1WIVA

Solution structure of rsgi ruh-023, a uba domain from arabidopsis cdna
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
73
structure length
73
Chain Sequence
b'GSSGSSGLLSHMDDPDIDAPISHQTSDIDQSSVDTLLSFGFAEDVARKALKASGGDIEKATDWVFNNSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ubiquitin-specific protease 14
publication title solution structure of RSGI RUH-023, a UBA domain from Arabidopsis cDNA
rcsb
source organism Arabidopsis thaliana
molecule tags Structural genomics, unknown function
total genus 11
structure length 73
sequence length 73
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2004-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00627 UBA UBA/TS-N domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 1wivA00
1E94E 3FE3A 3K9PA 4R71A 2JZ1A 2MJ5B 2QHOB 2O25A 3FRHA 1MN3A 2OO9A 4WP2A 5JI2E 1CUKA 2DI0A 2EKKA 4UN2B 1OTRA 2KNAA 3LCVB 2JY6B 2MR9A 4DBGB 1ZV1A 2LVOC 2QSFX 1G4AE 1R4GA 4G3OA 1AIPC 1YLAA 3GLFE 2JUJA 1NV8A 2ZTCA 3K9OA 2B3TA 2QNJA 2LVNC 2KHHA 4F2LA 1VEJA 2JP7A 1DO2A 1ZMVA 3B89A 1TTEA 1XB2B 1DV0A 1SG9A 2LVQD 1WIVA 1T43A 1IM2A 3FRIA 1WJ7A 1KYIA 2DZLA 2OOBA 2KNZA 1IFYA 1WGLA 1VEKA 3F92A 1WGNA 1T6OA 1HT1E 1TR8A 2JZ0A 2L4EA 3GLGE 1P3QQ 3MMPA 2DAIA 2OOAA 4HEOA 1JR3E 2DENA 2JY8A 2LVAA 2JY5A 2MROB 2BWEA 2H5XA 3BBZA 2KNVA 2WZJA 1BVSA 1ZMWA 2CP8A 2RRUA 2DAGA 1Y8GA 2DKLA 2L4FA 1QZEA 2HAKA 1UFZA 2G3QA 2DAMA 2MGWA 1G3IA 3GLIE 2L2DA 1Q02A 1GO5A 1IXSA 2JNHA 3T6PA 1A5TA 2DNAA 1HJPA 3GLHE 2EKFA 4F1IA 1VG5A 1OKSA 2EJSA 1V92A 3E21A 2DAKA 1G41A 1EFUB 1HQYE 5DFLA 3IHPA 2HWJA 2K0BX 3E46A 3IECA 3H4JA 1PGYA 2DHYA 2JY7A 2LTUA 4GEWA 1XXHE 2BWBA 1VEGA 2CWBA 1OQYA 2ZTDA 1OAIA 1ZMUA 2K9DA 1HT2E 2DAEA 3LCUA 1DO0A 1F4IA 1VQ1A 1WHCA 1VDLA 2LBCA 2LVPC 4Q7JA 1C7YA 2R0IA 1WR1B 1NV9A
chains in the Genus database with same CATH superfamily
3K9PA 4LGYA 1L8QA 1XNQM 2JZ1A 2D7GA 2MJ5B 3LVVA 2QHOB 1R7RA 3FYDA 2H1RA 5EP3A 4B08A 1E9SA 1PJSA 3FRHA 3SAUA 3VDPA 4W5WA 1CUKA 2LHGA 2X4AA 3A98B 2EKKA 4QHSA 3T1HM 1OIZA 2ZM6M 3LQQA 3UGJA 1OTRA 5ITXE 2KNAA 2VQEM 3HJQA 1Z5CA 3GLIA 4P16A 3KP0E 4DR5M 4GHAA 2QSFX 2EO2A 1EIJA 2DWLA 4MGYE 1HNXM 1HR0M 3FTCA 4REZA 4G3OA 5KPZA 1L2CA 1IBKM 5EQTA 3U60A 3PNVA 1V34A 1NV8A 1Q3BA 2LNHC 3GLHA 4NSOB 4G4NA 5GKNA 3VK8A 2R62A 4OU7A 4HL4A 3BOSA 2KHHA 3QYBA 1HNWM 4DV7M 1HQCA 1WXQA 4B3MM 3CF6E 2BNKA 4DV0M 4DR7M 1XXHB 1XB2B 2RGHA 2KZSA 3HY5A 5DYGA 5FSWA 2LVQD 1WIVA 1IN4A 4IBEA 1TDHA 3U6OA 3U5ZB 2F5NA 4QHTA 1XWIA 4JV5M 3UZUA 4IIWA 3T1YM 1KFVA 4YY3M 5KQ8A 2ZAMA 1VDDA 1OFHA 3LW5F 3GPYA 3HHXA 4DV5M 4JI4M 4B3SM 2F4VM 3MMPA 4GC5A 4M9SA 3D8BA 2OOAA 1TF0B 4JI0M 1T3TA 4RNAA 2R46A 3THGA 2DENA 3HJSA 2MROB 3DA1A 1NO1A 5BPVA 3BBZA 1PM5A 3KOXE 3GQ3A 