1WIVA

Solution structure of rsgi ruh-023, a uba domain from arabidopsis cdna
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
73
structure length
73
Chain Sequence
GSSGSSGLLSHMDDPDIDAPISHQTSDIDQSSVDTLLSFGFAEDVARKALKASGGDIEKATDWVFNNSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ubiquitin-specific protease 14
publication title solution structure of RSGI RUH-023, a UBA domain from Arabidopsis cDNA
rcsb
source organism Arabidopsis thaliana
molecule tags Structural genomics, unknown function
total genus 11
structure length 73
sequence length 73
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2004-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00627 UBA UBA/TS-N domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 1wivA00
2CWBA 3IECA 1JR3E 2DENA 1BVSA 1XB2B 2DAMA 1HT1E 2MGWA 2JY7A 2OOBA 3T6PA 3FE3A 3LCUA 2QHOB 2DKLA 2ZTCA 2O25A 1TTEA 1HJPA 2RRUA 1WHCA 1VEGA 1TR8A 1A5TA 3E21A 1Y8GA 2MJ5B 2JZ0A 2L4EA 1AIPC 3B89A 2HWJA 3GLHE 1G3IA 4F1IA 1VEKA 4Q7JA 1V92A 1DO2A 1XXHE 4HEOA 3FRIA 2MROB 2KHHA 2KNAA 2EJSA 2LVPC 2ZTDA 2EKKA 2G3QA 2JZ1A 1F4IA 2WZJA 1NV8A 1IM2A 1T6OA 1ZMUA 1WIVA 1WGLA 2LVQD 3BBZA 3IHPA 1E94E 1HQYE 1UFZA 2DAGA 1ZMWA 1WR1B 1HT2E 2KNVA 1OAIA 1ZV1A 2DHYA 2HAKA 1G4AE 2DZLA 2JY6B 4G3OA 4WP2A 2OOAA 2CP8A 1EFUB 1OTRA 2QSFX 1YLAA 1DO0A 1C7YA 2LVAA 2JP7A 1WGNA 1QZEA 2EKFA 4GEWA 2B3TA 2DAIA 1VEJA 3GLFE 1MN3A 1DV0A 1CUKA 4R71A 1WJ7A 1G41A 2DAEA 2OO9A 1GO5A 2LTUA 2BWEA 1ZMVA 2JY8A 4DBGB 2BWBA 2JY5A 2DAKA 1VQ1A 2DI0A 2LVNC 3GLIE 2LBCA 3FRHA 2R0IA 1R4GA 1IXSA 1SG9A 1P3QQ 2H5XA 1NV9A 3LCVB 2JUJA 1PGYA 3H4JA 3MMPA 2LVOC 1VDLA 2L2DA 5JI2E 2DNAA 2JNHA 4F2LA 3E46A 1T43A 1VG5A 1KYIA 1OKSA 2MR9A 3F92A 2QNJA 1Q02A 3K9PA 3GLGE 2K9DA 2K0BX 1IFYA 2L4FA 3K9OA 2KNZA 5DFLA 1OQYA 4UN2B
chains in the Genus database with same CATH superfamily
3SAVA 2CWBA 1JR3E 2ERCA 2J5YA 2RKOA 2AHMA 2DWNA 2ZM6M 3SFZA 4HL4A 2OOBA 3HJ8A 1XMOM 1N36M 2UU9M 3PFIA 4KHPM 2KDLA 2QHOB 3LCUA 4TUWA 4RNAA 3I4VA 4DR6M 2XFSA 1TTEA 2RRUA 4ITQA 2K6BA 2KW0A 4LRTA 4X66M 5DNYA 4LJAA 5IREB 5EJCA 5IWAM 1A5TA 4XBOA 3E21A 1GLNA 4PT5A 2HHHM 2MJ5B 5EP4A 1IQPA 3B7NA 3B89A 4A3VB 2CHQA 3LW5F 4L16A 4F1IA 4DV1M 4G4OA 2KXEA 4GMQA 1XXHE 1TGUA 1SXJA 1OIPA 4M0DA 1IXSB 1N77A 1OJLA 2MROB 4FCVA 2Y0QA 2C9OA 4NOOB 1D2NA 5FTJA 1W5SA 3KSJA 4Y28F 3RE8A 3GQ4A 4LG2A 4B3TM 1XHBA 2EKKA 4CGYB 3J80S 2JZ1A 3KOWE 2WZJA 3KP0E 4DV6M 4LGYA 3GQ5A 1WGLA 3MK6A 4LJ8A 1DGHB 4AG5A 2LVQD 2XLJA 5C1BA 3VK8A 4DR2M 4NC6A 4GHAA 2KA6B 4IBFA 3FTDA 2ZAOA 2KNVA 2ZANA 1ZV1A 1K82A 3U6QA 4G3OA 2YFQA 3J7AS 3HWSA 3GLFA 2QENA 3LQQA 1IBLM 1MU5A 3U6LA 1TH4A 4DV3M 3BOSA 3RGPA 5EXPA 4M9XA 4OVZA 4LJ5A 3KFUG 1DO0A 3A98B 1N34M 2O5RA 1I4WA 2LVAA 3SHGB 