1WIVA

Solution structure of rsgi ruh-023, a uba domain from arabidopsis cdna
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
73
structure length
73
Chain Sequence
GSSGSSGLLSHMDDPDIDAPISHQTSDIDQSSVDTLLSFGFAEDVARKALKASGGDIEKATDWVFNNSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ubiquitin-specific protease 14
publication title solution structure of RSGI RUH-023, a UBA domain from Arabidopsis cDNA
rcsb
source organism Arabidopsis thaliana
molecule tags Structural genomics, unknown function
total genus 11
structure length 73
sequence length 73
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2004-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00627 UBA UBA/TS-N domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 1wivA00
3LCVB 1WGLA 2DENA 2KHHA 3MMPA 2OO9A 1EFUB 3K9OA 1T6OA 1WJ7A 1WGNA 2JY5A 1C7YA 4DBGB 1TTEA 1HT1E 2WZJA 5DFLA 2MJ5B 2G3QA 1ZV1A 1IXSA 2KNZA 1VEKA 2K0BX 2DZLA 4WP2A 3GLGE 2ZTDA 1CUKA 2KNAA 2KNVA 2H5XA 1GO5A 2LBCA 2CP8A 1PGYA 1XXHE 3K9PA 1ZMWA 2OOAA 2B3TA 1NV8A 3FE3A 2DHYA 2L4EA 2JY8A 1DO0A 2JZ1A 2RRUA 1OQYA 2CWBA 1DV0A 2MR9A 2R0IA 3E46A 2JNHA 2K9DA 1G4AE 1E94E 2JP7A 3FRHA 2EJSA 2JY6B 2ZTCA 2LVAA 1JR3E 1DO2A 2O25A 1OTRA 1VEJA 1HT2E 1SG9A 3GLFE 1P3QQ 2DAKA 2EKFA 2LVPC 2JZ0A 2DAIA 2LVOC 1XB2B 3E21A 1V92A 2LVQD 3H4JA 4F2LA 2DAMA 1AIPC 3B89A 3LCUA 2BWBA 2MGWA 4HEOA 1ZMVA 2DI0A 2LTUA 3F92A 4UN2B 4R71A 2L2DA 2QSFX 1IFYA 2JY7A 1R4GA 2BWEA 4F1IA 1OKSA 1UFZA 1Y8GA 1ZMUA 1T43A 5JI2E 1YLAA 2HWJA 1F4IA 3FRIA 1QZEA 1NV9A 1HJPA 3IHPA 2MROB 3IECA 1KYIA 1G3IA 1VQ1A 2QHOB 1OAIA 2HAKA 2QNJA 4GEWA 4Q7JA 3BBZA 3T6PA 1WIVA 2DAGA 1VEGA 3GLIE 1BVSA 1WR1B 1Q02A 2JUJA 2DAEA 1WHCA 1HQYE 1MN3A 1A5TA 2OOBA 1IM2A 2L4FA 2EKKA 2DKLA 1VDLA 2DNAA 4G3OA 3GLHE 1VG5A 2LVNC 1TR8A 1G41A
chains in the Genus database with same CATH superfamily
4FD2A 1TH3A 1WGLA 3HJ8A 2DENA 3JR4A 4Y28F 4D82A 4LY6A 5EP4A 4DR4M 4M9SA 2JY5A 3AJIB 4JI2M 3UJNA 1NVMA 3GQ4A 4JYAM 4DBGB 3LMMA 4CIZA 1HT1E 2X8AA 2QPAA 1HQCA 2A5YB 3I51A 4IBBA 3FTFA 1L8QA 1VEKA 1OJLA 2DZLA 4PD2A 3VK7A 3PVSA 4IIWA 4G4OA 1LTMA 3B7NA 2JA2A 4DV7M 2UXBM 3L29A 3GLFB 3HU1A 4K0KM 1L2BA 1PGYA 4B7HA 1QAQA 3D8BA 3K9PA 3JR5A 2DWMA 1UM8A 1Z6TA 2ZANA 1YUBA 1XXHB 1ZMWA 3ILKA 4FCTA 3M0EA 3SFZA 1K82A 1XMOM 1G59A 3QWLA 2RGHA 3GLIA 4G4QA 2L4EA 2JY8A 4DV5M 5EQTA 4NXMM 2XF3A 3TWLA 4FCWA 1JR3D 4L15A 1DV0A 4JI4M 4XGIA 3Q8GA 3DFZA 3RGPA 1Z59A 1E94E 1ZQ9A 4NL4H 1IXSB 2EJSA 4JI8M 2ZTCA 3UZUA 1IXZA 2LVAA 2RGOA 3HJSA 5IREB 5ITTA 1DO2A 1QYRA 1GJTA 4LZZA 1GABA 1HT2E 1NY5A 2FOIC 2R44A 4LG2A 3U6MA 4FW9A 1T3TA 2ERCA 4OW0A 2F5SA 2KZUA 2JZ0A 1JQJC 3HHZA 3GPYA 2LVOC 3E21A 3KDSE 1G8PA 1V92A 1Z5CA 2LVQD 3HU3A 4IBKA 4LJ5A 4P16A 4F2LA 3L26A 