3CGWA 2WZJA 1BVSA 1TH2A 2FNAA 1N34M 2KRUA 4GC9A 2DZOB 4QNRA 3VDUA 1IBMM 2CP8A 3U61A 3OTOM 2DKLA 3AOEA 3AOGA 1N78A 1NVMA 4AI6A 2EUCA 4IBCA 4KO8A 3J81S 3AFHA 1G3IA 3NWLA 5A2QS 2D7HA 1IXSB 3ZCBB 4LF9M 1Q02A 3GLFB 3GRRA 4G6ZA 3SMPA 1Z5AA 1GO5A 2P5TA 3I01M 3KFUG 4KHPM 2CHQA 4LFAM 3L26A 4PCZA 2RGOA 1A5TA 3T6PA 1MX0A 4FW9A 1HNZM 2F5OA 4JI1M 3FTDA 3CF0A 3HJ8A 3L25A 4AKHA 3U6MA 3E21A 1J5EM 2VIIA 1EFUB 1G41A 3CTWB 4OVZA 4NRWA 4DR6M 3I4VA 1PJTA 2XSZD 3C3DA 3FKEA 4NSRA 3TL4X 1QAMA 3EIEA 4DV1M 1QDRA 4AKIA 1PGYA 1N77A 4MGZE 2CV0A 3HU3A 1GKIA 3KW6A 1XXHE 3W0FA 1K82A 4QNMA 2JWSA 4KLNA 3AV0A 1IXRC 1SXJD 2FOIC 4GKJM 2K9DA 4ITQA 3LCUA 2DAEA 2BJWA 5L8RF 1GLNA 5ITTA 1F4IA 3GLGA 3AL0C 1RU3A 2LVPC 1AUAA 3GO8A 3TWMA 2G5GX 2JA2A 2DXIA 4DR1M 2CV1A 1NV9A 1E94E 3FE3A 1XMOM 2LXEA 4YHHM 4I5SA 2J7NA 3JR4A 4JI5M 4JYAM 1N32M 2F5SA 1NHWC 2Q2EB 3VFDA 4LJ4A 2O25A 3B9PA 2CFOA 2OPFA 2FFJA 1JQJC 3GRUA 5JI2E 4JI6M 1OJLA 2ZAOA 5ITUA 3GLIB 4L4UA 5IT9S 2ERCA 4LGMA 1XMQM 3KS4A 1D0KA 1LV7A 1L1TA 2MH8A 3U60B 1G4AE 4LFBM 2RKOA 3GLHB 3GLFE 2C98A 5FLXS 3B7ZA 3L2AA 3IG5A 3KSXA 5DYIA 4R7GA 3HX3A 3AJIB 3M0EA 4S12A 3SC3A 3T15A 1MJGM 4AKGA 3KSJA 2OQ4A 1ORYB 1Q3CA 2XSZA 4I81A 5IWAM 3GQ5A 3FUUA 3U6EA 4F2LA 3GPXA 3MK6A 3SFZA 4LJ6A 1DGHA 5KQDA 2O5RA 3FYCA 4DV3M 3LVWA 1SXJA 4KT0F 3U6PA 2UU9M 1T43A 3KDSE 1IM2A 4L6V6 3FRIA 3H4MA 4DR3M 1WJ7A 2DZLA 2CE7A 3BXWA 1GABA 2OOBA 2KNZA 3HWSA 3SMSA 3TQSA 4PDIA 2Z8YM 1T6OA 1TR8A 2KA6B 2JZ0A 3U6SA 4EIWA 1IY0A 3B7NA 1I94M 1E32A 2R45A 2DZNB 2JY5A 3VLFB 5LMUM 1NJGA 2ZANA 1TDZA 1YE9A 2KNVA 4DR4M 2XFSA 1H6UA 1JR3D 3M7GA 5FTKA 4CHTB 3U6CA 2GQFA 3R9XB 2QBYA 3TE6A 2DAGA 3NBIA 5EP4A 1LTMA 4FCWA 2FH0A 2ZBKB 3W0LB 4I8OA 3U6QA 3TPZA 2DAMA 1NY5A 2MGWA 3KS8A 4JI8M 4LZJA 2L09A 4GH9A 4GIPA 3GLIE 2L2DA 3ZH9B 1PJJA 1QUTA 4NOOB 3KOWE 2R65A 4FWHA 4G4RA 2BJVA 2QENA 3GRVA 4LJ7A 4JI3M 5ITYA 4DV2M 2UUBM 5C1BA 2CHVA 1FNNA 2HKJA 1N33M 2C96A 3Q8GA 4AG6A 3GLHE 3K8ZA 4BLCA 4B3TM 1E9RA 4OVZB 1C1KA 1VG5A 1OKSA 1K3XA 3NBXX 2DHRA 3SYKA 2DAKA 1HQYE 3I51A 3W68A 3IHPA 3L28A 1R2ZA 3IECA 2Z3XA 4L78A 2XFTA 2XF3A 3B7QA 3HU1A 4IJEA 2L7HA 4TUWA 2J7OA 4DV6M 1Z5BA 4PD2A 3HGIA 3T38A 2HCBA 4FWGA 2DVWB 4LJAA 3KP1E 2X8AA 3FUVA 2CHGA 4LJ9A 3GLGB 3L27A 1OQYA 4OX9M 1OAIA 4HLQA 1ZMUA 3AKZA 3KXEC 4GMQA 1UM8A 1OFIA 5ITRA 1VDLA 2LBCA 2R6FA 2YFQA 1D0MA 1JR3A 1NJFA 4B7GA 4X66M 4X64M 1EE8A 3M6AA 2LHCA 4X65M 3VKHA 3V76A 2KRKA 5IZ7D 1L2DA 4LF7M 1QYRA 3C3EA 2Y20A 2W82A 2D7EA 1DGBA 2DI0A 4JI2M 5EP2A 3QAUA 4A3VB 3FTFA 4RF1A 5E26A 3DOAA 1N36M 2QPAA 3LCVB 1W5SA 2JY6B 4JN6A 4DBGB 1I4WA 2LVOC 3PXGA 2YQZA 4IBIA 2I7PA 1R4GA 2E5LM 4NL4H 2KW0A 1YLAA 2I7NA 4CJ6A 2DWZB 1JB0F 2JUJA 2ZTCA 2Z4SA 4RKUF 3K92A 3K9OA 1NNJA 2YR0A 4B7FA 3SHFA 2B3TA 4K0KM 