2YSSB 4S1DD 4XMLL 3D2UA 5DGQA 4Y2DC 2X4NA 2EH8L 3REVB 3ZSTA 2P49B 3ARBB 3ZKMD 1NEZB 1DBBL 1F3JB 1NC2D 2JJWA 2ESVE 3OHXB 4GRWF 5FB8B 3QDMA 4JRXB 3DV6B 2OL3B 2APTA 3VD3A 1JP5A 1BD2B 1IGFH 1NJ9A 4HJGB 3O8XC 2GY7B 3CK0H 3FFCB 3GSWB 3JV6B 1JV5A 4WUUD 1P7KB 4LEOA 1NDMB 5IV2A 4JPKH 5J3HC 3P40A 3QH3A 3F7YA 3MNZB 4M7KH 3GEWB 1X6LA 4V1DB 1F90L 4LSUL 2DQFA 3DNKA 5J8OA 1S9XB 1J11A 1HCFX 3KVQA 3NCJH 1NPUA 4YO0A 1YEIL 5ECJE 5HSFA 2A6KA 2CK2A 4PRAA 2NY4B 3KNBB 4MD4B 1PKQE 2DBLL 1MI5A 4LGSB 1J0ZA 1FDLH 3OG6B 2X6MA 3MLTB 1ZS8B 3VXUA 4L8SC 2FJFB 1A7QH 5EZJA 1XIWA 1W72B 1NCWH 4MNQA 4RGMB 2X7LA 4P2OA 4XRCB 4D9RE 1CZ8L 2L0DA 4G42B 4PLKC 4HIIB 3DTXB 4QRTB 1MCHA 2G60L 4NHUB 3ET9F 1NANH 5FK9A 4V1DD 4K23L 4XWOC 3ARBA 4LVNC 3MRKB 3V0WL 3LPFA 4HFUH 1I1AB 1BWWA 2XTLA 1MAJA 3HC4L 3ZDZF 1TCRA 5F1IA 5L8KB 1EHNA 4XCCL 5GJSH 4FN0A 4D9LL 4Z76B 4P2CG 5FECA 1H0DA 1BIIB 4BK5A 1OAUL 4FS0A 3TT3H 1A6ZA 1CXEA 2VDOL 3L9RA 5F1OB 5EU6A 4RMVA 1RZKL 4JQXC 2BVQA 1RUAH 4APQC 2NTSP 1VEOA 4LSSH 4JFFA 3V4VL 1FLRH 5T3ZH 4QHNA 5I73C 3RVWD 1EJOH 3H6JA 2DWEB 2R2BA 1MHHB 4Z95H 2YUVA 3DECA 3MJ8A 2E9JA 3G5YA 1WIUA 2AP2A 2ZOKA 3LKNA 2PCPA 1R3HB 4NSKB 1WWBX 5CKGA 3MV9B 3L9RB 1FL5A 3DX8B 4Z0BL 2UZIL 1C7TA 1FL3B 4Y0GA 1OF2B 3ULUE 2HLAB 1TDQA 2VB5A 1WAAE 4K3EL 1OM3L 3VXRA 1JZ3A 4Z78A 5BVPL 2V5SA 3HFML 4KI1A 2ZP0T 2WUCH 3MCKA 3UYOD 3W0WD 2VLRD 1I8MA 4XNXH 1AKJD 1KTLB 3QI9A 1DCLA 3P4MB 2H6PB 1N3NB 4U3HA 1JWSB 1J8HA 1T2QL 1ZWIA 1EV2E 1U95A 4YGVA 1S9WA 4ELMB 1G1YA 4PRPD 3MOBH 1D6VL 2DMKA 2OQJA 4BH8B 3DUUA 3MYZA 2YK1L 4HIEA 5JXEA 3BD3A 4U6VH 5T3ZL 4LSSL 4X6EB 3MA9H 3ZKXB 3NBNA 5DMYA 3LSOA 1D9KB 1EEQA 3QEUA 3MLYH 1WGOA 1Z5LB 4L1DA 5JOPD 5CSGA 5IVNA 4KUZL 4X6FB 2VLRB 4H26B 3KS0H 1A1NB 5IVXA 1XGQA 4CDHA 1LEGA 2HKFH 1YEKL 3L7FB 2QHLA 3MGOB 4NN7C 3H9SE 3ULUD 2Q6WB 3I6KA 1HDMB 2AK4E 1ZLVK 1UB5A 3AS3A 1G7PB 3N1PC 1RZKC 5K9QI 3H9HB 3VXTB 3U46A 5MERA 1JVKA 3DX6A 3OMZA 1KJ3H 4OZ4A 3LB6C 5J9PA 5DO2C 5SV3A 1S7SB 3L7EB 3RIAK 1NCWL 1EHXA 4R8WL 3T0VA 5C92A 1BBDL 1FFPA 1TVHA 3C6SB 4LSQL 1P4IH 4GOSA 4AEEA 5HYSB 5FM5M 3RDTC 4TVPE 1JK8A 2FIKA 5TDPA 2PYEE 5FAAA 3ARUA 4UNUA 3WIHA 3SDDD 1YEIH 1QFPA 2EDDA 4GQ9L 1T5XB 5L88L 3IAQA 4WTXA 2P8PA 4X4XA 2V17L 1BVLB 1I8IA 1X5ZA 5JOPE 1JFQL 4BH8A 1OAZL 1M6OB 2P5WD 4LIQL 5C08E 5JZ7C 1RQ5A 4LRIA 5J11B 4GO6B 4XBGA 5LGJA 3M17B 2GQHA 4PJIB 3W9EB 5EO0A 4GRWH 4NQDB 3GJFK 1T5XA 4Y5XA 1KLFA 1CXFA 3QJHA 1GZPA 4PJ7A 4P9HH 2VL4A 3HC3L 1TZHB 2BFVL 1EEZB 5ANMB 2A77H 1E4KC 3REWB 3GBMH 2X4TA 3UZEA 3E1F1 4Z7WA 1EA9C 3N85H 1H5BB 1SY6A 3VRLF 4Y5YA 3ZYJA 2ADGB 4IDLA 4XXCA 4GAJL 1MREL 1DQQB 3MRQB 1E4WH 2ADIB 4JM2D 4F57H 4U1GC 5E8OB 4NN5B 5F72S 4M3KB 2KDGA 3IETB 4HUKB 4Z7VE 1XF4A 3X12A 1FJ1B 1KN4L 4KI5E 3CC5B 1JNNL 2N7AA 4MNQB 4E5XA 4Q97A 3HAEH 4MAYD 1OT2A 1FO0B 4HUMB 2FJHA 1MWAB 4GW5B 3R06B 1E27B 1CFTB 3CCHB 2Z8SA 3BXNB 4J4PC 4Z7UF 4LASL 3GRWH 1V3LA 3FO2B 4KMQA 1F6AB 5HHMD 5D5ME 4EI5A 5IJVB 3SDYH 3T4AB 1F4XH 1LO4L 4OCWL 5I2IA 4YXLL 4UDTA 4YX2H 3TWCL 5LGHL 1EVTC 3L5WB 4XPGL 2Z92B 3QXAB 1M05B 5KW9H 1HEZB 5BMFH 2CUHA 4WW2A 3RQ3A 4EUPA 4GRLB 2A0LD 3WS6C 4MDJA 5L7XL 2ENSA 3ARFD 1KN2L 3SGJC 1OAQL 4H8WL 3OAYK 1WVZA 3WFCL 1C8PA 5C9JB 3H7LA 3CX5K 5HHPA 1KB5H 1T7YA 2L7UA 4PREB 2GSGA 4NO3B 4RFOH 5IEKB 1A6TA 4UV4H 5DK3A 3ARBC 5GQBA 1N8ZB 3T3ME 5IB1A 3PG2A 3RTQD 1XZ0A 1PEZA 4Y8AA 3V6FB 1UKSA 2FBJH 2G2RB 3SCMC 3EHBD 1A4KA 1CGSH 5EU4A 2EE2A 5DTFB 3X11B 1Y0LA 2XTJE 2GJ6B 2UV3A 4KVNH 5GSVA 1R3KA 2CUIA 1KPVA 4IIQC 