1WIVA

Solution structure of rsgi ruh-023, a uba domain from arabidopsis cdna
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
73
structure length
73
Chain Sequence
GSSGSSGLLSHMDDPDIDAPISHQTSDIDQSSVDTLLSFGFAEDVARKALKASGGDIEKATDWVFNNSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title solution structure of RSGI RUH-023, a UBA domain from Arabidopsis cDNA
rcsb
source organism Arabidopsis thaliana
molecule tags Structural genomics, unknown function
molecule keywords ubiquitin-specific protease 14
total genus 11
structure length 73
sequence length 73
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2004-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00627 UBA UBA/TS-N domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 1wivA00
2L4FA 3GLIE 2O25A 1R4GA 1WIVA 3FRHA 3FRIA 1UFZA 1VEJA 1ZMVA 2MJ5B 3E21A 3E46A 2RRUA 3BBZA 1V92A 2OO9A 2LTUA 1C7YA 1NV8A 1YLAA 4F1IA 1DO2A 1QZEA 3K9OA 1ZMWA 1Q02A 2DKLA 2WZJA 5DFLA 1WGNA 2QNJA 2LBCA 2MROB 2ZTCA 2LVOC 2LVPC 1E94E 2HWJA 3GLGE 2LVNC 2JZ0A 1ZMUA 1JR3E 2DENA 2DAMA 2MR9A 2DHYA 1OAIA 3H4JA 2EJSA 2DAIA 1HT1E 3IECA 2JY6B 3FE3A 2KNZA 2L4EA 4G3OA 1HJPA 1IFYA 2JY5A 1WGLA 1IM2A 1EFUB 3LCVB 3MMPA 2L2DA 3T6PA 2JY7A 3B89A 1VG5A 2MGWA 1XXHE 1A5TA 2JUJA 1PGYA 2DAEA 2KNVA 2ZTDA 2JZ1A 4Q7JA 1G3IA 3F92A 2H5XA 1WJ7A 2DAGA 4GEWA 2G3QA 4DBGB 2R0IA 1AIPC 3GLFE 1DV0A 2OOBA 3K9PA 2KNAA 2OOAA 2EKKA 1SG9A 1WHCA 1VQ1A 4UN2B 2KHHA 3LCUA 1WR1B 3GLHE 1NV9A 1OQYA 2BWEA 1VDLA 2JY8A 1OKSA 2JNHA 1Y8GA 1GO5A 1VEGA 2K9DA 1G41A 1ZV1A 1VEKA 1MN3A 2QHOB 1OTRA 1DO0A 1T43A 1IXSA 1T6OA 5JI2E 1XB2B 2JP7A 2LVAA 2K0BX 2QSFX 1BVSA 2CWBA 4WP2A 1F4IA 1KYIA 1G4AE 1P3QQ 2DAKA 2DNAA 4F2LA 1TR8A 1CUKA 1HT2E 1TTEA 4HEOA 2DZLA 1HQYE 2EKFA 2B3TA 3IHPA 4R71A 2LVQD 2DI0A 2BWBA 2HAKA 2CP8A
chains in the Genus database with same CATH superfamily
1JB0F 3TE6A 4BBAA 3WHLA 2J7OA 3FRIA 3HHZA 1TH2A 4GITA 5ITQA 2NQ8C 4ANRA 5F3WA 2R45A 1ZMVA 2R4EA 4MGZE 3VLFB 2UXCM 1Z6TA 3AOGA 4QOZC 1DO2A 3FTFA 3PNVA 5JI3E 4REZA 3GPUA 3HHWA 5LMNM 1XC8A 4B3TM 1Q02A 3VKHA 5DFLA 4RKUF 1R5LA 2Z3XA 3T38A 3H4MA 4BB9A 2YQZA 3FUWA 5EXSA 2LVPC 1E94E 2J7NA 3U6PA 3U60B 2YNMD 2HWJA 2BJVA 3GLGE 1Q3BA 3J2PB 2C5RA 4LJ7A 1ZMUA 1JR3E 1UM8A 3VDUA 3JAMS 2DENA 3MHVC 2KEBA 4LRSA 1DGHA 2VDBB 3C3EA 4OVZB 4I81A 2EJSA 2M5ZA 1N34M 2UXBM 2DAIA 3IECA 1GLNA 5FTKA 3LVWA 5EXTA 3GP1A 1QZMA 4LJ4A 3FE3A 5KPZA 4Y28F 3DA1A 3JR5A 3L29A 4L6V6 1PJTA 1HJPA 3SASA 4DV7M 4DR7M 4DV6M 3FUUA 2GNOA 4BLCA 3MMPA 2RGOA 3U60A 2KZUA 1PJSA 3T15A 2UXDM 3SMPA 3NBIA 3B74A 4DV5M 1A5TA 1D2NA 1PGYA 2RKOA 2JZ1A 3EIEA 1R7RA 4FCVA 4KO8A 4Q7JA 1WJ7A 2DAGA 3EIHA 3W0LB 4X65M 2ZAOA 3HX3A 1DGHB 4FWGA 5FTLA 1Z59A 3R8FA 4G4QA 2KZSA 3HJ8A 3UK6A 