2QNJA 1TH3A 3PFIA 1DGHB 4DUYM 2LVNC 4LCBA 5FTMA 3MJ5A 4M9XA 1VEJA 1SXJB 2JP7A 3MHVC 3Q8XA 1G71A 3DFZA 1DO2A 3UK6A 3FTEA 1X37A 3PNYA 1TTEA 4LF5M 7CATA 2UUAM 1DV0A 1J09A 4MGIE 1Z6TA 2AHMA 4ANRA 1R2YA 3L29A 3JR5A 1Z59A 3C9PA 4IBJA 1KYIA 4MH0E 3RGPA 3TWKA 1WGLA 4LFCM 1VEKA 2M60A 1WGNA 1MU5A 3F92A 3HU2A 1HT1E 2G8LA 2APLA 4GRIA 5FTNA 3SATA 4PT5A 2KEBA 3GLGE 1P3QQ 4M9ZA 1TGUA 3A45A 2DAIA 4QOSA 2C5RA 5LMNM 2KXEA 2XEPA 2UXCM 2LVAA 2BWEA 2QBYB 1QDTA 2HL7A 4WW0A 4FCVA 5KO3A 1L2BA 1PJQA 2O01F 3FUWA 1ZMWA 2X49A 2KDLA 3I04M 3AOEC 5EXTA 2RRUA 4XBOA 2Y21A 3SYLA 2R0IA 4DUZM 1Y8GA 2VQFM 4X62M 3DZDA 4WURA 1FJGM 2HAKA 2G3QA 5E6JA 5BR8M 1KSFX 1GL6A 1ZAEA 5ITXA 4G4QA 1R6BX 2KZUA 4PDGA 2VF8A 2V6ZM 2J5YA 4L15A 5EJCA 4XK8F 4MB7A 2F5PA 4IBGA 2WSCF 2UXBM 8CATA 3C58A 2YNMD 1HJPA 2DNAA 5FTLA 3GP1A 3CF2A 2EKFA 2K47A 1W5TA 4F1IA 4DR2M 4QOZC 3KOYE 3W67A 3U61B 3GPPA 4MGKE 3LQRA 3HHWA 4BB9A 2GNOA 1IXZA 5KPTA 2K0BX 3E46A 5KPRA 3VKGA 4L16A 4AW4A 2JY7A 2DHYA 1SXJE 1D0LA 1XHBA 2BWBA 1VEGA 3J7BA 3UMMA 2LH0A 1DO0A 3FD9A 5EXXA 3RFWA 1VQ1A 3UJNA 1GJSA 3HZJA 1YUBA 2CRUA 2A5YB 1C7YA 1NNUC 1XC8A 3GRYA 2L6OA 4GKKM 2QQ8A 2WSEF 1OAOC 4JI7M 4IBBA 2UXDM 3J7AS 4R71A 1QZMA 2K6BA 4IJFA 4GHLA 3PVSA 4XGIA 1NY6A 1R5LA 4MM3B 4NXMM 2CV2A 4AZFA 3B74A 3WHLA 1PRBA 1MN3A 2OO9A 3SBJA 4WP2A 1L1ZA 4CISA 1IY1A 4IBDA 1GJTA 3A42A 3QYEA 2C9CA 2R18A 2XZUA 4CIZA 4UN2B 3K1JA 3U6LA 5C18A 2MR9A 2Y0TA 1ZV1A 2VDBB 2DWMA 3KVWA 4IBKA 1AIPC 4M0DA 4B7HA 4M0WA 1G8PA 5JI3E 4IBFA 2QP9X 2XLJA 5EXSA 1IN6A 1D2NA 3J2PB 2Y0QA 3SAWA 2HHHM 4Z8XA 2FS1A 2CUZA 4MGHA 4D81A 1XNRM 3WHKA 1IN7A 4B3RM 4RF0A 4LY6A 3KOZE 1GL7A 4LRTA 1K3WA 3IG8A 1WR1B 1ZMVA 1TH4A 1SXJC 3B89A 1N75A 3FUXA 1NHGC 2UUCM 3I4YA 1SG9A 4JXJA 4P17A 4LRSA 1DGFA 2L7IA 1XXHA 4CGYB 2JXNA 5ITQA 1IN5A 5IREB 4G4OA 1IFYA 2LWXA 1DGGA 2NQ8C 3U5ZA 4L8RC 4LJ5A 3JAMS 4LF8M 2L4EA 4AG5A 2DWNA 2Z7JA 4D80A 2C9OA 1IY2A 4HEOA 1JR3E 2JY8A 3TWLA 4DV4M 4AQYM 2H5XA 4KODA 4OW0A 1YSYA 2XH9A 4R3DA 2V1UA 1OIPA 4II7A 4NRVA 2V1CA 3ILKA 2CEAA 2XGNA 4LJ8A 3RE8A 1Q39A 1NSFA 1QZEA 4LF6M 4FD2A 1UFZA 2N35A 3VK7A 1ZQ9A 2QCUA 1V33A 5FTJA 3A46A 1IN8A 4LG2A 4ZPXA 2VF7A 3LMMA 3ZC7B 4NXNM 4FVMA 2M5ZA 4LZZA 4LF4M 1IXSA 3GLFA 4GITA 3GPUA 1S3SA 2JNHA 3HHZA 3HHYA 3U6DA 2R4JA 5H37D 1PJIA 3K2LA 3R8FA 2EA0A 2EJSA 1V92A 3E4RA 3SASA 3QWLA 4FCTA 5DFLA 2F5QA 4D82A 2HWJA 2C99A 2WSFF 3H4JA 1QUSA 5EP1A 3HKPA 4GEWA 1J7KA 2LTUA 1IQPA 4I4LA 5DNYA 3SARA 4Y28F 2XZFA 1QVRA 1IBLM 2Z4RA 3J27B 3SHGB 1QQWA 2CWBA 4FWDA 2ZTDA 4NC6A 5EXPA 3RGSA 3SAVA 2R44A 5F3WA 4BBAA 1HT2E 1QANA 3FUTA 1QAQA 1WHCA 2R4EA 4Q7JA 3D8LA 3GQ4A 3ZQJA 2QZ4A 3EIHA 3J80S 4Z6YA 1GVNA 3E9SA 1QAOA 2L4FA 1G59A 2FE8A
chains in the Genus database with same CATH topology