4PBXA 1DJSA 4U2ZA 4U6TA 3UXFA 1KPUB 5DDHA 4ZYKA 4G80B 2X4RA 1XH3A 3GMLB 2OK0L 1U3HB 4IRJD 3OF6A 1HXYB 4PJEF 8CGTA 5J1SC 4JPWL 2FLRT 3K2MC 3TCLA 1TPXC 3FB7A 3GSNH 4LRNL 5BV7C 3ARDD 2HFGH 4PLJC 5KSUB 4ONGL 2CIKA 4K94H 2YD9A 3RWGB 1ZHKB 2BVOA 5FKPB 1U8LA 4JZNB 4MNGA 4KK8C 4MD0B 4MXVF 4LHQB 4U4BA 1PSKH 2ESVA 1EO8L 5CJOL 4WU5A 3WFBH 1QA9A 4JRXA 1SM3L 3RY5A 2BXZA 3T3MF 4JFDE 1CFNB 3D25B 3CFJA 4PLKD 4KTEH 1TVBA 1XGTA 4GW1B 1A3QA 2DQJL 4QCIB 3UZQA 4J3UA 2R15A 5SX5K 3RX8A 1B0RB 4B50A 4JANB 3VFUB 5K9JL 5MEPB 3E2HB 3OR7B 3QXDA 3LRSB 2MHAA 3NH7H 3QXDB 4IM8A 4WDIB 1ZHLA 4YHNA 2CGRL 3QNYB 3T08A 1YYLH 2AV1A 1L6XA 4FFWD 1NUNB 3LY6A 2DLHA 3GSNA 5IUSA 2GCYB 5E8EB 4G3YH 5I15H 2PW2A 1DUYB 2EDJA 4S1SH 4XX1G 5D7IB 4LSPH 4ETQA 1FG2A 3TF7C 3PGDA 2I25N 4O2EB 1F8TH 1MCPL 2IEPA 4ZFOA 4X7SH 3BQUD 2HH0L 1CDCA 2H9GB 2HN7A 4RX4D 4HGWB 1ZT7A 4R97C 1AXSB 1QKZH 2YD4A 4HWZB 2VUOA 2O93L 1AGEA 5FA3B 4HWNA 3MV8E 4J4PD 1MAMH 1F3JA 3B3IA 1QRNB 2IQAB 5SWZD 1V05A 4NRZA 4X6FA 3RA7L 3SE4C 3DO7B 5DT1L 1E28B 4KRMB 2YC1B 1A2YB 2ZUQC 4PJFA 4ELKA 1Q94B 3T1WA 2R4RL 2Y36H 1KCRH 1KTDB 1A6UL 2HG5B 5EC2B 3FQTB 3GMRA 4KH2A 4U1NA 4OUOA 2UYLB 5ICXB 3BQUA 4KKAC 3QIUA 2NXZC 3MTRA 4P5TB 4G8FB 4TUKH 5C0AB 4NKQB 3NZHH 4NZJA 4WEBH 2DJSA 2IPKB 2XKUA 5DVNA 1K3ZA 2GK2A 5F96L 5H35A 5CJQL 2AGJH 1T2XA 4WCYH 1ZTXL 3UJIH 4KDTC 4XXDA 4YO0B 3N9GL 2A38A 4X5WB 4QRRE 3DX7B 3UX9B 2I07B 4LK4A 2LFGA 2WINA 4KY1L 2JLLA 1BJMA 4OTXL 5E8NA 1JYWA 1AGBB 3KPRD 2ARJB 2HJFA 4KJYA 4JFPA 1JTPA 3QSKB 3MNZA 1OAYH 3H42L 1NCDL 5DQ9B 3IJYA 1LK2A 2GFBA 3DWTA 2A9MH 3L3JA 4KJPD 4WFGD 2EE3A 2D4FA 3ZTNH 1T2JA 2ZJSH 3L1OH 2FX9H 5DHVB 3ZHDA 5CIPB 2D3VA 4GRLC 2ZG1A 1HZHL 3DBXB 3V95A 3BPOB 2XWTB 4MXWH 1YPZA 4Y2DD 3DBXA 5BZWA 3TH3T 5I1IH 4Y5XC 3BZEA 5IHUL 2YUWA 4HH9B 3QXVA 5EOQH 4TQEL 2FO4B 3MRCB 1GGYA 3IU3A 2M1KA 4I4WB 1YEEH 3HTLX 1OD9A 3KPMB 3UYPA 2XT1B 3ULSA 3RU8H 2GEEA 4N1EA 5HHXL 4JFQB 3RX5A 3PWUB 1ZLUK 1NAMH 4H5SA 5ACLA 4WFFD 2DQUL 4KXZI 5K9KA 4CJ1A 3O6KL 2EKSB 3FT4A 5B38B 3AAZA 2L7JA 3SHSA 2FHBA 4Q2ZB 1KXQE 3WFHB 1CDYA 3HZKA 3VXUD 2IFFH 3K4DA 2BNUB 3DSFL 5E00A 4Y2DB 4HIJA 3IGAB 4OFDA 2BVPA 3MLXL 4W6YB 5FKAB 4EDWH 1N7MH 4J2XA 4YR6B 3S98A 1D5ZA 3DX6B 3BKCL 4WW2C 2OXHA 3I50H 1P84J 5FF6A 4FXGA 1JPTH 3WIHH 4PB0L 3WNPA 3VG9B 2Q6WA 1JZ7A 5DHYB 3QCVL 3JUYA 4P5KA 5ILTH 3DVGB 5BV7H 1PEWA 4U1IB 4Y8DC 3D3VA 4NBYB 1GZQA 4UINL 5EO9A 1W72L 1YNKL 3GSQA 4Y4KC 4AH2A 2IPTL 5GGRY 3ZKND 1WSST 5B4MD 3SGEH 1R5VB 3V8CA 1KCKA 5GGTL 4LFHG 1IEAB 5I9QB 2WLZA 1H9VA 1NL0L 1YMHB 3LVEA 2H2PD 4WHDA 4PGBA 3QZWB 2YXMA 3O3UN 3QFJB 2XN9A 2EYRA 3QUXD 3U1SL 1NGYB 1V3MA 4YDKH 1JWSA 3SDDA 4LSRL 2H6PA 5GSVB 1QLRB 3MBEB 3G6AB 4KMLB 2YPLD 4HF5H 1KJ2A 5HGHA 1L7IH 1K4DA 4GMSL 2BVEA 3RP1A 1N8ZA 5B38A 4LLUB 5D7SL 3RBSA 2DKUA 4P5MA 1S7RB 1YPZF 4WI3A 2AJVL 2H8PA 1IQWH 1T20B 2Y72A 2P45B 3QQ4A 4WI2A 1M1SA 4KI5C 2AXHA 4HS3B 4OD2A 1EEZA 5DD3L 5C0CB 3TH4T 2F8VA 3HNSH 1A9EB 1T5WA 3MLVL 2GUOB 1CLCA 4MXQC 4QTIL 1R3IH 3VFPA 4KZDL 2J8UE 1DLFL 2WBJA 2G9HB 3QQNA 1TJGL 2E7HA 3QUXA 1YMMD 1KB5B 2HKHH 4FQ1H 5FYKE 2VUYA 4PJ5E 4U2YA 1QHOA 25C8L 3V4UL 4KTYA 2HJKA 1JHKH 1Z9LA 3DHMA 1WZ1H 4JLRB 4P57B 3VXRE 4DQOL 1Q9WA 5FGRA 5BXFA 5DI8B 1Q0YL 4R7NA 4MAUH 2WP3T 1KOAA 2BNRA 2J6EH 4FZEH 3SKNA 1MCCA 1AXTH 2UWEE 4F3FA 3QXUA 1OB1A 3MUGA 4JN2B 3ARGA 2AQ1A 4R9HA 2HLFC 5IMKB 1Q72H 1JNLH 2NY7H 3QPXH 5GHWH 4CNIA 4UOJA 1WLHA 5MP6H 5LVEA 3UJJH 1QFUH 4CVWA 1G7HA 1AO7E 2KPNA 5DGRA 5EU6E 4PJFF 4IOFC 2DLFH 1IM9D 