1IN5A 3B7ZA 1HNWM 3I4YA 4JV5M 1QZEA 2RGOA 4GEWA 5EP3A 1KSFX 4QNRA 3K92A 1JR3A 2XZUA 3L28A 2DAEA 4NL4H 3UGJA 3IG8A 7CATA 4JI4M 2BNKA 3VKGA 1T3TA 4PDIA 4IIWA 3A45A 1IN6A 4CISA 2C99A 3NWLA 4OU7A 2XFTA 2JY5A 2Z4SA 4G6ZA 4RKUF 2LVNC 4PD2A 3GLIE 4LFCM 3UJNA 1DGBA 1E32A 5LMNM 4DR4M 1IBMM 4QOSA 1SG9A 2QCUA 1SXJB 1NV9A 3GQ3A 3AOEA 1XMQM 4JI6M 4OX9M 3SHFA 3KDSE 4LJ9A 3H4JA 3L2AA 3MMPA 4FW9A 1NHWC 4FD2A 4YY3M 1L1TA 2LVOC 3M0EA 3UMMA 3RGSA 3VK7A 1VDLA 1TDZA 1SXJC 1L2BA 5ITQA 3HU3A 3HHZA 1PJJA 5E6JA 2MR9A 1R2YA 2QNJA 2C98A 4ZPXA 1XNQM 2ZAMA 1EIJA 5LMUM 3C3DA 3J7BA 2OQ4A 1N32M 1OIZA 4JI1M 4BBAA 1OQYA 3FD9A 4GKJM 3GLFB 1HR0M 3IECA 1LTMA 2DAMA 4GIPA 4OVZB 4M9ZA 2CV0A 2JY7A 3U61A 3AJIB 2VF7A 3GLHA 2R4EA 4MGKE 3HU1A 1NO1A 1HJPA 2VQFM 2K47A 3KXEC 1VEGA 3PNVA 1E9SA 5F3WA 3TWLA 4G4QA 2RGHA 2LWXA 1PM5A 1NY6A 1TH3A 3AV0A 4MM3B 5FTLA 3NBIA 1NY5A 1Y8GA 4PCZA 5KPRA 5FLXS 3L26A 2F5SA 5KO3A 5BPVA 3JR5A 3GPXA 4G4NA 2OPFA 2XEPA 4JI3M 1L2DA 2QZ4A 2C9CA 4LF7M 3U6CA 2QBYA 4DV7M 4Q7JA 3TQSA 4XGIA 3VLFB 3FUTA 3KW6A 3D8LA 1NHGC 5EP2A 1JQJC 4HEOA 2NQ8C 4FCWA 5L8RF 3FRIA 1VDDA 2WSEF 3GRUA 5EXSA 3HHXA 3UZUA 3HX3A 5ITXE 4B3MM 1QAMA 2VF8A 1IN8A 2KHHA 4AKGA 3KSXA 3SAWA 4GKKM 4RF0A 3Q8GA 5IT9S 1NV8A 2Y0TA 1WIVA 2CFOA 2YR0A 1QDTA 3AOEC 3SARA 1R7RA 1SXJD 4B08A 3BBZA 4I8OA 4LFAM 3SYLA 3JR4A 3U6PA 3D8BA 3SMPA 3VFDA 4QNMA 1UFZA 3ZCBB 3KVWA 4FCTA 1WR1B 4QOZC 3PXGA 1N78A 2DHYA 5FSWA 4YHHM 1G4AE 1TDHA 1IY2A 1IN7A 1NJFA 4IBBA 4IBCA 3FUWA 3L27A 5IZ7D 1I94M 4LZZA 3QYBA 1ZAEA 4AKHA 2DWZB 2HKJA 2CP8A 1OTRA 3FUXA 3SASA 1Q39A 1YLAA 1C7YA 2KZUA 3L29A 1TH2A 2HL7A 2JP7A 3U61B 4IBIA 4M9SA 2EKFA 3THGA 1OAOC 3GLHB 2XGNA 2KRKA 3K2LA 4R7GA 1E9RA 4L78A 4D81A 1MN3A 4G4RA 3HKPA 1GJTA 4XK8F 1GO5A 2LTUA 3ZH9B 4MB7A 2BWEA 1PJQA 2WSFF 1ZMVA 2L6OA 1PJSA 2JY8A 1EE8A 4IJFA 4M0WA 2UUBM 1R2ZA 1Q3CA 2BWBA 4DR7M 2DI0A 1HNXM 3FYDA 3B74A 1QZMA 4LF8M 2QBYB 1JR3D 3I51A 2LBCA 3CGWA 4AQYM 4Z8XA 1IY0A 3GRRA 1R4GA 5E26A 3LCVB 2ZBKB 2KEBA 1IY1A 5ITUA 3GLGA 4NSRA 2D7EA 2I7PA 3HY5A 5KPZA 3OTOM 5JI2E 1Z5CA 5EXXA 4B3SM 1DGGA 3J2PB 2JNHA 4F2LA 2FE8A 1T43A 3QWLA 5ITXA 2N35A 3J27B 2R4JA 2D7HA 3FUUA 4LGMA 4LZJA 1J5EM 4DV0M 2EUCA 3KOZE 2K0BX 4GC9A 4DV5M 1RU3A 1IN4A 3K9OA 4P16A 3U6MA 3FTFA 4JYAM 2KNZA 5DFLA 1FJGM 2L09A 4UN2B 3C3EA 5BR8M 3U6DA 1Z5BA 3T1YM 4IBDA 4NRVA 2DENA 2M5ZA 4B3RM 2G8LA 3PNYA 3E4RA 4W5WA 3AL0C 1BVSA 3KS4A 3SYKA 3VKHA 3GRYA 1WXQA 3HHWA 4L6V6 3T6PA 4I5SA 3FE3A 1XC8A 3DOAA 2ZTCA 4X65M 1N75A 2O25A 2EA0A 5A2QS 4II7A 1XXHA 2R44A 1L8QA 2X8AA 3VDUA 1V34A 1R5LA 3TPZA 2YNMD 4D80A 3FUVA 2CEAA 2JZ0A 4P17A 2L4EA 3M7GA 3NBXX 4DUZM 3CF0A 1GL7A 2GQFA 4BB9A 2HWJA 5EP1A 2FH0A 4FWDA 4I4LA 2FFJA 2J7OA 1X37A 4KO8A 4LCBA 4MGYE 3WHLA 5C18A 1GABA 