1E94E 3FE3A 3K9PA 4R71A 2JZ1A 2MJ5B 2QHOB 2O25A 3FRHA 1MN3A 2OO9A 4WP2A 5JI2E 1CUKA 2DI0A 2EKKA 4UN2B 1OTRA 2KNAA 3LCVB 2JY6B 2MR9A 4DBGB 1ZV1A 2LVOC 2QSFX 1G4AE 1R4GA 4G3OA 1AIPC 1YLAA 3GLFE 2JUJA 1NV8A 2ZTCA 3K9OA 2B3TA 2QNJA 2LVNC 2KHHA 4F2LA 1VEJA 2JP7A 1DO2A 1ZMVA 3B89A 1TTEA 1XB2B 1DV0A 1SG9A 2LVQD 1WIVA 1T43A 1IM2A 3FRIA 1WJ7A 1KYIA 2DZLA 2OOBA 2KNZA 1IFYA 1WGLA 1VEKA 3F92A 1WGNA 1T6OA 1HT1E 1TR8A 2JZ0A 2L4EA 3GLGE 1P3QQ 3MMPA 2DAIA 2OOAA 4HEOA 1JR3E 2DENA 2JY8A 2LVAA 2JY5A 2MROB 2BWEA 2H5XA 3BBZA 2KNVA 2WZJA 1BVSA 1ZMWA 2CP8A 2RRUA 2DAGA 1Y8GA 2DKLA 2L4FA 1QZEA 2HAKA 1UFZA 2G3QA 2DAMA 2MGWA 1G3IA 3GLIE 2L2DA 1Q02A 1GO5A 1IXSA 2JNHA 3T6PA 1A5TA 2DNAA 1HJPA 3GLHE 2EKFA 4F1IA 1VG5A 1OKSA 2EJSA 1V92A 3E21A 2DAKA 1G41A 1EFUB 1HQYE 5DFLA 3IHPA 2HWJA 2K0BX 3E46A 3IECA 3H4JA 1PGYA 2DHYA 2JY7A 2LTUA 4GEWA 1XXHE 2BWBA 1VEGA 2CWBA 1OQYA 2ZTDA 1OAIA 1ZMUA 2K9DA 1HT2E 2DAEA 3LCUA 1DO0A 1F4IA 1VQ1A 1WHCA 1VDLA 2LBCA 2LVPC 4Q7JA 1C7YA 2R0IA 1WR1B 1NV9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1E94 E;  3FE3 A;  3K9P A;  4R71 A;  2JZ1 A;  2MJ5 B;  2QHO B;  2O25 A;  3FRH A;  1MN3 A;  2OO9 A;  4WP2 A;  5JI2 E;  1CUK A;  2DI0 A;  2EKK A;  4UN2 B;  1OTR A;  2KNA A;  3LCV B;  2JY6 B;  2MR9 A;  4DBG B;  1ZV1 A;  2LVO C;  2QSF X;  1G4A E;  1R4G A;  4G3O A;  1AIP C;  1YLA A;  3GLF E;  2JUJ A;  1NV8 A;  2ZTC A;  3K9O A;  2B3T A;  2QNJ A;  2LVN C;  2KHH A;  4F2L A;  1VEJ A;  2JP7 A;  1DO2 A;  1ZMV A;  3B89 A;  1TTE A;  1XB2 B;  1DV0 A;  1SG9 A;  2LVQ D;  1WIV A;  1T43 A;  1IM2 A;  3FRI A;  1WJ7 A;  1KYI A;  2DZL A;  2OOB A;  2KNZ A;  1IFY A;  1WGL A;  1VEK A;  3F92 A;  1WGN A;  1T6O A;  1HT1 E;  1TR8 A;  2JZ0 A;  2L4E A;  3GLG E;  1P3Q Q;  3MMP A;  2DAI A;  2OOA A;  4HEO A;  1JR3 E;  2DEN A;  2JY8 A;  2LVA A;  2JY5 A;  2MRO B;  2BWE A;  2H5X A;  3BBZ A;  2KNV A;  2WZJ A;  1BVS A;  1ZMW A;  2CP8 A;  2RRU A;  2DAG A;  1Y8G A;  2DKL A;  2L4F A;  1QZE A;  2HAK A;  1UFZ A;  2G3Q A;  2DAM A;  2MGW A;  1G3I A;  3GLI E;  2L2D A;  1Q02 A;  1GO5 A;  1IXS A;  2JNH A;  3T6P A;  1A5T A;  2DNA A;  1HJP A;  3GLH E;  2EKF A;  4F1I A;  1VG5 A;  1OKS A;  2EJS A;  1V92 A;  3E21 A;  2DAK A;  1G41 A;  1EFU B;  1HQY E;  5DFL A;  3IHP A;  2HWJ A;  2K0B X;  3E46 A;  3IEC A;  3H4J A;  1PGY A;  2DHY A;  2JY7 A;  2LTU A;  4GEW A;  1XXH E;  2BWB A;  1VEG A;  2CWB A;  1OQY A;  2ZTD A;  1OAI A;  1ZMU A;  2K9D A;  1HT2 E;  2DAE A;  3LCU A;  1DO0 A;  1F4I A;  1VQ1 A;  1WHC A;  1VDL A;  2LBC A;  2LVP C;  4Q7J A;  1C7Y A;  2R0I A;  1WR1 B;  1NV9 A; 
#chains in the Genus database with same CATH topology