5GS1A 2CDGA 1LP9A 4H20H 2FHCA 2IWGA 4NKMB 3TBSA 1OP5H 3QEQA 2A6DB 5KJRL 4JFXA 2N4IA 5LGJB 3GMOA 3AM8C 3GJFA 2CKNA 5EU5A 3EYOA 3VGHA 2FWOA 2ZUTA 1CD1A 4KKLC 1IAMA 3NIGF 3CD4A 1JGDB 2IFGA 1K4CB 4M93B 3P0GB 3CMOL 5F7HA 1FNEB 4W6XB 2HWZH 2FB4L 1ULVA 2XZCL 3I2CL 4UIMA 3V4PL 2D4DA 1LEIB 2MWCA 4L3AA 5C9JA 4ZFGL 1GIGH 4U1KB 1I1YB 3CMGA 4XHQA 4OF8A 2P5EA 5I1KL 4I9WE 3O6LL 4MJIA 3P3YA 3QEHA 4Y4FB 3IDNB 1CFSA 4M6OH 4HWUA 4N8CL 4FQHA 4FP8H 2AJXH 3FT3B 4OCYH 5F1IB 3ZE1E 3SE4A 2DKMA 3V52H 3NCCB 4P2OB 4XVJL 4MA8L 5HHNA 5BCAA 1NEUA 2DDQH 4PS4L 4WU7B 2EXWD 5IBUG 2YR3A 4XC3L 3PHOA 3C6LA 4BH7A 1VGKB 3OJ2C 1CE1L 5CZXC 1QBLH 4LBEA 2X4PA 3LKSB 3ULSB 3D39D 1CD9B 4JG0L 4LAQH 4CU8A 5JHLH 4HPYH 1T22B 2IPUK 3U2SB 4NQVB 1MJJB 3PQYD 3KXFB 4JDTH 5EZLA 4MQ7A 2ICEA 3GIZL 3QHTC 3RNKA 4XCEA 3NPZB 4OCRH 1B4JL 4F9PC 3BN3B 4HKZB 1NC2B 3G5YB 5E2JA 3AB0C 5AZEH 5C07A 2BY3A 2QKIB 3LD8B 3O4LD 1KXTB 3HS0B 4UI2A 4XPBL 3FB6B 4NZDA 3DETC 4Z18A 1OP5K 2GJZB 4OCLC 3O81A 1IMHC 4YK4C 4MWFA 2ESVB 1CDGA 2VQTA 1OP9A 4ZS7L 4MZ3A 3GHBH 2ZCHH 1P4LA 2X5PA 3RL2B 5BO1H 4LQFL 3EBAA 4JZOB 4XNZB 1LDSA 3MX0A 4G8IA 1C5CH 4LCIH 4B7IA 4XP9L 3DJ9A 5F7WC 2BCKA 3QUYA 1I1YA 2APFA 2OM5A 1RUKH 2VXQH 3MR9B 1T1ZB 3HZMA 1H15B 1R24A 1ZA3B 2HFEB 1S7RA 5E9DD 3FQUA 4CADB 2AEQH 4U33A 2LVEA 1HHGA 3RGVC 3RI5K 4MMZC 4Y19B 4DVBA 1KELH 2R1XB 2PW1B 4HHAA 1NBYB 2VXTL 1ZT1B 1T4KA 3RJQB 3DUUB 5C1MB 15C8L 4LKXB 2YWZA 4XAWL 4HWBH 1O7SA 3WJLA 4LCCA 4UILH 3GHEH 5AWNL 1N2RA 4RGOH 2WANA 1UJ3C 2AV7B 1XF3B 3QHFL 3STLA 5IMMB 1LO2L 3IU4L 4UTBL 1J12A 2P8MA 4NT6B 4FA8A 2X4UA 4OT1H 4D0CA 2SEBA 4HS8H 4DVRH 1RK1A 5GGUB 1CFVH 1NLBL 5BJTA 1RZJH 2DN7A 3GMRB 3SO3B 3KYOA 3HB3D 2ZKHL 1KCUL 3B9AA 1YEDB 3F7QA 4LIQE 1IGML 3PGCA 3G6JA 4ODTH 5DD6B 4G5ZH 1V5JA 5IHZA 3MRPA 3SQOH 4JFFB 4K2UH 1FFNB 4P99A 4Q0XH 4ODVH 2BX5A 2V2XB 3D9AH 5D5MF 1U58B 4WEMB 4WNQA 3ZYZA 5GS2H 4P4RB 2R56H 4K9EL 1E6OH 4Q74A 2Z4QB 3F12B 1B88A 4P23D 3S35L 5FGSA 4MQXD 2LAGB 4A6YH 1A7OH 3S6CA 3QCUL 3MBXH 4RFEB 2X1XR 4O9HH 5IIEA 4Q6YA 5IW1A 1AGBA 5GGRB 1GAFL 2R8SL 1JYVA 2YOCA 5AUMB 4MLIA 1A21A 3BGFB 4YGAB 3D2UB 2F5BH 4BZ2L 1A7RH 2J12B 3DUSA 3VD5A 1YJDC 4HMEA 2V7NB 4Z7WF 3LIZL 4Z7VF 2OMNA 4U49A 1PY9A 4HJ0D 3RZCD 5ISZE 5DJYA 1BOGA 1OAKL 4QRUA 4Y19E 4Y5VB 1AD0B 3TO2B 3HRZA 3OKMA 1ZSDA 5HY9A 3K46A 5IFJB 3VJ6A 2JJVA 1JNHA 5J6HA 5F7DB 1MJUL 4L8DA 3QRGL 4PY7B 2EDLA 4ZFFB 3ZE0F 2DQFB 3AFLA 2CDEB 2K1MA 5D1XA 4TSAL 5HVWA 2X4TB 3MRLB 2LTQB 3VD4A 4G8FA 1X5IA 1QRND 4KXZH 3RWDA 5DD1L 4PJDB 3OAYH 3QIWC 3SPVB 4U1NB 5DRZA 2B0SL 2DTSA 1FNSH 1KTDA 4G6JL 4KJWC 3S96A 3PV6B 5L9DL 3LQZA 2MPAL 4S2SA 4HIJB 3MRBA 1ZVSA 3RWIA 35C8H 1IARB 1ORQA 4RX4A 4NKDA 1EMTH 3G5VA 3MV7A 1YEJH 5MEQB 3PWPD 4GLRH 5DSCA 3BEVB 4L5FH 2OL3H 4ZAKA 1G9NH 5CILL 5CEZH 4R26H 5AEAA 3RKPA 4Y1AD 5J89A 3VWKC 2VDPL 5JW5A 3WXVL 1MFNA 5CEXB 4S1RH 4FFYL 5IWLC 4UQ3B 5HYJD 3SGDI 3VFGH 4FQXC 5A2JH 2QEJA 4H0IA 5EZIH 3G6DL 1V7ML 3H0TA 4RISL 1A14H 4G7YL 1A6WH 4JQVA 4PBWD 2EO9A 1XR8A 2IBGA 5FF6B 4PD4J 5JIPA 4DW2L 3PHOB 3AMLA 4G43A 5TE6L 4Q9QL 4L3ED 5EIVA 2R29L 1MFCH 4HK3N 5HD8C 4PLJD 3DO3A 2V9RA 2B7DT 4YHYC 1KPRB 2YMXL 3D3VE 2Q8AH 4ODUA 1ZXQA 1DR9A 3MZGB 1RIVH 4UT7L 3VFWB 3D2UD 2NY3C 1WBYB 2XZAL 1G84A 3NIGE 4JFHE 4OZFB 3IFOB 3S4SA 4N0FB 2NY2D 2X4SA 1BQUA 2YD5A 3QT2A 3WIIH 2QADD 2QR0B 4HIXH 4DGIH 4W4OA 4I3RH 3VRJB 2XN9E 3ZTJH 4MA3B 2Z91B 2O5YL 4FZ8H 5C09D 3C08H 4NZUH 2HYMA 3WNLA 4AZ8A 4O58H 3BEWA 2PO6B 4CGTA 5FCSH 5I0ZA 1MY5A 3MLSH 4R4NC 4PJAA 