1WITA

Twitchin immunoglobulin superfamily domain (igsf module) (ig 18'), nmr, minimized average structure
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
93
structure length
93
Chain Sequence
b'LKPKILTASRKIKIKAGFTHNLEVDFIGAPDPTATWTVGDSGAALAPELLVDAKSSTTSIFFPSAKRADSGNYKLKVKNELGEDEAIFEVIVQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TWITCHIN 18TH IGSF MODULE
publication title Structure and stability of an immunoglobulin superfamily domain from twitchin, a muscle protein of the nematode Caenorhabditis elegans.
pubmed doi rcsb
source organism Caenorhabditis elegans
molecule tags Muscle protein
total genus 11
structure length 93
sequence length 93
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 1996-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07679 I-set Immunoglobulin I-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1witA00
1DLHA 1FG2B 4JVUA 1FFNB 5GRUH 2WBJB 3KDMA 4FQQA 3NGBC 4KTEL 2G75B 2FR4B 3P0VH 3DJ9A 1RUAH 1U92B 1YQVH 3DX6A 5HI5D 5E8NA 2ZOKB 1F2QA 2YD7A 1GZQB 3UROR 5DZLA 1UB6A 3LS4H 3FB7A 5E1HB 5IVNA 3Q1SL 4X6FB 1MEXH 3TN0C 1A3QA 4HDIB 1CK0H 1OTUC 4YK4C 3IKCA 4J3WA 4UQ3A 1KGCD 2H32B 2YPLA 3D9AL 3KLHC 4U0QB 2KUTA 5DHXB 4YC2C 1S8DA 1KB5B 2R1YB 4KC3B 3NFSH 4ZD3L 4DGVL 4ODXB 3HAEB 2VLKD 2VDOL 1BOYA 1QLRB 1BZ9A 5F44A 2C1OB 5E2VL 5SV3A 4NPYA 1HCFX 4YBQC 3MLUL 3AY4C 3X13A 4KVNH 3KPPA 3QIBC 4LSUL 4OUUA 4QHLB 4FXGB 5D4QA 4E41E 1RD6A 1A0QH 4KPHL 1INQB 4TNVK 1NCWL 4ZFFB 4JY6A 4GQ9L 3U6RB 1KUMA 3KLAA 1MH5A 5J1AB 1MWAA 4TSAH 2F53D 2VXVH 3H3KA 3O3EA 3IDGA 3C8DA 2D3VA 1MHEB 4FHBD 1KNOB 4CU8A 4XVJL 1NCCH 3MJ8A 4YHPB 3UJJL 4N8PA 5BVPH 4OLZL 1AHWB 5F89A 1FZOB 2IH1A 4NQXA 1DDHA 2X7LA 3LD8C 4CNIB 4Q9QL 4KKCC 3MBXH 3GO1L 2GSGB 1U2HA 4X9HA 4Y4FC 1RZKH 4ONHA 5C70A 3BXNB 1TETH 3W9DA 3HPLA 2DTSA 2XV6B 3RDTD 4ZNEE 3GSNA 2DB8A 2KPNA 1RHHA 1OM3L 5HY9A 4QHNB 4GRMA 5GS0L 3UJIH 4UIMA 1YECH 3GJFK 1MCOL 3PQYB 2FEEI 3DURA 5K9OA 5C3TA 4XMLL 1QSVA 3MJ6A 1LNUB 1DN0B 1G9NC 4P5MA 3QUZA 2OMNA 4NT6B 5EIVA 3DV6B 4RAUA 5T33H 2NY2B 1Q9OA 3IFLH 2R29L 1AQDB 3WUWG 2PCPA 1KCKA 1Q94B 4FNLL 1JHLL 5MEPA 1F13A 5FKAB 5IW3A 4N5EC 1VFAB 1I85C 2PNDA 1XR9B 5BQ7A 1R5VA 2W59A 4RRPG 2XA8L 5F9JB 5DYOA 5C0FA 1KLGB 3KNBA 3BH8B 3BO8A 1T7WA 4JR9L 3A67H 2ZCHH 3IU4H 1FO0B 2CXKA 1CCZA 3EZJB 5E8DL 1TZGL 2BRRL 4NWTH 5ANMB 1LO5A 1IAOB 4WO4B 5EUOF 1LD9B 4NO2B 5T5NF 4G8IB 4EOWH 2DAVA 5ITBL 4LCYB 4OCSL 2P5WA 5E6IA 3RVTC 4Z7OF 2VZ3A 4ODUA 3NA9H 2E7BA 3P4LA 3BDYH 5JOFB 1WLHA 3DGGB 3EO1B 4KRNA 1CFQB 4WVRA 2VTFA 3LKRA 5F7DB 5GIRB 2IG2H 5I15L 4LRNH 1ODAA 5AG9A 4YUEH 4PJ7E 5DD0H 1DVFB 1MCDA 3H9HB 4MDJA 5FKPA 4Y4KA 1FCCA 3VW3H 3B9EA 2HRPL 1X7QA 4IRSA 3MJGX 4X6EA 1UEMA 3UPRB 1IBGL 4F7CA 5IF0A 1N5AA 4HXAL 1KOAA 1J8KA 2R1WB 4JE4B 4ZUSA 2HVJB 3QUXB 4RWYL 1VGKB 4H25A 5FB8A 2X4SA 4OV5B 3I75A 3IFPB 4JFDB 4QOKA 3BAEL 1MI5A 3F7QA 1UCBH 3ZE1E 4DGIL 4PLKC 4PRPE 1DQLL 4QWWD 4TVPD 2LV4A 3QWOA 4ODHH 2V7HB 2N56A 5I8CA 5J3HD 3PWPD 4OZIE 4TUKL 3VWJC 4NQTA 3RWCB 4G6AC 5L2KB 4MAYD 3FOLA 1G7LB 1IGFL 1T5WA 4CAGA 3IDMA 1RUMH 3OKNB 3HZVA 1TVBA 2DLEA 4MNGE 4RWHA 3TIEA 5L9DH 2HA1A 5E5MB 5I1JH 2NLJA 4QF1B 3WMSA 4PY8J 1NBYB 2B2XL 4J3VA 3SBWA 4HBQA 3LN4B 2YD8A 4LHUB 5EO0A 3UTTB 3FQUB 1LP9F 1U2CA 2NY0C 4KGJA 4Q97A 4KVCL 3WFEH 3MRMB 5SWSE 3RU8H 4P46D 1CDUA 3QDGD 1FE8L 4PTUB 2D7PA 1HQRB 1U36A 3BUYB 3UC0L 4F2MA 4CJ1A 3VXOB 4LIQL 5D7IB 1ZLVH 3ZKXC 3WHE1 4ETQA 4R0LA 4RX4A 2W60B 3L7EA 2FJGB 5FYLD 3AS2A 1MIML 4CVZA 2YWYA 4I0PA 5CSBA 5GSRA 5T1LA 2HFFA 2ZJSL 1DBJH 3QAZB 3W2DH 4OCNC 3SGJC 2BDNL 2GAZB 4KFZC 4ODVL 1T1XB 2HH0L 3BX7C 4JDTH 1S7WA 2YN3A 1VGEL 5CKGA 4JRYB 1QSZA 2ORBH 4LHQB 3SE4C 5EOQH 3IB4A 1R0AH 3I3EA 1RPQA 4YHZH 1BAFH 4HSQA 1RFDH 4JN2A 2IALA 2AV1B 1P4BL 8CGTA 3OAYK 3U1SH 5A16A 5HHNB 3D87B 5E0QA 3ESUF 3QI9C 3ILQC 3SO3C 2OR8A 4RQQB 5H94B 2BVQB 4XTRD 3ARBC 3NIDF 2VL5B 2QR0B 3B9AA 1QFUL 4PJ8D 2YS4A 4I18A 1KV3A 1TJGL 4YDKH 4H1LH 5LWYL 3O3DB 4WI3A 3CC5A 5C07B 5DGQA 3RHWK 3G04A 3GFUA 3D3VD 3RUGE 3TYFB 3GMRA 4HQQH 1F2XK 2YD9A 1RUQH 4GAJL 3FQWA 4PGEB 3WNMA 3ZT6A 1CXIA 2BVPA 3LPWA 2MPAL 1D9KA 1H8SA 4HUVA 3UYRL 3EOTL 3WIIH 2CK0L 5HDQH 1FAIH 3OGCB 3O4LA 1K4CB 2I60H 1QFHA 4PJ9C 4M1GH 3MRCB 4KJPC 1IAKB 5CBEA 3EO0A 5JA9A 3RZCA 1CGYA 3MUJA 1CICB 5DFTA 2YKLH 5K9KA 5SX4I 5I1IH 3QNYB 2HKFL 3C5ZB 2Y36H 2FATL 1NANI 3MA7B 3ZKNC 3MBEB 5SX5K 4OLYL 5IQ7H 3B2UD 1A9EB 3RTQD 5BV7L 4TUOB 4XZUB 3ES6B 4CN4A 4NJAH 4LAQH 3C6SA 2JJVA 5ENWA 3SKJL 4TSBL 4BJLA 3ZDXF 2BERA 3QCTH 2HFEA 3VXSD 1U8KA 2WK2A 1UM4L 2UUDH 4M1CD 4X4XB 5DTFB 3AB0C 4N90D 4NQVA 1RZ7H 1ZS8A 3DUUA 4RGOH 4MHHG 1QBBA 5HYJD 4Z18A 1KGCE 4I4WA 3AROA 2DIAA 4P3DA 3RIFF 1KT2A 2AJYH 2VOTA 2APTA 1A6AB 1N2RA 2IPUG 1AY1L 4S1RH 4XPBL 3T4AA 2C3GA 1J5OH 4P57B 4KUZH 5T1MB 3WUWA 3WS6C 4W70A 3VGAC 4K3DL 5ITFB 3J7HA 4GG6A 5D8JH 2VLKE 1GOHA 1U6AH 4PFEA 4U6VH 3VFSA 1CDYA 3R0NA 4UIKL 1MJ7H 4RRPA 1D5MB 1BLNA 2NXYC 1JV5A 2DICA 4WHTB 3UTSA 1KB9K 3O6FA 3OAZH 1I8KA 4Z7UA 3GJEB 3HI5L 3SDDB 5EWIL 4ZAKA 1TENA 2EZ0C 2OBGA 3UTPD 5D2LA 1GVIA 1XF2A 3T3PF 1QBLH 3NCJH 5DT1L 5JW5A 2PTUA 2XACC 2ZUXA 3OR7A 3QULA 3S88L 2FH6A 4DWHA 3HA0A 