2F5NA 2DXIA 1C1KA 3GPUA 1R2YA 3SMPA 7CATA 1IN4A 4UN2B 2F5PA 4R71A 1PJQA 3HJQA 3B7QA 3U61A 3SC3A 3KS4A 2JY7A 1K3WA 1DGHA 2BWEA 4FWDA 4MGKE 3J27B 3SHFA 4F1IA 3U5ZA 4IBCA 1Y8GA 1ZMUA 4KODA 4CJ6A 3L27A 1YLAA 3K92A 3ZCBB 4DR6M 2R18A 3J2PB 4LRSA 5KQ8A 3HHXA 3TPZA 1FJGM 4BLCA 1HJPA 2P5TA 5FLXS 3DA1A 1NJGA 4DR5M 4EIWA 2J7OA 1QVRA 1E9SA 1QZMA 1MU5A 5EJCA 1G3IA 5E26A 4JI6M 1OAIA 2ZBKB 4JI7M 4L4UA 1R5LA 3BBZA 1QUSA 3MK6A 5KPZA 3FTEA 1Q39A 2DAGA 4M9ZA 3GLIE 2UU9M 1RU3A 1BVSA 2D7HA 2XH9A 4OVZB 5A2QS 1Q02A 3KVWA 1PJJA 3AL0C 4KLNA 3V76A 4OU7A 1NY6A 1QQWA 3WHKA 4HL4A 2R65A 1MN3A 3T15A 1EE8A 1PJTA 3R9XB 2APLA 2L6OA 4MH0E 1NNJA 3B7ZA 3EIHA 5EXXA 3K1JA 4LRTA 3TL4X 2OQ4A 1DGGA 4JXJA 2EKKA 1OFHA 4B3MM 2DKLA 1VDLA 2Z8YM 4RF1A 1JR3A 5ITUA 3KOYE 4XBOA 1VG5A 2LVNC 5FSWA 4B7GA 2Z7JA 3LCVB 5DYGA 3QYEA 3ZH9B 4B3TM 4LFCM 1T6OA 2KDLA 1WGNA 2EO2A 2LWXA 4HLQA 3UK6A 4II7A 1NHGC 1XHBA 4JI5M 4L6V6 4DV0M 1C7YA 2G5GX 2RKOA 2LNHC 3R8FA 1IY1A 3CF0A 1VDDA 4IBGA 1SXJC 2G3QA 1DGFA 5E6JA 4JI0M 1ZV1A 3AKZA 3GRUA 2KNZA 2CHQA 2Z4SA 5EXPA 2DZNB 4WP2A 4REZA 3GLGE 1L2DA 2UUAM 3DZDA 4NOOB 2FE8A 2VIIA 3LVVA 2VF7A 1GO5A 2HCBA 3QYBA 2LBCA 2NQ8C 4DR2M 1N33M 1NNUC 4GC9A 3A98B 2BNKA 3FUXA 4LF5M 2EA0A 3VKHA 4IJEA 4X64M 3KFUG 1XNQM 1NV8A 2GQFA 2WSEF 2Y20A 3FE3A 4CISA 2DHYA 2KXEA 2QENA 4DUZM 3U60A 1L2CA 1D0LA 1DO0A 2K6BA 2XFSA 3Q8XA 2RRUA 4LJ6A 4AKIA 1OQYA 2CWBA 4LFAM 2YNMD 2K47A 3GP1A 2JNHA 2CFOA 5EP2A 1D0KA 2FS1A 3E4RA 3HX3A 5EXTA 3MHVC 5GKNA 3A42A 3C3DA 4IBEA 3VFDA 4BBAA 1PM5A 1JR3E 2CHGA 2O25A 1OTRA 3T1HM 4R7GA 3SYLA 3VK8A 1SG9A 2QQ8A 1WXQA 1P3QQ 3KOWE 2LVPC 3GLHA 1SXJA 4QHSA 2UUCM 4NSRA 1GLNA 3AV0A 2AHMA 4D80A 1EIJA 1KFVA 4PDGA 2DAMA 3GQ5A 1FNNA 3SASA 2ZM6M 2MGWA 2X49A 3GLIB 2DI0A 2LTUA 3F92A 4M0DA 1TH4A 1R2ZA 5FTKA 1IFYA 2KRKA 2WSCF 1QAOA 2R6FA 1N32M 1GL6A 1OKSA 3IG8A 3LQRA 2JWSA 4LJAA 1QUTA 1PJIA 1F4IA 2V6ZM 3AOEC 3FRIA 4M0WA 2CV0A 1QZEA 1NV9A 2L7IA 2DWLA 4GC5A 2MROB 3U6DA 3SHGB 5KO3A 2UUBM 1KYIA 3LQQA 3HHWA 1OAOC 1QDRA 2HAKA 2QHOB 2QNJA 4Q7JA 5FTNA 4A3VB 3U6LA 2C98A 1XXHA 3KS8A 3T6PA 3U6PA 3FKEA 1IY0A 3PFIA 5EP1A 5BR8M 4AKHA 2LH0A 3BXWA 4Z6YA 3CGWA 4AKGA 2F4VM 3KP1E 2V1CA 1TDZA 1YE9A 4QOSA 4DV3M 3U61B 1WHCA 4L78A 1HQYE 5DNYA 1DGHB 2KRUA 3B9PA 3TWKA 3U5ZB 3SBJA 4LGYA 1IM2A 1Z5AA 1MJGM 3I04M 4QNRA 3J7AS 3GRVA 2DWNA 3GLGA 2YQZA 3U6CA 4LF8M 2Z4RA 3LVWA 3GLHE 4I8OA 1SXJE 1HR0M 1R7RA 3L2AA 3HZJA 4LF6M 1G41A 3VKGA 2R46A 5IWAM 3K8ZA 1HNWM 5KQDA 2X4AA 3VDPA 4G6ZA 3W67A 4LGMA 1TH2A 2OO9A 1EFUB 1OFIA 3K9OA 1WJ7A 2L09A 3KSXA 4GITA 3GRRA 3AFHA 1TTEA 2WZJA 2H1RA 1PRBA 4MM3B 5KPTA 4GHAA 1R6BX 3ZC7B 3U6QA 4GKKM 1SXJD 1J5EM 3HKPA 3VDUA 4KT0F 1ZAEA 2UXCM 2ZAOA 2H5XA 3U6OA 3HHYA 2QBYA 4ZPXA 5EP3A 2CP8A 4M9XA 4MGZE 