2MH8A 1DO2A 1MX0A 5GKNA 3PVSA 3W68A 2YQZA 3HU2A 8CATA 3A46A 1G59A 3KOYE 3DZDA 3GLGB 2KNAA 2EJSA 2ZTDA 2FS1A 4JI2M 4L15A 3HGIA 2KZSA 1LV7A 1T6OA 1ZMUA 2UXBM 4NXNM 4LJ7A 3FYCA 2R45A 4LF6M 2CE7A 3IHPA 1SXJE 2DZOB 1E94E 4B7GA 4S12A 1HQYE 3B9PA 3HJSA 1ZMWA 5EXTA 1HT2E 1D0MA 1YSYA 2JY6B 2HAKA 4IBEA 3U60A 3FTEA 4DR1M 4WP2A 3DFZA 2W82A 3Q8XA 2DWMA 3BXWA 3FKEA 3GPUA 2VQEM 2QSFX 1EFUB 2V1CA 2QPAA 4MGZE 2DVWB 1Z59A 2R6FA 2LHCA 3LVVA 1N33M 3KS8A 3C58A 2CUZA 3GLIA 2M60A 3GPPA 2DAIA 3GLFE 4JXJA 1G8PA 3HZJA 1WJ7A 1G41A 2CHVA 2Q2EB 3R8FA 1OFHA 1XXHB 2CHGA 2XSZA 3H4MA 4B7HA 3JAMS 2LH0A 4K0KM 3QYEA 5EQTA 4LFBM 3GP1A 2R18A 1ZQ9A 1G71A 2LHGA 3DA1A 3V76A 5JI3E 4JI8M 2X4AA 1ORYB 1R6BX 4KT0F 4AI6A 4IBJA 4B7FA 3UK6A 3FRHA 4PDGA 1S3SA 3HHYA 4NRWA 4X62M 2Z3XA 2H5XA 1P3QQ 3C9PA 1JB0F 2JUJA 3TWMA 1PGYA 2XF3A 4IJEA 4AKIA 3U6OA 1K3WA 2VDBB 3AKZA 3U6EA 1L2CA 3T38A 4RF1A 1Q3BA 2L2DA 3J81S 1QDRA 3CTWB 4EIWA 4DR5M 2DNAA 1QVRA 2CRUA 2QQ8A 1VG5A 1OKSA 3F92A 2APLA 1NVMA 1Q02A 4OW0A 3K9PA 3GRVA 1QAOA 4MGIE 3AFHA 2K9DA 3A42A 3WHKA 2L4FA 2WSCF 2DHRA 2JWSA 4WURA 3T1HM 3U60B 4HLQA 4BLCA 2UUCM 1GJSA 1PRBA 4IBKA 1QYRA 1J7KA 4LJ4A 5ITYA 4DV4M 3SATA 2UXCM 3R9XB 1XB2B 2FNAA 1W5TA 3EIEA 3E9SA 1HT1E 2MGWA 4REZA 2F5NA 3T15A 3K8ZA 4NSOB 2Y21A 3SC3A 3ZQJA 1HQCA 2F5QA 3U5ZA 5ITRA 4MGHA 2DKLA 1GL6A 4FVMA 5DYIA 3GLIB 1WHCA 2CV1A 2O01F 2R46A 4LF5M 3L25A 4JI5M 3CF2A 1QQWA 1TR8A 4QHTA 1YUBA 3FTCA 2R65A 2L7IA 4CIZA 3SMSA 1D0KA 4AG6A 2L7HA 3W0FA 4LY6A 1AIPC 3W0LB 2D7GA 3GLHE 2DZNB 1G3IA 4CJ6A 4LRSA 4L4UA 4LJ6A 4JI0M 3SAUA 1VEKA 3GO8A 1V92A 2FOIC 2UUAM 5KQ8A 1NNJA 1QUSA 3LVWA 4FWGA 1QANA 2V1UA 2VIIA 4GC5A 1K3XA 2BJVA 2LVPC 3M6AA 3KP1E 4QHSA 4NXMM 1J09A 2G3QA 1F4IA 1PJTA 1IM2A 1NSFA 2JA2A 2J7NA 5FTMA 3EIHA 4GH9A 2UXDM 2V6ZM 4KODA 1FNNA 2DAGA 5DYGA 1PJIA 2C5RA 1QUTA 5ITTA 1OAIA 2BJWA 4AW4A 2DZLA 3I04M 2C96A 1C1KA 4KLNA 3ZC7B 4IBGA 2EO2A 4WW0A 2DXIA 1AUAA 1IXRC 3CF6E 3B7QA 3VDPA 4DUYM 3QAUA 2OOAA 4I81A 4R3DA 2P5TA 5H37D 4DV2M 1KFVA 2CV2A 4L8RC 4GHLA 4D82A 2XZFA 3GPYA 1IBKM 4ANRA 1Z5AA 4JN6A 1WGNA 2F5PA 2XH9A 1YE9A 2R62A 3U5ZB 3ILKA 2B3TA 4DR3M 1H6UA 2E5LM 1V33A 2LNHC 1VEJA 4CHTB 1DV0A 1CUKA 4R71A 2OO9A 2DWLA 4LF4M 1XWIA 3AOGA 1XNRM 2Z7JA 2Z8YM 4Z6YA 3RFWA 4GITA 3W67A 3TWKA 2GNOA 4DBGB 3LQRA 2X49A 3MJ5A 2DAKA 1VQ1A 3SBJA 2I7NA 1GVNA 4GRIA 4AZFA 1D0LA 1IXZA 3K1JA 2Y20A 1HNZM 2R0IA 4FWHA 2XSZD 1IXSA 1DGFA 3KOXE 4LF9M 4X64M 1OFIA 1UM8A 1NJGA 2Z4RA 5FTKA 5FTNA 1Z6TA 2QP9X 2G5GX 3LMMA 3TL4X 3MHVC 2JXNA 3U6SA 2F5OA 1DGHA 3E46A 2H1RA 1TF0B 3TE6A 1KYIA 5KPTA 2LXEA 4JI7M 1MJGM 3I01M 3GLGE 5KQDA 3IG5A 2HCBA 1IFYA 4MH0E 2F4VM 2KRUA 3HJQA 2A5YB 1GKIA 1NNUC 1L1ZA 1QAQA
chains in the Genus database with same CATH topology