4L4TD 2P5EB 3FHAA 4MQXC 4XNMB 4O2FA 1MFEL 2RAMA 5AYUL 5C0EB 3OKOB 1VKXA 1GHFL 5FHAL 1IC1A 4JVPA 4XVUD 3MMEB 5LXGL 1A9BA 3VFUA 4F15B 2BY2A 5FV2A 1A4JB 5FO7B 1GGBH 3VI4F 1GOGA 1NEZA 1NLBL 4YDJA 3D85B 1PG7L 1QVOA 2H6PA 2GJ6D 4OGYL 3QUXD 4J3UA 1ZHNA 3HZMA 1ORQB 2ERJC 5CD5C 1BQSA 3AVEA 4H20H 2H26B 1A21A 4JDVA 1IGCH 3G5VA 5GQBA 2JE8A 3HPJB 3JWDL 2X89D 4LEOA 3MRNA 3W5NA 5L8LB 2NY1C 5GGSA 3HFML 1ADQH 4LLMB 2NTFB 3OKLB 4YPJA 5EOCH 1B0GB 1F4AA 4HJJH 1JZ5A 3BP6A 1QPPA 4R7DB 2X1OA 4ZUTB 4DGYL 2LQRA 1IEAB 4E42B 4G8GB 3RI5F 1I1AD 4NQCE 4KK9C 1G7IB 1UENA 2DQHL 2ITCA 5C0GB 1SM3H 1IGIH 5CCKL 5EU6A 3ARFA 4MNQB 5KS9F 4UV4L 4Y5VB 4WDIB 3QO0B 5A2LH 4DUWA 4EKXA 1EHAA 4LHUD 1REIA 4QO1A 5FGRA 1JFQL 1V5JA 2HJLB 1HYSD 1A1NB 3CSYB 3RWGB 5H2BB 3O9WD 4JGUA 3LY6A 3DBXA 1PSKL 1RZJL 4HLJA 2FH8A 5C09B 4ONGL 4DKDC 3B5TA 2X42A 2X4QB 2C7UB 3MUHL 3M1BA 5CEXB 4KJYB 1AO7A 1YJDH 3U7AA 4JKKA 4G8EA 4K9EH 4TTDD 5GGVL 5FDWB 3FTGB 1DBBH 5ETUB 3HB3C 4I3SH 1RUAL 3HE6B 3BWAB 5SWZA 2ICES 3MV7B 2BNQB 3T77B 5BOZG 1ADQA 4PGCB 2XZZA 3W81A 2PW1A 3INUH 5I1LB 3SKNA 3UZQA 3P9LB 4Z5RB 4KDTC 4OIAA 1FIEA 3VGBA 3GM8A 4NKMA 3LN5B 3F7RA 3QO1B 1H3PH 2DF3A 5ELIA 3I2CH 3N1GC 4C54A 3OJMB 2XKNB 3AAZB 4LCUB 3NFSL 3D39A 1WQVT 3E6FA 3PL6C 5HGHB 5ID0B 4NDMA 4G3YH 4YPGA 4KKLD 2WUBH 2O61B 4D0DA 3PF2A 4XB7A 3L3DB 4JFYA 4NN7B 2OM5A 1T7YA 2CR6A 3BP7A 3RHWF 2GUOA 2Q7YA 4HIIB 4KVNL 4Q74A 1RJLB 4OI8A 4HWBL 3BEVB 1TZHB 3R06B 4WJ5B 2XTJC 1YPZF 3B6SA 1Z9SA 3D2UD 5J1SC 2OTWB 5EPMB 4EI5C 4H8WL 3FQRB 1DQJA 3MLVH 1FVEB 2B5IC 1NCCL 3T0VA 4PJGB 5JHLH 2Y4SA 1T66C 2W92A 1SEQL 1DLFH 2QHRL 1ETZA 2R23B 1RZKL 2FEDD 2R8SH 4U3XA 1WC7B 4OTXH 2XRAH 2YXMA 1DSFH 1CICD 4ZODA 2Y6SD 3UJIL 5DUMH 2IAMC 1NDGA 4L9LA 3LRHA 3MRRA 4UQ2B 3CX5J 4JM4L 2MSPA 1LEKB 1T7XA 4J23A 3BSZH 4MA3A 2SEBA 2V2WB 5DEGB 5FYLE 3SKOA 3I6GB 2P46B 4JANB 5T33L 3E3QC 4K7PX 4RBPH 3CDFA 4O51A 4L8DA 4RA0C 4RZCB 3CFBA 1I7UA 5IW1B 3EOAA 1C12A 2DLTA 2EDOA 3WIFB 4HIEB 4UTAL 4FG6D 1B90A 3Q6GH 3RPIB 3MGOA 2EE3A 1L7TL 3VI3E 1ZKAA 2IH3B 3A0OA 3ZKSD 1T1YB 3VFOB 3ULSB 1LO2H 4NN5C 5L8JB 3CLFL 4HC1L 2MFNA 4GRLB 4PS4H 1QR1A 3IU4L 5K33A 5GISH 2HT4C 3QEGL 2YUWA 3BPLC 4POZC 3OB0H 4YFEA 3D25A 3DO7B 5E6YA 3ARDA 2HWZH 4NUGH 4Y5YA 5HHXL 4JFHE 1BHGA 3NA9L 3IDXL 4P23C 2DJSA 3U46B 3K1DA 3PWUA 3P40A 1YY9C 3GBMH 1TPXB 2IG2L 4LRNL 3ZLQC 3TP4A 1HHJB 5GS0D 4X4MA 1AFVL 3VW3L 4MX7B 1DBKL 4P0DA 5GS3A 5D5MF 2CIIB 4W6YB 3D3VE 5F9WC 9CGTA 4XCNB 4C83A 1SY6A 3U7WL 4AG4H 3HI1B 4KKNA 2XZAL 3C60A 4ZDHB 4HH8A 2Y07H 3L9RB 2H8PB 5I0DA 1A02N 1UCBL 1H3VA 4JPVH 3RWJA 3OKKA 4L8SB 4ODHL 2N4IA 5IFAH 2OK0L 4HF5L 3GMQA 4PRBB 4IIQB 1U91A 5DJYA 1G9NH 4AIOA 4X9GA 4MJ2A 4F7PB 3EOYG 3HNTH 3N0PB 4JFOB 1RUML 3RGVD 2H3NA 2RQ8A 1YQ2A 1P7QA 1CDGA 5L9DL 2C1PA 2F54B 2XY2A 3FT3B 5I1JL 4GW5A 1ZK9A 2NCMA 3VA6A 1CIUA 1MNUH 3EDDA 2HKHH 1PQZA 4N90E 1BZ7A 1LE5A 3EYQD 1XIWA 4RMUA 5C0ND 1JGDB 4XPHH 5HYJE 3JUZA 4N8CH 5C0AB 1FHGA 3QUKB 3W0WD 4GRWH 3WFZA 4P2QB 3WFEL 1ZWIA 3EYUH 1UM6H 2VLLA 1E27A 3BHBA 2L7UA 3BPCB 3LKSB 1AJ7L 3DYPA 1LILA 4L1HA 3V52L 4LVOC 3CVHH 1A6WL 5C09D 2RCSL 5D96C 3GNMH 3PV6B 5ANME 2EYRB 4UDTB 4ORGB 5IEHB 1F5WA 4G6ML 4UT7L 4HFWB 5E4IA 1P4LB 4N1CA 2ICWB 2UWEA 4MYWB 3HE6D 3BUTA 3C6LB 3REVA 2E7LC 4PB0H 3K80A 5AAMA 4JQVA 3QXWA 2R4SH 4JDTL 3DX6B 2X4NA 4OJFH 2EDXA 3O6LL 5IROC 3FB7B 1Y6KR 1RJYA 1VFMA 2DQUL 1BAFL 2G2RB 1OP5H 4LQFL 3TBYB 4PJEA 4UQ3B 4GW4A 5IHZA 2V5MA 1PD6A 3AREC 2GJ6E 2VLRA 4KZDH 2CIKB 1I9JL 1S8DB 3RWHB 4JFDE 1K4DA 3BPNC 1BECA 4Z76A 3ROLB 3GK8H 2VE6A 3GB7A 5C6WH 3I02B 4RFNB 3T8XA 1MAKA 3L3IB 3B9KA 3DGCR 1TTFA 1ZEAL 1IGTA 3MC0A 5DMIH 4R7NA 1U93B 3JV5A 2BSSA 3W11C 4M4PA 3KPPB 4HIJA 1AKJA 3MRLB 1FZJB 5JW4Q 3CVIH 6FABH 4HQQL 1NUFA 1A4KB 1M7IB 2EDNA 5CUSH 2BNRB 2EIZB 4R4BA 3FL7A 4UBDD 5DD5H 1YY8A 3O3EB 2VSCA 1FAIL 1FN4B 3WD5L 4U1LB 1MVUA 3KPOB 3UTTE 4ZUVB 2EO1A 4K7FA 3Q6FB 3QIUC 1F58H 2CKBH 4HUXA 5EH1A 2X7LB 2Y36L 4X5LA 5DVKA 4KI5D 2HN7A 4I3RH 3V7AE 1NL0H 3S4SG 2Z4QA 4JN1H 5IQ7L 1EO7A 1RHHB 5HY9B 3FO9A 1E6OH 3HZYA 4GRMB 5D7IE 5IESL 1MRCL 4XI5D 2BHYA 4PJAA 3NH7H 3QCTL 1EX0A 1OGTB 4JKMA 1YN6A 4H88H 1MFNA 4P5MB 3ULVF 3K0WA 1RZ7L 4PJFE 2XPGA 4QHMA 2VR5A 1FL6A 1PKQA 1L9NA 2FGZA 1MCWM 5D7JA 5T1DL 4JRYE 4LF3A 3ET9F 1B0RB 3QNXA 4BYHA 5C0CA 3KS0J 4TPRH 3GHEH 1FNHA 5I1DA 1J5OL 1R5VB 3TZVB 3CAFA 1NQBA 5C0FB 4NO0A 1SEBB 1UZ6E 5DURB 5D8JL 2WAHA 3VFPA 1U6AL 1NGZA 2XICA 1K8DB 3TJHC 1OAQH 2CKBA 2ZP0T 2FL5A 3FJTA 1X4XA 1Q9KB 1CG9B 4UUJA 2GTZA 1D5ZA 3T4YB 1LO5B 5I75C 3PDOB 4GLRI 1BVZA 1QBLL 1OAXH 5E6IB 1AGFA 1S7SA 5GRYA 2X4OA 3V6OC 1IEBA 2ESVA 3LKQA 5JOPD 4HAFA 4X80H 1XGYH 1KJMA 4R96A 4LVHC 5FGSA 2FHCA 2X5PA 3SE4A 1OHQA 5DD1H 4MDJB 1X7QB 1GGBL 4OGAC 5E2JA 4AIXA 2HLAA 4TN9A 5E7BA 5IF0B 4F7CB 4FQXC 2QQNL 1B6DA 3GIZH 5BMFL 5GGTH 5I2IB 2BOCA 3AS3A 5KSBF 5FB8B 1W72H 4FN0A 4HIHB 1MCPH 1DBMH 3B5HA 3I75B 4DCQB 4KQ4H 5IWLC 2ADIB 3ARBA 1DE4A 5IT2H 1KCRL 5HGGS 4CL7A 4URTB 3UTQB 5E99H 4EDWL 4XWOD 1CLZH 3V95A 4MLIA 4HS3A 4R9HA 3S96B 3FOLB 4MJ6A 4QGTA 1RZ8B 4NQDD 3UYOD 1T5WB 3N1MC 1E4XI 3K74B 1T7VA 3EDFA 1VESA 4MD4A 5EDXA 4Y19B 2R2EA 1IFHH 4PRIA 4NZRH 3GMNA 2CLRB 3DYMA 4LKXA 3UX9B 