3LS5L 1KEGH 4OD1H 4U0RC 2P44B 4RQQA 2BHYA 3QEQE 3O4OB 3ETBF 1TENA 1TZIA 1YQ2A 4OZIE 2X10A 1N6UA 5E2TH 3C8DA 1CDUA 3B2VH 4HC1H 1PQZA 3JVGA 4YGVB 4QRPA 2XWJA 1OW0C 3ULUF 1IM9A 4XAKD 4YR6A 1X5JA 2APXA 1ZLSH 2BVPB 1RUMH 1KYOJ 3CDGA 3NTCL 4HS6A 1CDJA 3BX7C 4HS6B 1KTKE 2A9NH 4J6RL 3NCEB 1CR9H 2X4RB 1AO7B 5JIIA 4BFBD 3A0OA 2ORBL 4PRBB 4KUCF 2CUMA 4JDZB 5IROA 2IANB 3PDOB 2NYYD 4QRRD 3SOBL 5DEGA 2J2ZA 3FONB 3MRHA 1AJ7H 1C08A 3QISA 1F02I 2WLYA 4PJCF 4PB9H 3PJSA 4NNXA 2W0LA 3BO8A 1P5VA 1JF1B 2ZCLL 2P4AB 5IEKA 2VLKE 1V7NH 2X4QB 3EFDH 3ALXA 1YNTB 3O2WL 5E8DH 3MNVB 3DLQR 1LE9B 5ERWA 5I71C 5FGCE 4B5EA 5BOPA 4RFNB 4L3EB 12E8L 1DBML 1DUYA 5E2UL 3EKCA 1I7TB 2HT4C 5IK3A 5CCKL 4X7FC 4H25A 3R0MA 1CXLA 4Y89A 3W81A 1GH7A 2QTEA 3BN9D 1MH5A 4PRIB 1MUJB 2LU3A 4URTB 2OR9H 3HLAA 2AXFB 1UJ3A 5JW4R 3MRIB 1JGVH 5T1DL 2DD8H 4WTZG 4XMPL 2IF7A 4KHXH 4AT6A 3U0WL 3VDAA 4KAQH 1KT2B 3K2UL 4P5TD 3RUGE 2JJTA 4EQ3A 3CDGB 4C56B 5JQ6L 3TLRA 2A0LC 4OZ4B 2XA8L 3LD8C 3WN5A 1RULH 2JK5B 5GIRA 5GSRB 1OVZA 5J9PB 4NO2B 4NYLA 4WO4A 1D5XA 1KIQB 3O9WD 4WJ5B 2DM4A 1XIWB 4NQTA 3BW9A 4K71B 5ANMA 1RFDH 2IQ9H 4NKIL 4PTUA 4OGAC 4NJ9L 3VFMB 1FH5H 4L4VE 5JORB 2P5EB 3AREC 3RVXC 1YQVL 1P53A 1YA5A 3A6BL 2HG5A 1WK0A 2ZNXA 3O4LE 3EHBC 5E8OA 2P8PB 1JPFA 5DLMH 1Q9LB 4ZO9A 5EH1A 3BT2L 3FTGA 1UWGH 5FUZL 3BKMH 4IMLA 5BVJB 4K8RH 4Y4KB 4RMQA 1RU9L 4JO3H 4F15B 4KGLA 4Y16B 3JV6A 3HI6L 3VW3L 3H2WA 2H32B 2XV6B 4Y5XB 1S9YB 3IDJA 4MA7H 3RUGF 1MRFH 3GMMA 3PP3K 5FDYA 3WS3B 2BP3A 3JWOH 2NY3D 2BHZA 1FFOA 3K4AA 1KT2A 3W0WA 2RFXB 3KG5A 4HKZA 4Z7QF 1UEYA 4RSVA 3WE6A 3FO1B 4LF3A 5EC1B 1TITA 1G9MH 3T3PE 4PJ9D 5H37H 4LSVH 3QIUC 1B2WL 1QBMH 5CEZD 1OCWL 2E27L 3WMSA 1IC5L 5GRZA 1MCWW 5A2LH 5ICYB 4OLVH 1MELA 5KN5B 4NUJB 2FBOJ 4RWYH 5C0NC 5HHPB 3HI1A 4FMFA 3C8KB 4JDVB 2EIBA 4IOIA 5E95B 2EO1A 3CLEL 3F6IA 4I3GA 2J8UF 3X3FH 5DHVA 4KZEL 2E8ZA 1D9KC 2YWYA 5D1XC 5F1KC 3ARBD 2IH3B 3IDIA 2DQGL 3IKCB 5IJVA 3Q6GH 2CR6A 4ELMA 5C0JB 1RSFA 5TDOA 2DQIL 4C56D 1GGUA 5A16A 1GGIH 4LLQA 1WV7T 3RWCB 2YKLH 3DIFB 3DX9A 1IEBA 4PJ9B 5ACMA 5TE7H 4E41A 1T1XA 1WIOA 3H9YA 3Q3GB 3OAUL 4NO0B 1Q1JH 3U9PH 3VFSA 4FQXA 5ACZA 1JPGB 4Q9RL 4HIHA 3S37L 4JRWA 2BSSA 1ITBB 4RGMC 3DX7A 3N0PB 4QF1B 1N0XH 1AQDB 2P5ED 4Z7WE 5D96C 3O4OC 2SEBB 4ISVB 2W07A 3ULVC 5A2FA 3W0WE 2FH8A 2HT2D 4I5BA 1AGFA 2NX5A 4OGYH 1R3HA 2J7LA 4NSKA 4WWKD 1YEDA 2MKLC 1VFUA 1IT9L 3GB7A 3HC0B 3VXOB 1BBJA 5FO7A 4KJQC 3B6SA 1NQBA 1WZMA 1MAKA 5ADOH 1ZWIB 5IMOB 5C0AE 2F19H 4JQVC 2LU4A 1DQDH 4PLOB 1VCAA 2B2XH 5KANG 1R5VA 5HBBA 1TJHL 2D0GA 4P46C 4R3SA 3ZDZE 1S78D 4HJJL 3DXAB 3QCTH 4M7ZC 2WIIA 3V5DA 1MJ8H 2NCMA 1DUZA 1U8PB 2HRLA 2NMSA 5EOCJ 1AD9A 1LO0H 5C2BH 1FLTX 4HFWA 1IC7H 2EIZB 4JM2F 1G7IA 3N1MC 5LGKA 1WUNT 2VTFA 1HHGB 2HT4D 4N0FA 1DN0A 1T83A 3LB6D 2UY6A 4OFYA 3FQUB 5FM8A 4CADA 3ECBA 2WQRA 2O5ZH 3KLHD 3MRRA 4IDJH 1R0AL 4HGWA 5FYJU 4PJ5B 3LMJH 5F9OL 1L7TL 3IFNL 4BFIB 5DUMH 4NOFA 4FQXB 1DUZB 1U8PA 4ZFOL 1BGXH 3Q1SL 4ORZC 4P48A 3K3QA 5E00B 4XBEH 1F97A 4HZLB 4XVUD 1VFAA 4YDJA 4U1LB 1CTOA 2ZG2A 3OKLA 5D7JA 3NCBB 3TGXA 1ZMYA 2X4UB 3QHZL 4LU5L 4MCYA 5BJTB 1UACH 1ED3B 4NHCH 3UC0L 3P11H 4RGNC 4OD3L 4J8RB 1MIML 4HS3A 1VGEL 1BEYL 3LRSA 3OAZK 4XP1H 32C2B 5TJWK 1SEBB 1W0WA 1RPQA 4MSWA 5C0RL 5IB4B 5IKCB 3P9WB 5T5NG 2F53B 1BIHA 4JO4H 5CMAA 2XIDA 5LKNA 3BH9A 4FQLH 4KKCC 3AB0B 4UB0H 3MXVH 4M7LT 3RWHA 4RZCB 3GSVB 2DQEL 2PR4L 3O3EB 3FN0L 2AJUL 3DV6A 4KC3B 4LKCA 3MUZ1 3BAEL 1UT9A 1KJMA 3UTPE 1G6RH 2DF3A 2EDOA 4Z7NF 