2C9OA 4LJ4A 3SYKA 1XXHE 2M5ZA 2V1UA 2R62A 3EIEA 4W5WA 1IN8A 4PT5A 2L7HA 2O5RA 4AW4A 4RNAA 2Z3XA 2DWZB 3FTCA 4PDIA 1I94M 4FWGA 4PCZA 3M7GA 3I4VA 5FTJA 2LHCA 2MR9A 2W82A 3E46A 2K9DA 3KW6A 1TF0B 1W5SA 4R3DA 3THGA 1G4AE 2FFJA 4LCBA 2JP7A 2F5QA 3SATA 1I4WA 4NRVA 4XK8F 4AZFA 1XC8A 3L25A 2C96A 2VQEM 2G8LA 1TGUA 3J80S 2J5YA 3CF2A 4DV6M 2HKJA 4I4LA 4KHPM 4JN6A 2DAIA 2Y0TA 4NC6A 1YSYA 1S3SA 4IBIA 1XB2B 4B7FA 3GQ3A 3H4JA 2LHGA 4IJFA 4CHTB 4D81A 1AIPC 4QNMA 3LCUA 1L1TA 1GKIA 4HEOA 2XLJA 3FUVA 1IN5A 1OIZA 2CRUA 3WHLA 1NHWC 3NWLA 2CE7A 1N78A 4AG6A 4TUWA 1QDTA 3MJ5A 1UFZA 2R4EA 8CATA 5DYIA 4X62M 2QCUA 4IBDA 5JI2E 3KSJA 2CHVA 1XWIA 2QP9X 1N36M 4B3RM 3IHPA 3KP0E 3I01M 3H4MA 5ITXE 3W0FA 3GLHB 1SXJB 3FUUA 2FH0A 1VQ1A 4BB9A 1L1ZA 4RF0A 3UGJA 4L16A 4OX9M 4AI6A 1VEGA 3FUTA 4MB7A 5ITQA 2EUCA 4QHTA 2Y0QA 3GO8A 3T38A 3KXEC 1N77A 3FYDA 2C5RA 1A5TA 2Q2EB 2OPFA 4JI1M 5LMUM 2OOBA 1GVNA 2CUZA 2JXNA 2VF8A 2L4FA 3NBIA 4L8RC 4DV4M 4LF7M 3FD9A 4WURA 4IBFA 5FTMA 3RFWA 1V33A 4G3OA 2XSZA 5L8RF 1AUAA 2J7NA 3GLFA 4I5SA 4B08A 4LJ7A 3PXGA 1TR8A 2LXEA 5KPRA 1QAMA 2CEAA 2KHHA 3MMPA 2I7PA 4JI3M 2MH8A 4DR3M 1XNRM 4CGYB 3E9SA 3FTDA 3KOZE 3IG5A 3CF6E 3HGIA 2KA6B 3I4YA 1IN6A 4LJ9A 3U6EA 1NSFA 2XGNA 2C9CA 2DZOB 2ZAMA 3HWSA 5DFLA 2MJ5B 4GMQA 4X66M 4ITQA 1OIPA 1NO1A 1IXSA 3UMMA 3FYCA 4LZJA 2K0BX 1J7KA 2M60A 3A45A 2ZTDA 1JB0F 3BOSA 1CUKA 1N34M 2D7GA 4P17A 2O01F 3LW5F 3GLGB 1LV7A 5IT9S 4WW0A 2KNAA 2KNVA 3SAWA 4GIPA 1GL7A 1E32A 1IXRC 2YFQA 4G4RA 1HNXM 5C18A 3J81S 3TQSA 4AG5A 2XFTA 2Y21A 3PNVA 4GHLA 4RKUF 1GJSA 2OOAA 1W5TA 2B3TA 4MGHA 3AOEA 1X37A 3GPPA 1IN7A 2I7NA 2JZ1A 4LFBM 2KZSA 4GKJM 2DHRA 3C3EA 3AOGA 1QANA 5BPVA 2HHHM 1PJSA 2E5LM 1D2NA 3SAVA 2R0IA 3PNYA 3VLFB 1IBKM 3FRHA 1Z5BA 2JY6B 2N35A 4NXNM 2FNAA 4IBJA 4LF4M 5IZ7D 3TWMA 1VEJA 2QZ4A 4JV5M 3GLFE 4FVMA 3SAUA 2DAKA 4DUYM 2QBYB 2EKFA 1MX0A 4AQYM 3KOXE 4X65M 4GRIA 2C99A 2CV1A 3JAMS 5ITRA 1Q3CA 3K2LA 5ITXA 1TDHA 5JI3E 3U6SA 4DR7M 1G71A 4Z8XA 4LF9M 3GPXA 5LMNM 2YR0A 3B89A 1K3XA 5C1BA 2BWBA 3W0LB 4GH9A 4OVZA 2R45A 1IBLM 1ZMVA 3CTWB 4NSOB 2L2DA 2QSFX 2XEPA 4B3SM 4YY3M 4LJ8A 1R4GA 3B74A 3TE6A 2VQFM 1DGBA 2XSZD 3M6AA 5FTLA 5H37D 4DR1M 3HY5A 1T43A 1IY2A 1E9RA 2HWJA 2XZFA 1XMQM 4QOZC 1ORYB 1NJFA 4KO8A 4S12A 3GRYA 2UXDM 1HNZM 2GNOA 5EXSA 3J7BA 2KEBA 2WSFF 3IECA 3HU2A 3RGSA 3SARA 5F3WA 4GEWA 1H6UA 3FUWA 1V34A 3SMSA 3W68A 3ZQJA 1WIVA 4DV1M 2BJWA 4DV2M 2CV2A 3C9PA 3C58A 1WR1B 1N75A 1KSFX 1J09A 1Q3BA 2JUJA 2DAEA 3NBXX 4I81A 3U60B 1IBMM 2KW0A 4FWHA 3A46A 3QAUA 2XZUA 4NRWA 2R4JA 3RE8A 3D8LA 4ANRA 3DOAA 1D0MA 3L28A 4MGIE 5ITYA 2F5OA 2D7EA 2DNAA 2DVWB 4YHHM 2BJVA 1IQPA 3OTOM 4FCVA 4MGYE 4G4NA 3T1YM 2HL7A 2VDBB
chains in the Genus database with same CATH topology