2CWBA 3IECA 1JR3E 2DENA 1BVSA 1XB2B 2DAMA 1HT1E 2MGWA 2JY7A 2OOBA 3T6PA 3FE3A 3LCUA 2QHOB 2DKLA 2ZTCA 2O25A 1TTEA 1HJPA 2RRUA 1WHCA 1VEGA 1TR8A 1A5TA 3E21A 1Y8GA 2MJ5B 2JZ0A 2L4EA 1AIPC 3B89A 2HWJA 3GLHE 1G3IA 4F1IA 1VEKA 4Q7JA 1V92A 1DO2A 1XXHE 4HEOA 3FRIA 2MROB 2KHHA 2KNAA 2EJSA 2LVPC 2ZTDA 2EKKA 2G3QA 2JZ1A 1F4IA 2WZJA 1NV8A 1IM2A 1T6OA 1ZMUA 1WIVA 1WGLA 2LVQD 3BBZA 3IHPA 1E94E 1HQYE 1UFZA 2DAGA 1ZMWA 1WR1B 1HT2E 2KNVA 1OAIA 1ZV1A 2DHYA 2HAKA 1G4AE 2DZLA 2JY6B 4G3OA 4WP2A 2OOAA 2CP8A 1EFUB 1OTRA 2QSFX 1YLAA 1DO0A 1C7YA 2LVAA 2JP7A 1WGNA 1QZEA 2EKFA 4GEWA 2B3TA 2DAIA 1VEJA 3GLFE 1MN3A 1DV0A 1CUKA 4R71A 1WJ7A 1G41A 2DAEA 2OO9A 1GO5A 2LTUA 2BWEA 1ZMVA 2JY8A 4DBGB 2BWBA 2JY5A 2DAKA 1VQ1A 2DI0A 2LVNC 3GLIE 2LBCA 3FRHA 2R0IA 1R4GA 1IXSA 1SG9A 1P3QQ 2H5XA 1NV9A 3LCVB 2JUJA 1PGYA 3H4JA 3MMPA 2LVOC 1VDLA 2L2DA 5JI2E 2DNAA 2JNHA 4F2LA 3E46A 1T43A 1VG5A 1KYIA 1OKSA 2MR9A 3F92A 2QNJA 1Q02A 3K9PA 3GLGE 2K9DA 2K0BX 1IFYA 2L4FA 3K9OA 2KNZA 5DFLA 1OQYA 4UN2B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CWB A;  3IEC A;  1JR3 E;  2DEN A;  1BVS A;  1XB2 B;  2DAM A;  1HT1 E;  2MGW A;  2JY7 A;  2OOB A;  3T6P A;  3FE3 A;  3LCU A;  2QHO B;  2DKL A;  2ZTC A;  2O25 A;  1TTE A;  1HJP A;  2RRU A;  1WHC A;  1VEG A;  1TR8 A;  1A5T A;  3E21 A;  1Y8G A;  2MJ5 B;  2JZ0 A;  2L4E A;  1AIP C;  3B89 A;  2HWJ A;  3GLH E;  1G3I A;  4F1I A;  1VEK A;  4Q7J A;  1V92 A;  1DO2 A;  1XXH E;  4HEO A;  3FRI A;  2MRO B;  2KHH A;  2KNA A;  2EJS A;  2LVP C;  2ZTD A;  2EKK A;  2G3Q A;  2JZ1 A;  1F4I A;  2WZJ A;  1NV8 A;  1IM2 A;  1T6O A;  1ZMU A;  1WIV A;  1WGL A;  2LVQ D;  3BBZ A;  3IHP A;  1E94 E;  1HQY E;  1UFZ A;  2DAG A;  1ZMW A;  1WR1 B;  1HT2 E;  2KNV A;  1OAI A;  1ZV1 A;  2DHY A;  2HAK A;  1G4A E;  2DZL A;  2JY6 B;  4G3O A;  4WP2 A;  2OOA A;  2CP8 A;  1EFU B;  1OTR A;  2QSF X;  1YLA A;  1DO0 A;  1C7Y A;  2LVA A;  2JP7 A;  1WGN A;  1QZE A;  2EKF A;  4GEW A;  2B3T A;  2DAI A;  1VEJ A;  3GLF E;  1MN3 A;  1DV0 A;  1CUK A;  4R71 A;  1WJ7 A;  1G41 A;  2DAE A;  2OO9 A;  1GO5 A;  2LTU A;  2BWE A;  1ZMV A;  2JY8 A;  4DBG B;  2BWB A;  2JY5 A;  2DAK A;  1VQ1 A;  2DI0 A;  2LVN C;  3GLI E;  2LBC A;  3FRH A;  2R0I A;  1R4G A;  1IXS A;  1SG9 A;  1P3Q Q;  2H5X A;  1NV9 A;  3LCV B;  2JUJ A;  1PGY A;  3H4J A;  3MMP A;  2LVO C;  1VDL A;  2L2D A;  5JI2 E;  2DNA A;  2JNH A;  4F2L A;  3E46 A;  1T43 A;  1VG5 A;  1KYI A;  1OKS A;  2MR9 A;  3F92 A;  2QNJ A;  1Q02 A;  3K9P A;  3GLG E;  2K9D A;  2K0B X;  1IFY A;  2L4F A;  3K9O A;  2KNZ A;  5DFL A;  1OQY A;  4UN2 B; 
#chains in the Genus database with same CATH topology