1BLNB 3E6HB 2E9IA 5F7MC 5LBSH 4M1GL 4FTVB 3JUZA 2CJUH 1FBIL 5DC9B 3K8LA 3H8NA 3DVIA 4A2MA 4JVUA 2FX8L 4L3CA 3FRUB 4F9LA 5HGGS 1HH6B 4P3CH 4KRNA 5BW7A 4P4KB 2VQUA 4NP4H 1GSMA 3CLFL 4HWEH 2BC4A 1P7KA 1EXUB 3QUXB 5E2VH 3B5HA 1QFHA 4QNPF 1FPTL 3ULUL 4MJID 4YLQT 1AR1C 3OPZH 1FIEA 2FYYB 1A6AA 2XYCA 2I9TA 4QHMB 4IIQB 1NDGA 4YXKL 3HE6C 3OWEA 5JORA 2AQ2A 3CNKA 4RNRA 5CZVH 2PYEA 3QUZA 5D71L 5EBLB 3LDBB 2YSSA 2FX7L 3EDKA 2R0LH 1XAUA 3MACH 2Z31A 1OGTB 1MCWM 4FQHB 5DQJA 2XRAL 4I18B 3AM8A 3PWJA 1Q9WB 1TMCB 2YD7A 1QSVA 1AE6L 2YA2A 4PBVC 2VDRH 2Q7YB 4G8GD 5AD0A 2IAMB 2PTVA 4TVPH 4LPXA 4HLJA 3TYFB 5C07D 1RURH 4ZUTA 3QDGB 5HI4D 1DBKH 3BIBX 2C26A 1JPSL 2NPLX 2NY1D 5MI0B 1G7LB 4KV5F 4HXBL 3KWWB 1S7XB 4YEFA 5MHSE 3U4AA 1FL6B 1RVFH 1DL7L 1U8OA 1ZHNB 3KYNB 2ARJA 1FE8H 1WEJL 5K59F 1RHFA 1WBZB 4LPTA 3IS1X 4A6YB 4MNQE 5E08L 3FONA 3S88L 5IP4A 2XY2A 3K1KC 4KPHL 1JZ8A 1DQJA 5JNYA 2J4WH 1P9MA 1FE8L 4GFTB 1FZKA 4JM2B 4J1UB 4YZFF 1DSFL 4BKLB 4WY7L 1RVFL 1HINH 4LLAA 2B8OT 2WQ8A 2BOBA 2XI9A 1BX2A 3SE3A 3BWAB 1ZGLA 4EBQH 5FM4A 2IMNA 3RWFA 4PJAB 1MCBA 1WCBA 2AJ3A 4FG6C 5I18H 1S9KC 5HHOA 4JCMA 4GUPB 4XC1L 3VDBA 5EUOB 3MOAL 1JMXA 3MRJA 5L2KA 1CE6A 4LPWA 4Y88A 2D03H 4UAOB 1J8HD 2IALB 1R3JB 4BZ1H 2VZ1A 3W2DH 1GVIA 3QQ3A 1ACZA 1N59A 2BVUA 2HJKB 5JUEH 1SEQL 4HEME 5GISH 3UTSA 4F37F 2D31A 2DIAA 1QFWM 4MJ6B 1C08B 1BIIA 4JJ5A 1ZHBB 1T0PB 3OAZH 4OGZA 2F5AH 5ENWA 3IGAA 3TIDA 3VDCA 4KKAD 5FV2A 4KKBC 3U0TA 5I8CA 3VA2C 4M61B 1ITCA 3I6LE 3G08B 4H0GA 4YK4B 4DN4L 5GRVK 4AK1A 1QSEB 2QL1A 1KNOA 4DEPC 2PTTA 4NZRH 4GG6F 3R8QA 1AC6A 4WFFE 3OPZL 2D9CA 1YEFH 2QLVB 4X8JA 2FL5B 5KG9A 1LDPH 1J1XH 2GTWA 1CN4A 1NGQL 1YJDL 4L1HA 3PGDB 4RA3A 2EE9A 3KPRA 1EHLL 1WFTA 2Z9TA 3GRWA 1I7RB 1IAKB 1ZANH 5C8JB 3LH2L 1T83C 3CLFH 4LVHC 5IVXE 4NP4L 3WDHA 1NCAH 4IMLB 1XGUA 4KTDL 4XT1C 1NFIB 4N0RA 5IMLB 4PGDA 4X4MA 2GCYA 5CKAA 1OD7A 1YMHA 3IDGB 4YXHH 1HQ4B 4ODSH 4P46A 2AK4A 4LCWD 5SV4A 1J0HA 4JY6A 2JCCF 4GUPA 3GK8L 5IK3B 3TJEL 3WKMH 3QIBA 3E2HC 4ERSL 4HC1A 4M1GH 3ILQC 3OGCA 3F7YB 5C0IB 4L8BA 4QRPE 1QSFA 5DR5H 1VFAB 4YDJB 4V1DA 1XF3A 2V5MA 1CXKA 4PJXB 4X6CB 4PV9B 1MRCL 3MSPA 3VXNB 1P1ZA 4GKOA 4LLMB 5D9SA 5GRYA 2PR4H 4NO5B 3C2AL 4RA0C 3FOMA 3MODL 3EFFB 3PWLB 4NO2A 4KVCH 4UB0L 1MFBL 2CLZA 4FQLL 3WN5B 2EEBA 2NR6D 4HCRA 5D1ZC 5GGSA 2FGZA 4GG6E 3RWGA 4D0DB 2BY0A 3HR5A 1FZMB 4QRUB 4K7PY 5D7JC 2EDNA 3DETD 3UPAA 1MCDA 1DQQA 3MRQA 3DYPA 1VGEH 5FO8A 4ZOEA 3HB3C 3ABZA 1MIMH 3PV7A 2H2PC 3UBXB 2IJ0C 5D5MB 4Z5RA 1EZVY 2AXJA 3L3OB 4YDIH 4I4WA 3HNVH 1V8HA 4TPRH 4EVNB 5MENE 1U8JA 3C5ZD 3MLWL 1P7HL 1HHJB 1MFBH 3QHZH 1OP3K 3MRNA 1JRHI 4NQSB 4WFED 2E7MA 1S5IL 4E41E 1ZGLP 3DMMD 1NAMA 1UADC 1JGUL 1UFUA 1PFCA 2NX5B 3W5MA 2ZUUA 3L3HB 1S7XA 1I8IB 3IFNH 2R1YA 4M1CD 3LQZB 4S2SB 1L7TH 5F9OH 5I2IB 1S7WA 3MV11 4OF3A 1J05B 4ERSH 4YC2C 3FB5B 3I6LD 3TJEH 4KI5D 4UQ2B 4C57C 4H8WC 4ODSL 4MMXC 4YXHL 2F15A 5AD0B 5D2LA 1LO0L 1IAOA 4HUWB 2WIIB 1WAAA 3V5DB 4DJMA 3QCTL 1ADQA 1QHPA 1TJHH 1YJDH 3CPLB 4K55A 1BF8A 1INDH 1ONQA 4JFZH 1KLUA 4XX1E 4DKFL 4PP1C 3MPCA 4D9QE 3RPIA 2Y06L 4XRCA 5H8DA 4NZRL 3QJFB 4WHTB 1O5DT 5DUBA 4NQED 5DRNB 3W39B 3D6GA 1U3ZA 3ZL4L 5MENB 4NRXA 1AO7D 1EFQA 1A7NH 3WHE1 4MDIA 1W0VB 4KRPC 1VERA 3IDYC 2X89A 2B5IB 4RIRB 2C3VB 4LMQE 1T22A 3BKYL 3QIWB 5F1NB 5D2LE 2XNAA 4H26A 1B0GB 5B3NA 1K8DB 2Z91A 3TPUB 2IAMA 3LQAL 4Q6IA 3TT1H 1ZEAH 3EJJX 5J6GA 2P1YA 3OAUH 1IM3A 3EZJB 3T2QA 4O2FB 2HT2C 1DANT 3DSNA 3G5VB 4TVPD 4TSCH 4F7CB 2YKLL 1Q0XL 1NMAH 