2CV0A 1QDTA 2OOAA 4B7HA 4LRTA 3K8ZA 3KVWA 1IXRC 1VQ1A 2C9OA 3FTDA 4UN2B 1TH4A 2KHHA 1FNNA 1K82A 3GQ3A 4I8OA 1NV9A 5FLXS 2FOIC 2RGHA 1E32A 1OKSA 3FUTA 4CIZA 1IBLM 2V1UA 1LV7A 8CATA 1Y8GA 4AQYM 3BXWA 2C98A 1SXJB 2JA2A 1L2BA 2L7HA 4DR5M 3J80S 3U61A 1GJSA 4JV5M 2K9DA 1AUAA 1G41A 1ZV1A 4II7A 4OW0A 4OX9M 2L7IA 2E5LM 4DR2M 4AKHA 3AKZA 1V33A 1N75A 4G4NA 4JN6A 3CF0A 4JI0M 1DGGA 2BNKA 1T6OA 2XSZA 1L2CA 4QNMA 4NL4H 3TWLA 3GLGB 3QWLA 2QSFX 1NNJA 3GLHB 1SXJE 4IBEA 3RFWA 1TDZA 2DAKA 1TH3A 4RF1A 2F5PA 3PVSA 3M6AA 3SAWA 1HNZM 1CUKA 4W5WA 2LH0A 4X64M 1TTEA 2M60A 5DNYA 1HNWM 4JXJA 4S12A 4TUWA 4KLNA 3SC3A 3SBJA 5EXXA 3IHPA 1QDRA 5EP1A 1PJQA 3GPYA 3GO8A 3L2AA 3SAVA 3TPZA 2L4FA 1PRBA 1XNRM 1R4GA 4LZZA 1L1TA 2VIIA 4JI8M 4JI1M 2FNAA 3I51A 1UFZA 2XEPA 2CV2A 3CGWA 1QANA 4R3DA 4JI2M 1S3SA 2MJ5B 3KS4A 4GMQA 4HLQA 2YR0A 4FWDA 3WHKA 3KW6A 4KODA 2LTUA 3TWMA 1OIPA 3HZJA 1XNQM 4F1IA 2XF3A 2CUZA 1QZEA 2KRUA 3HKPA 2DHRA 3K9OA 1XMQM 2KRKA 4G6ZA 1Q3CA 1RU3A 4XBOA 1ZMWA 2WZJA 4PT5A 3AOEA 2WSCF 2N35A 3FD9A 1WGNA 1Z5BA 3FYDA 2QP9X 2ZTCA 1K3WA 3QYBA 4B7FA 3KS8A 4QOSA 1MU5A 2LVNC 2JZ0A 3C3DA 4JI5M 2Z8YM 2F5SA 2CHQA 2C96A 3B7QA 4IBIA 3ZC7B 2LNHC 2R62A 1N77A 2ZAMA 3B7ZA 1HT1E 4AKIA 3GLFB 3HJSA 4CJ6A 2KNZA 3CF2A 4YHHM 2VQFM 4G3OA 2XSZD 2FS1A 3GRUA 4NXMM 1IFYA 4FW9A 3W0FA 1WGLA 4LJ5A 3OTOM 3ILKA 1IM2A 1EFUB 2CFOA 3LCVB 3IG5A 4KT0F 5KO3A 1IBMM 1QQWA 3PFIA 2MGWA 1VG5A 3U6LA 1DGFA 3FUVA 4LFBM 1NHGC 3KXEC 3GLFA 1G3IA 2ZANA 2H5XA 1OAOC 2GQFA 4GEWA 3HHXA 5IZ7D 4LGYA 4XGIA 3U6EA 3MK6A 2EO2A 4LG2A 4FCWA 4JI6M 4L15A 2R65A 4DUYM 2KNAA 4WW0A 3J27B 3K1JA 3GLHA 3K2LA 3LCUA 4LCBA 5E26A 3GLHE 4L4UA 2XZFA 2BWEA 1NVMA 1VDLA 2CHGA 3HU2A 2JNHA 2K6BA 5FTMA 2LHCA 1G71A 1E9RA 4NRVA 2Q2EB 4IBCA 4AG6A 1GO5A 5LMUM 1IY2A 2A5YB 3UGJA 5DYIA 3U6DA 2F5NA 3JR4A 4B7GA 3QAUA 4I4LA 3LMMA 1R2YA 2APLA 1T43A 3FYCA 1IXSA 5FTJA 2O01F 3TQSA 1IN4A 1N78A 4A3VB 4Z6YA 4D82A 4LF8M 5ITUA 3UMMA 1NY5A 2DWNA 1XXHA 3LW5F 1IN5A 1BVSA 2CWBA 2XFSA 4WP2A 3KDSE 1KYIA 3U6CA 2VF8A 1G4AE 3L27A 1L1ZA 3FUXA 2Y20A 3E4RA 4F2LA 2VF7A 4DUZM 1GVNA 4IBKA 1IXSB 5GKNA 4X66M 2KXEA 2O5RA 4QNRA 2QBYA 1D0MA 3AFHA 4HEOA 1VDDA 1XMOM 4K0KM 3SHGB 5C1BA 1HQYE 2B3TA 3GLIB 4R71A 2FE8A 2ERCA 5ITXA 2DWMA 4LFAM 3GLFE 1IBKM 3SYLA 3I04M 1IXZA 4LF6M 4LJAA 3VKGA 1QAMA 2O25A 4AZFA 1MX0A 2I7PA 3HGIA 4QHSA 4WURA 4PD2A 5KPTA 2KW0A 3E21A 2Z7JA 2QZ4A 3U61B 1TF0B 3SHFA 3BBZA 4L8RC 2QBYB 5DYGA 1NJGA 4PCZA 1NV8A 5BPVA 1YLAA 1ZAEA 2D7HA 3RGSA 2P5TA 3GRVA 2XFTA 4P17A 2Y0TA 4GC9A 2ZBKB 3LQQA 4FD2A 3GQ4A 4G4RA 3HJQA 3A42A 4LF4M 4DV4M 2DKLA 1NNUC 2DZOB 1GKIA 1ZQ9A 2QQ8A 5EJCA 1G8PA 1NO1A 5C18A 2LBCA 2MROB 1ORYB 3A98B 5EXPA 3E9SA 1IY1A 4CISA 4M0WA 4QHTA 1QUSA 4MH0E 4M0DA 4LGMA 4DR4M 4MGKE 2DAMA 