3LCVB 1WGLA 2DENA 2KHHA 3MMPA 2OO9A 1EFUB 3K9OA 1T6OA 1WJ7A 1WGNA 2JY5A 1C7YA 4DBGB 1TTEA 1HT1E 2WZJA 5DFLA 2MJ5B 2G3QA 1ZV1A 1IXSA 2KNZA 1VEKA 2K0BX 2DZLA 4WP2A 3GLGE 2ZTDA 1CUKA 2KNAA 2KNVA 2H5XA 1GO5A 2LBCA 2CP8A 1PGYA 1XXHE 3K9PA 1ZMWA 2OOAA 2B3TA 1NV8A 3FE3A 2DHYA 2L4EA 2JY8A 1DO0A 2JZ1A 2RRUA 1OQYA 2CWBA 1DV0A 2MR9A 2R0IA 3E46A 2JNHA 2K9DA 1G4AE 1E94E 2JP7A 3FRHA 2EJSA 2JY6B 2ZTCA 2LVAA 1JR3E 1DO2A 2O25A 1OTRA 1VEJA 1HT2E 1SG9A 3GLFE 1P3QQ 2DAKA 2EKFA 2LVPC 2JZ0A 2DAIA 2LVOC 1XB2B 3E21A 1V92A 2LVQD 3H4JA 4F2LA 2DAMA 1AIPC 3B89A 3LCUA 2BWBA 2MGWA 4HEOA 1ZMVA 2DI0A 2LTUA 3F92A 4UN2B 4R71A 2L2DA 2QSFX 1IFYA 2JY7A 1R4GA 2BWEA 4F1IA 1OKSA 1UFZA 1Y8GA 1ZMUA 1T43A 5JI2E 1YLAA 2HWJA 1F4IA 3FRIA 1QZEA 1NV9A 1HJPA 3IHPA 2MROB 3IECA 1KYIA 1G3IA 1VQ1A 2QHOB 1OAIA 2HAKA 2QNJA 4GEWA 4Q7JA 3BBZA 3T6PA 1WIVA 2DAGA 1VEGA 3GLIE 1BVSA 1WR1B 1Q02A 2JUJA 2DAEA 1WHCA 1HQYE 1MN3A 1A5TA 2OOBA 1IM2A 2L4FA 2EKKA 2DKLA 1VDLA 2DNAA 4G3OA 3GLHE 1VG5A 2LVNC 1TR8A 1G41A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LCV B;  1WGL A;  2DEN A;  2KHH A;  3MMP A;  2OO9 A;  1EFU B;  3K9O A;  1T6O A;  1WJ7 A;  1WGN A;  2JY5 A;  1C7Y A;  4DBG B;  1TTE A;  1HT1 E;  2WZJ A;  5DFL A;  2MJ5 B;  2G3Q A;  1ZV1 A;  1IXS A;  2KNZ A;  1VEK A;  2K0B X;  2DZL A;  4WP2 A;  3GLG E;  2ZTD A;  1CUK A;  2KNA A;  2KNV A;  2H5X A;  1GO5 A;  2LBC A;  2CP8 A;  1PGY A;  1XXH E;  3K9P A;  1ZMW A;  2OOA A;  2B3T A;  1NV8 A;  3FE3 A;  2DHY A;  2L4E A;  2JY8 A;  1DO0 A;  2JZ1 A;  2RRU A;  1OQY A;  2CWB A;  1DV0 A;  2MR9 A;  2R0I A;  3E46 A;  2JNH A;  2K9D A;  1G4A E;  1E94 E;  2JP7 A;  3FRH A;  2EJS A;  2JY6 B;  2ZTC A;  2LVA A;  1JR3 E;  1DO2 A;  2O25 A;  1OTR A;  1VEJ A;  1HT2 E;  1SG9 A;  3GLF E;  1P3Q Q;  2DAK A;  2EKF A;  2LVP C;  2JZ0 A;  2DAI A;  2LVO C;  1XB2 B;  3E21 A;  1V92 A;  2LVQ D;  3H4J A;  4F2L A;  2DAM A;  1AIP C;  3B89 A;  3LCU A;  2BWB A;  2MGW A;  4HEO A;  1ZMV A;  2DI0 A;  2LTU A;  3F92 A;  4UN2 B;  4R71 A;  2L2D A;  2QSF X;  1IFY A;  2JY7 A;  1R4G A;  2BWE A;  4F1I A;  1OKS A;  1UFZ A;  1Y8G A;  1ZMU A;  1T43 A;  5JI2 E;  1YLA A;  2HWJ A;  1F4I A;  3FRI A;  1QZE A;  1NV9 A;  1HJP A;  3IHP A;  2MRO B;  3IEC A;  1KYI A;  1G3I A;  1VQ1 A;  2QHO B;  1OAI A;  2HAK A;  2QNJ A;  4GEW A;  4Q7J A;  3BBZ A;  3T6P A;  1WIV A;  2DAG A;  1VEG A;  3GLI E;  1BVS A;  1WR1 B;  1Q02 A;  2JUJ A;  2DAE A;  1WHC A;  1HQY E;  1MN3 A;  1A5T A;  2OOB A;  1IM2 A;  2L4F A;  2EKK A;  2DKL A;  1VDL A;  2DNA A;  4G3O A;  3GLH E;  1VG5 A;  2LVN C;  1TR8 A;  1G41 A; 
#chains in the Genus database with same CATH topology