4U1JA 4CN1A 1KTRL 2DQGH 1M05A 4R90H 5E03A 3QXWA 2DMCA 2ATPA 2Y9RT 1UGNA 3OF6D 1BFSA 4EBQL 2XKNA 3VXUE 1NFDA 4WWKB 3VFVA 1WFNA 4UDTB 1IM3B 1IZJA 2WAHA 3O3EA 4HUXA 3BRFA 1DSFH 2ICEB 5DK0B 5ITBH 5GGVH 2YUZA 3BP4B 1YC8A 1OQXA 3UTQB 1X5LA 4GXUM 2Z8RA 1IC5H 5T1LD 2AABH 2GHWB 5ENWB 3QDHA 4PTTA 1FL3A 1EAPB 5B8CC 5I1GH 1S3KL 2HLAA 1EPFA 4NQEE 3H7BB 3S5LB 1G9ML 3C60D 1JJUA 5IB3A 3FQRB 5DJ0A 4XNMB 3F58L 4NRXB 3U4BL 2H41A 4HZLA 5KVGL 1Z9SA 3ROLB 1R3KB 5F6HJ 1OSPL 2GITB 1HYSD 3GJEA 3AS0A 1JMZA 3O6FD 4PJBB 5E24E 4R2GB 5GZNC 2ZSVA 1T7ZA 3K8MA 2EYTB 5DUPL 1MRFL 3MRRB 3JV0A 1KEML 3EGSA 1JPSH 3LN4B 1QPXA 3HI6H 3VW3H 4ZQKB 5I71B 3LKQA 2AERT 1I7ZB 4WO4D 4JO3L 1RU9H 1V3JA 5FOBA 2VLJD 5DF0A 2VDRL 1G6VK 4JFDB 3EJYC 3IFPB 3KJ6H 2GSIA 5HVHC 4WHYG 3BT2H 1YMMB 2RCSH 3BDYH 2XRAH 3WNKA 2ICES 1KENL 4TULH 1WC7B 5JR1H 3D69A 1IGIH 3K74B 1XR9A 1YQVH 3OKMB 3WL9B 3O3AB 3TPKA 4R7DB 3HG1D 2FJHB 4GW5A 5TQ0L 1JBJA 1XGYL 4G7VL 4ONOA 5C0EB 2EXWC 4LLDA 4Y4FD 4M3JA 4WO4B 5GS1B 3ESVF 1IEAA 2K7PA 5H37G 2CDFA 5CINL 1FJ1A 4GKSB 2OR7A 2VSDA 1AY1H 2VXSL 4NOBA 2IANA 2EECA 2GW5A 4HULB 1EO7A 2Z93A 4HLZH 4CNIB 4G8GE 3EYFA 5EU3B 4HWEL 5H2BB 2DWDB 4XMPH 1Z0NA 3F6LA 4JQIH 2YPVL 4UNTA 3WN5C 3WO3B 3SJVA 3HMWL 2DL2A 2W9DL 5EU7C 4Y4HC 2OR9L 4Y4FC 2FECL 2FX8H 1QOKA 1A5FL 4J3TA 4YFLI 5CCKH 1CBVH 1NCTA 3F5WA 1DBMH 2CJUL 1M7IA 12E8H 2X41A 1E6JL 4E9LA 1OY3B 1LNUB 4N8VB 3TN0C 3V6OE 1P1ZB 1HEZA 4KKLD 4I0PD 3O3DA 3O2WH 4BQ8A 4NN5C 4RMWA 1OF2A 3WLWD 3SDCC 4YBHA 1MLBA 1X4ZA 2HTKD 4L8BB 3VD7A 3U83A 1MEXH 1VA9A 2EDQA 4PB9L 3GSUB 3MXVL 1LQSR 3VXQA 4Y1AE 3HE7B 3KPMA 4JO4L 5HDQH 4GW4A 4G42A 3IJSA 3C8KA 1AKJA 1I1FB 1G6RB 3L5JA 4DKAA 3T09A 1JCKA 4Y2OA 3IF1B 1CFQB 1XEDA 1BEYH 4XP1L 5D1ZA 1UQSB 3QRFM 1CR9L 1PYWB 5C6WH 1C16B 5DFVD 4OD3H 4I0PA 1SBSH 4Y19A 4DVBB 2XXMB 2ADIA 3ZDXF 4OF5A 3UC0H 1I8LC 4L4VB 1K85A 3LKOA 1URLA 1UKTA 5K93A 5JW3L 1F00I 1ZOXA 3KJ4B 4NM8L 3UEZA 2FCBA 5DZOA 5H2BA 5I6XB 1CXHA 1D9KD 2Q20A 3SJVE 5HPMA 3B2VL 3VCLB 2BVOB 2AJSH 3HN3A 2ATPB 5D2NE 2YPKB 4NPYA 1ORSA 1UWXK 5E94B 4KJYB 4LLQB 3LMJL 4G8IB 1RY7B 4L8CA 3G5XB 4UQ2A 5CEYA 2Y1VA 3T0EA 3BZDA 2VZ3A 4UQ3A 4TNWF 2VR9A 4MB3A 3O6ML 4P59L 1NCUA 3CFBA 2X42A 3WD5H 3E6FB 5E6IB 4FZ8L 1EVUA 3VFOB 2OP4H 4I3RL 2I26N 2QR0A 3VG0L 5HYSG 1MJ8L 1F3DJ 3O3BA 1RI8A 4ZOAA 5FDWA 3D18A 2M26A 2DLGA 2ZUQB 1IQDB 1MLCA 4UT7H 2ICWB 1TETH 1BD2E 4LQ1A 3MLUL 4P2QE 2B2XL 5JW4M 3DVGA 1DQDL 2FZ3A 3UPRA 1NGPH 3QNXB 5IB1B 5J13B 1AI1L 3Q5OA 4JKWA 4XNQA 4TUJA 5DZNA 5KS9B 5F89B 3UAJC 3AY4A 4GBXD 4DW2H 4ZQKA 3I02A 4CMMA 4NNPL 5TH2A 1U95B 2BK8A 3RPIB 1QLFA 4OGYL 4AT6B 1A6WL 3P4NB 4G7YH 2W59A 5DJAA 2VIRB 3C09B 4ONHB 4Q6IC 3DXAE 2ZOLB 5HXMA 4H25B 1QFOA 2Y5TA 1IFHH 2WUBL 4QXTA 1NGYA 4FFYH 4PRDA 4P3WA 3U36B 1HI6B 5L2JB 2YD3A 4L3EA 5C08A 3BIKA 4OCSL 1DANU 5DJYB 5FUCC 4ZODA 5CEZL 1CICB 5CILH 4L5FL 2VITB 5D96B 5F7NC 5TF1H 2EDYA 1CF8L 3SDXA 3U9PL 4PV9A 3FB8B 1YN6B 2MKWA 5HGAB 2VLKD 1K8DA 2DL9A 1ES0A 4GAYB 3IYLW 1YECL 2W65A 2X9WA 3D48R 3T4YA 4UV7L 3Q6GL 4PG2C 4KZEH 4M4RA 5JPNA 5DFTA 5IF0B 2DI7A 2WBJD 3CIQA 4X7CC 4PJHF 3NFNA 3CLEH 5DD1H 2NY0B 5HI5D 5ERWB 2QHRH 4FXGB 2C4FT 2ZG3A 4YBQC 5HGBB 5J1TC 5I19H 1I4FB 4JKMA 4CN6A 5TF0A 3F12A 3VGGA 5F70A 1U8JB 2E27H 3LDBC 5CIPH 5E7FA 2C3WA 3DMMC 4I8DA 3D25A 1JHLL 2DI8A 2VDKH 1FYTE 3VI3E 3SDCA 1QLRA 5IQ9A 1RIHL 5TGBA 5EBGA 3UP1A 1XF5A 1I4FA 3EOAA 3ZSSA 3S3PA 2BHUA 3ARGD 3JWOL 3HR6A 2CKBB 2FEEL 4BZYA 1GGBL 4M7JH 4ZFZA 4X98A 3ARTA 1Q38A 3RVUC 1TIUA 5KSAC 