3AV0A 1TDHA 2MR9A 2XGNA 3H4JA 3FKEA 2OPFA 4DV0M 4R7GA 2UU9M 1PM5A 2R4JA 3IG8A 3ZCBB 2D7GA 2WSEF 4LFCM 1PJJA 4PDIA 2L4EA 3HWSA 1SXJA 3K92A 1Z5CA 3RE8A 1H6UA 4ZPXA 1KFVA 2UUCM 3U6MA 2JY7A 2V6ZM 4GIPA 1XXHE 3LVVA 4M9SA 3W68A 4LF5M 4OU7A 3F92A 1DGBA 2C99A 4DBGB 3FTEA 2F5QA 1AIPC 3VK8A 3HU1A 4M9ZA 1QYRA 1IN7A 2HL7A 2OOBA 2LXEA 3AOEC 2G8LA 3TL4X 7CATA 2XLJA 4DV1M 4JI4M 2EKKA 4G4OA 1SG9A 4IBBA 2VQEM 2XH9A 3ZH9B 2EUCA 2JXNA 2LWXA 1XHBA 4IBDA 3NBXX 2QCUA 1KSFX 2CV1A 1OFHA 2V1CA 2FH0A 1TGUA 3U6OA 1QAOA 3C9PA 3U5ZA 3GPXA 2CEAA 1WXQA 3D8BA 2G5GX 3T1YM 2BJWA 4JI3M 1MN3A 5H37D 2CRUA 4D80A 1D0LA 1YSYA 1MJGM 1PJIA 2H1RA 2R44A 5KQDA 3AL0C 3DZDA 2F4VM 1XB2B 1IN8A 3HU3A 2JP7A 1SXJC 4RNAA 2MH8A 3KP0E 2LVAA 2W82A 1I4WA 3THGA 2R6FA 2DZNB 2F5OA 2D7EA 1F4IA 4AI6A 3PXGA 4B3SM 1NHWC 4JYAM 2Z4RA 4IJFA 1W5TA 2X8AA 4NSRA 4XK8F 5EP2A 5FTNA 5ITRA 3T1HM 4D81A 4B3MM 1J09A 4LZJA 3CF6E 2CHVA 1L2DA 1HT2E 4PDGA 3W67A 1HNXM 1GL7A 4L16A 2DWZB 5EQTA 1LTMA 2EKFA 1R6BX 3I01M 4IBFA 4DR1M 2LVQD 1GJTA 1E9SA 2DI0A 3B9PA 4IBJA 1NJFA 4LY6A 5ITYA 2XZUA 2CP8A 5ITXE 3SARA 4GHLA 3GLIE 4LJ8A 1XWIA 3DFZA 1IY0A 1WIVA 3FRHA 3J7BA 4B3RM 2L09A 5BR8M 1YUBA 2HHHM 1VEJA 1NY6A 1T3TA 4GRIA 3KSXA 4NOOB 4AKGA 2X49A 3E46A 2RRUA 1V92A 2OO9A 3GRRA 4GKJM 4GC5A 1C7YA 5IREB 3J7AS 5IT9S 4I5SA 4HL4A 4RF0A 3KOWE 4FVMA 3FTCA 4IJEA 3V76A 3CTWB 3D8LA 4CHTB 2FFJA 1QUTA 1OJLA 2QNJA 2LVOC 1D0KA 2KDLA 3A46A 5IWAM 4FWHA 5E6JA 2DWLA 1HQCA 3NWLA 2R18A 5KQ8A 3Q8GA 5A2QS 2DHYA 1OAIA 2KA6B 3PNYA 4AW4A 2DXIA 2AHMA 2ZM6M 1QAQA 1Q39A 3SAUA 3VFDA 3U6SA 4DV2M 4YY3M 1EE8A 2JY6B 3M0EA 1R2ZA 3J81S 1Z5AA 5EP3A 5FSWA 3QYEA 2JY5A 2R46A 4KHPM 3GQ5A 1OFIA 1C1KA 2Y0QA 2Y21A 4DR3M 2CE7A 2JWSA 3MJ5A 2DVWB 2C9CA 2L2DA 3T6PA 3B89A 1JR3D 4NRWA 1HR0M 3R9XB 4MB7A 4NXNM 2L6OA 1N36M 2ZTDA 2JUJA 1W5SA 2DAEA 2KNVA 3AJIB 4MGYE 3M7GA 4AG5A 3SATA 2QPAA 2EA0A 2G3QA 4OVZA 3L26A 2R0IA 1N33M 3KSJA 1I94M 3ZQJA 1DV0A 1JQJC 2Z4SA 3TWKA 3K9PA 4MGHA 2UUBM 4DV3M 1L8QA 1IQPA 1WHCA 1GABA 1NSFA 1K3XA 4L78A 4Z8XA 1J5EM 4MM3B 3GPPA 1WR1B 4LF7M 4MGIE 1OQYA 5ITTA 2JY8A 3L28A 3BOSA 1QVRA 2K47A 3DOAA 3Q8XA 2I7NA 4ITQA 2WSFF 3SFZA 5L8RF 3HY5A 1VEGA 3GLIA 3LQRA 3B7NA 3A45A 3HHYA 1VEKA 4NSOB 4LF9M 2QHOB 1JR3A 4M9XA 2OQ4A 4X62M 3L25A 3U5ZB 1IN6A 1OTRA 4LJ9A 4NC6A 3KP1E 1DO0A 3I4YA 2QENA 4P16A 5KPRA 3KOYE 1SXJD 5JI2E 1X37A 4LJ6A 2HKJA 3UZUA 3GRYA 4DR6M 2K0BX 3VK7A 5EP4A 1V34A 4IIWA 4GKKM 3SYKA 2HCBA 1XXHB 4CGYB 1P3QQ 2DNAA 3VDPA 3RGPA 2UUAM 3C58A 1N32M 4B08A 1TR8A 3SMSA 1OIZA 1G59A 4GHAA 2LHGA 1J7KA 2J5YA 3KFUG 2X4AA 3UJNA 3KOXE 3KOZE 4IBGA 1YE9A 4JI7M 2YFQA 2DZLA 3I4VA 1EIJA 3GLGA 1GL6A 4FCTA 1FJGM 4EIWA 2BWBA 2HAKA 4GH9A 3U6QA
chains in the Genus database with same CATH topology