 3K9P A;  4LGY A;  1L8Q A;  1XNQ M;  2JZ1 A;  2D7G A;  2MJ5 B;  3LVV A;  2QHO B;  1R7R A;  3FYD A;  2H1R A;  5EP3 A;  4B08 A;  1E9S A;  1PJS A;  3FRH A;  3SAU A;  3VDP A;  4W5W A;  1CUK A;  2LHG A;  2X4A A;  3A98 B;  2EKK A;  4QHS A;  3T1H M;  1OIZ A;  2ZM6 M;  3LQQ A;  3UGJ A;  1OTR A;  5ITX E;  2KNA A;  2VQE M;  3HJQ A;  1Z5C A;  3GLI A;  4P16 A;  3KP0 E;  4DR5 M;  4GHA A;  2QSF X;  2EO2 A;  1EIJ A;  2DWL A;  4MGY E;  1HNX M;  1HR0 M;  3FTC A;  4REZ A;  4G3O A;  5KPZ A;  1L2C A;  1IBK M;  5EQT A;  3U60 A;  3PNV A;  1V34 A;  1NV8 A;  1Q3B A;  2LNH C;  3GLH A;  4NSO B;  4G4N A;  5GKN A;  3VK8 A;  2R62 A;  4OU7 A;  4HL4 A;  3BOS A;  2KHH A;  3QYB A;  1HNW M;  4DV7 M;  1HQC A;  1WXQ A;  4B3M M;  3CF6 E;  2BNK A;  4DV0 M;  4DR7 M;  1XXH B;  1XB2 B;  2RGH A;  2KZS A;  3HY5 A;  5DYG A;  5FSW A;  2LVQ D;  1WIV A;  1IN4 A;  4IBE A;  1TDH A;  3U6O A;  3U5Z B;  2F5N A;  4QHT A;  1XWI A;  4JV5 M;  3UZU A;  4IIW A;  3T1Y M;  1KFV A;  4YY3 M;  5KQ8 A;  2ZAM A;  1VDD A;  1OFH A;  3LW5 F;  3GPY A;  3HHX A;  4DV5 M;  4JI4 M;  4B3S M;  2F4V M;  3MMP A;  4GC5 A;  4M9S A;  3D8B A;  2OOA A;  1TF0 B;  4JI0 M;  1T3T A;  4RNA A;  2R46 A;  3THG A;  2DEN A;  3HJS A;  2MRO B;  3DA1 A;  1NO1 A;  5BPV A;  3BBZ A;  1PM5 A;  3KOX E;  3GQ3 A;  3CGW A;  2WZJ A;  1BVS A;  1TH2 A;  2FNA A;  1N34 M;  2KRU A;  4GC9 A;  2DZO B;  4QNR A;  3VDU A;  1IBM M;  2CP8 A;  3U61 A;  3OTO M;  2DKL A;  3AOE A;  3AOG A;  1N78 A;  1NVM A;  4AI6 A;  2EUC A;  4IBC A;  4KO8 A;  3J81 S;  3AFH A;  1G3I A;  3NWL A;  5A2Q S;  2D7H A;  1IXS B;  3ZCB B;  4LF9 M;  1Q02 A;  3GLF B;  3GRR A;  4G6Z A;  3SMP A;  1Z5A A;  1GO5 A;  2P5T A;  3I01 M;  3KFU G;  4KHP M;  2CHQ A;  4LFA M;  3L26 A;  4PCZ A;  2RGO A;  1A5T A;  3T6P A;  1MX0 A;  4FW9 A;  1HNZ M;  2F5O A;  4JI1 M;  3FTD A;  3CF0 A;  3HJ8 A;  3L25 A;  4AKH A;  3U6M A;  3E21 A;  1J5E M;  2VII A;  1EFU B;  1G41 A;  3CTW B;  4OVZ A;  4NRW A;  4DR6 M;  3I4V A;  1PJT A;  2XSZ D;  3C3D A;  3FKE A;  4NSR A;  3TL4 X;  1QAM A;  3EIE A;  4DV1 M;  1QDR A;  4AKI A;  1PGY A;  1N77 A;  4MGZ E;  2CV0 A;  3HU3 A;  1GKI A;  3KW6 A;  1XXH E;  3W0F A;  1K82 A;  4QNM A;  2JWS A;  4KLN A;  3AV0 A;  1IXR C;  1SXJ D;  2FOI C;  4GKJ M;  2K9D A;  4ITQ A;  3LCU A;  2DAE A;  2BJW A;  5L8R F;  1GLN A;  5ITT A;  1F4I A;  3GLG A;  3AL0 C;  1RU3 A;  2LVP C;  1AUA A;  3GO8 A;  3TWM A;  2G5G X;  2JA2 A;  2DXI A;  4DR1 M;  2CV1 A;  1NV9 A;  1E94 E;  3FE3 A;  1XMO M;  2LXE A;  4YHH M;  4I5S A;  2J7N A;  3JR4 A;  4JI5 M;  4JYA M;  1N32 M;  2F5S A;  1NHW C;  2Q2E B;  3VFD A;  4LJ4 A;  2O25 A;  3B9P A;  2CFO A;  2OPF A;  2FFJ A;  1JQJ C;  3GRU A;  5JI2 E;  4JI6 M;  1OJL A;  2ZAO A;  5ITU A;  3GLI B;  4L4U A;  5IT9 S;  2ERC A;  4LGM A;  1XMQ M;  3KS4 A;  1D0K A;  1LV7 A;  1L1T A;  2MH8 A;  