 4FD2 A;  1TH3 A;  1WGL A;  3HJ8 A;  2DEN A;  3JR4 A;  4Y28 F;  4D82 A;  4LY6 A;  5EP4 A;  4DR4 M;  4M9S A;  2JY5 A;  3AJI B;  4JI2 M;  3UJN A;  1NVM A;  3GQ4 A;  4JYA M;  4DBG B;  3LMM A;  4CIZ A;  1HT1 E;  2X8A A;  2QPA A;  1HQC A;  2A5Y B;  3I51 A;  4IBB A;  3FTF A;  1L8Q A;  1VEK A;  1OJL A;  2DZL A;  4PD2 A;  3VK7 A;  3PVS A;  4IIW A;  4G4O A;  1LTM A;  3B7N A;  2JA2 A;  4DV7 M;  2UXB M;  3L29 A;  3GLF B;  3HU1 A;  4K0K M;  1L2B A;  1PGY A;  4B7H A;  1QAQ A;  3D8B A;  3K9P A;  3JR5 A;  2DWM A;  1UM8 A;  1Z6T A;  2ZAN A;  1YUB A;  1XXH B;  1ZMW A;  3ILK A;  4FCT A;  3M0E A;  3SFZ A;  1K82 A;  1XMO M;  1G59 A;  3QWL A;  2RGH A;  3GLI A;  4G4Q A;  2L4E A;  2JY8 A;  4DV5 M;  5EQT A;  4NXM M;  2XF3 A;  3TWL A;  4FCW A;  1JR3 D;  4L15 A;  1DV0 A;  4JI4 M;  4XGI A;  3Q8G A;  3DFZ A;  3RGP A;  1Z59 A;  1E94 E;  1ZQ9 A;  4NL4 H;  1IXS B;  2EJS A;  4JI8 M;  2ZTC A;  3UZU A;  1IXZ A;  2LVA A;  2RGO A;  3HJS A;  5IRE B;  5ITT A;  1DO2 A;  1QYR A;  1GJT A;  4LZZ A;  1GAB A;  1HT2 E;  1NY5 A;  2FOI C;  2R44 A;  4LG2 A;  3U6M A;  4FW9 A;  1T3T A;  2ERC A;  4OW0 A;  2F5S A;  2KZU A;  2JZ0 A;  1JQJ C;  3HHZ A;  3GPY A;  2LVO C;  3E21 A;  3KDS E;  1G8P A;  1V92 A;  1Z5C A;  2LVQ D;  3HU3 A;  4IBK A;  4LJ5 A;  4P16 A;  4F2L A;  3L26 A;  2F5N A;  2DXI A;  1C1K A;  3GPU A;  1R2Y A;  3SMP A;  7CAT A;  1IN4 A;  4UN2 B;  2F5P A;  4R71 A;  1PJQ A;  3HJQ A;  3B7Q A;  3U61 A;  3SC3 A;  3KS4 A;  2JY7 A;  1K3W A;  1DGH A;  2BWE A;  4FWD A;  4MGK E;  3J27 B;  3SHF A;  4F1I A;  3U5Z A;  4IBC A;  1Y8G A;  1ZMU A;  4KOD A;  4CJ6 A;  3L27 A;  1YLA A;  3K92 A;  3ZCB B;  4DR6 M;  2R18 A;  3J2P B;  4LRS A;  5KQ8 A;  3HHX A;  3TPZ A;  1FJG M;  4BLC A;  1HJP A;  2P5T A;  5FLX S;  3DA1 A;  1NJG A;  4DR5 M;  4EIW A;  2J7O A;  1QVR A;  1E9S A;  1QZM A;  1MU5 A;  5EJC A;  1G3I A;  5E26 A;  4JI6 M;  1OAI A;  2ZBK B;  4JI7 M;  4L4U A;  1R5L A;  3BBZ A;  1QUS A;  3MK6 A;  5KPZ A;  3FTE A;  1Q39 A;  2DAG A;  4M9Z A;  3GLI E;  2UU9 M;  1RU3 A;  1BVS A;  2D7H A;  2XH9 A;  4OVZ B;  5A2Q S;  1Q02 A;  3KVW A;  1PJJ A;  3AL0 C;  4KLN A;  3V76 A;  4OU7 A;  1NY6 A;  1QQW A;  3WHK A;  4HL4 A;  2R65 A;  1MN3 A;  3T15 A;  1EE8 A;  1PJT A;  3R9X B;  2APL A;  2L6O A;  4MH0 E;  1NNJ A;  3B7Z A;  3EIH A;  5EXX A;  3K1J A;  4LRT A;  3TL4 X;  2OQ4 A;  1DGG A;  4JXJ A;  2EKK A;  1OFH A;  4B3M M;  2DKL A;  1VDL A;  2Z8Y M;  4RF1 A;  1JR3 A;  5ITU A;  3KOY E;  4XBO A;  1VG5 A;  2LVN C;  5FSW A;  4B7G A;  2Z7J A;  3LCV B;  5DYG A;  3QYE A;  3ZH9 B;  4B3T M;  4LFC M;  1T6O A;  2KDL A;  1WGN A;  2EO2 A;  2LWX A;  4HLQ A;  3UK6 A;  4II7 A;  1NHG C;  1XHB A;  4JI5 M;  4L6V 6;  4DV0 M;  1C7Y A;  2G5G X;  2RKO A;  2LNH C;  3R8F A;  1IY1 A;  3CF0 A;  1VDD A;  4IBG A;  1SXJ C;  2G3Q A;  1DGF A;  5E6J A;  4JI0 M;  1ZV1 