2L4FA 3GLIE 2O25A 1R4GA 1WIVA 3FRHA 3FRIA 1UFZA 1VEJA 1ZMVA 2MJ5B 3E21A 3E46A 2RRUA 3BBZA 1V92A 2OO9A 2LTUA 1C7YA 1NV8A 1YLAA 4F1IA 1DO2A 1QZEA 3K9OA 1ZMWA 1Q02A 2DKLA 2WZJA 5DFLA 1WGNA 2QNJA 2LBCA 2MROB 2ZTCA 2LVOC 2LVPC 1E94E 2HWJA 3GLGE 2LVNC 2JZ0A 1ZMUA 1JR3E 2DENA 2DAMA 2MR9A 2DHYA 1OAIA 3H4JA 2EJSA 2DAIA 1HT1E 3IECA 2JY6B 3FE3A 2KNZA 2L4EA 4G3OA 1HJPA 1IFYA 2JY5A 1WGLA 1IM2A 1EFUB 3LCVB 3MMPA 2L2DA 3T6PA 2JY7A 3B89A 1VG5A 2MGWA 1XXHE 1A5TA 2JUJA 1PGYA 2DAEA 2KNVA 2ZTDA 2JZ1A 4Q7JA 1G3IA 3F92A 2H5XA 1WJ7A 2DAGA 4GEWA 2G3QA 4DBGB 2R0IA 1AIPC 3GLFE 1DV0A 2OOBA 3K9PA 2KNAA 2OOAA 2EKKA 1SG9A 1WHCA 1VQ1A 4UN2B 2KHHA 3LCUA 1WR1B 3GLHE 1NV9A 1OQYA 2BWEA 1VDLA 2JY8A 1OKSA 2JNHA 1Y8GA 1GO5A 1VEGA 2K9DA 1G41A 1ZV1A 1VEKA 1MN3A 2QHOB 1OTRA 1DO0A 1T43A 1IXSA 1T6OA 5JI2E 1XB2B 2JP7A 2LVAA 2K0BX 2QSFX 1BVSA 2CWBA 4WP2A 1F4IA 1KYIA 1G4AE 1P3QQ 2DAKA 2DNAA 4F2LA 1TR8A 1CUKA 1HT2E 1TTEA 4HEOA 2DZLA 1HQYE 2EKFA 2B3TA 3IHPA 4R71A 2LVQD 2DI0A 2BWBA 2HAKA 2CP8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L4F A;  3GLI E;  2O25 A;  1R4G A;  1WIV A;  3FRH A;  3FRI A;  1UFZ A;  1VEJ A;  1ZMV A;  2MJ5 B;  3E21 A;  3E46 A;  2RRU A;  3BBZ A;  1V92 A;  2OO9 A;  2LTU A;  1C7Y A;  1NV8 A;  1YLA A;  4F1I A;  1DO2 A;  1QZE A;  3K9O A;  1ZMW A;  1Q02 A;  2DKL A;  2WZJ A;  5DFL A;  1WGN A;  2QNJ A;  2LBC A;  2MRO B;  2ZTC A;  2LVO C;  2LVP C;  1E94 E;  2HWJ A;  3GLG E;  2LVN C;  2JZ0 A;  1ZMU A;  1JR3 E;  2DEN A;  2DAM A;  2MR9 A;  2DHY A;  1OAI A;  3H4J A;  2EJS A;  2DAI A;  1HT1 E;  3IEC A;  2JY6 B;  3FE3 A;  2KNZ A;  2L4E A;  4G3O A;  1HJP A;  1IFY A;  2JY5 A;  1WGL A;  1IM2 A;  1EFU B;  3LCV B;  3MMP A;  2L2D A;  3T6P A;  2JY7 A;  3B89 A;  1VG5 A;  2MGW A;  1XXH E;  1A5T A;  2JUJ A;  1PGY A;  2DAE A;  2KNV A;  2ZTD A;  2JZ1 A;  4Q7J A;  1G3I A;  3F92 A;  2H5X A;  1WJ7 A;  2DAG A;  4GEW A;  2G3Q A;  4DBG B;  2R0I A;  1AIP C;  3GLF E;  1DV0 A;  2OOB A;  3K9P A;  2KNA A;  2OOA A;  2EKK A;  1SG9 A;  1WHC A;  1VQ1 A;  4UN2 B;  2KHH A;  3LCU A;  1WR1 B;  3GLH E;  1NV9 A;  1OQY A;  2BWE A;  1VDL A;  2JY8 A;  1OKS A;  2JNH A;  1Y8G A;  1GO5 A;  1VEG A;  2K9D A;  1G41 A;  1ZV1 A;  1VEK A;  1MN3 A;  2QHO B;  1OTR A;  1DO0 A;  1T43 A;  1IXS A;  1T6O A;  5JI2 E;  1XB2 B;  2JP7 A;  2LVA A;  2K0B X;  2QSF X;  1BVS A;  2CWB A;  4WP2 A;  1F4I A;  1KYI A;  1G4A E;  1P3Q Q;  2DAK A;  2DNA A;  4F2L A;  1TR8 A;  1CUK A;  1HT2 E;  1TTE A;  4HEO A;  2DZL A;  1HQY E;  2EKF A;  2B3T A;  3IHP A;  4R71 A;  2LVQ D;  2DI0 A;  2BWB A;  2HAK A;  2CP8 A; 
#chains in the Genus database with same CATH topology