1UB5A 2DM2A 1HSAB 4U0RC 5DI8B 2GK0B 2VDPH 4NM8H 4P2QD 2W9DH 4MJ4A 5JPMA 1Z9OA 1KXQE 5GZOD 4LDLB 3HN3A 1MY5A 5KG9B 4DN3H 4M8QA 4UDUB 4DW2L 1QPXA 4JEGB 1DBBL 1UH2A 2EDRA 4XPTH 4ETQB 3X12A 5IBLD 1BFTA 3SQBA 1JZ4A 2MCG1 4D0BA 2M8XA 4KMTH 1A6UH 3RWIA 5IBUG 3H9SA 4PJXB 3VMOA 1PFCA 4R97C 1WIOA 1A7OH 2P5EE 3HI6H 3E6HA 1C7TA 1WF5A 3MRHA 5B8CC 4WWKA 2D4DA 3IFOB 5IVXA 2E8YA 4CW1B 3WS6A 1K5NA 4WI7A 4MXWH 1ZTXH 2W9LA 2BRQA 1BGXL 1J1OH 3VXRD 5D1ZB 2D2OA 5H37H 2AJSL 3SDXF 1QRKA 3ECBA 4WTXA 4AL8L 3NTCH 4RFEB 3QG6A 2QBWA 4XHQA 2RFXB 1O7SA 1JP5A 3DVNA 5TF1L 3VGDA 3MLVL 1O7VA 4HXBL 1HHGB 4I18B 3EYOA 5F7KC 5DS8B 4HJGB 4F33B 2HTKC 3PJSA 3CC5B 4WENB 2X44D 2AJUH 4HLZG 5DC4B 3SDAC 4OZGB 1QA9A 1UH4A 2BNRD 3W0WE 2R8SL 4R8WL 1AD9A 4I48A 4AIZB 4OTXL 3NPSB 4YXKH 1DSFL 5TH2B 3X14A 4ZPVA 1I8IB 4N0CC 3ZTJH 5HI5C 35C8H 4JHAH 5ACMA 1C08B 3VMPA 5CBEB 5DVNA 4YDLB 5C09E 1EHLH 3BSZL 2OI9B 3MLRH 2EEDA 5JHDA 1WVZA 4EIZC 1IKNC 3V4PL 1F3DH 2Y9RT 1ZHKA 5GS1A 1X5AA 3O0RL 4X7TA 5JPNA 5HXMA 5L8KB 3Q6GL 3T2OA 4LU5L 3KYKH 4HGWA 2D7NA 3ARGB 1V05A 1U8KB 2IADA 3O3UN 5E94A 5K59E 5SX4H 2E3VA 3NIGE 3BZEA 1XGTA 4H1LB 4Y4HD 4PS4L 3DUUB 5T1KB 2C4XA 5GISL 3KPRD 3ARPA 3WN5C 2A0LD 3NCYP 4QXTB 4UT6H 3SE3A 3TPKA 1I3RB 4HWEL 1YMMB 5J12C 3T4AB 3MRJA 3EDEA 4P5TB 3CUPA 1CE1H 1P9MA 3DX8A 4DZBB 5JW4M 4N0UA 4PJHE 4MSWB 1PY4A 4NZUL 4RIRB 5KW9L 1U8IA 4UZGA 3JXAA 1BLNB 1JF1A 1JV5B 2YA1A 3O3AA 3MRQB 3IAQA 1NGWA 4KMLB 4ODSH 4LVNB 1FFQA 3G6DH 3EJJX 1FFRA 2CDEA 5E00A 1N8ZA 1XGUB 5D2LB 1EUTA 3RDTC 1XF2B 5JW5B 4LIQE 3RWDA 2PXYD 3NCEB 1BQHB 3OR7B 3QULB 5LG1A 4PLNC 5JR1H 5FEBA 4PJGE 3DECA 3H42H 4O2FB 2OL3H 4PUBH 5JO5A 3MCKA 1R24B 2VXTH 3PWLB 1BD2B 1MJ8H 5FYJH 4LOUD 3OG4B 4NSKA 3VFUB 2ZKHH 1MHHB 3GMPB 1JPFA 3NCBB 3QZWG 4X8XA 3G5YB 3OF6A 1NEZB 1XCQA 4YDJB 5IFAL 5EA0H 1ZLVK 4OZHE 4WFGD 4LCCA 4KI5E 5LGJB 1C16A 1HXYA 1G9NL 4LFHD 5C2BH 3HZMB 3PWNA 4N68A 5HHPA 3HNTL 4PRHD 3FQTB 5DMGD 1X5FA 5D9SA 5ALBH 1HIMH 1LO4H 2B20A 4LEOB 5IVZB 5I30L 1AXIB 2G9HA 3OR6B 5GGSB 4AQ1B 4X6CA 1MNUL 2BVUA 4WW2B 4JFPA 2RIKA 1OPGL 5BZDA 4XPHL 4Y19D 3ZT7A 3MNWA 4RMWA 1RIHH 4GKOA 4OLWH 5KSAD 1U8JA 1ZSDA 2IBZX 3EYUL 1UM6L 3O2DL 5KANI 4V2CB 4ZOBA 5KVGH 3T3ME 2OL3A 4XHJC 4ZXBD 3O4OC 2ATPB 5D7SL 5ERWA 1F11A 4JFZH 3BE1L 3CVHL 1RJZB 3GNML 3HZKA 4WI4A 5HHOA 3DBXB 2HFGH 1R3HA 1ZT4A 2X70B 3M1BB 5JMOC 4EBQL 4OD3H 3EYSH 4BH7A 1AO7B 4WI8A 4PB0L 2UVFA 1IGYB 2MCPH 5CEZL 1KLUA 5F6HJ 5SWZB 5JOPE 3V79C 1EVUA 3LEXB 2O5YH 4Y5XA 4Y8DC 2PW1B 2WINB 1NMAH 5IB5A 5I76A 5DQ9B 2CRMA 5GGSY 3HS0A 3VXNB 1OAKH 3AFLA 4U1MB 4M61A 2AK4B 3L1OL 4W4OA 4U49A 2OJEB 4MAYC 3WBDA 4BZ2H 3F6IA 2DYPA 1LK2A 1ND0B 3BGAA 4KZDL 4J6RH 3BQUD 3D39B 2H2SC 1J1PH 4ZG1A 5I8EA 4WEBH 4KTDL 4FXKA 1TJHL 3NZ8B 4J3OC 4R2GB 2Y7QA 3GMOA 4Z77B 4CN1A 3BP7B 1MAJA 3V8OA 5F1IA 4ZTPH 4U1GC 1EAJA 3BRFA 2BY0A 4XPFL 5HVHC 1XF4B 2UUDK 3TWCH 3CNKA 1K85A 2CO7B 2A6JA 3CVIL 3LZFL 4NQDE 4G43A 5IK3B 1HKLH 5J11C 4P48A 4N1EA 1BBDH 2APWA 1P7HL 4LAJH 3HHRB 4U1IB 1KFAH 1QACA 4L4VA 5CJ8A 4BQ9A 4YE4H 5C0AE 1MCJA 1MREH 1F58L 1Q9LB 4P2QE 2GTWA 3FQNA 3ALPA 1DQQA 1WWWX 1TNMA 4IMKA 5C9JA 1NL0L 3KPSB 5ICXB 2BFVL 2V2TA 1E6OL 3TVMB 4LSQH 2YMXH 2IWGA 1PJ9A 2MMXA 2VN7A 1RIUH 1NDGB 3MRKB 2AJXH 1JTPA 4EEEA 1VADB 5GSVA 2NNAB 4QEGA 3SKOB 1OGAB 2DQDH 3VCLA 1KTKE 1NBVH 5BS0A 1CU4L 4L8DB 3HKFA 1ED3B 3STZA 3TNNA 1I7UB 1AE6H 5HYSB 4MCYA 3MFGB 4MQTB 4NBZB 3ARGD 3T65A 2I07B 3MGOB 4C56D 1BX2B 4TPRL 4XTRC 4OD1H 4F8QA 2AGJH 2L7JA 3S98A 3M45A 2FEEL 4HWNA 1T0MA 2R2BA 3TBWB 4XPAL 2DQJH 4PJ8C 1FNEB 4YHIB 3L5IA 1INEL 1OAQL 4NNXA 5CINH 4K94H 3VXRE 1JWMB 5AD0A 3LRGA 3P0YH 1JF5A 3TBTB 1YEGH 5FCSH 3GI8H 3P4NA 5L2JA 4NYLB 4XBGA 1OAXL 2OCFD 1M4KA 4OCWH 2X1WL 5BRZB 3VDBA 4G6FD 4H5SB 4W81A 3NGBB 3PWUB 1J1XH 1DQMH 1XGYL 1NPUA 2EYSB 3I50L 1MCRA 3W82A 5FK9B 4FFWD 1LEIA 1KENH 5DD1L 1V7ML 3FRPG 5DWUL 4GMTH 3VXTA 4YK4B 3SQOH 1UKSA 5IJKC 2BNRE 3RTQC 1Y18A 2Z8RA 1DEEB 3CMOL 3QSKB 5CIPH 4E41A 2CGRL 2E9BA 3MRBA 5GGTL 1BD2D 4O58H 5F6IC 3RX8A 1W72L 2CK2A 4YC2B 3NN8B 3O81A 3ZYZA 1PG7X 4KQ4L 4X4ZA 4M1CC 3GRWA 1NFDB 1K3IA 1NC2D 3DVGA 3DYOA 1MFDH 3OKKB 4E5XA 4ELKB 5EZLB 2ARWA 3L3JB 1U91B 2X6MA 1CLZL 2WUCH 4LLUA 2Q6WA 3V0VA 3QZWA 3QIBB 1AC0A 5CEYA 1J11A 2KDGA 1MIEH 1T2QH 4XNYH 4GG8B 5A2KH 4RGND 4AEEA 1OARL 4ZNEA 5F3BB 2GI7A 2GSIB 2XTLA 1ZLWH 1QO3A 1P7QB 5K9QG 2ADFH 2NY5L 3U4AA 4Z95H 1JUFB 4UILL 4Z7OE 1LE5B 3ZE0E 1MHCB 1QFWI 1NC4B 2VDPL 4HX1A 2XQBH 1BBJB 4L3EB 2W9DL 5BZWA 3QIUA 4MZ3A 5AZEH 3CZFB 3CU1A 1BPVA 1WWCA 5CIPA 2DJUA 1ZWIB 3LD8B 4Y4FB 2GY5A 1OSZB 1E27B 2NMSA 2CD0A 4P3CH 1TJIL 4X4YB 4K23H 4OKVA 3RKDD 3LQZA 4XVUC 1MY7A 3QQ3B 4LNRA 3V6FB 5C3LD 5FCUL 4GG6F 4LSPL 5DA0B 2BC4A 3IGAB 3MCLL 5J6GA 5TE7H 2K7QA 1UJ3A 1UACH 1EERB 2ZSVA 3WDHA 1UYWL 3BI9X 4M7LH 4M9OA 2UWEB 4NOBA 2MQCA 4Z7UF 2VDRH 3A6BH 4WFFD 1QTYT 2R2HA 3R1GH 1ZLSL 2J6EH 5D2LF 2XN9B 4OFPA 4RA3A 1EJOH 2AERT 3ESVF 2C3WA 3QP3A 2BHZA 2OQJA 4JPKH 3TF7C 4MXWL 1ZTXL 4X6BA 4WEUD 4N0FB 2ITDB 4LLYA 4XH2B 4PJEB 4KKAC 1A8JH 4GW4B 1CD8A 4PJ7A 5I8KH 4GRWB 1N64H 2JB5H 3LH2H 5CHNB 1AD0A 3OG6B 1I1AC 1ZAGA 5FECB 1K4DB 5CBAA 1CE6A 4WU7A 1U58B 2VE6B 3DWTA 1RULH 3F58H 3NTCL 