A;  3AKZ A;  3GRU A;  2KNZ A;  2CHQ A;  2Z4S A;  5EXP A;  2DZN B;  4WP2 A;  4REZ A;  3GLG E;  1L2D A;  2UUA M;  3DZD A;  4NOO B;  2FE8 A;  2VII A;  3LVV A;  2VF7 A;  1GO5 A;  2HCB A;  3QYB A;  2LBC A;  2NQ8 C;  4DR2 M;  1N33 M;  1NNU C;  4GC9 A;  3A98 B;  2BNK A;  3FUX A;  4LF5 M;  2EA0 A;  3VKH A;  4IJE A;  4X64 M;  3KFU G;  1XNQ M;  1NV8 A;  2GQF A;  2WSE F;  2Y20 A;  3FE3 A;  4CIS A;  2DHY A;  2KXE A;  2QEN A;  4DUZ M;  3U60 A;  1L2C A;  1D0L A;  1DO0 A;  2K6B A;  2XFS A;  3Q8X A;  2RRU A;  4LJ6 A;  4AKI A;  1OQY A;  2CWB A;  4LFA M;  2YNM D;  2K47 A;  3GP1 A;  2JNH A;  2CFO A;  5EP2 A;  1D0K A;  2FS1 A;  3E4R A;  3HX3 A;  5EXT A;  3MHV C;  5GKN A;  3A42 A;  3C3D A;  4IBE A;  3VFD A;  4BBA A;  1PM5 A;  1JR3 E;  2CHG A;  2O25 A;  1OTR A;  3T1H M;  4R7G A;  3SYL A;  3VK8 A;  1SG9 A;  2QQ8 A;  1WXQ A;  1P3Q Q;  3KOW E;  2LVP C;  3GLH A;  1SXJ A;  4QHS A;  2UUC M;  4NSR A;  1GLN A;  3AV0 A;  2AHM A;  4D80 A;  1EIJ A;  1KFV A;  4PDG A;  2DAM A;  3GQ5 A;  1FNN A;  3SAS A;  2ZM6 M;  2MGW A;  2X49 A;  3GLI B;  2DI0 A;  2LTU A;  3F92 A;  4M0D A;  1TH4 A;  1R2Z A;  5FTK A;  1IFY A;  2KRK A;  2WSC F;  1QAO A;  2R6F A;  1N32 M;  1GL6 A;  1OKS A;  3IG8 A;  3LQR A;  2JWS A;  4LJA A;  1QUT A;  1PJI A;  1F4I A;  2V6Z M;  3AOE C;  3FRI A;  4M0W A;  2CV0 A;  1QZE A;  1NV9 A;  2L7I A;  2DWL A;  4GC5 A;  2MRO B;  3U6D A;  3SHG B;  5KO3 A;  2UUB M;  1KYI A;  3LQQ A;  3HHW A;  1OAO C;  1QDR A;  2HAK A;  2QHO B;  2QNJ A;  4Q7J A;  5FTN A;  4A3V B;  3U6L A;  2C98 A;  1XXH A;  3KS8 A;  3T6P A;  3U6P A;  3FKE A;  1IY0 A;  3PFI A;  5EP1 A;  5BR8 M;  4AKH A;  2LH0 A;  3BXW A;  4Z6Y A;  3CGW A;  4AKG A;  2F4V M;  3KP1 E;  2V1C A;  1TDZ A;  1YE9 A;  4QOS A;  4DV3 M;  3U61 B;  1WHC A;  4L78 A;  1HQY E;  5DNY A;  1DGH B;  2KRU A;  3B9P A;  3TWK A;  3U5Z B;  3SBJ A;  4LGY A;  1IM2 A;  1Z5A A;  1MJG M;  3I04 M;  4QNR A;  3J7A S;  3GRV A;  2DWN A;  3GLG A;  2YQZ A;  3U6C A;  4LF8 M;  2Z4R A;  3LVW A;  3GLH E;  4I8O A;  1SXJ E;  1HR0 M;  1R7R A;  3L2A A;  3HZJ A;  4LF6 M;  1G41 A;  3VKG A;  2R46 A;  5IWA M;  3K8Z A;  1HNW M;  5KQD A;  2X4A A;  3VDP A;  4G6Z A;  3W67 A;  4LGM A;  1TH2 A;  2OO9 A;  1EFU B;  1OFI A;  3K9O A;  1WJ7 A;  2L09 A;  3KSX A;  4GIT A;  3GRR A;  3AFH A;  1TTE A;  2WZJ A;  2H1R A;  1PRB A;  4MM3 B;  5KPT A;  4GHA A;  1R6B X;  3ZC7 B;  3U6Q A;  4GKK M;  1SXJ D;  1J5E M;  3HKP A;  3VDU A;  4KT0 F;  1ZAE A;  2UXC M;  2ZAO A;  2H5X A;  3U6O A;  3HHY A;  2QBY A;  4ZPX A;  5EP3 A;  2CP8 A;  4M9X A;  4MGZ E;  2C9O A;  4LJ4 A;  3SYK A;  1XXH E;  2M5Z A;  2V1U A;  2R62 A;  3EIE A;  4W5W A;  1IN8 A;  4PT5 A;  2L7H A;  2O5R A;  4AW4 A;  4RNA A;  2Z3X A;  2DWZ B;  3FTC A;  