3U60 B;  1G4A E;  4LFB M;  2RKO A;  3GLH B;  3GLF E;  2C98 A;  5FLX S;  3B7Z A;  3L2A A;  3IG5 A;  3KSX A;  5DYI A;  4R7G A;  3HX3 A;  3AJI B;  3M0E A;  4S12 A;  3SC3 A;  3T15 A;  1MJG M;  4AKG A;  3KSJ A;  2OQ4 A;  1ORY B;  1Q3C A;  2XSZ A;  4I81 A;  5IWA M;  3GQ5 A;  3FUU A;  3U6E A;  4F2L A;  3GPX A;  3MK6 A;  3SFZ A;  4LJ6 A;  1DGH A;  5KQD A;  2O5R A;  3FYC A;  4DV3 M;  3LVW A;  1SXJ A;  4KT0 F;  3U6P A;  2UU9 M;  1T43 A;  3KDS E;  1IM2 A;  4L6V 6;  3FRI A;  3H4M A;  4DR3 M;  1WJ7 A;  2DZL A;  2CE7 A;  3BXW A;  1GAB A;  2OOB A;  2KNZ A;  3HWS A;  3SMS A;  3TQS A;  4PDI A;  2Z8Y M;  1T6O A;  1TR8 A;  2KA6 B;  2JZ0 A;  3U6S A;  4EIW A;  1IY0 A;  3B7N A;  1I94 M;  1E32 A;  2R45 A;  2DZN B;  2JY5 A;  3VLF B;  5LMU M;  1NJG A;  2ZAN A;  1TDZ A;  1YE9 A;  2KNV A;  4DR4 M;  2XFS A;  1H6U A;  1JR3 D;  3M7G A;  5FTK A;  4CHT B;  3U6C A;  2GQF A;  3R9X B;  2QBY A;  3TE6 A;  2DAG A;  3NBI A;  5EP4 A;  1LTM A;  4FCW A;  2FH0 A;  2ZBK B;  3W0L B;  4I8O A;  3U6Q A;  3TPZ A;  2DAM A;  1NY5 A;  2MGW A;  3KS8 A;  4JI8 M;  4LZJ A;  2L09 A;  4GH9 A;  4GIP A;  3GLI E;  2L2D A;  3ZH9 B;  1PJJ A;  1QUT A;  4NOO B;  3KOW E;  2R65 A;  4FWH A;  4G4R A;  2BJV A;  2QEN A;  3GRV A;  4LJ7 A;  4JI3 M;  5ITY A;  4DV2 M;  2UUB M;  5C1B A;  2CHV A;  1FNN A;  2HKJ A;  1N33 M;  2C96 A;  3Q8G A;  4AG6 A;  3GLH E;  3K8Z A;  4BLC A;  4B3T M;  1E9R A;  4OVZ B;  1C1K A;  1VG5 A;  1OKS A;  1K3X A;  3NBX X;  2DHR A;  3SYK A;  2DAK A;  1HQY E;  3I51 A;  3W68 A;  3IHP A;  3L28 A;  1R2Z A;  3IEC A;  2Z3X A;  4L78 A;  2XFT A;  2XF3 A;  3B7Q A;  3HU1 A;  4IJE A;  2L7H A;  4TUW A;  2J7O A;  4DV6 M;  1Z5B A;  4PD2 A;  3HGI A;  3T38 A;  2HCB A;  4FWG A;  2DVW B;  4LJA A;  3KP1 E;  2X8A A;  3FUV A;  2CHG A;  4LJ9 A;  3GLG B;  3L27 A;  1OQY A;  4OX9 M;  1OAI A;  4HLQ A;  1ZMU A;  3AKZ A;  3KXE C;  4GMQ A;  1UM8 A;  1OFI A;  5ITR A;  1VDL A;  2LBC A;  2R6F A;  2YFQ A;  1D0M A;  1JR3 A;  1NJF A;  4B7G A;  4X66 M;  4X64 M;  1EE8 A;  3M6A A;  2LHC A;  4X65 M;  3VKH A;  3V76 A;  2KRK A;  5IZ7 D;  1L2D A;  4LF7 M;  1QYR A;  3C3E A;  2Y20 A;  2W82 A;  2D7E A;  1DGB A;  2DI0 A;  4JI2 M;  5EP2 A;  3QAU A;  4A3V B;  3FTF A;  4RF1 A;  5E26 A;  3DOA A;  1N36 M;  2QPA A;  3LCV B;  1W5S A;  2JY6 B;  4JN6 A;  4DBG B;  1I4W A;  2LVO C;  3PXG A;  2YQZ A;  4IBI A;  2I7P A;  1R4G A;  2E5L M;  4NL4 H;  2KW0 A;  1YLA A;  2I7N A;  4CJ6 A;  2DWZ B;  1JB0 F;  2JUJ A;  2ZTC A;  2Z4S A;  4RKU F;  3K92 A;  3K9O A;  1NNJ A;  2YR0 A;  4B7F A;  3SHF A;  2B3T A;  4K0K M;  2QNJ A;  1TH3 A;  3PFI A;  1DGH B;  4DUY M;  2LVN C;  4LCB A;  5FTM A;  3MJ5 A;  4M9X A;  1VEJ A;  1SXJ B;  2JP7 A;  3MHV C;  3Q8X A;  1G71 A;  3DFZ A;  1DO2 