 3SAV A;  2CWB A;  1JR3 E;  2ERC A;  2J5Y A;  2RKO A;  2AHM A;  2DWN A;  2ZM6 M;  3SFZ A;  4HL4 A;  2OOB A;  3HJ8 A;  1XMO M;  1N36 M;  2UU9 M;  3PFI A;  4KHP M;  2KDL A;  2QHO B;  3LCU A;  4TUW A;  4RNA A;  3I4V A;  4DR6 M;  2XFS A;  1TTE A;  2RRU A;  4ITQ A;  2K6B A;  2KW0 A;  4LRT A;  4X66 M;  5DNY A;  4LJA A;  5IRE B;  5EJC A;  5IWA M;  1A5T A;  4XBO A;  3E21 A;  1GLN A;  4PT5 A;  2HHH M;  2MJ5 B;  5EP4 A;  1IQP A;  3B7N A;  3B89 A;  4A3V B;  2CHQ A;  3LW5 F;  4L16 A;  4F1I A;  4DV1 M;  4G4O A;  2KXE A;  4GMQ A;  1XXH E;  1TGU A;  1SXJ A;  1OIP A;  4M0D A;  1IXS B;  1N77 A;  1OJL A;  2MRO B;  4FCV A;  2Y0Q A;  2C9O A;  4NOO B;  1D2N A;  5FTJ A;  1W5S A;  3KSJ A;  4Y28 F;  3RE8 A;  3GQ4 A;  4LG2 A;  4B3T M;  1XHB A;  2EKK A;  4CGY B;  3J80 S;  2JZ1 A;  3KOW E;  2WZJ A;  3KP0 E;  4DV6 M;  4LGY A;  3GQ5 A;  1WGL A;  3MK6 A;  4LJ8 A;  1DGH B;  4AG5 A;  2LVQ D;  2XLJ A;  5C1B A;  3VK8 A;  4DR2 M;  4NC6 A;  4GHA A;  2KA6 B;  4IBF A;  3FTD A;  2ZAO A;  2KNV A;  2ZAN A;  1ZV1 A;  1K82 A;  3U6Q A;  4G3O A;  2YFQ A;  3J7A S;  3HWS A;  3GLF A;  2QEN A;  3LQQ A;  1IBL M;  1MU5 A;  3U6L A;  1TH4 A;  4DV3 M;  3BOS A;  3RGP A;  5EXP A;  4M9X A;  4OVZ A;  4LJ5 A;  3KFU G;  1DO0 A;  3A98 B;  1N34 M;  2O5R A;  1I4W A;  2LVA A;  3SHG B;  1IN5 A;  3B7Z A;  1HNW M;  3I4Y A;  4JV5 M;  1QZE A;  2RGO A;  4GEW A;  5EP3 A;  1KSF X;  4QNR A;  3K92 A;  1JR3 A;  2XZU A;  3L28 A;  2DAE A;  4NL4 H;  3UGJ A;  3IG8 A;  7CAT A;  4JI4 M;  2BNK A;  3VKG A;  1T3T A;  4PDI A;  4IIW A;  3A45 A;  1IN6 A;  4CIS A;  2C99 A;  3NWL A;  4OU7 A;  2XFT A;  2JY5 A;  2Z4S A;  4G6Z A;  4RKU F;  2LVN C;  4PD2 A;  3GLI E;  4LFC M;  3UJN A;  1DGB A;  1E32 A;  5LMN M;  4DR4 M;  1IBM M;  4QOS A;  1SG9 A;  2QCU A;  1SXJ B;  1NV9 A;  3GQ3 A;  3AOE A;  1XMQ M;  4JI6 M;  4OX9 M;  3SHF A;  3KDS E;  4LJ9 A;  3H4J A;  3L2A A;  3MMP A;  4FW9 A;  1NHW C;  4FD2 A;  4YY3 M;  1L1T A;  2LVO C;  3M0E A;  3UMM A;  3RGS A;  3VK7 A;  1VDL A;  1TDZ A;  1SXJ C;  1L2B A;  5ITQ A;  3HU3 A;  3HHZ A;  1PJJ A;  5E6J A;  2MR9 A;  1R2Y A;  2QNJ A;  2C98 A;  4ZPX A;  1XNQ M;  2ZAM A;  1EIJ A;  5LMU M;  3C3D A;  3J7B A;  2OQ4 A;  1N32 M;  1OIZ A;  4JI1 M;  4BBA A;  1OQY A;  3FD9 A;  4GKJ M;  3GLF B;  1HR0 M;  3IEC A;  1LTM A;  2DAM A;  4GIP A;  4OVZ B;  4M9Z A;  2CV0 A;  2JY7 A;  3U61 A;  3AJI B;  2VF7 A;  3GLH A;  2R4E A;  4MGK E;  3HU1 A;  1NO1 A;  1HJP A;  2VQF M;  2K47 A;  3KXE C;  1VEG A;  3PNV A;  1E9S A;  5F3W A;  3TWL A;  4G4Q A;  2RGH A;  2LWX A;  1PM5 A;  1NY6 A;  1TH3 A;  3AV0 A;  4MM3 B;  5FTL A;  3NBI A;  1NY5 A;  1Y8G A;  4PCZ A;  5KPR A;  5FLX S;  3L26 A;  2F5S A;  5KO3 A;  5BPV A;  3JR5 A;  3GPX A;  4G4N A;  2OPF A;  2XEP A;  4JI3 M;  1L2D A;  2QZ4 A;  2C9C A;  4LF7 M;  3U6C A;  2QBY A;  4DV7 M;  4Q7J A;  3TQS