4PDI A;  1I94 M;  4FWG A;  4PCZ A;  3M7G A;  3I4V A;  5FTJ A;  2LHC A;  2MR9 A;  2W82 A;  3E46 A;  2K9D A;  3KW6 A;  1TF0 B;  1W5S A;  4R3D A;  3THG A;  1G4A E;  2FFJ A;  4LCB A;  2JP7 A;  2F5Q A;  3SAT A;  1I4W A;  4NRV A;  4XK8 F;  4AZF A;  1XC8 A;  3L25 A;  2C96 A;  2VQE M;  2G8L A;  1TGU A;  3J80 S;  2J5Y A;  3CF2 A;  4DV6 M;  2HKJ A;  4I4L A;  4KHP M;  4JN6 A;  2DAI A;  2Y0T A;  4NC6 A;  1YSY A;  1S3S A;  4IBI A;  1XB2 B;  4B7F A;  3GQ3 A;  3H4J A;  2LHG A;  4IJF A;  4CHT B;  4D81 A;  1AIP C;  4QNM A;  3LCU A;  1L1T A;  1GKI A;  4HEO A;  2XLJ A;  3FUV A;  1IN5 A;  1OIZ A;  2CRU A;  3WHL A;  1NHW C;  3NWL A;  2CE7 A;  1N78 A;  4AG6 A;  4TUW A;  1QDT A;  3MJ5 A;  1UFZ A;  2R4E A;  8CAT A;  5DYI A;  4X62 M;  2QCU A;  4IBD A;  5JI2 E;  3KSJ A;  2CHV A;  1XWI A;  2QP9 X;  1N36 M;  4B3R M;  3IHP A;  3KP0 E;  3I01 M;  3H4M A;  5ITX E;  3W0F A;  3GLH B;  1SXJ B;  3FUU A;  2FH0 A;  1VQ1 A;  4BB9 A;  1L1Z A;  4RF0 A;  3UGJ A;  4L16 A;  4OX9 M;  4AI6 A;  1VEG A;  3FUT A;  4MB7 A;  5ITQ A;  2EUC A;  4QHT A;  2Y0Q A;  3GO8 A;  3T38 A;  3KXE C;  1N77 A;  3FYD A;  2C5R A;  1A5T A;  2Q2E B;  2OPF A;  4JI1 M;  5LMU M;  2OOB A;  1GVN A;  2CUZ A;  2JXN A;  2VF8 A;  2L4F A;  3NBI A;  4L8R C;  4DV4 M;  4LF7 M;  3FD9 A;  4WUR A;  4IBF A;  5FTM A;  3RFW A;  1V33 A;  4G3O A;  2XSZ A;  5L8R F;  1AUA A;  2J7N A;  3GLF A;  4I5S A;  4B08 A;  4LJ7 A;  3PXG A;  1TR8 A;  2LXE A;  5KPR A;  1QAM A;  2CEA A;  2KHH A;  3MMP A;  2I7P A;  4JI3 M;  2MH8 A;  4DR3 M;  1XNR M;  4CGY B;  3E9S A;  3FTD A;  3KOZ E;  3IG5 A;  3CF6 E;  3HGI A;  2KA6 B;  3I4Y A;  1IN6 A;  4LJ9 A;  3U6E A;  1NSF A;  2XGN A;  2C9C A;  2DZO B;  2ZAM A;  3HWS A;  5DFL A;  2MJ5 B;  4GMQ A;  4X66 M;  4ITQ A;  1OIP A;  1NO1 A;  1IXS A;  3UMM A;  3FYC A;  4LZJ A;  2K0B X;  1J7K A;  2M60 A;  3A45 A;  2ZTD A;  1JB0 F;  3BOS A;  1CUK A;  1N34 M;  2D7G A;  4P17 A;  2O01 F;  3LW5 F;  3GLG B;  1LV7 A;  5IT9 S;  4WW0 A;  2KNA A;  2KNV A;  3SAW A;  4GIP A;  1GL7 A;  1E32 A;  1IXR C;  2YFQ A;  4G4R A;  1HNX M;  5C18 A;  3J81 S;  3TQS A;  4AG5 A;  2XFT A;  2Y21 A;  3PNV A;  4GHL A;  4RKU F;  1GJS A;  2OOA A;  1W5T A;  2B3T A;  4MGH A;  3AOE A;  1X37 A;  3GPP A;  1IN7 A;  2I7N A;  2JZ1 A;  4LFB M;  2KZS A;  4GKJ M;  2DHR A;  3C3E A;  3AOG A;  1QAN A;  5BPV A;  2HHH M;  1PJS A;  2E5L M;  1D2N A;  3SAV A;  2R0I A;  3PNY A;  3VLF B;  1IBK M;  3FRH A;  1Z5B A;  2JY6 B;  2N35 A;  4NXN M;  2FNA A;  4IBJ A;  4LF4 M;  5IZ7 D;  3TWM A;  1VEJ A;  2QZ4 A;  4JV5 M;  3GLF E;  4FVM A;  3SAU A;  2DAK A;  4DUY M;  2QBY B;  2EKF A;  1MX0 A;  4AQY M;  3KOX E;  4X65 M;  4GRI A;  2C99 A;  2CV1 A;  3JAM S;  5ITR A;  1Q3C A;  3K2L A;  5ITX A;  1TDH