3RNQB 2P46B 5B38G 3MV01 4PJBF 1HSAB 5T33H 3W9EA 5EZJB 3GIVB 3G5ZB 4GJTB 1GAFH 5SX4H 4YDLB 1C5DB 2VAAB 3PXHA 4ONFH 3B8SA 4AJ0A 1J87A 3QJFA 4K8RL 1MWAH 4DGVH 3HI1B 1BAFH 1A4JA 2JIXB 4WFEE 3U4EB 2UYLA 5ICXA 3BZFA 1UENA 3S35H 3BGFC 4K3DL 3UJTL 3D69B 3WLBA 1ZVSB 3RWIB 4OUUB 4JM4H 2J88H 1S5HA 2NXZB 1GGTA 1BQHA 2E9BA 2X09A 3OG4B 1AXSA 3QDGD 1SY6L 2R0ZL 4GH7B 1R5WB 4L8SB 1U8QA 1DVFD 4JO1L 3GO1H 4NIKB 1YC7A 4GS7C 5B4MC 3VXMA 3UBXA 2WZPD 3SDAA 5EBMA 4AM0B 2R1WB 1Y6KR 2IQ9L 4NKIH 2F54D 1KCUH 1MVUB 4PJGF 5IB2B 4X5WA 4V1DE 4MXVE 3PWVA 1NLBH 2IH3A 2P8LA 4DVRL 4F9LC 4HS8L 3SN6N 4ZPTB 3C87A 2R0KH 2QSCH 4HW6A 4LMQI 5I1JH 1LO2H 4UTBH 4YIQA 5EBLA 4WV1A 4RGOL 3QEHB 4Y4FA 3B9KA 3GHEL 3ARRA 3GSOB 5AWNH 4P5TA 3AXLA 3U0WH 1CT8B 1FZJB 4HWBL 4PJDF 1IGCL 4YPGA 2ZPKL 4S1QH 4IMKC 2DD8L 1UYWH 3QDMD 3MROA 3FN3A 4EI6B 1CYGA 3K0WA 3WFDL 3ARDB 5H94B 3ROOB 3HI5H 4XCYB 2WBKA 2XWBA 5T3ZE 3JTSB 2YPLE 4GT7A 3WEXA 2M2DA 3GM8A 4JM2C 3VH8A 1R3LA 2R2HB 5F44A 2W0PA 3QH3B 4EN3C 1MY7A 4F2MA 2PYFB 1KIRA 3D0LA 4O51B 4XP9H 4C58B 4UU9A 4OZFA 1S7UB 3FQWB 3NMEA 2ZCHL 3TN0A 1T0NA 1IAIM 1U92A 4ZS7H 5KSBF 4O4YL 1NKOA 1U0QA 1AJ7L 4PJDA 1AIFB 1M7XA 2BOBB 2ED8A 3SOBH 2Z0BA 1A3RH 4I9WD 3MJGX 3V5KB 2Z31B 4HKXA 4F2MB 1Q9KA 2ORBH 4Y5VC 5MEND 3ARYA 4HAFA 3M45A 3ILPA 4JCLA 3TNMA 4XZUA 4MNQD 1F58L 2GJ6A 1KPUA 3OTTA 3IAPA 3LKOB 3NAAH 2RB8A 4JRXE 3EDFA 2J5LB 4PJGA 5I16A 4PRHA 3RWJA 5JHLL 3NTCH 1RUML 5B3JF 3D85D 5AYUL 1IKNA 5D1ZD 1LK3H 3V7AE 1PZ5B 1KGCD 4WUUA 1VESA 2EDHA 2JF1A 3T65A 4ZUTB 3UTPD 3V6ZB 5F6IB 4B53A 1BQHG 5ALCL 4XPHH 4YE4H 3ISWA 5E2TL 1MHHA 2Q8BL 4FQ2L 2VH5H 4U1SB 2HVJA 2AS5M 4R7DA 4CMHC 2IADA 1FCGA 5DK2B 3MBEC 4NCC2 2C1PB 4FP8L 5ADPL 3L3IB 4N8CH 1CE6B 1AGEB 5FA3A 1KEGL 1P9MC 4M6OL 3EO9L 5BOZG 4DCQA 5EU6D 2Z4QA 4EDXB 4MD0A 3H9SD 5E7BA 4O58L 3O6LH 3SE3C 5I1KH 4YH6A 2EKJA 3C08L 3C60A 1YN6A 4IRJC 3V5HA 5F88A 4JDZA 4HIXL 3C09C 4H1LB 5EUOF 4FHBD 4XWOD 4GXUN 3MFFA 3BHBB 2ZUXA 2MMXA 2XZCH 3G6JB 2BNRE 3CMOH 4DCQB 1S7TA 1RIVL 4MAYC 1CICC 4OAWB 5M94B 1FFNA 3B2UD 2H1PH 4MWFB 1WISA 1Y18B 5CJ8A 2YMXH 5CP7A 1WAAF 3SKJL 3IKKA 1MFCL 1MLCB 3CVHH 5HPOA 5EU3A 4X7TA 4ZDHA 5KJRH 1ZE3C 5D93C 2XN9B 5F3BA 4Z6AT 5IOPB 3NABH 2AVGA 4KGJA 3ZKXC 4PJ8C 4MD4A 5FYKH 4PRID 3AS2A 2VOTA 5FA4B 1C5BH 1D5MA 3HG1E 5EZIL 3GNMH 3TFKC 3BWAA 4YDVA 4RAUB 4JE4B 5MP6L 4S1RL 3FJTA 1KB9J 2VLJB 4P4KA 3O41B 5D7LE 1G9NL 2ZSWA 1G7JB 4LKXA 4PGCA 4JB9L 3DMMB 1JYXA 2ZZUT 2A6IA 1CU4H 1BZ7B 4DTGH 1U3HC 35C8L 5GGSB 3C6LD 4MAUL 4QO1A 1Q0YH 3RY6A 4X9GA 3BI9X 1MOEA 4X6DA 4G6JH 2A74B 5B21A 2H9GA 2IAND 3MXWL 4XVTH 3SPVA 4YHLH 1VEPA 3UTSE 3IDMB 3V4UH 3DMMA 2BNRD 4MZ2A 4Z7UE 2L4OA 3REVA 3TYGH 3QA3B 1T7WA 3FO2A 4EI5B 1RUPL 1UM4L 1D5IL 1D5BA 1DLHB 5F9JB 4ZOCA 4QTIH 1I3RA 1T0MB 5T1KD 3MLVH 1BPVA 5DJZA 4K8RD 4DKDC 4OZGA 3BPNC 3N50A 4XCEB 2FWOB 3C6LB 4BH7B 4LF3B 2ILLA 4KKCD 1OAKH 4LBEB 5LCVL 4JKLA 3TM6A 5B8CB 4I18A 5CBEB 3KPRB 5MEQA 1S7VB 3L5XL 3LIZH 4MQXC 1IGJA 4PR5A 4HF5L 1JF5A 1I3RB 4ENEC 4QRQB 3GBLA 1HXMB 3FL7A 4R0LA 5I9QC 4FQPA 1FAKT 1MIEH 1HILB 1TPXB 4YDKL 4YNYA 5CAYB 4PRPB 4M7ZB 2QSQA 2W92A 1CVRA 3BSZH 1N6QL 4PREA 5A2KH 5I1LA 2XZQH 2R8SH 4NWUH 5BRZB 4M48H 2F58L 1NL0H 2FIRT 4QOKE 1EEYA 1G7MA 1S8DA 1WF5A 2ICWI 3E3QE 3MBXL 1HQRB 2UUDH 3TBYA 1U8QB 4P2RB 1J5OL 4R3SB 2ICWA 3VXQB 2G5RA 3QDAA 4ENED 4EN3B 4L8DB 4OLYL 4QRSA 2E7LC 3R1GH 1MCIA 4NHUA 4Z7UB 5BV7L 2J3SA 5ILTL 4N90E 4EKXA 4K2UL 2IC2A 3CCHA 4MQTB 5FHAH 5KSAB 4PB0H 1Q9LA 2LV4A 5E5MB 4X9HA 4QYOB 