4R2GD 3K4AA 1Z2KA 2UV3A 4RBPK 4XP9H 2WW8A 3MA9H 3CVHB 2PTTB 5F70A 4HK3J 5IMKA 4R7NB 1U41A 3ETBF 3O9WC 4IRZL 3L7FB 3WJLC 1CDCA 4PRPA 1Z9MA 3VU2A 3SGKA 1X3DA 4Y19E 1OW0A 3OXRA 3UTZB 4OZIA 2P8PA 2MQ3A 4OCMC 2H1PH 4TTDC 1FC2D 3I3DA 3JV6B 2L4OA 3LKPA 1Q0XH 2FX8H 3OB0K 1YY8B 1UXSB 2O5ZH 3HC3H 4KJQD 1WCQA 2BP3A 2R0KL 35C8L 3QWRD 4Y7MA 2ZSWB 2XA3A 5FM5O 1MVUB 2B1HH 4GW1B 4MNGA 4DVBB 5F1SA 1Q0YL 2JTDA 4HUXB 5EFIA 4M7ZB 4RMSA 1B88A 2HN7B 3KPLA 1KXTB 2Z4QB 5AUMB 3VWJB 3FO9B 3HZYB 4M02A 1BJ8A 2VR4A 5SWSA 4YNYB 4PJAB 1V3LA 4P9HC 5F1KC 1MHPH 4H26B 2W9EH 1YN6B 3VXUD 1OSPH 4PJXE 3L5WB 4N8VB 4NKDA 3BKCH 3F12A 3LPGA 1FL6B 1PKQB 4JQXC 1S9XB 3LKNA 1A7NH 3AM8A 1AR1D 1G9MH 4PLOB 1VEOA 3OPZH 2QQKH 3IJYB 3QNXB 5C0CB 3CFEB 1KCSL 2NY0B 4PG2C 3PGCA 3AMKA 2BVEA 4M03A 1CE1L 2VERN 5DJ6A 4PV8B 5A40E 3S3PA 2G5BB 2XG5A 4M7JH 4NC1E 1UT9A 3ZTNL 1J0JA 1CXKA 2CKBB 1JI2A 4XXDB 3ZKXB 4ODSL 4E0RA 2DMCA 4JM2C 4IDLA 5DRWA 1MQ8A 4G6JH 2FEDC 2FX9H 3BN9D 1U95B 5BRZD 5D6DA 2F15A 4LASH 1MFBH 3IJSB 2Y6SC 4WW1B 5JR1L 4YDVA 1QLFA 2ESVB 1B4RA 3H42L 4APQA 4Y1AB 4Q0XL 1U8PB 1FZMA 1PAMA 4PUBL 3TN0D 5FYKD 1R5IB 1S78D 4OZGE 2CJUL 2KZWA 1A7BA 5FYJL 4HK3N 4EQ3A 1KPRA 5J8OA 3L95A 2HLAB 4GLRH 5EA0L 4X9FA 2A6KB 5CJ5A 3KPQB 2VWEE 3BW9A 5C2BL 4R4FH 1NMCC 3FRPA 3RUGA 2HJKA 3O8XA 2P45B 2DL2A 2X41A 3B43A 4KV5E 5F1NA 3SO3B 2DWDB 4ONOA 4XP4H 3TH3T 4YBQD 3ARBB 4X7SL 1OF2A 4NCC2 5IR1B 1IM9D 1FH5H 3HNSL 3QIBD 3SDCD 2FBJH 4GAGL 3DSFL 4H0IA 5KTEH 1PZ5A 4HS3B 3ZDYF 4MJ6B 4LCIL 1OP5K 3EDKA 3FHQA 4OLWL 3OX8B 4MD4B 3MV8B 3M17B 4LNVA 3VJ6A 1FL5A 5IM7A 1UJTA 3IVKA 2GK2A 4A2LA 4IJ3C 4PRIB 5KVGL 3S97C 4U1JB 1RV6X 3GMNB 1NC4D 4EVNA 2X4RA 2Q87A 1GIGH 2XZQH 1MJUL 3RBGA 5IMOA 3QQ4B 4F58H 4PJ9B 1JHTA 1FBIH 1WTGT 2DQEL 3MV9B 5GS0C 4PYGA 1YMME 3LMJH 1FV1B 4ZUWB 4DKFH 2HFGL 3GEWB 4PJDF 1FL3B 43CAB 1E4XH 2UVEA 3C08H 3EYSL 4HG4K 1W72B 2VXUH 4I8DA 1JGVH 5EC1A 4HUMB 5F8QC 3T0WA 1T2XA 2MCPL 3KJ6H 3V6ZB 3V8CA 2VLKA 4D0BB 1CGSH 3PWJB 4TUJA 5C08B 5I19H 3SKMA 1JPSH 3RWIB 1OAKL 3BKMH 1JWSB 3AB0B 1RZFH 4QCIA 4BSWB 3MREA 1FJ1A 3E6HB 1YEIL 3MRHB 1S9VB 3RGVC 3KYOB 4J6RL 1BD2E 1J1PL 3PNWB 4OI9A 5SWQB 5J13C 3VGAB 4WEBL 4KHTH 1KTDB 1TQCB 3V6BR 2AVGA 4Y16D 3EYQC 1CXFA 3EYVB 4QXUH 3ROOA 4BUHA 1MRFH 1ZGLM 2CLZB 5E2UH 4B7IA 2NXYB 4ZTPL 1IQDB 5FA4B 3QDMB 4FQLL 5MP6H 3TWCL 2AKRB 2R4RH 3ECBB 1HKLL 4XP1H 3RDTA 3H0TA 5ESQA 3DLQR 1GH7A 1KFAL 2AEIT 1GSMA 4ZFOA 3FN0H 4WV1A 1CGUA 3SE8H 4NO5B 4MDIB 2BVYA 1ROWA 1UADC 5DQJA 2YUVA 1KCVH 3OMZA 2V5SA 4Q9CA 1MREL 3PJSB 2YC1A 4X6DB 1LEGB 1BOGB 4D9LL 5CEZD 1KG0B 4HH9A 4YHKL 2MKWA 1YA5A 1AD9B 1OVZA 3UMTA 3SPVA 4FQJH 4XCEB 4JHWH 5ESAB 1H8NA 3C5JB 3MJ7A 3A6CH 5ADPH 4LSQL 3L3KB 3ZE2E 1S9KC 4QRUA 2YMXL 2ERJB 4NQCA 1RIUL 5ESVA 4MB3A 5DMKA 2FNBA 5F7WC 5JHDB 3AC0A 4JFED 4G6AD 3BIKA 3WNPA 1G0XA 2Q20A 4TVPH 3QUYC 1IAIH 3QFJB 4U1HA 4PYHA 4G5ZH 4JO2H 1KIQB 2V7NA 4WFFE 3IFNH 3QNZB 1JIBA 4HGWB 4OD1L 2OR9L 2BX5A 2AGJL 1QFWM 1DUZA 4U6YA 5E94B 5C0BB 1SYVB 1ITCA 1XGTB 4L8CA 2AK4E 1TIUA 3G6AB 4KGLA 3S7GA 2VITA 1AGDB 1G6RA 3QH3A 5H35A 3BOVA 5HDOA 1LO3H 2NY0D 4PRDB 2FZ3B 1WZLA 4PJEF 1H0DA 1KBGL 3GI8L 5CWSB 5CZVH 3T04D 2WIIA 4UBDC 3FT2B 3N50A 4OCWL 4HKXB 1U8OB 1F4HA 2C4FT 1MCQA 4CN6A 1JPGB 5ADOH 1J1XL 4FFZL 4OSUH 4XNXH 2DQFA 5D1QC 1KENL 2CDEB 4O5LL 3QXDA 1N8ZB 4KI5C 3IXTA 5FYLH 3O2VH 2Q86B 4XXCA 5IFJA 2Q3ZA 2O5XH 3RWDB 5C86A 4Y1AD 5CJQL 1RUPH 3WUZA 4XI5C 5IQ9B 1ZT1A 1U3HA 5DRZA 4LHUG 4DZ8A 3MCKB 5FUOH 2IFGA 1GXEA 2VH5L 3PL6B 3C8KB 1CS6A 1OAYL 2VUYA 1JPFB 3KPSE 1M6OA 3PHSA 1WAAE 5D70H 1XCQB 2W07A 1GL4B 3GJFA 2WZPD 3JUYA 4JKLA 3V7AG 2EEAA 2H32H 4ZUUB 3D6GA 1C16B 1JTTA 2WUCL 4U3HA 1G7JB 4KTYA 1KB5H 3ILQD 3QI9D 5J89A 4JVWA 3RVXC 1T2QL 3LRSB 2XTJB 1ZHBB 2IJ0C 4P46A 2BXYA 5I1EH 1OGAE 4NBXB 2JCCE 3NVQA 1HWHB 4BA8A 5E8PA 1S9YB 4EI5B 3UXFA 4BZYA 3VXUE 5I16B 2YPVL 1QR4A 5EG6C 4PJAF 2YBRA 4I13B 2B5IB 1AGEA 2AI0H 3MV8D 3RNKB 5BZDB 3CDYA 2PO6A 2XQBL 3C2SA 3MNWB 1LDPL 1FG2A 4PB9H 4YHNA 1FFNA 3QA3A 4ZSOE 2IQ9H 3ULUF 3HR5B 2B4CC 4YGAB 3RY6C 2G75A 3AMLA 2FR4A 4F9LC 5LJYH 5JW3H 4P3CL 3IYLW 3QEQB 1JJUA 2JJWA 2OL3B 4PJ9D 1EGJL 5CGYD 4K23L 3DMMC 4HDIA 5BV7C 1H8OA 2Z8VC 4KUCF 1MPAL 2IAMB 1IQWH 3HZKB 2ED7A 4IRJC 3F65A 1NMBH 1ZT4B 2H32A 1UACL 1AGBA 1FZKB 3S36H 5BRZE 1KB5A 2VDKL 1BZQK 3B9VA 2R1YA 2Z35B 3TNMB 5TQ2H 5ICZB 2NPLX 4ODXA 2QSCL 3UCRA 3R1GL 2J6EL 4HMEA 2C1OA 3QHTC 2IAND 2CDFB 3O2WH 4CUCA 3GSOB 4Y5XB 1N7MH 3LV3B 5TF0A 1II4E 1UZ8A 4NN5B 5IGXH 2DLFL 3QDJB 4PJ8A 1HHKA 4QHLA 4XWOC 3VD7A 4FXGA 3X3GL 4D9RE 4YXHH 4MJ5B 2DYPB 1WIUA 1INQA 2OJZH 2OSLB 2X9XA 2JB5L 3LH2L 4IDJL 4JO4L 2JJTC 3BPLB 5TGBA 2AXJA 1Q9WA 3U6RA 1KELH 3D3VA 2WNGA 4Z78A 2AJ3B 5J1AA 1NFDE 3F58L 4BK5A 4BFGA 1X5GA 4M1DL 1CL7H 1HHHB 4XP9L 1KNOA 4HFUL 4FXKB 4Z7WB 4NIKB 4OFYA 4YHPA 1J8HB 2NXYD 3HE7C 2FGWL 1UVQA 4P23B 1KIRB 2A9NH 2KZ1B 4C4KO 3ELAT 2J88L 3QDMD 4BUGA 1FZOA 1JF6A 1P6AB 5F1IB 4R90H 5F7EH 2GSGA 4XVSL 3BXNA 5GZOC 1U8HB 3LKOA 5MENB 1J0IA 4OGXL 4EN3D 3HMXL 2J7LA 4QHNA 2H1PL 4TQEH 1A3LH 3T0EC 5F9WB 2FX8L 3CH8A 4MQXD 5BW7A 1EZVX 3TIDA 1I3GL 4OKDA 2Q8BL 1LNUA 3GMMA 5IBLC 4L3EE 5EBWA 3EYFB 1E4KA 3MRFA 4NT6A 3DV6A 2D0FA 