A;  5JI3 E;  3U6S A;  4DR7 M;  1G71 A;  4Z8X A;  4LF9 M;  3GPX A;  5LMN M;  2YR0 A;  3B89 A;  1K3X A;  5C1B A;  2BWB A;  3W0L B;  4GH9 A;  4OVZ A;  2R45 A;  1IBL M;  1ZMV A;  3CTW B;  4NSO B;  2L2D A;  2QSF X;  2XEP A;  4B3S M;  4YY3 M;  4LJ8 A;  1R4G A;  3B74 A;  3TE6 A;  2VQF M;  1DGB A;  2XSZ D;  3M6A A;  5FTL A;  5H37 D;  4DR1 M;  3HY5 A;  1T43 A;  1IY2 A;  1E9R A;  2HWJ A;  2XZF A;  1XMQ M;  4QOZ C;  1ORY B;  1NJF A;  4KO8 A;  4S12 A;  3GRY A;  2UXD M;  1HNZ M;  2GNO A;  5EXS A;  3J7B A;  2KEB A;  2WSF F;  3IEC A;  3HU2 A;  3RGS A;  3SAR A;  5F3W A;  4GEW A;  1H6U A;  3FUW A;  1V34 A;  3SMS A;  3W68 A;  3ZQJ A;  1WIV A;  4DV1 M;  2BJW A;  4DV2 M;  2CV2 A;  3C9P A;  3C58 A;  1WR1 B;  1N75 A;  1KSF X;  1J09 A;  1Q3B A;  2JUJ A;  2DAE A;  3NBX X;  4I81 A;  3U60 B;  1IBM M;  2KW0 A;  4FWH A;  3A46 A;  3QAU A;  2XZU A;  4NRW A;  2R4J A;  3RE8 A;  3D8L A;  4ANR A;  3DOA A;  1D0M A;  3L28 A;  4MGI E;  5ITY A;  2F5O A;  2D7E A;  2DNA A;  2DVW B;  4YHH M;  2BJV A;  1IQP A;  3OTO M;  4FCV A;  4MGY E;  4G4N A;  3T1Y M;  2HL7 A;  2VDB B; 
#chains in the Genus database with same CATH homology
 3LCV B;  1WGL A;  2DEN A;  2KHH A;  3MMP A;  2OO9 A;  1EFU B;  3K9O A;  1T6O A;  1WJ7 A;  1WGN A;  2JY5 A;  1C7Y A;  4DBG B;  1TTE A;  1HT1 E;  2WZJ A;  5DFL A;  2MJ5 B;  2G3Q A;  1ZV1 A;  1IXS A;  2KNZ A;  1VEK A;  2K0B X;  2DZL A;  4WP2 A;  3GLG E;  2ZTD A;  1CUK A;  2KNA A;  2KNV A;  2H5X A;  1GO5 A;  2LBC A;  2CP8 A;  1PGY A;  1XXH E;  3K9P A;  1ZMW A;  2OOA A;  2B3T A;  1NV8 A;  3FE3 A;  2DHY A;  2L4E A;  2JY8 A;  1DO0 A;  2JZ1 A;  2RRU A;  1OQY A;  2CWB A;  1DV0 A;  2MR9 A;  2R0I A;  3E46 A;  2JNH A;  2K9D A;  1G4A E;  1E94 E;  2JP7 A;  3FRH A;  2EJS A;  2JY6 B;  2ZTC A;  2LVA A;  1JR3 E;  1DO2 A;  2O25 A;  1OTR A;  1VEJ A;  1HT2 E;  1SG9 A;  3GLF E;  1P3Q Q;  2DAK A;  2EKF A;  2LVP C;  2JZ0 A;  2DAI A;  2LVO C;  1XB2 B;  3E21 A;  1V92 A;  2LVQ D;  3H4J A;  4F2L A;  2DAM A;  1AIP C;  3B89 A;  3LCU A;  2BWB A;  2MGW A;  4HEO A;  1ZMV A;  2DI0 A;  2LTU A;  3F92 A;  4UN2 B;  4R71 A;  2L2D A;  2QSF X;  1IFY A;  2JY7 A;  1R4G A;  2BWE A;  4F1I A;  1OKS A;  1UFZ A;  1Y8G A;  1ZMU A;  1T43 A;  5JI2 E;  1YLA A;  2HWJ A;  1F4I A;  3FRI A;  1QZE A;  1NV9 A;  1HJP A;  3IHP A;  2MRO B;  3IEC A;  1KYI A;  1G3I A;  1VQ1 A;  2QHO B;  1OAI A;  2HAK A;  2QNJ A;  4GEW A;  4Q7J A;  3BBZ A;  3T6P A;  1WIV A;  2DAG A;  1VEG A;  3GLI E;  1BVS A;  1WR1 B;  1Q02 A;  2JUJ A;  2DAE A;  1WHC A;  1HQY E;  1MN3 A;  1A5T A;  2OOB A;  1IM2 A;  2L4F A;  2EKK A;  2DKL A;  1VDL A;  2DNA A;  4G3O A;  3GLH E;  1VG5 A;  2LVN C;  1TR8 A;  1G41 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...