 1JB0 F;  3TE6 A;  4BBA A;  3WHL A;  2J7O A;  3FRI A;  3HHZ A;  1TH2 A;  4GIT A;  5ITQ A;  2NQ8 C;  4ANR A;  5F3W A;  2R45 A;  1ZMV A;  2R4E A;  4MGZ E;  3VLF B;  2UXC M;  1Z6T A;  3AOG A;  4QOZ C;  1DO2 A;  3FTF A;  3PNV A;  5JI3 E;  4REZ A;  3GPU A;  3HHW A;  5LMN M;  1XC8 A;  4B3T M;  1Q02 A;  3VKH A;  5DFL A;  4RKU F;  1R5L A;  2Z3X A;  3T38 A;  3H4M A;  4BB9 A;  2YQZ A;  3FUW A;  5EXS A;  2LVP C;  1E94 E;  2J7N A;  3U6P A;  3U60 B;  2YNM D;  2HWJ A;  2BJV A;  3GLG E;  1Q3B A;  3J2P B;  2C5R A;  4LJ7 A;  1ZMU A;  1JR3 E;  1UM8 A;  3VDU A;  3JAM S;  2DEN A;  3MHV C;  2KEB A;  4LRS A;  1DGH A;  2VDB B;  3C3E A;  4OVZ B;  4I81 A;  2EJS A;  2M5Z A;  1N34 M;  2UXB M;  2DAI A;  3IEC A;  1GLN A;  5FTK A;  3LVW A;  5EXT A;  3GP1 A;  1QZM A;  4LJ4 A;  3FE3 A;  5KPZ A;  4Y28 F;  3DA1 A;  3JR5 A;  3L29 A;  4L6V 6;  1PJT A;  1HJP A;  3SAS A;  4DV7 M;  4DR7 M;  4DV6 M;  3FUU A;  2GNO A;  4BLC A;  3MMP A;  2RGO A;  3U60 A;  2KZU A;  1PJS A;  3T15 A;  2UXD M;  3SMP A;  3NBI A;  3B74 A;  4DV5 M;  1A5T A;  1D2N A;  1PGY A;  2RKO A;  2JZ1 A;  3EIE A;  1R7R A;  4FCV A;  4KO8 A;  4Q7J A;  1WJ7 A;  2DAG A;  3EIH A;  3W0L B;  4X65 M;  2ZAO A;  3HX3 A;  1DGH B;  4FWG A;  5FTL A;  1Z59 A;  3R8F A;  4G4Q A;  2KZS A;  3HJ8 A;  3UK6 A;  2CV0 A;  1QDT A;  2OOA A;  4B7H A;  4LRT A;  3K8Z A;  3KVW A;  1IXR C;  1VQ1 A;  2C9O A;  3FTD A;  4UN2 B;  1TH4 A;  2KHH A;  1FNN A;  1K82 A;  3GQ3 A;  4I8O A;  1NV9 A;  5FLX S;  2FOI C;  2RGH A;  1E32 A;  1OKS A;  3FUT A;  4CIZ A;  1IBL M;  2V1U A;  1LV7 A;  8CAT A;  1Y8G A;  4AQY M;  3BXW A;  2C98 A;  1SXJ B;  2JA2 A;  1L2B A;  2L7H A;  4DR5 M;  3J80 S;  3U61 A;  1GJS A;  4JV5 M;  2K9D A;  1AUA A;  1G41 A;  1ZV1 A;  4II7 A;  4OW0 A;  4OX9 M;  2L7I A;  2E5L M;  4DR2 M;  4AKH A;  3AKZ A;  1V33 A;  1N75 A;  4G4N A;  4JN6 A;  3CF0 A;  4JI0 M;  1DGG A;  2BNK A;  1T6O A;  2XSZ A;  1L2C A;  4QNM A;  4NL4 H;  3TWL A;  3GLG B;  3QWL A;  2QSF X;  1NNJ A;  3GLH B;  1SXJ E;  4IBE A;  3RFW A;  1TDZ A;  2DAK A;  1TH3 A;  4RF1 A;  2F5P A;  3PVS A;  3M6A A;  3SAW A;  1HNZ M;  1CUK A;  4W5W A;  2LH0 A;  4X64 M;  1TTE A;  2M60 A;  5DNY A;  1HNW M;  4JXJ A;  4S12 A;  4TUW A;  4KLN A;  3SC3 A;  3SBJ A;  5EXX A;  3IHP A;  1QDR A;  5EP1 A;  1PJQ A;  3GPY A;  3GO8 A;  3L2A A;  3SAV A;  3TPZ A;  2L4F A;  1PRB A;  1XNR M;  1R4G A;  4LZZ A;  1L1T A;  2VII A;  4JI8 M;  4JI1 M;  2FNA A;  3I51 A;  1UFZ A;  2XEP A;  2CV2 A;  3CGW A;  1QAN A;  4R3D A;  4JI2 M;  1S3S A;  2MJ5 B;  3KS4 A;  4GMQ A;  4HLQ A;  2YR0 A;  4FWD A;  3WHK A;  3KW6 A;  4KOD A;  2LTU A;  3TWM A;  1OIP A;  3HZJ A;  1XNQ M;  4F1I A;  2XF3 A;  2CUZ A;  1QZE A;  2KRU A;  3HKP A;  2DHR A;  3K9O A;  1XMQ M;  2KRK A;  4G6Z A;  1Q3C A;  1RU3 A;  4XBO A;  1ZMW A;  2WZJ A;  4PT5 A;  3AOE A;  2WSC F;  