2GTWB 2C3VB 3UBXI 5D6CB 5I1AB 4MJID 1D6VH 4K8RD 1A6VH 1KCUL 1Q94A 3BPOB 3JWDC 5HYJA 5FKAA 5CD5D 1RIVH 2V2TB 4MXVF 1T6VN 1G7PA 1XR9A 3QB7C 4FFVC 2OP4H 5F9JA 1F4YH 2ZPKH 1KLGA 3BH8A 4TNWK 3ZO0A 1XF1A 2FLRT 3VRLF 5FDYA 2YPLD 2NY1D 1FO0A 2VLJB 1OSPL 3VCLB 1Q72H 3O6MH 1CLYL 4FTVB 4NCC1 5ANMA 3TYGL 4GXUN 4WO4A 4RFOL 1LD9A 4OCXH 4NO2A 4ZTOL 1OT1A 4M48H 5F97E 4LCYA 3T65B 3OPZL 2QQKL 3VXMB 1WBZA 5C0BD 4PGBB 5JOFA 4JG0H 3TC9A 5C8JB 3DGGA 4B53A 1RZJC 1CQKA 3EO1A 1CFQA 1Z5LB 5KOMC 5GIRA 5F7DA 5GZNC 4M7JL 5I8OL 5IVXF 4AZ8A 3SGDH 5IKCB 4JZNA 3WXWH 1DVFA 4GRWE 4PJBB 1F97A 3H9HA 1AC6A 2DM3A 3TCLA 4LVOB 5AD0B 1ZANL 5D96B 3U30C 1AQKH 1HXMB 3UPRA 1GJIA 2FX9L 5A1AA 5F8RC 2YRZA 4F9PA 4HUUA 5L2JB 2R1WA 2HVJA 4LPYA 4OQTH 1FPTL 2GJ6A 3QUXA 1VGKA 3PG2A 4MCZA 5FXCH 1CFSA 1VPOH 3IFPA 4JFDA 1CDJA 4KAQH 4EDXA 4HUKB 4M6NH 3DV4B 3QJHB 4HAGA 2V6HA 3OQ3B 1KN4H 4ZO8A 4O02L 1F4XH 2V7HA 2X89A 4JFXA 1HEZB 3RWCA 2V9QA 5CEZE 4OF6A 5E2WH 5A2JH 1G7LA 2D03H 3VFNA 1GAFH 4R4FL 3AREB 1J0HA 2HTLD 1CXLA 3JV4B 3OKNA 5FAAA 5E5MA 1I1AA 1A64A 1JMXA 3BPNB 4QF1A 3SJVB 1VB9A 2OXGA 4NP4L 1NBYA 2JJSC 5CMAB 3VFVB 2JIXB 4Y4HC 5MHSD 3LN4A 2WP3O 2YOCA 2NQCA 4LHUA 3UTTA 4P9HH 2FBJL 5DA4A 5HVWA 4JFEE 1H3XA 5KTEL 4LLUB 2XTJD 3V0VB 3MRMA 1W2KT 3H2WA 1D5IL 5CJXC 4OQTA 3O45A 1HH6B 4XNUH 1HQRA 2WV3A 1PLGL 1IGML 1I3UA 4Q9RH 2WM0A 5D7IA 1NCDH 3LEYH 3HUJF 3WJJC 2FJGA 2I25N 1GIGL 4ZO9A 1EHNA 1FBIL 3BYYA 4IM8A 1M1SA 2P5WD 4D9QD 4P4RB 1SYSA 3QIUB 5D93C 1CDHA 1TLKA 4PJFA 3QEQD 1JZ8A 1E4XL 5CIPB 2PXYC 4GBXC 4KTEH 1KPUB 1T1XA 1FVDB 4CMMB 3NIFE 5FYJD 1P1ZB 3OTTA 4JRYA 2IAMD 4K2UL 4ZOCA 5GRXG 4Y4KD 3Q1SH 3KJ6L 4IRSD 1R3LA 4LOUC 5KSBE 2BC4B 3ORJA 5B3JE 3D9AH 2EDWA 4OF0A 3DO3A 1JPSL 2ZSVB 5HHNA 1RZFL 1CZ8L 1MI5D 1JCKA 4Y1AE 5HI4D 4LLWB 2VDOH 4RQQA 1I1YB 2H9GB 3D2UA 5E2VH 2QR0A 4ALAH 2RR3A 4CGTA 2X2YA 4KHTL 1PX3A 3MLUH 1UWEL 3X3FL 1W0VB 3MROB 5GGUA 4LSUH 2OTPA 2Q7NA 2WLYA 4M5ZL 1NCTA 4LLYB 1KB9J 4O9HL 3V5KB 1INDH 4QXUL 3FN3A 2J12B 3TYFA 2APVA 5E9DB 2DQCH 1AD0B 1FIGL 4PGEA 2WWMD 5KSAC 2AXFA 1PBYA 2R4RL 5F1OB 5FM8A 1M7DA 2XXCB 4OIIL 5I75B 5EU7E 4XP1L 2D9CA 4XVJH 4ZXBC 4HPOL 3UJJH 3VRIB 1YY9D 1IAKA 1CICA 5IMKB 3GDBA 2ZG2A 4P2OC 5HDLA 4Q9QH 3QNYA 3GO1H 1KCVL 4LPCA 5MEND 3MA7A 1G0DA 1JE6A 2ATKA 2JB6B 3EFFA 3MV8E 4MA8L 4X6CF 1A14H 1A9EA 2EYTA 1OM3H 3BDBA 4OM0H 7FABL 1CTNA 4XZUA 2V5TA 3BP4B 3ES6A 5GS0H 3BD3A 4NFBA 4FQJL 4RX4D 1MQKH 1MCOH 2EO9A 4FQXB 4CRPA 4ERSH 3F8UB 1F4WL 3A6CL 5ADPL 1XAUA 2HVKB 3MNZB 4X4XA 5DTFA 4MNGB 5ISZB 1EUUA 4ELMB 2R29H 3MZTA 1VEPA 4CU7A 5JIHA 2RBLA 4FNLH 4TVPL 1A6AA 1JHLH 1L6XA 4XBPB 1J7VR 4CU6A 5JXED 4F80A 2R0ZL 5DEZA 5B39A 4LLAA 2XA8H 3BQUC 2X4UB 2VLJD 3P3YA 2XQYG 2J4WL 1LO0H 5DJ0B 4JR9H 4NC1C 5C08E 2IANE 4FTVD 4PGJA 3EKCA 4WHTA 3BGMB 4KU1A 1YYML 2BRRH 1A1OB 3SDDA 3VXMD 4U0RB 1U8LB 3LKNB 2P7TB 3OXSB 3HG1D 1NGPL 2XWTB 2P5EA 4XNMA 5J7CC 4NQSB 2NX5B 5C0EA 5I15H 4QRPD 1DBAL 3MMEA 5E4EC 1TCRA 3OKYA 4HIXH 5J0BA 1RAMA 3TO2B 1A4JA 4ZYKB 2HRPH 3QDME 3JVGC 4OSUL 5HGBB 2WBJC 4XNXL 1ZLWK 4E0RB 5C0IA 1H3WM 1IBGH 2E9WA 3TA3D 2VWEC 2NY3D 4U1SA 3T09A 3O2VL 1ORQA 4R97B 3RZCD 2H26A 1FYHB 1T20B 3HPJA 1RUPL 5C0JB 4DGIH 1WBYB 2E7HA 3NCMA 4X6DE 4PV9B 3DUSB 3T2QA 4LLMA 2J5LC 1B0GA 4TUKH 1KPRB 4R7DA 4G80B 4ZUTA 1U8MB 1JPST 4TULL 4U3CA 5D70L 4MJIE 1IEAA 3ARED 3BW9B 3IDIB 2EICA 4G8GA 2AQ2A 1PEWA 4UNUA 4KMQA 5CKAA 4MAUH 1G7IA 5LBSH 2HJKB 1DANT 2D9QB 5C0GA 3W0WA 2R39A 3L5XH 2JIXD 1EPFA 4Y5VA 1G7HB 4WDIA 5C0RL 2AABL 3BH9B 1T1WB 4PP1D 2V9RA 4OCRL 3CSYA 3V0WH 3RWGA 3CFDA 5H2BA 3W11D 2LVCA 3QFJE 2HFTA 5C09A 3RX5A 3Q5OA 1QSEB 5BJTB 5CJOL 2X4QA 3MJ9L 2AI0L 2C7UA 5EN2B 4PB9L 4LSSL 4ZMAT 5L6YL 1FE8H 5FDWA 3FTGA 5C0BE 3VJ6B 3UC0H 3IVKB 4HKBB 5ETUA 4UTBH 5JW3L 1AHWC 3JWNC 4WEMB 3HE6A 3UTSD 2E6JA 3BWAA 4GT7A 4KXZI 5JUEH 4EVNB 2P48B 5IB4B 2X4RB 3EJYD 2XYCA 1CQYA 1MIMH 4RISL 5I1LA 1UQSB 4FFWC 3H9ZA 4K3GA 3MQIA 2ZJSH 3GSXA 2BDNH 3P0GB 3LN5A 3QO1A 2DOCA 3S36L 2XKNA 1VGEH 5DQDH 3AAZA 2ILLA 1BWMA 3RGHA 1CF8H 3V7MA 2ZUYA 3ARUA 3SOBH 3L3DA 1X6LA 2NY2C 4S2SA 4LL9A 3TV3L 4PJHA 2VLKB 1N7ML 4TUJB 3LIZL 1P4BH 4HIIA 2E9IA 5IGXL 3BEVA 2XZCH 3R06A 4WJ5A 4YXHL 3MREB 1FJ1B 2OJZL 2Z0BA 2JF1A 3WN5B 5EZIL 5EPMA 3BN3B 4RGNC 5HSFA 1KELL 4U1KA 5E1AB 3RZWA 3FQRA 5J12B 2DJ4A 5F7MC 1QFUH 1FVEA 2NY4D 4PJGA 5EBMB 1TJGH 2F53B 4HCRL 5LWYH 2A9NL 4R90L 5LGKA 3T0AA 4PIRF 5ACZB 1U8QB 2W0LA 2Z91B 2XTJE 1W0YT 5EU6D 3ARFD 1WC7A 3UYRH 3ZHKA 3EOTH 4OZHA 4A6YL 3RDTB 3H0TB 3QIWC 1B6UA 4ZFOB 7CGTA 4UQ2A 5DC9B 5DK3A 2B4CH 4KHXL 1LEKA 3MV01 4EIGB 2V2WA 1CFBA 3QCVL 2FATH 2PYED 3I6GA 2YZ8A 4D94A 4GMSL 4JO1H 4OGAD 4OLYH 4D9QE 3ZL4L 1D6VL 4RZCA 1ZVSB 1CDIA 5IW1A 5F3HA 5BV7H 3KWWA 3DRQB 3QEQE 1EK3A 4HIEA 4GXUM 3RPIA 3SKJH 5FYJE 2IH3A 2Z8SA 3VFOA 1F4YL 2ZPKL 3ULSA 1UM4H 1BIIB 1QSFB 2OXHA 4GRLA 2W0PA 4S1SH 2CUMA 3MODH 5ID1B 5DJCA 2MHAA 4WNQB 4JRXB 1Q72L 5JQHC 3E3QE 43C9B 3MLPA 1AY1H 1K6QL 4UB0H 1F8TL 4M48L 3UDWA 3HRPA 4M6MH 4JG0L 4UIKH 4HULB 5T3ZL 3RY6A 3QDJE 3D5OF 3BJ91 4LP4A 3WXWL 3HI5H 1Y6MR 1HHJA 3O4OB 4LSRL 2D4FA 4MX7A 1I75A 5ABDE 4X7EC 4JJ5B 2CIIA 5DT1H 1AQKL 4QGYA 1A2YB 3LN9A 5JNYB 4XCNA 2NX5D 4Z7WE 4PJ7F 2WIIB 3HI1A 2X1XR 5F72S 1RURL 4KJQC 1JGLL 5AYUH 1CBVL 4AEFA 3L9RA 1VPOL 4KAQL 2VISA 5LXGH 3O3BA 4M6NL 5IUSA 3OJDB 1KN4L 3QAZC 2DD8L 1ACZA 3VG9C 2DQFB 1F4XL 1PG7H 4X5XA 4PRBA 5MENE 4IIQA 4OGYH 3UPCA 2VDMH 5IFJB 2BCKA 3LDBB 5E2WL 3PWPB 4GKNA 3ZE1F 4PRAB 2D03L 1WZ1L 3WDJA 1P69B 4MAYB 4JFOA 1GAFL 3U4BH 3JWDH 4UNTA 2H45A 1NCBL 4OZIF 4NQDA 1OAZH 4C55A 5DRZB 2JJTA 3FT3A 1A5FH 1AP2B 2OTUB 3IS0X 3NZHL 3HFMH 3VWKC 4DGYH 1JGDA 1KTLB 3DROA 2HP4A 5C0AA 4NBYB 3QUKA 2I27N 4JREB 4LPWA 4ZNCD 3BFOA 4P2QA 3MFFB 3S8WA 1T7ZA 4U1GB 5HVHB 1EEYB 1XF3B 5CCKH 4K7PY 3LKSA 4JHBA 3FOMB 1A1MB 3F6LA 4XNUL 2VLJE 5B38B 3N9GL 3TO4C 4Q9RL 5J11B 3VDAA 1BWWA 3QDGB 2UY7A 3PV6A 4FTVE 3LEYL 2FSEB 4UDTA 4ORGA 5IEHA 1PSKH 1RZJH 4ONGH 4LLQB 4HFWA 1AGEB 3IDYC 1P6FA 3SDAD 3VXME 4JDZA 1P4LA 3BGFC 2ICWA 3BN9C 3QA3B 5GGVH 3H9YA 4AQOA 5FOJA 3C6LA 3QPXL 3HG1E 1T89C 4WUKL 4YHML 4N0CD 3LEVL 4PJBE 1C5CH 3C5ZC 3CMGA 2DLGA 3QHZL 4QRPE 3CJJA 3MBEC 4RAVB 1S7RB 1QFWL 1S78C 1A7PH 2G2RA 4OD2B 3TBYA 3FONA 5HHQB 4K71C 2PF6A 1AGBB 2CIKA 3VXRA 3RWHA 3OJVC 5FUZL 2E9JA 3ROLA 1S7QB 1YEJL 2IQAB 3I02A 3IXAB 4GKSB 2ARJQ 4X99B 3L3IA 1U42A 2VQ1B 2YUZA 3I6KA 2VQUA 4CDGC 4ALAL 2ICWJ 3KPTA 5DHYB 1U93A 4UOJA 4QNPE 2EDYA 2B0SH 1D5BB 2Z93A 4LKCB 1UZ8B 3SDCC 4HWBH 1EA9C 4PJ8B 1A6TB 1HHKB 1INDL 4JZOB 3MRLA 3V0AC 1I9EA 1FZJA 3NACH 2DQCL 5INCA 5TGBB 2W1NA 1Q9WB 3SJVE 1A4KA 1M7IA 3D3VB 2VNCA 4H8WH 2BNRA 2EIZA 3Q3GB 4XAWH 5HI3C 1WT5A 4Z78B 5C71A 3OGOE 3TT1L 1FN4A 4ESKA 4LK4A 2WANA 4U1LA 1H3UA 5L88H 4JO3L 3RUGF 3KPOA 4KROD 4ZUVA 1UVQB 3Q6FA 1SEQH 2QV2A 2QHRH 5KN5B 5TFSH 4QTHA 1F90L 4WI2A 4BKLA 1XGQA 3G5ZA 1A14L 3LKOB 4OM0L 5FF6A 5HPMA 1CLOL 3C5SA 3RTQB 4H1LG 1MQKL 4F15C 1ZXQA 4ERSL 1N3NB 4JM4H 3TIDB 1OGTA 3DX7B 4Z7UE 2QSTA 4N1HB 3GMMB 5F6IB 3LSOB 5EBWB 3MRFB 3VXSB 4HWBA 2MTPA 4YHYB 5C6PB 5J6HA 1QKZH 1YMHB 3GGWA 2IFFL 3CSPA 4UTAH 3Q5TA 5HYJB 1B0RA 5JDJA 2A83B 1L7TH 1QSFD 1RQ5A 1G7PB 4ZS6C 3TZVA 1O5DT 3PWVB 4OZFH 5DFVD 4I2XB 1SEBA 4P99A 5CILH 2C3HA 2BSTB 5JIKA 3CLFH 4HC1H 1LO0L 1YDPA 5DK2B 4JRXD 1K8DA 4PGZA 3OKMA 4Y16C 2DKSA 5D7LD 3QEGH 1PX4A 2VLRD 4YH6A 1Q9KA 4BELD 1EFXB 1CG9A 1BQHG 3T4YA 2X1QA 1G7MB 4U2YA 3PDOA 3B9KD 2YA2A 4A6YB 4AT6B 5HHXH 1WBZB 1JNHB 3IDXH 3P9MA 1YYLH 2BNUB 1G1YA 2PXYA 4XHJD 1MAML 1NEZG 1QYGH 1QHOA 1SJXA 5EBLB 2P1YA 4JZNB 4L4TB 4CADB 5CGTA 4HIXL 5E9DE 2EE9A 1AFVH 3IRPX 2YD2A 3TCLB 4KJWD 5C1MB 1DBKH 1F45A 2B39A 4IOSD 3U7WH 4M3KB 4HUUB 4OZFA 5I2IA 1I7ZB 2GJ6B 2XZAH 4MCZB 4HIHA 1CGWA 1HZHH 4RSVA 1CFSB 3V6OE 4FMFA 4DCQA 4HC1A 4G7YL 4PREB 4EDXB 3VMNA 1ZMYA 2ADIA 2OK0H 4HF5H 3DHJA 4MD5B 2PYEE 4Y8AA 4JFXB 2I9TB 3UTQA 2CRZA 3NBNA 2BSRB 4I9WD 5BXFA 3S96A 5HD8D 4RCAA 1RZ8A 4LGRB 3VFNB 4LRIC 4JKWA 1MCCA 1M05A 4Y19A 2H41A 2H2SD 4MAUL 1MLCB 5LBSL 1NSNL 1TTGA 3L5XL 1I1AB 5J9PA 5ISZE 4ELME 4HT1H 1MLBA 2CLRA 3UJTH 1HSAA 5DI8A 1IZJA 2GK0A 1X5ZA 3V0WL 4WFED 4JY4B 1JGUH 2EIDA 4FQ1L 3RWEB 3O9WB 2EXYC 5KG9A 5E8EA 4FABH 3R0MA 4KUCD 1NH6A 3O45B 4UDUA 2EDQA 1AJ7H 3U48A 2Z31D 1K8IB 3V52H 4QXWA 4UTBL 4ORZC 4WY7H 1WEJH 1A6WH 2RCSH 5JOEA 5JUEL 2GFBB 4JG1L 5HVFB 3QUMH 2GHWB 4LEXH 4G6MH 4UT7H 1FORL 5HYQB 4OT1H 1GC1C 2EKSA 4PJXA 1SYSB 1JK8B 1ORSA 2PW2B 3QISA 1HK6A 5I6XC 3DI3B 4PJFB 4WUUB 5GGQH 2NX5E 3IFOA 3PGDB 5DQDL 4X98B 3RL2B 3O6LH 1CF8L 4GSDL 2R0WH 2R69H 4CW1A 3G6JB 3SOBL 3GSVA 2DQUH 3BQUA 1R3LB 3U0WH 4LQFH 4G7VH 2DWEA 4NKOB 4YLQT 2WSKA 2QSQA 5D1ZA 2VDQL 2DMBA 4TNVF 2BJMH 1I9JH 1U3YA 2XZCL 4OF8A 2W0FB 5FGBC 3D18B 1EEZB 2D7MA 4RFEA 1QFPA 5EU7C 2RFXA 1ZEAH 5SV4A 3CH1B 3D2UB 3B3IB 2DIBA 4PJCB 3GBNH 1HHGA 3L3GB 3U2SA 3BKJH 1X6NA 1HN1A 4QRSA 5DS8A 5GGUB 4HJGA 4F33A 4DAGL 2QL1A 2FB4L 3WHXB 4Y0GA 3MGAA 4OZGA 4LPTA 4S1DD 4AIZA 4JM2B 2AXFB 4CMHC 3PV7A 1M7DB 1HQ4B 5TH2A 4FQIH 3WD5H 1I8IA 2VLMD 4PJDE 1C08A 3AS1A 5CGYC 4P9ML 5I73C 4U6HA 3VFWB 3VFMB 1T0NA 4NNYA 2B4CL 4F7MB 1QSEE 3HLAB 5HYSG 4RNRB 3CXDL 2WLZA 5GJTH 2ZCLL 2ATKB 4DKAA 3EFFB 1KJ3L 4JO1L 3CK0L 4FZ8L 1CGTA 1ZA6A 1TCMA 2EYTB 1WISA 4YGVA 1XF5A 5IESH 1DQDL 5EZJB 5ALCL 1MRCH 5ECJE 4HV8A 1N6VA 3ARGA 1NMCB 3H7BA 3ZKMC 3DTXB 3H9SD 4X4ME 4HPYH 4H1LA 1UFUA 5BOPA 5T1KA 4S1SL 3MODL 3JBG7 1EXUB 4V1DD 5T1DH 5ACLA 4QXTA 4O2CB 1NCNA 5JQ6L 1I3RA 2NY5C 3QFDB 3HCVB 1YMMA 4UB0L 5B39B 4P5TA 4FP8H 1QFOA 5T3XL 4DZBA 1RHFA 1RK0B 2F8VA 4MSWA 5IG7B 4M6ML 5F21B 2FIKB 3I9GL 4Z6AT 4OFIA 4RIRA 2CO6B 1EFXD 2P24B 3OKEB 3DXAB 5IHLB 5I71C 3MRQA 1QQDB 4P4KC 3FZUC 5I1KH 2EDJA 1FNSH 1XGUA 2LU3A 4AK1A 5HHMD 1JNLL 5DMJB 2CSPA 3TEUA 4EN3C 1BQHA 5CLTA 4PY8I 5EU4B 2DMKA 1UG9A 4F7TA 3P30L 2F53E 3BRGC 3LPFA 5CSZB 2VKWA 1R24A 3PWLA 2FECI 4GKZB 1BD2A 1TCRB 4QT5B 1U9KA 2YSSB 1D5XA 1MHHA 3GMPA 3G5YA 5C0IB 1IC5L 1NC2A 4K8RC 4NNPL 3UAJC 2QQNH 4XCCL 5F7FA 3RL1B 3TFKD 5LGJA 2VDML 2FDBP 1QEWB 4G9DB 4U1SB 5GRZA 5BMFH 5MI0C 2GT9B 4X5WB 2XT1B 3FQTA 3WXVL 4YAQA 1GGCH 3U4BL 1B3JA 1OLZA 2JLLA 3DPBA 5DJ2B 1OAZL 5IVZA 5GXBB 1A5FL 1KCRH 3W5MA 1MJJA 4XGZB 3OR6A 3RGVB 5C0DB 5IIEB 2FJFA 2E6PA 3ZKQD 4F37K 3QPQD 4WW2A 2AEQL 5J13B 5F9OL 4Y2DD 4QHKJ 4EDWH 4KKAD 3KLSA 2R0LL 1JNJA 4QXGL 5T3ZD 1MCKA 2ZNXA 3JV0A 1SJHB 1I4FB 3GBLA 3NFNB 1QSFE 1FNLA 3W0WB 3AU1B 2BMKB 5TQ0L 