A;  4XGI A;  3VLF B;  3FUT A;  3KW6 A;  3D8L A;  1NHG C;  5EP2 A;  1JQJ C;  4HEO A;  2NQ8 C;  4FCW A;  5L8R F;  3FRI A;  1VDD A;  2WSE F;  3GRU A;  5EXS A;  3HHX A;  3UZU A;  3HX3 A;  5ITX E;  4B3M M;  1QAM A;  2VF8 A;  1IN8 A;  2KHH A;  4AKG A;  3KSX A;  3SAW A;  4GKK M;  4RF0 A;  3Q8G A;  5IT9 S;  1NV8 A;  2Y0T A;  1WIV A;  2CFO A;  2YR0 A;  1QDT A;  3AOE C;  3SAR A;  1R7R A;  1SXJ D;  4B08 A;  3BBZ A;  4I8O A;  4LFA M;  3SYL A;  3JR4 A;  3U6P A;  3D8B A;  3SMP A;  3VFD A;  4QNM A;  1UFZ A;  3ZCB B;  3KVW A;  4FCT A;  1WR1 B;  4QOZ C;  3PXG A;  1N78 A;  2DHY A;  5FSW A;  4YHH M;  1G4A E;  1TDH A;  1IY2 A;  1IN7 A;  1NJF A;  4IBB A;  4IBC A;  3FUW A;  3L27 A;  5IZ7 D;  1I94 M;  4LZZ A;  3QYB A;  1ZAE A;  4AKH A;  2DWZ B;  2HKJ A;  2CP8 A;  1OTR A;  3FUX A;  3SAS A;  1Q39 A;  1YLA A;  1C7Y A;  2KZU A;  3L29 A;  1TH2 A;  2HL7 A;  2JP7 A;  3U61 B;  4IBI A;  4M9S A;  2EKF A;  3THG A;  1OAO C;  3GLH B;  2XGN A;  2KRK A;  3K2L A;  4R7G A;  1E9R A;  4L78 A;  4D81 A;  1MN3 A;  4G4R A;  3HKP A;  1GJT A;  4XK8 F;  1GO5 A;  2LTU A;  3ZH9 B;  4MB7 A;  2BWE A;  1PJQ A;  2WSF F;  1ZMV A;  2L6O A;  1PJS A;  2JY8 A;  1EE8 A;  4IJF A;  4M0W A;  2UUB M;  1R2Z A;  1Q3C A;  2BWB A;  4DR7 M;  2DI0 A;  1HNX M;  3FYD A;  3B74 A;  1QZM A;  4LF8 M;  2QBY B;  1JR3 D;  3I51 A;  2LBC A;  3CGW A;  4AQY M;  4Z8X A;  1IY0 A;  3GRR A;  1R4G A;  5E26 A;  3LCV B;  2ZBK B;  2KEB A;  1IY1 A;  5ITU A;  3GLG A;  4NSR A;  2D7E A;  2I7P A;  3HY5 A;  5KPZ A;  3OTO M;  5JI2 E;  1Z5C A;  5EXX A;  4B3S M;  1DGG A;  3J2P B;  2JNH A;  4F2L A;  2FE8 A;  1T43 A;  3QWL A;  5ITX A;  2N35 A;  3J27 B;  2R4J A;  2D7H A;  3FUU A;  4LGM A;  4LZJ A;  1J5E M;  4DV0 M;  2EUC A;  3KOZ E;  2K0B X;  4GC9 A;  4DV5 M;  1RU3 A;  1IN4 A;  3K9O A;  4P16 A;  3U6M A;  3FTF A;  4JYA M;  2KNZ A;  5DFL A;  1FJG M;  2L09 A;  4UN2 B;  3C3E A;  5BR8 M;  3U6D A;  1Z5B A;  3T1Y M;  4IBD A;  4NRV A;  2DEN A;  2M5Z A;  4B3R M;  2G8L A;  3PNY A;  3E4R A;  4W5W A;  3AL0 C;  1BVS A;  3KS4 A;  3SYK A;  3VKH A;  3GRY A;  1WXQ A;  3HHW A;  4L6V 6;  3T6P A;  4I5S A;  3FE3 A;  1XC8 A;  3DOA A;  2ZTC A;  4X65 M;  1N75 A;  2O25 A;  2EA0 A;  5A2Q S;  4II7 A;  1XXH A;  2R44 A;  1L8Q A;  2X8A A;  3VDU A;  1V34 A;  1R5L A;  3TPZ A;  2YNM D;  4D80 A;  3FUV A;  2CEA A;  2JZ0 A;  4P17 A;  2L4E A;  3M7G A;  3NBX X;  4DUZ M;  3CF0 A;  1GL7 A;  2GQF A;  4BB9 A;  2HWJ A;  5EP1 A;  2FH0 A;  4FWD A;  4I4L A;  2FFJ A;  2J7O A;  1X37 A;  4KO8 A;  4LCB A;  4MGY E;  3WHL A;  5C18 A;  1GAB A;  2MH8 A;  1DO2 A;  1MX0 A;  5GKN A;  3PVS A;  3W68 A;  2YQZ A;  3HU2 A;  8CAT A;  3A46 A;  1G59 A;  3KOY E;  3DZD A;  3GLG B;  2KNA A;  2EJS A;  2ZTD A;  2FS1 A;  