A;  3UK6 A;  3FTE A;  1X37 A;  3PNY A;  1TTE A;  4LF5 M;  7CAT A;  2UUA M;  1DV0 A;  1J09 A;  4MGI E;  1Z6T A;  2AHM A;  4ANR A;  1R2Y A;  3L29 A;  3JR5 A;  1Z59 A;  3C9P A;  4IBJ A;  1KYI A;  4MH0 E;  3RGP A;  3TWK A;  1WGL A;  4LFC M;  1VEK A;  2M60 A;  1WGN A;  1MU5 A;  3F92 A;  3HU2 A;  1HT1 E;  2G8L A;  2APL A;  4GRI A;  5FTN A;  3SAT A;  4PT5 A;  2KEB A;  3GLG E;  1P3Q Q;  4M9Z A;  1TGU A;  3A45 A;  2DAI A;  4QOS A;  2C5R A;  5LMN M;  2KXE A;  2XEP A;  2UXC M;  2LVA A;  2BWE A;  2QBY B;  1QDT A;  2HL7 A;  4WW0 A;  4FCV A;  5KO3 A;  1L2B A;  1PJQ A;  2O01 F;  3FUW A;  1ZMW A;  2X49 A;  2KDL A;  3I04 M;  3AOE C;  5EXT A;  2RRU A;  4XBO A;  2Y21 A;  3SYL A;  2R0I A;  4DUZ M;  1Y8G A;  2VQF M;  4X62 M;  3DZD A;  4WUR A;  1FJG M;  2HAK A;  2G3Q A;  5E6J A;  5BR8 M;  1KSF X;  1GL6 A;  1ZAE A;  5ITX A;  4G4Q A;  1R6B X;  2KZU A;  4PDG A;  2VF8 A;  2V6Z M;  2J5Y A;  4L15 A;  5EJC A;  4XK8 F;  4MB7 A;  2F5P A;  4IBG A;  2WSC F;  2UXB M;  8CAT A;  3C58 A;  2YNM D;  1HJP A;  2DNA A;  5FTL A;  3GP1 A;  3CF2 A;  2EKF A;  2K47 A;  1W5T A;  4F1I A;  4DR2 M;  4QOZ C;  3KOY E;  3W67 A;  3U61 B;  3GPP A;  4MGK E;  3LQR A;  3HHW A;  4BB9 A;  2GNO A;  1IXZ A;  5KPT A;  2K0B X;  3E46 A;  5KPR A;  3VKG A;  4L16 A;  4AW4 A;  2JY7 A;  2DHY A;  1SXJ E;  1D0L A;  1XHB A;  2BWB A;  1VEG A;  3J7B A;  3UMM A;  2LH0 A;  1DO0 A;  3FD9 A;  5EXX A;  3RFW A;  1VQ1 A;  3UJN A;  1GJS A;  3HZJ A;  1YUB A;  2CRU A;  2A5Y B;  1C7Y A;  1NNU C;  1XC8 A;  3GRY A;  2L6O A;  4GKK M;  2QQ8 A;  2WSE F;  1OAO C;  4JI7 M;  4IBB A;  2UXD M;  3J7A S;  4R71 A;  1QZM A;  2K6B A;  4IJF A;  4GHL A;  3PVS A;  4XGI A;  1NY6 A;  1R5L A;  4MM3 B;  4NXM M;  2CV2 A;  4AZF A;  3B74 A;  3WHL A;  1PRB A;  1MN3 A;  2OO9 A;  3SBJ A;  4WP2 A;  1L1Z A;  4CIS A;  1IY1 A;  4IBD A;  1GJT A;  3A42 A;  3QYE A;  2C9C A;  2R18 A;  2XZU A;  4CIZ A;  4UN2 B;  3K1J A;  3U6L A;  5C18 A;  2MR9 A;  2Y0T A;  1ZV1 A;  2VDB B;  2DWM A;  3KVW A;  4IBK A;  1AIP C;  4M0D A;  4B7H A;  4M0W A;  1G8P A;  5JI3 E;  4IBF A;  2QP9 X;  2XLJ A;  5EXS A;  1IN6 A;  1D2N A;  3J2P B;  2Y0Q A;  3SAW A;  2HHH M;  4Z8X A;  2FS1 A;  2CUZ A;  4MGH A;  4D81 A;  1XNR M;  3WHK A;  1IN7 A;  4B3R M;  4RF0 A;  4LY6 A;  3KOZ E;  1GL7 A;  4LRT A;  1K3W A;  3IG8 A;  1WR1 B;  1ZMV A;  1TH4 A;  1SXJ C;  3B89 A;  1N75 A;  3FUX A;  1NHG C;  2UUC M;  3I4Y A;  1SG9 A;  4JXJ A;  4P17 A;  4LRS A;  1DGF A;  2L7I A;  1XXH A;  4CGY B;  2JXN A;  5ITQ A;  1IN5 A;  5IRE B;  4G4O A;  1IFY A;  2LWX A;  1DGG A;  2NQ8 C;  3U5Z A;  4L8R C;  4LJ5 A;  3JAM S;  4LF8 M;  2L4E A;  4AG5 A;  2DWN A;  2Z7J A;  4D80 A;  2C9O A;  1IY2 A;  4HEO A;  1JR3 E;  2JY8 A;  3TWL A;  4DV4 M;  