3CCHA 4OQ1A 3DETC 2ATPA 5DF0A 2HT3C 1HWGB 4AEHL 2CUIA 4JRXE 1RJZA 2AEPH 1DP0A 5D7LE 3CFDB 5C7XL 2UY6A 2VLRE 3EBAA 2DRUA 5B22A 2X70A 4HWZA 3KYMB 1IARB 2NY7H 4JJHA 1EO8H 2A6IB 2J2ZA 4DW2H 1X5JA 4G6KH 4O4YH 4M6OL 1IGYA 1ACYL 2C3XA 3FFCB 1T83C 1GCFA 4F57L 3VE0A 1C5CL 1MFCH 3LEXA 1D3CA 5E5UB 1UWGL 2WINA 5DQ9A 3VXNA 1A7PL 2W91A 1VFBB 4WUUD 1N59B 5E08L 4U1MA 1YNKH 2AK4A 1WFUA 3GSXB 3TT3L 2OJEA 2P4AB 4Z7QE 1ND0A 1H5BC 5JXAH 1Q1JH 5C9KA 1QRNB 1KJ2L 1N6QL 4BFBD 3WFCL 2HTLC 5DUPL 4LSTL 3QUYB 5IHUL 3L3OB 3QUZC 3GSWA 3CPLB 4IOIA 1J05A 4D2NA 3NZ8A 3VXPB 4S2SB 3CFKB 1T21A 4PJHB 4TVPE 4WI5A 2D31B 3NMEA 4Z77A 5GRVL 1BGXH 5DRNB 2B0SL 2AJSH 3PWPE 3ZZ1A 2VZTA 1UWXH 3TPUB 1XF4A 4I9WE 4YEEA 3NACL 4AL8H 2F5BH 4XC3L 5IK3A 1YEKL 5EOCJ 4NZJA 5DJ8A 4QY8B 1J0KA 4U1IA 4U1KB 5DUBA 4XAWL 5TF1H 1AXSB 5IBTH 4HXBH 2VZUA 4K3JL 2K3TA 2CUHA 2UZIL 5L88L 2HRLA 2I9LB 2VIRA 1NGYB 4PJIE 3QWRA 1Q9LA 1K2DB 3MUZ1 1SQ2N 3EHBC 4L3CB 5TFSL 4JM2D 4WFEE 5FO8A 4R8WH 1SBSL 4NHUA 3KPSA 1R3JB 1WAAA 3MRDA 5D1QB 4LMQI 1EVTC 4OZHB 1YUHB 5ICXA 3QDGE 3F7VB 3TVMA 4DQOL 4N8VG 2YD3A 2WBKA 4L8BB 3I3BA 5J57B 3MRKA 4Y4KC 4YFLF 3MLSL 4IRSC 5DD3L 2IBZY 1JHKL 1VADA 3S37L 2NNAA 4M43H 1OGAA 4U6TA 2DM7A 1CR9L 2JCCA 5D7IF 1ES0A 3WL9B 4HBCH 3V4PH 3VXUA 1Z9LA 3CZJA 5FYKH 4OBRA 1ED3A 1QLEH 1QKZL 3O0RH 5HYSA 2M2DA 5F3HB 2N7AA 3KWWB 5EORL 3MGTB 2X1PA 2I07A 4LU5H 5HI4C 2A74B 1BX2A 4PR5A 5DMYA 4PJFF 4ZSOA 8FABB 2AW2A 2KL6A 5CILL 3U36B 1TQBC 3TBWA 1XR8A 3MNVA 1FNEA 2J8UB 4YHIA 2NZIA 4I5BB 2Y5TB 3ARQA 4FQ2H 5DJCB 2MHAB 2EE2A 3WO4C 4D8PB 1JWMA 4ODBD 2V17L 2KKQA 2J3SA 1UZ6F 3B2VL 4HWEH 3EAKA 3TBTA 4LPXA 2WWMC 1NFIB 3MRPA 4ENED 4NYLA 3DXAD 1P84K 4L5FH 2W38A 4NZUH 5B21A 5BRZA 3SBWC 3BESR 1YYLL 3MCG1 2DIJA 3F7PC 4H5SA 5KW9H 2EKJA 4QHKI 3C2AL 2WBWB 4WU5B 1T89A 1QYGL 2EYSA 4U6XB 1KJVB 5FK9A 3OSKA 5IMMB 3TN0A 2HYMA 4I1NB 5D2NE 3FO0H 2CDGB 5BV7B 1JGEB 4IRJB 4L4VD 1DEEA 5JW4N 5IMLB 3IF1B 3MACL 2FO4B 4R0LC 3PDDA 1HZHL 3NN8A 3QG7H 2VISB 4DKEH 4I0PC 3O3BB 3IRZA 4HZLA 1NFDA 2GITB 4UI2A 2DBLH 1FFPB 4ELKA 5EZLA 4X5XB 3U0PB 5GPRA 3L3JA 1BP3B 1CVRA 1T04B 1ZT7A 3AY4A 4XRCB 2BCKB 1Y6NR 3QIBA 4GKNB 5JXEC 3GMLB 5B4MC 4GG8A 3DI2B 1DL7L 1VHPA 5F3BA 2GSIA 4NQDB 3WFHB 1IMHC 5I30H 3VXSE 1CDBA 4HT1L 3H9SE 1JUFA 2YRPA 5BS0D 3UJTL 5JIPA 4K3HA 2X4PB 4NM4H 4RMVA 1MHCA 4X0KB 1NC4A 1OPGH 3MLTB 3DROB 1XCTA 4G8FB 1BBJA 4L3EA 3HE7B 4V1DE 1JGUL 1PVHA 3CZFA 5IVXE 4I2XE 3BT2L 2F74B 5EC2A 1FNFA 4CVWA 4Y4FA 4FABL 3O2DH 1OSZA 5JTWA 4X4YA 1TVDA 4YBLC 2EH8L 5D7SH 4WY7L 1GOFA 3BE1H 1WEJL 3FCTA 4W68A 3QQ3A 3V6FA 3T0EB 4ZFGL 1IGJA 4GO6B 4X7FC 5C6TL 3QUML 3IGAA 4LEXL 1GGIH 1UC6A 1D9KC 4OT1L 3UO1H 1ZHLB 4JDZB 4EBQH 3TA3C 1U3ZA 3UTPE 2NY3C 3FFCD 5HHME 5GGQL 1EAPB 4OF7A 3DIFA 3RZCC 2QHLA 2A77H 3CX2A 5CEZH 5E70A 3PP4L 2XN9A 3Q0HA 1FLTX 4L4TE 5L0QC 4J8RB 5AG8A 1I85A 3IAPA 5IJVB 2R0WL 2R69L 4I3GA 5D7KD 4N0FA 3U0WL 4XNQB 5HHVL 3S36X 1R5WB 2ITDA 4XH2A 4G7VL 1OD9A 3FONB 1HH9B 1QRND 3QEHB 4PD4K 3L1OH 5FGCB 3MO1B 1S3KL 4E41D 2EECA 4Y16A 1AR2A 3RAJH 3QUYD 5CHNA 2BJML 5KVMC 4E9LA 3VXRB 5FECA 1J18A 3O2DA 3VH8G 1JBJA 1MCEA 2XQYK 1U58A 5TE4H 2Z9TA 4KTDH 1TJHH 3I6KB 3CVHA 4QTIL 2PTTA 3R8QA 3WIHL 4PP1C 2COQA 3GBNL 5HPOA 2VXSL 2K7PA 3BKJL 2Z93B 3L7FA 4N9GB 4XPFH 1KEGH 2OX5A 1XH3B 2AXGB 3LZFH 3HUJE 3UTZA 5F96H 3VFTA 5T3ZE 5INCB 1WFTA 1YEFL 3JV6A 3U30B 4HZAA 1UXSA 5TDOB 4YHOH 4FQIL 3TH4T 3O6FC 2WQRA 2ZSWA 5H37G 3EJYC 4ZAKC 4Z0BL 1RU9L 2EDTA 4DVBA 4GW1A 2CLVA 3L5HA 1WBXB 4QTHB 5D1QD 5DR5L 5HGAB 5HYEA 5GJTL 4FMKA 4BKLB 3D69B 5EZOL 1XGQB 3G5ZB 5AUMA 4QRTB 2DTML 3RVVD 3FB6B 2BFVH 1BJ1J 2FHFA 3VWJA 4JFEA 5FF6B 3RX7A 5HPMB 1JYXA 2OZ4L 3C5SB 5JLZB 3IAGC 2A38A 3CXHJ 4JLRA 4RMRA 5KVEL 4YNYA 2VC2L 1FQ9C 4LRIA 5EU5B 5LGHH 1OD7A 3PGFH 3JTSB 4H26A 1C7SA 3L5WA 4N8VA 5HDBE 4YX2L 2EH7H 5EUOB 4HPYL 4PGDA 4WUUE 1CU4H 5J6HB 1CFNB 3GGWB 1S9XA 3S3SA 4Y4HB 3ZTJG 3ZSSA 5K59F 1RUKH 2F19H 1AI1H 3KPRB 3IJYA 5GGVY 3NIGF 3R4DA 1WJ3A 2DKUA 5FOBA 3CFEA 2IPTH 2PKDA 3RVXD 3DRTB 5KSVB 3G6JE 1CD9B 4FP8L 1RVFL 5FV1L 3BZ4B 4MHHI 1R3KB 4PV8A 4EJ1C 2G5BA 4XPAH 1G7QB 4NRZA 3H3PH 1YDPB 2NY4C 4OLVH 3OKMB 1INEH 4XXDA 1FO0L 2A1WL 1P5VA 3QJFB 4PJHF 4DUVA 5I1KL 3HNVH 4DVRL 4UINH 1FNSL 2X09A 3QCUH 1U95A 3ARFC 3THML 1NDMB 1DTUA 4HG4J 5D93B 3IJSA 2EC9T 4PJCE 4WW1A 3P9MB 3M8OH 3SGJA 4X6CE 2PXYB 4GBXB 4CVXA 4AENB 5EO9B 3OWEA 4Y1AA 3I50H 1U8PA 3DMMD 4Y88A 1R5IA 2NZ9C 3BKYL 3QXAA 1C1EL 3S34H 4IRJD 1V7MH 5DWUH 4PJGF 3K1KC 5IV2B 4TOYH 2A6KA 3KPQA 4ONFH 1J0ZA 3CMOH 1E4WL 2G60L 1IC4L 2BHUA 1E28B 2CGRH 4OZFB 4AEIL 2FWOA 4MA1C 4HKZA 4JAMB 1GGCL 3QHFH 3QI9A 4XCFH 2DWDA 4KI5F 4PRHB 2A73B 3UBXB 1XZ0A 4YDIL 3KPMA 5IR1A 4F7EA 2P8MB 5T3XD 1NGQL 3WEXA 4X9BA 1MUJA 5DJAB 4CJ0A 5BXFB 4XVTL 5SWSD 1EMTH 3CFJA 5FYJU 3OX8A 1M05B 3MV8A 3M17A 1OARH 1V7NL 3P73B 2NY5H 5KSAB 4U1JA 5J9PB 3AXLB 2CMRL 1MLBB 4UILH 1PGRB 3HE7D 1FDLL 1QBAA 3QQ4A 3S35X 4PJ9A 2AEPL 4ZXBB 1CFTB 3MV9A 4K9EC 1MCIA 1FV1A 2P49B 4ZUWA 1N0XL 4P2OB 1FL3A 43CAA 2RHEA 2PR4L 5E8EB 2NY7L 5GGTA 1EO8L 3WE6A 4NKIL 5TJWK 1W72A 1TJIH 3T0ED 3DXAE 1UKTA 3JTTB 4G6KL 32C2B 4O4YL 2BK8A 2F8XC 2ZOLB 2NXZD 3V6ZA 5FCUH 4TSCH 4LSPH 5F88B 