4JI2 M;  4L15 A;  3HGI A;  2KZS A;  1LV7 A;  1T6O A;  1ZMU A;  2UXB M;  4NXN M;  4LJ7 A;  3FYC A;  2R45 A;  4LF6 M;  2CE7 A;  3IHP A;  1SXJ E;  2DZO B;  1E94 E;  4B7G A;  4S12 A;  1HQY E;  3B9P A;  3HJS A;  1ZMW A;  5EXT A;  1HT2 E;  1D0M A;  1YSY A;  2JY6 B;  2HAK A;  4IBE A;  3U60 A;  3FTE A;  4DR1 M;  4WP2 A;  3DFZ A;  2W82 A;  3Q8X A;  2DWM A;  3BXW A;  3FKE A;  3GPU A;  2VQE M;  2QSF X;  1EFU B;  2V1C A;  2QPA A;  4MGZ E;  2DVW B;  1Z59 A;  2R6F A;  2LHC A;  3LVV A;  1N33 M;  3KS8 A;  3C58 A;  2CUZ A;  3GLI A;  2M60 A;  3GPP A;  2DAI A;  3GLF E;  4JXJ A;  1G8P A;  3HZJ A;  1WJ7 A;  1G41 A;  2CHV A;  2Q2E B;  3R8F A;  1OFH A;  1XXH B;  2CHG A;  2XSZ A;  3H4M A;  4B7H A;  3JAM S;  2LH0 A;  4K0K M;  3QYE A;  5EQT A;  4LFB M;  3GP1 A;  2R18 A;  1ZQ9 A;  1G71 A;  2LHG A;  3DA1 A;  3V76 A;  5JI3 E;  4JI8 M;  2X4A A;  1ORY B;  1R6B X;  4KT0 F;  4AI6 A;  4IBJ A;  4B7F A;  3UK6 A;  3FRH A;  4PDG A;  1S3S A;  3HHY A;  4NRW A;  4X62 M;  2Z3X A;  2H5X A;  1P3Q Q;  3C9P A;  1JB0 F;  2JUJ A;  3TWM A;  1PGY A;  2XF3 A;  4IJE A;  4AKI A;  3U6O A;  1K3W A;  2VDB B;  3AKZ A;  3U6E A;  1L2C A;  3T38 A;  4RF1 A;  1Q3B A;  2L2D A;  3J81 S;  1QDR A;  3CTW B;  4EIW A;  4DR5 M;  2DNA A;  1QVR A;  2CRU A;  2QQ8 A;  1VG5 A;  1OKS A;  3F92 A;  2APL A;  1NVM A;  1Q02 A;  4OW0 A;  3K9P A;  3GRV A;  1QAO A;  4MGI E;  3AFH A;  2K9D A;  3A42 A;  3WHK A;  2L4F A;  2WSC F;  2DHR A;  2JWS A;  4WUR A;  3T1H M;  3U60 B;  4HLQ A;  4BLC A;  2UUC M;  1GJS A;  1PRB A;  4IBK A;  1QYR A;  1J7K A;  4LJ4 A;  5ITY A;  4DV4 M;  3SAT A;  2UXC M;  3R9X B;  1XB2 B;  2FNA A;  1W5T A;  3EIE A;  3E9S A;  1HT1 E;  2MGW A;  4REZ A;  2F5N A;  3T15 A;  3K8Z A;  4NSO B;  2Y21 A;  3SC3 A;  3ZQJ A;  1HQC A;  2F5Q A;  3U5Z A;  5ITR A;  4MGH A;  2DKL A;  1GL6 A;  4FVM A;  5DYI A;  3GLI B;  1WHC A;  2CV1 A;  2O01 F;  2R46 A;  4LF5 M;  3L25 A;  4JI5 M;  3CF2 A;  1QQW A;  1TR8 A;  4QHT A;  1YUB A;  3FTC A;  2R65 A;  2L7I A;  4CIZ A;  3SMS A;  1D0K A;  4AG6 A;  2L7H A;  3W0F A;  4LY6 A;  1AIP C;  3W0L B;  2D7G A;  3GLH E;  2DZN B;  1G3I A;  4CJ6 A;  4LRS A;  4L4U A;  4LJ6 A;  4JI0 M;  3SAU A;  1VEK A;  3GO8 A;  1V92 A;  2FOI C;  2UUA M;  5KQ8 A;  1NNJ A;  1QUS A;  3LVW A;  4FWG A;  1QAN A;  2V1U A;  2VII A;  4GC5 A;  1K3X A;  2BJV A;  2LVP C;  3M6A A;  3KP1 E;  4QHS A;  4NXM M;  1J09 A;  2G3Q A;  1F4I A;  1PJT A;  1IM2 A;  1NSF A;  2JA2 A;  2J7N A;  5FTM A;  3EIH A;  4GH9 A;  2UXD M;  2V6Z M;  4KOD A;  1FNN A;  2DAG A;  5DYG A;  1PJI A;  2C5R A;  1QUT A;  5ITT A;  1OAI A;  2BJW A;  4AW4 A;  2DZL A;  3I04 M;  2C96 A;  1C1K A;  4KLN A;  3ZC7 B;  4IBG A;  2EO2 A;  4WW0 A;  2DXI A;  1AUA A;  1IXR C;  3CF6 E;  3B7Q