2N35 A;  3FD9 A;  1WGN A;  1Z5B A;  3FYD A;  2QP9 X;  2ZTC A;  1K3W A;  3QYB A;  4B7F A;  3KS8 A;  4QOS A;  1MU5 A;  2LVN C;  2JZ0 A;  3C3D A;  4JI5 M;  2Z8Y M;  2F5S A;  2CHQ A;  2C96 A;  3B7Q A;  4IBI A;  3ZC7 B;  2LNH C;  2R62 A;  1N77 A;  2ZAM A;  3B7Z A;  1HT1 E;  4AKI A;  3GLF B;  3HJS A;  4CJ6 A;  2KNZ A;  3CF2 A;  4YHH M;  2VQF M;  4G3O A;  2XSZ D;  2FS1 A;  3GRU A;  4NXM M;  1IFY A;  4FW9 A;  3W0F A;  1WGL A;  4LJ5 A;  3OTO M;  3ILK A;  1IM2 A;  1EFU B;  2CFO A;  3LCV B;  3IG5 A;  4KT0 F;  5KO3 A;  1IBM M;  1QQW A;  3PFI A;  2MGW A;  1VG5 A;  3U6L A;  1DGF A;  3FUV A;  4LFB M;  1NHG C;  3KXE C;  3GLF A;  1G3I A;  2ZAN A;  2H5X A;  1OAO C;  2GQF A;  4GEW A;  3HHX A;  5IZ7 D;  4LGY A;  4XGI A;  3U6E A;  3MK6 A;  2EO2 A;  4LG2 A;  4FCW A;  4JI6 M;  4L15 A;  2R65 A;  4DUY M;  2KNA A;  4WW0 A;  3J27 B;  3K1J A;  3GLH A;  3K2L A;  3LCU A;  4LCB A;  5E26 A;  3GLH E;  4L4U A;  2XZF A;  2BWE A;  1NVM A;  1VDL A;  2CHG A;  3HU2 A;  2JNH A;  2K6B A;  5FTM A;  2LHC A;  1G71 A;  1E9R A;  4NRV A;  2Q2E B;  4IBC A;  4AG6 A;  1GO5 A;  5LMU M;  1IY2 A;  2A5Y B;  3UGJ A;  5DYI A;  3U6D A;  2F5N A;  3JR4 A;  4B7G A;  3QAU A;  4I4L A;  3LMM A;  1R2Y A;  2APL A;  1T43 A;  3FYC A;  1IXS A;  5FTJ A;  2O01 F;  3TQS A;  1IN4 A;  1N78 A;  4A3V B;  4Z6Y A;  4D82 A;  4LF8 M;  5ITU A;  3UMM A;  1NY5 A;  2DWN A;  1XXH A;  3LW5 F;  1IN5 A;  1BVS A;  2CWB A;  2XFS A;  4WP2 A;  3KDS E;  1KYI A;  3U6C A;  2VF8 A;  1G4A E;  3L27 A;  1L1Z A;  3FUX A;  2Y20 A;  3E4R A;  4F2L A;  2VF7 A;  4DUZ M;  1GVN A;  4IBK A;  1IXS B;  5GKN A;  4X66 M;  2KXE A;  2O5R A;  4QNR A;  2QBY A;  1D0M A;  3AFH A;  4HEO A;  1VDD A;  1XMO M;  4K0K M;  3SHG B;  5C1B A;  1HQY E;  2B3T A;  3GLI B;  4R71 A;  2FE8 A;  2ERC A;  5ITX A;  2DWM A;  4LFA M;  3GLF E;  1IBK M;  3SYL A;  3I04 M;  1IXZ A;  4LF6 M;  4LJA A;  3VKG A;  1QAM A;  2O25 A;  4AZF A;  1MX0 A;  2I7P A;  3HGI A;  4QHS A;  4WUR A;  4PD2 A;  5KPT A;  2KW0 A;  3E21 A;  2Z7J A;  2QZ4 A;  3U61 B;  1TF0 B;  3SHF A;  3BBZ A;  4L8R C;  2QBY B;  5DYG A;  1NJG A;  4PCZ A;  1NV8 A;  5BPV A;  1YLA A;  1ZAE A;  2D7H A;  3RGS A;  2P5T A;  3GRV A;  2XFT A;  4P17 A;  2Y0T A;  4GC9 A;  2ZBK B;  3LQQ A;  4FD2 A;  3GQ4 A;  4G4R A;  3HJQ A;  3A42 A;  4LF4 M;  4DV4 M;  2DKL A;  1NNU C;  2DZO B;  1GKI A;  1ZQ9 A;  2QQ8 A;  5EJC A;  1G8P A;  1NO1 A;  5C18 A;  2LBC A;  2MRO B;  1ORY B;  3A98 B;  5EXP A;  3E9S A;  1IY1 A;  4CIS A;  4M0W A;  4QHT A;  1QUS A;  4MH0 E;  4M0D A;  4LGM A;  4DR4 M;  4MGK E;  2DAM A;  3AV0 A;  1TDH A;  2MR9 A;  2XGN A;  3H4J A;  3FKE A;  2OPF A;  4DV0 M;  4R7G A;  2UU9 M;  1PM5 A;  2R4J A;  3IG8 A;  3ZCB B;  2D7G A;  2WSE F;  4LFC M;  1PJJ A;  4PDI A;  2L4E A;  3HWS A;  1SXJ A;  3K92 A;  1Z5C A;  3RE8 A;  1H6U A;  4ZPX A;  1KFV A;  2UUC M;  3U6M A;  2JY7 A;  2V6Z M;  4GIP A;  1XXH E;  3LVV A;  4M9S A;  3W68 A;  4LF5 M;  4OU7 A;  3F92 A;  1DGB A;  2C99 A;  4DBG B;  3FTE A;  2F5Q A;  1AIP C;  3VK8 A;  3HU1 A;  4M9Z A;  1QYR A;  1IN7 A;  2HL7 A;  2OOB A;  2LXE A;  3AOE C;  2G8L A;  3TL4 X;  7CAT A;  2XLJ A;  4DV1 M;  4JI4 M;  2EKK A;  4G4O A;  1SG9 A;  4IBB A;  2VQE M;  2XH9 A;  3ZH9 B;  2EUC A;  2JXN A;  2LWX A;  1XHB A;  4IBD A;  3NBX X;  2QCU A;  1KSF X;  2CV1 A;  1OFH A;  2V1C A;  2FH0 A;  1TGU A;  3U6O A;  1QAO A;  3C9P A;  3U5Z A;  3GPX A;  2CEA A;  1WXQ A;  3D8B A;  2G5G X;  3T1Y M;  2BJW A;  4JI3 M;  1MN3 A;  5H37 D;  2CRU A;  4D80 A;  1D0L A;  1YSY A;  1MJG M;  1PJI A;  2H1R A;  2R44 A;  5KQD A;  3AL0 C;  3DZD A;  2F4V M;  1XB2 B;  1IN8 A;  3HU3 A;  2JP7 A;  1SXJ C;  4RNA A;  2MH8 A;  3KP0 E;  2LVA A;  2W82 A;  1I4W A;  3THG A;  2R6F A;  2DZN B;  2F5O A;  2D7E A;  1F4I A;  4AI6 A;  3PXG A;  4B3S M;  1NHW C;  4JYA M;  2Z4R A;  4IJF A;  1W5T A;  2X8A A;  4NSR A;  4XK8 F;  5EP2 A;  5FTN A;  5ITR A;  3T1H M;  4D81 A;  4B3M M;  1J09 A;  4LZJ A;  3CF6 E;  2CHV A;  1L2D A;  1HT2 E;  4PDG A;  3W67 A;  1HNX M;  1GL7 A;  4L16 A;  2DWZ B;  5EQT A;  1LTM A;  2EKF A;  1R6B X;  3I01 M;  4IBF A;  4DR1 M;  2LVQ D;  1GJT A;  1E9S A;  2DI0 A;  3B9P A;  4IBJ A;  1NJF A;  4LY6 A;  5ITY A;  2XZU A;  2CP8 A;  5ITX E;  3SAR A;  4GHL A;  3GLI E;  4LJ8 A;  1XWI A;  3DFZ A;  1IY0 A;  1WIV A;  3FRH A;  3J7B A;  4B3R M;  2L09 A;  5BR8 M;  1YUB A;  2HHH M;  1VEJ A;  1NY6 A;  1T3T A;  4GRI A;  3KSX A;  4NOO B;  4AKG A;  2X49 A;  3E46 A;  2RRU A;  1V92 A;  2OO9 A;  3GRR A;  4GKJ M;  4GC5 A;  1C7Y A;  5IRE B;  3J7A S;  5IT9 S;  4I5S A;  4HL4 A;  4RF0 A;  3KOW E;  4FVM A;  3FTC A;  4IJE A;  3V76 A;  3CTW B;  3D8L A;  4CHT B;  2FFJ A;  1QUT A;  1OJL A;  2QNJ A;  2LVO C;  1D0K A;  2KDL A;  3A46 A;  5IWA M;  4FWH A;  5E6J A;  2DWL A;  1HQC A;  3NWL A;  2R18 A;  5KQ8 A;  3Q8G A;  5A2Q S;  2DHY A;  1OAI A;  2KA6 B;  3PNY A;  4AW4 A;  2DXI A;  2AHM A;  2ZM6 M;  1QAQ A;  1Q39 A;  3SAU A;  3VFD A;  3U6S A;  4DV2 M;  4YY3 M;  1EE8 A;  2JY6 B;  3M0E A;  1R2Z A;  3J81 S;  1Z5A A;  5EP3 A;  5FSW A;  3QYE A;  2JY5 A;  2R46 A;  4KHP M;  3GQ5 A;  1OFI A;  1C1K A;  2Y0Q A;  2Y21 A;  4DR3 M;  2CE7 A;  2JWS A;  3MJ5 A;  2DVW B;  2C9C A;  2L2D A;  3T6P A;  3B89 A;  1JR3 D;  4NRW A;  1HR0 M;  3R9X B;  4MB7 A;  4NXN M;  2L6O A;  1N36 M;  2ZTD A;  2JUJ A;  1W5S A;  2DAE A;  2KNV A;  3AJI B;  4MGY E;  3M7G A;  4AG5 A;  3SAT A;  2QPA A;  2EA0 A;  2G3Q A;  4OVZ A;  3L26 A;  2R0I A;  1N33 M;  3KSJ A;  1I94 M;  3ZQJ A;  1DV0 A;  1JQJ C;  