1MFCL 5DZOA 3MCLH 3PWJA 5C08A 5DZNA 3CD4A 1CT8A 2IANA 2EKSB 1UYWH 1JWSA 2DQGL 2C4FU 1ORSB 4OI7A 1YNKL 4BSWA 2YEZA 1LE9A 2APXA 5JXAL 1F02I 2FJHB 4OCLC 1S9VA 4L9LC 1Q1JL 1ZLSH 5DLMH 4ODWB 4FFVD 3CDGA 4K8RH 4XMKH 4FOMA 3QBTB 3KYOA 1HSBB 3SDYL 4M62H 1DR9A 1OWWA 3PNWA 1UM5L 5SWQA 1KTDA 1ITBB 3GSVB 3BQUB 4HHAB 2KQMA 2DWEB 5I1GH 3EYVA 2NW2A 3HC0B 3PHOA 2CLZA 3ZDZE 4PJ5B 1I9RH 2N7BA 1IQDA 5FA4A 3QDMA 2QQLL 2AKRA 3L6FB 2F5BL 4NHCH 5BVJB 4MS8C 1T1ZB 3VH8A 2GCYB 2QTEA 5GZND 5IBTL 3QUMB 1OL0A 4NO5A 1IL1B 4MDIA 3U2SB 4IRZH 2HLFC 4QRSB 5HBBA 1T5XA 3U7YL 4X6DA 1LEGA 1BOGA 3ARDC 5TDPB 1KG0A 4Y5YC 1FYTD 1ZA3B 4MJIA 4XCEA 5ESAA 2XWJB 2ZUWA 3C5JA 3SCMD 2F8OA 2R0KH 2XNAB 5E2TL 1MWAH 1RMFL 3L3KA 3R8BB 1I7TB 4EXPX 4U6HB 3EO9L 4LBEA 1T0NB 4NNYB 4V2BA 1Q0YH 1WCBB 2ZUQC 5DD6B 4GXVH 4JKPL 2LTQC 4M43L 3GUTB 1U8NB 5DHVH 4HBCL 1JNNH 2J5LB 1PZUB 1ZA6B 5FYKL 4Z7VE 1QLEL 3C60C 3QFJA 3FFCE 5GRWA 4YGVB 3GSNH 1KIQA 1XF5B 3PABA 3WNLA 3KXFB 1BVKB 3QNZA 4UAOC 4HV8B 4M4RA 2DM4A 5F9AC 1YZZA 4YIQB 3OKDB 3VD3A 3RA7H 4C56B 3H7BB 4LCWD 3VGGA 5C0BA 2EDHA 4EZMA 1SYVA 1NANH 5DJZB 1LWRA 3NAAH 3G6AA 1JRHI 1AGDA 3BRDA 5D7KE 3MYJB 4FQ2L 4WTWA 1JWUB 1V3KA 1QRNE 2QADD 4PRDA 2FZ3A 5HGDB 1KCSH 1NAML 4X83A 5CWSA 1X5LA 4WRLA 1R3IH 3FT2A 3EW3B 4L5FL 5KVFL 3W9EB 4HKXA 1U8OA 1XIWC 4JFFD 2YUXA 3ZTNH 1KF9B 1JPGA 4KROC 3CGTA 1A7QL 5D1XD 4EXKA 4G6FB 1NBZA 1T83A 5DHVA 3KVQA 3GI9L 3M07A 1DQTA 2Q86A 3FO0L 3GSUB 3K2UL 1PKOA 4GBXD 4NWUH 4KDTA 5AAWA 4KQ3H 4F7TB 5CZKA 1H5BA 5IQ9A 4FQPA 4Q0XH 3FO1A 3QG7L 4MQSB 2BZDA 4DKEL 4J3SA 3VFRB 2CJUH 3PL6A 3C8KA 1D5XB 4M00A 2DBLL 4LPUA 4LDEB 3SKUD 2X10A 4U1NB 3KPNA 4ZOAA 3MRIB 1NC2B 4ZUUA 4JQVC 1CFVL 4K07A 5KS9B 5LQBL 1G7JA 4NQCD 5IB2B 1RZIB 4YAQB 4YFDB 5LAXA 5DFVC 3LRSA 1WITA 1ZHBA 1F3DJ 1S9YA 1EEQA 4X7SH 4EI5A 4RGNB 1MJJB 5I16A 2DQIH 3HNSH 2FJFB 4GAGH 3DSFH 5I74C 4NM4L 3FB8B 5FFLA 3RNKA 1QBMH 1K9TA 4LCIH 1OTTC 1BFSA 2ZUSA 3RIFK 1TZIB 3B9KC 3HR5A 5EOTB 3ZE0F 2J8UE 3QEQA 3CCHB 1P5UA 5LCVL 4I77L 3ISWA 2ICCA 3H7LA 1MJUH 3WV0A 4X7DC 2Y72A 3QIWB 1MF2L 4P2OD 2DQEH 3D0LB 4C59B 2IAMA 3RJQB 3L3HB 4KJWC 2P47B 4WFHD 1GGIL 4HWZB 3UO1L 1FZKA 3QXUA 1L7IH 2Z35A 3TNMA 5D72L 4M9PA 5ICZA 3FAWA 2A77L 4P49A 2AAVA 3U0TB 1KULA 1OTSD 2YK1H 3VE0B 4KWUA 3ULVL 4M7ZC 2CDFA 4NO3B 3GSOA 3LV3A 3TJEH 2NYYD 2Y23A 1OB1A 2AJZA 4IEFB 1YPZB 4OLUH 3OHXB 1L0QA 2JELH 3N1QC 3QDJA 5KVDH 4MJ5A 5HD8C 3EJZD 2OSLA 4ISVB 1YEIH 3RAJL 2GJZB 1U3HD 5T5FL 4U31A 5E24E 1FNGB 4JCMA 2AJ3A 1I9IL 1D7FA 2FCBA 5TE4L 5IOPA 3GSWB 4LVEA 3EGSB 4IOIB 1HHHA 1J05B 4HW6A 4Z7WA 3ULUC 1ULVA 3FB5B 3P77B 4X8JB 1J8HA 1T21B 4PJ5D 4P23A 5D7JC 1KIRA 5FA3B 4FQCL 5T3XE 1A6PA 5B3NA 4FQLH 1HI6B 2RB8A 5E56A 1KEGL 1X5HA 1U8HA 4KRPD 4JFQA 4B50A 2J1KA 5MENA 4HWUA 5F96L 4AYFA 3O41A 5DJ8B 1KPVA 3RI5K 5DUBB 2Z31C 4YHOL 3PXHA 2AJVL 4JQIL 4UV7L 1SBBA 1YEDA 2YPKA 4KZEL 1B2WL 2VIRB 2PO6D 3EYFA 1S7XB 3UZEA 4TTGA 2NY6C 3DARA 3BIAX 2WBJD 2C3VA 4HGKC 4J7RA 4Q6IC 5D6CA 4R26L 4D9LH 2FX7L 5I1AA 5FO8B 4YHKH 3STLB 1TMCB 3TLRA 4NHUB 4N0YL 3VG9B 3ZSTA 3MRDB 4XMPL 1YC7A 3OAZK 4PY7A 1T22B 1GC1L 4OIBA 3T0EE 2DL9A 1TNNA 2AV7A 5JXEA 4WHYG 4NZTL 3IETB 1ZVHA 1FVCB 1VACA 5J56B 2Z92A 3PGFL 5LGHL 3K4DA 2VLJA 3D1MC 1M71A 2EH7L 2JCCB 4YR6A 1U0QA 1ES0B 4LSDA 2O93L 4RMTA 3VXUB 4Q2ZA 5F71A 4FTVA 3KXFD 2A2QT 1JN6B 3MOBL 3VWKB 3N1FC 2ADJA 4IOFD 3CFCL 1RUKL 1B9ZA 2F19L 1AI1L 1MOEA 4PJXF 3VXMA 3FMGH 5DVLA 4JFHD 4PGBA 4PR5B 2FLBT 2IPTL 2OR9H 4ZSOB 5C8JA 2CRIA 2VABB 1Z5LA 3HG1A 4MQ7B 5F93C 2WMPA 1XR8B 3MNVB 1BFVL 3H3PL 5FGCE 5IKCA 4OLVL 3RVWC 5D5MB 5F7NC 1NJ9B 4PJBA 4MD0B 1GRWA 1WWBX 3H8NA 4JPWH 3TO4B 4QRPA 5CS7A 4G9FB 1S9WB 5D2NC 1HXMA 1IKFL 1FG9C 3HNVL 4MXQC 4S1DC 4UINL 5I9QC 5IFHH 3QCUL 1KBGH 2XFXA 3MRPB 3IDYB 4OFYD 3TA3A 3BGFB 2XXMB 5DJDB 3M8OL 3U83A 5HVGB 1HNGA 3DV4A 3QJHA 2E7LA 4FFZH 4C57C 1EHXA 4NRXB 3C09C 4O5LH 5IROA 4R6UA 1HEZA 4P2CG 3S34L 1BF8A 2MQ0A 3TN0B 1UKQA 1SMOA 4W6WB 3Q2CA 3BMWA 4TOYL 4ONFL 1FYTE 3PQYD 2CXGA 4K71B 5CJQH 3AREA 1WFNA 4OZGF 3T1FA 4NC2B 3JV4A 3S6CA 2HJFB 5KJRH 2AQ1A 3QXVA 3D0VB 3QHFL 2NY2D 5GHWL 1HCVA 3SJVA 2VH5H 4HUNB 2KH2B 4XCFL 4HZLB 5CMAA 3VFVA 1OAYH 5ILTL 4FQHA 1FGVL 2JIXA 3IJHA 3MXVL 1TVHA 2M26A 2ED9A 1EZVY 4WWKC 1G6VK 1GZPA 4NGHH 1J12A 1ZT7B 4QYOB 1YEEL 4KV5F 1IM9B 1NAMB 5F6HI 3SDCB 1EMTL 3GIVB 3DX9B 3PDGA 4KK8D 3UPAA 5L7XL 1TQCC 1HH6A 4XBEL 3V5DA 3VD4A 2ED8A 5INDA 1EBPA 2VQTA 5DO2D 5MEOB 5EUOE 4FFYL 4LCWE 1AGCB 2YPVH 1YNTB 1C5BL 5IB1B 4WO4D 2R2CA 3U4EB 5E5RB 3KPRE 2ADGA 5FHBH 1XCTB 1LDPH 4P4RA 3UZVB 4MWFB 4M93C 5EC2B 3ZHLA 4HKJB 1KPUA 1FVDA 4ETYA 4CMMA 1RK1B 1P1ZA 3WLWC 1UWXK 3QIWD 1WICA 1DVFD 1EGJH 2PYFB 4BQBA 1XGRB 4JFFE 3FCTB 5JDSA 3C8HA 4HUWB 1P7KB 4TSCL 4JY5L 1IGJB 5TE6L 1MPAH 3ALXA 4P2RB 4P59L 1RZGB 4OCYL 3I6LD 4U33A 3TFKC 4BZ1H 3V5HB 2VDKH 4JFDD 2QSCH 1N4XH 1O0VA 3DIFB 4LLWA 1I1YA 4LGSB 5DLML 4K8RL 4IS6B 4XMKL 2H9GA 4NJ9L 4WCYH 4M62L 2Q8AH 1S5IL 1UGNA 5KBNC 1JI1A 2BVOB 4QRRB 5L2KD 2DLIA 1W0VA 5I18H 3MROA 1HOCA 2XKUA 3QPQC 2DLFH 5GS1C 3V5KA 4Y2DC 5I1GL 3X3GH 3U9UB 1UEYA 3NCCB 4Y16B 3IKKA 4WFGE 2XWBA 3MOQA 5E9DA 4IDJH 1I9RL 4JO4H 3MUGB 3P4OB 3MXWH 2HMID 4PRHE 1LP9E 2D7TL