4AQY M;  2H5X A;  4KOD A;  4OW0 A;  1YSY A;  2XH9 A;  4R3D A;  2V1U A;  1OIP A;  4II7 A;  4NRV A;  2V1C A;  3ILK A;  2CEA A;  2XGN A;  4LJ8 A;  3RE8 A;  1Q39 A;  1NSF A;  1QZE A;  4LF6 M;  4FD2 A;  1UFZ A;  2N35 A;  3VK7 A;  1ZQ9 A;  2QCU A;  1V33 A;  5FTJ A;  3A46 A;  1IN8 A;  4LG2 A;  4ZPX A;  2VF7 A;  3LMM A;  3ZC7 B;  4NXN M;  4FVM A;  2M5Z A;  4LZZ A;  4LF4 M;  1IXS A;  3GLF A;  4GIT A;  3GPU A;  1S3S A;  2JNH A;  3HHZ A;  3HHY A;  3U6D A;  2R4J A;  5H37 D;  1PJI A;  3K2L A;  3R8F A;  2EA0 A;  2EJS A;  1V92 A;  3E4R A;  3SAS A;  3QWL A;  4FCT A;  5DFL A;  2F5Q A;  4D82 A;  2HWJ A;  2C99 A;  2WSF F;  3H4J A;  1QUS A;  5EP1 A;  3HKP A;  4GEW A;  1J7K A;  2LTU A;  1IQP A;  4I4L A;  5DNY A;  3SAR A;  4Y28 F;  2XZF A;  1QVR A;  1IBL M;  2Z4R A;  3J27 B;  3SHG B;  1QQW A;  2CWB A;  4FWD A;  2ZTD A;  4NC6 A;  5EXP A;  3RGS A;  3SAV A;  2R44 A;  5F3W A;  4BBA A;  1HT2 E;  1QAN A;  3FUT A;  1QAQ A;  1WHC A;  2R4E A;  4Q7J A;  3D8L A;  3GQ4 A;  3ZQJ A;  2QZ4 A;  3EIH A;  3J80 S;  4Z6Y A;  1GVN A;  3E9S A;  1QAO A;  2L4F A;  1G59 A;  2FE8 A; 
#chains in the Genus database with same CATH homology
 1E94 E;  3FE3 A;  3K9P A;  4R71 A;  2JZ1 A;  2MJ5 B;  2QHO B;  2O25 A;  3FRH A;  1MN3 A;  2OO9 A;  4WP2 A;  5JI2 E;  1CUK A;  2DI0 A;  2EKK A;  4UN2 B;  1OTR A;  2KNA A;  3LCV B;  2JY6 B;  2MR9 A;  4DBG B;  1ZV1 A;  2LVO C;  2QSF X;  1G4A E;  1R4G A;  4G3O A;  1AIP C;  1YLA A;  3GLF E;  2JUJ A;  1NV8 A;  2ZTC A;  3K9O A;  2B3T A;  2QNJ A;  2LVN C;  2KHH A;  4F2L A;  1VEJ A;  2JP7 A;  1DO2 A;  1ZMV A;  3B89 A;  1TTE A;  1XB2 B;  1DV0 A;  1SG9 A;  2LVQ D;  1WIV A;  1T43 A;  1IM2 A;  3FRI A;  1WJ7 A;  1KYI A;  2DZL A;  2OOB A;  2KNZ A;  1IFY A;  1WGL A;  1VEK A;  3F92 A;  1WGN A;  1T6O A;  1HT1 E;  1TR8 A;  2JZ0 A;  2L4E A;  3GLG E;  1P3Q Q;  3MMP A;  2DAI A;  2OOA A;  4HEO A;  1JR3 E;  2DEN A;  2JY8 A;  2LVA A;  2JY5 A;  2MRO B;  2BWE A;  2H5X A;  3BBZ A;  2KNV A;  2WZJ A;  1BVS A;  1ZMW A;  2CP8 A;  2RRU A;  2DAG A;  1Y8G A;  2DKL A;  2L4F A;  1QZE A;  2HAK A;  1UFZ A;  2G3Q A;  2DAM A;  2MGW A;  1G3I A;  3GLI E;  2L2D A;  1Q02 A;  1GO5 A;  1IXS A;  2JNH A;  3T6P A;  1A5T A;  2DNA A;  1HJP A;  3GLH E;  2EKF A;  4F1I A;  1VG5 A;  1OKS A;  2EJS A;  1V92 A;  3E21 A;  2DAK A;  1G41 A;  1EFU B;  1HQY E;  5DFL A;  3IHP A;  2HWJ A;  2K0B X;  3E46 A;  3IEC A;  3H4J A;  1PGY A;  2DHY A;  2JY7 A;  2LTU A;  4GEW A;  1XXH E;  2BWB A;  1VEG A;  2CWB A;  1OQY A;  2ZTD A;  1OAI A;  1ZMU A;  2K9D A;  1HT2 E;  2DAE A;  3LCU A;  1DO0 A;  1F4I A;  1VQ1 A;  1WHC A;  1VDL A;  2LBC A;  2LVP C;  4Q7J A;  1C7Y A;  2R0I A;  1WR1 B;  1NV9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...