2Z4S A;  3TWK A;  3K9P A;  4MGH A;  2UUB M;  4DV3 M;  1L8Q A;  1IQP A;  1WHC A;  1GAB A;  1NSF A;  1K3X A;  4L78 A;  4Z8X A;  1J5E M;  4MM3 B;  3GPP A;  1WR1 B;  4LF7 M;  4MGI E;  1OQY A;  5ITT A;  2JY8 A;  3L28 A;  3BOS A;  1QVR A;  2K47 A;  3DOA A;  3Q8X A;  2I7N A;  4ITQ A;  2WSF F;  3SFZ A;  5L8R F;  3HY5 A;  1VEG A;  3GLI A;  3LQR A;  3B7N A;  3A45 A;  3HHY A;  1VEK A;  4NSO B;  4LF9 M;  2QHO B;  1JR3 A;  4M9X A;  2OQ4 A;  4X62 M;  3L25 A;  3U5Z B;  1IN6 A;  1OTR A;  4LJ9 A;  4NC6 A;  3KP1 E;  1DO0 A;  3I4Y A;  2QEN A;  4P16 A;  5KPR A;  3KOY E;  1SXJ D;  5JI2 E;  1X37 A;  4LJ6 A;  2HKJ A;  3UZU A;  3GRY A;  4DR6 M;  2K0B X;  3VK7 A;  5EP4 A;  1V34 A;  4IIW A;  4GKK M;  3SYK A;  2HCB A;  1XXH B;  4CGY B;  1P3Q Q;  2DNA A;  3VDP A;  3RGP A;  2UUA M;  3C58 A;  1N32 M;  4B08 A;  1TR8 A;  3SMS A;  1OIZ A;  1G59 A;  4GHA A;  2LHG A;  1J7K A;  2J5Y A;  3KFU G;  2X4A A;  3UJN A;  3KOX E;  3KOZ E;  4IBG A;  1YE9 A;  4JI7 M;  2YFQ A;  2DZL A;  3I4V A;  1EIJ A;  3GLG A;  1GL6 A;  4FCT A;  1FJG M;  4EIW A;  2BWB A;  2HAK A;  4GH9 A;  3U6Q A; 
#chains in the Genus database with same CATH homology
 2L4F A;  3GLI E;  2O25 A;  1R4G A;  1WIV A;  3FRH A;  3FRI A;  1UFZ A;  1VEJ A;  1ZMV A;  2MJ5 B;  3E21 A;  3E46 A;  2RRU A;  3BBZ A;  1V92 A;  2OO9 A;  2LTU A;  1C7Y A;  1NV8 A;  1YLA A;  4F1I A;  1DO2 A;  1QZE A;  3K9O A;  1ZMW A;  1Q02 A;  2DKL A;  2WZJ A;  5DFL A;  1WGN A;  2QNJ A;  2LBC A;  2MRO B;  2ZTC A;  2LVO C;  2LVP C;  1E94 E;  2HWJ A;  3GLG E;  2LVN C;  2JZ0 A;  1ZMU A;  1JR3 E;  2DEN A;  2DAM A;  2MR9 A;  2DHY A;  1OAI A;  3H4J A;  2EJS A;  2DAI A;  1HT1 E;  3IEC A;  2JY6 B;  3FE3 A;  2KNZ A;  2L4E A;  4G3O A;  1HJP A;  1IFY A;  2JY5 A;  1WGL A;  1IM2 A;  1EFU B;  3LCV B;  3MMP A;  2L2D A;  3T6P A;  2JY7 A;  3B89 A;  1VG5 A;  2MGW A;  1XXH E;  1A5T A;  2JUJ A;  1PGY A;  2DAE A;  2KNV A;  2ZTD A;  2JZ1 A;  4Q7J A;  1G3I A;  3F92 A;  2H5X A;  1WJ7 A;  2DAG A;  4GEW A;  2G3Q A;  4DBG B;  2R0I A;  1AIP C;  3GLF E;  1DV0 A;  2OOB A;  3K9P A;  2KNA A;  2OOA A;  2EKK A;  1SG9 A;  1WHC A;  1VQ1 A;  4UN2 B;  2KHH A;  3LCU A;  1WR1 B;  3GLH E;  1NV9 A;  1OQY A;  2BWE A;  1VDL A;  2JY8 A;  1OKS A;  2JNH A;  1Y8G A;  1GO5 A;  1VEG A;  2K9D A;  1G41 A;  1ZV1 A;  1VEK A;  1MN3 A;  2QHO B;  1OTR A;  1DO0 A;  1T43 A;  1IXS A;  1T6O A;  5JI2 E;  1XB2 B;  2JP7 A;  2LVA A;  2K0B X;  2QSF X;  1BVS A;  2CWB A;  4WP2 A;  1F4I A;  1KYI A;  1G4A E;  1P3Q Q;  2DAK A;  2DNA A;  4F2L A;  1TR8 A;  1CUK A;  1HT2 E;  1TTE A;  4HEO A;  2DZL A;  1HQY E;  2EKF A;  2B3T A;  3IHP A;  4R71 A;  2LVQ D;  2DI0 A;  2BWB A;  2HAK A;  2CP8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...