2ZKHH 3VRLE 1B0GA 1L9MA 5F6IC 3MJ9H 3CUPA 3B9KC 5JHDB 2GYSA 1CFVL 4EDWL 3BRGC 3MLXH 4OT1L 3BXNA 1WWAX 4LVOC 3IETA 1FNHA 1GC1L 4NO0D 2Q87A 4CVZB 3HZKB 2IH1A 4EVNA 1N2RB 2COQA 4MAYA 1FYTB 1KSRA 4U6HB 3NFPA 4XAWH 2J8UB 3SE8L 5EFIA 2OBGA 15C8H 4ISVA 5LAXB 5J1AB 4CW1B 4RDQF 4XP5H 2VXTH 2H3NB 1UB6B 4L9DA 1CGUA 1YEEL 5TFSH 4D94A 5BV7B 1LILA 2VAJA 2AEQL 3WUWB 5IHUH 1K2DA 5E6ID 3MV9A 4POZD 3THML 4X4YB 4O51A 2DTMH 4PY8J 1FVDB 2EIZA 2J8HA 3TZVC 1B4RA 1EEYB 1G7MB 4W70A 2ZCKH 3MUY1 4O5LL 4R4BA 1LE9A 2DKSA 3Q2CA 3WBDA 1HZHH 2K9UA 2WSKA 4I1NB 2NZ9C 5ID0B 5KSBB 3MGTB 3T1FA 1GC1C 2N7BA 4LCIL 4NUJA 4ODBD 2ZJSL 1C5CL 4OIIL 4P4KC 3ZTNL 5D93B 5BO1L 4EN3A 1ADQH 3GHBL 1FRGH 3C5JB 1NGXB 2A9ML 2PXYA 3GDBA 4B7LA 3Q5TA 4JFFE 5IW1B 4QY8A 2FRGP 4G8GA 3TFKD 1OAYL 1GOFA 1DEEB 3H42H 1FVCA 5AZEL 1JI2A 2VITA 4KI5F 3BO8B 3DGGA 3MV9D 4OZIA 1ZK9A 3GIZH 2MHAB 4OTXH 4KY1H 3EYUL 2GK0B 3U6RA 2J8OA 1HN1A 2C4XA 3HUJF 1ZTXH 4L4TD 3MO1A 3CSYA 2ZOLA 4MJ2A 4QXTB 3C9NB 2OLDA 2JELH 4HPYL 3RDTA 3QQ4B 4JG0H 1A9EA 3EDJA 3UBXG 5IHZB 3GFUA 2BVYA 2X89D 1QBLL 5T1MB 3MBEA 4DUWA 1CE1H 5DJ6B 1DBAH 3QIBD 1JGLH 3NFPB 1K4DB 4P2QA 4EIGB 4XVSH 3ULVH 1OT1A 4HBCH 4XPAH 3TNNA 3GI9L 4KFZC 3V52L 4AM0A 3IRPX 5HGDB 3SY0A 2JJSC 5HYJE 4OCYL 2OS7A 1SMAA 4RAVA 1EGJL 1EFXB 4WI6A 1NUDA 4WW1B 1PG7H 5BZDA 2EDEA 4JKKA 1A6UH 5DRXA 4D3CH 2R4RH 2Y36L 1A7BA 1FSKB 3LEVH 3L95B 4P57A 5DT1H 4AH2B 4ZXBC 5BS0A 1XCTB 1WWWX 2DRUA 5ESQB 5D7IE 1MAML 3BN9C 3GUTB 3EOBB 1EH9A 3OXSB 4P23A 2VC2L 5IB5B 3QULB 1QO3B 1ORQB 4PRHE 2GAZB 2V9QA 2FB4H 3VH8G 2VRAA 1FFRA 4XPFL 3MLRL 1FV1A 1P7QB 4NQSA 5HYQB 2HH0H 2FIKB 5TDPB 3KPOA 3FQNB 4NUGH 1H3PL 4GRMA 3LZFH 5L8JB 1O0VA 4OZFG 4K3JH 5IV2B 1PKQA 5C8JA 4LLUA 5DD5H 4OLWH 2A6DA 4KDWA 3O2DA 3B9EA 1HWGB 5AYQA 4H20L 1WZKA 1VKXA 2DLFL 4IS6A 4YUEH 3OKKA 2GITA 4PD4K 3Q5YA 1YYLL 3KXFE 1MVFA 4C56A 3I84A 3MRMA 2UVFA 1RIUL 1ZHNA 3TIEA 4N0UB 5CBEA 3MLTA 1JNLL 2BNQA 4JRYE 4ZG1A 3JZ7A 1MI5B 3BZFB 5J56B 9CGTA 5E6YA 4BSVB 1G7QA 2KZWA 4G9FD 4KTEL 4NKDB 4FZEL 3VRIA 2J6EL 3PIQA 5EPMB 1ONQB 1SM3H 3OKNA 1W8OA 3NCYS 5C0BB 4F7EA 1QUNA 2Q7YA 1QQDB 1WZ1L 4WVRA 5C07E 1OARH 4ONGH 4OZIF 5EBMB 5LWYH 1G7QB 1YPZB 1E4XL 4AQOA 5KSVA 25C8H 3GSNL 4LRNH 4LOUC 3P9LB 4E5XB 3VGAB 4N5ED 4V2CB 1OHQA 1W0YT 4JPWH 3QFDB 1DLFH 1JZ2A 4MD5A 2C7UB 1G7HB 1GPOH 1PVHA 3INUL 3BYTA 3HNSL 4G9FB 1UB6A 1NUGA 5DD3H 3EW3B 5DQDL 3UTZB 5KAQG 3WNOA 2XWJB 4PRBA 3BUYB 2AJVH 3DVNB 2EKSA 2XNAB 3DVNA 4IHOB 1RHHB 4FQJH 3VWJC 3SDAD 4YBQD 4DK6A 4JG1H 3VXRD 4NBXB 4XCFH 1L7IL 1CGSL 3V9FA 4PRPE 3L6FB 2FBJL 5EN2B 3H0TB 4WTWA 1H3UA 3SJVD 5I30L 2V5TA 5D2LF 1VB9A 1DVFC 4I18C 1CDBA 4UV4L 1ZHLB 4YHNB 1NC4D 5TPWL 3SBWC 3EJZC 5EDXA 5FDWB 4K9EC 1OAQH 3QO0A 4H8WH 4XCNB 3V2AR 2IGFH 4MCZB 1R5IB 1YMME 4FFWC 1AH1A 4JFYA 1BQLL 4K7FA 5DRWA 2IPTH 2GY5A 3O2DL 1GOHA 1YNKH 2VZTA 4BQ9A 2XICA 1W72H 3EO0A 4UINH 4NWTH 3V0VB 5KW9L 3KLAB 2JJSA 2YZ8A 3TBYB 2B39A 3QG6A 3QCVH 4HKXB 4XPGH 4CN4A 5KSVB 1BFOB 3TWCH 1J88A 4YX2L 4JY5L 4LCWB 3DX9B 1JPTL 3E8UH 3ES6B 5A3ID 2BCKB 4YXLH 4WI7A 3PDDA 2DMBA 1ETZB 1NC4B 1NEZG 3QFDA 4K7FB 5DRWB 5FK9B 2BXYA 2HRPL 4LASH 4Z0XA 5K9QG 2QADC 2NY0C 2MQCA 3DSFH 2OMBA 2AV7A 1PY4A 1AP2B 3GZKA 2XOTA 3ULVF 1MCRA 1FSKC 5GRUH 1PQZB 2OJEA 1F2XK 1JNNH 1W0WB 1DFBL 2OJEB 4OZHB 3AROA 4ALAL 4MX7A 1VEMA 4EJ1C 5C9KA 3L6FA 5KS9F 4PTTB 5KS9E 1KG0B 2P48B 1HH9B 2DYPB 3FQXA 1E4XI 2AV1B 2YC1A 2F53E 3QDME 3GBML 3U30C 4HK0A 3MGTA 4WUKH 3T1FB 1OTSD 1ZLWK 2BFVH 3CU7A 5IVZA 3JWDL 1B0RA