A;  3VDP A;  4DUY M;  3QAU A;  2OOA A;  4I81 A;  4R3D A;  2P5T A;  5H37 D;  4DV2 M;  1KFV A;  2CV2 A;  4L8R C;  4GHL A;  4D82 A;  2XZF A;  3GPY A;  1IBK M;  4ANR A;  1Z5A A;  4JN6 A;  1WGN A;  2F5P A;  2XH9 A;  1YE9 A;  2R62 A;  3U5Z B;  3ILK A;  2B3T A;  4DR3 M;  1H6U A;  2E5L M;  1V33 A;  2LNH C;  1VEJ A;  4CHT B;  1DV0 A;  1CUK A;  4R71 A;  2OO9 A;  2DWL A;  4LF4 M;  1XWI A;  3AOG A;  1XNR M;  2Z7J A;  2Z8Y M;  4Z6Y A;  3RFW A;  4GIT A;  3W67 A;  3TWK A;  2GNO A;  4DBG B;  3LQR A;  2X49 A;  3MJ5 A;  2DAK A;  1VQ1 A;  3SBJ A;  2I7N A;  1GVN A;  4GRI A;  4AZF A;  1D0L A;  1IXZ A;  3K1J A;  2Y20 A;  1HNZ M;  2R0I A;  4FWH A;  2XSZ D;  1IXS A;  1DGF A;  3KOX E;  4LF9 M;  4X64 M;  1OFI A;  1UM8 A;  1NJG A;  2Z4R A;  5FTK A;  5FTN A;  1Z6T A;  2QP9 X;  2G5G X;  3LMM A;  3TL4 X;  3MHV C;  2JXN A;  3U6S A;  2F5O A;  1DGH A;  3E46 A;  2H1R A;  1TF0 B;  3TE6 A;  1KYI A;  5KPT A;  2LXE A;  4JI7 M;  1MJG M;  3I01 M;  3GLG E;  5KQD A;  3IG5 A;  2HCB A;  1IFY A;  4MH0 E;  2F4V M;  2KRU A;  3HJQ A;  2A5Y B;  1GKI A;  1NNU C;  1L1Z A;  1QAQ A; 
#chains in the Genus database with same CATH homology
 2CWB A;  3IEC A;  1JR3 E;  2DEN A;  1BVS A;  1XB2 B;  2DAM A;  1HT1 E;  2MGW A;  2JY7 A;  2OOB A;  3T6P A;  3FE3 A;  3LCU A;  2QHO B;  2DKL A;  2ZTC A;  2O25 A;  1TTE A;  1HJP A;  2RRU A;  1WHC A;  1VEG A;  1TR8 A;  1A5T A;  3E21 A;  1Y8G A;  2MJ5 B;  2JZ0 A;  2L4E A;  1AIP C;  3B89 A;  2HWJ A;  3GLH E;  1G3I A;  4F1I A;  1VEK A;  4Q7J A;  1V92 A;  1DO2 A;  1XXH E;  4HEO A;  3FRI A;  2MRO B;  2KHH A;  2KNA A;  2EJS A;  2LVP C;  2ZTD A;  2EKK A;  2G3Q A;  2JZ1 A;  1F4I A;  2WZJ A;  1NV8 A;  1IM2 A;  1T6O A;  1ZMU A;  1WIV A;  1WGL A;  2LVQ D;  3BBZ A;  3IHP A;  1E94 E;  1HQY E;  1UFZ A;  2DAG A;  1ZMW A;  1WR1 B;  1HT2 E;  2KNV A;  1OAI A;  1ZV1 A;  2DHY A;  2HAK A;  1G4A E;  2DZL A;  2JY6 B;  4G3O A;  4WP2 A;  2OOA A;  2CP8 A;  1EFU B;  1OTR A;  2QSF X;  1YLA A;  1DO0 A;  1C7Y A;  2LVA A;  2JP7 A;  1WGN A;  1QZE A;  2EKF A;  4GEW A;  2B3T A;  2DAI A;  1VEJ A;  3GLF E;  1MN3 A;  1DV0 A;  1CUK A;  4R71 A;  1WJ7 A;  1G41 A;  2DAE A;  2OO9 A;  1GO5 A;  2LTU A;  2BWE A;  1ZMV A;  2JY8 A;  4DBG B;  2BWB A;  2JY5 A;  2DAK A;  1VQ1 A;  2DI0 A;  2LVN C;  3GLI E;  2LBC A;  3FRH A;  2R0I A;  1R4G A;  1IXS A;  1SG9 A;  1P3Q Q;  2H5X A;  1NV9 A;  3LCV B;  2JUJ A;  1PGY A;  3H4J A;  3MMP A;  2LVO C;  1VDL A;  2L2D A;  5JI2 E;  2DNA A;  2JNH A;  4F2L A;  3E46 A;  1T43 A;  1VG5 A;  1KYI A;  1OKS A;  2MR9 A;  3F92 A;  2QNJ A;  1Q02 A;  3K9P A;  3GLG E;  2K9D A;  2K0B X;  1IFY A;  2L4F A;  3K9O A;  2KNZ A;  5DFL A;  1OQY A;  4UN2 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...