1WJ7A

Solution structure of rsgi ruh-015, a uba domain from mouse cdna
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
104
structure length
104
Chain Sequence
GSSGSSGNQNQTQHKQRPQATAEQIRLAQMISDHNDADFEEKVKQLIDITGKNQDECVIALHDCNGDVNRAINVLLEGNPDTHSWEMVGKKKGVSGQKSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of RSGI RUH-015, a UBA domain from mouse cDNA
rcsb
source organism Mus musculus
molecule tags Structural genomics, unknown function
molecule keywords Hypothetical protein (RSGI RUH-015)
total genus 15
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2004-05-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 1wj7A01
2DENA 1DV0A 4F2LA 1ZMVA 2DI0A 1A5TA 1OAIA 1T6OA 1XXHE 2ZTDA 2H5XA 2DAKA 2CWBA 2DAEA 3LCUA 2LBCA 1KYIA 1HT1E 3FE3A 2DAMA 2G3QA 3E21A 1WGLA 1WIVA 2OOAA 2L2DA 1JR3E 2WZJA 1OTRA 2CP8A 1C7YA 2KNVA 1AIPC 3GLFE 1ZMUA 3IHPA 1HT2E 2R0IA 5DFLA 2K9DA 2DAGA 1G4AE 1G3IA 1IFYA 1SG9A 1OKSA 3BBZA 2HWJA 1WR1B 1NV9A 1ZMWA 2JNHA 1T43A 1TR8A 5JI2E 3FRHA 1BVSA 2LVOC 2JY5A 1DO0A 1VEKA 1V92A 1WJ7A 1TTEA 3MMPA 2K0BX 2RRUA 4R71A 2OOBA 4WP2A 2HAKA 2JY7A 1IM2A 2EJSA 1QZEA 2LVNC 2KHHA 1WGNA 3F92A 1F4IA 3B89A 2ZTCA 1Y8GA 4HEOA 4F1IA 2JY8A 1HJPA 2DAIA 1YLAA 2MR9A 1NV8A 1XB2B 3IECA 1MN3A 4G3OA 1IXSA 2EKKA 1R4GA 2KNZA 3GLIE 2OO9A 3LCVB 2DZLA 3T6PA 2L4EA 2QHOB 2JP7A 1VEJA 1VEGA 1Q02A 1PGYA 2LTUA 2JZ0A 4Q7JA 1GO5A 2DNAA 2JY6B 3E46A 3K9PA 2BWEA 2EKFA 1HQYE 1DO2A 1ZV1A 3GLHE 2MJ5B 2O25A 3K9OA 2BWBA 2KNAA 2DHYA 2JZ1A 1P3QQ 1CUKA 1UFZA 2B3TA 2LVPC 3H4JA 4GEWA 1OQYA 3FRIA 1VG5A 2JUJA 2L4FA 4DBGB 1E94E 2LVQD 2MROB 2LVAA 2QSFX 1WHCA 2QNJA 2MGWA 1VDLA 1VQ1A 4UN2B 1G41A 2DKLA 3GLGE 1EFUB
chains in the Genus database with same CATH superfamily
2DENA 3KS8A 3TE6A 4IBBA 2UUAM 3D8LA 5EXXA 3GLGB 4LF4M 2XF3A 3VLFB 2H1RA 3WHLA 2GQFA 2W82A 1ZAEA 5EP1A 1IBLM 2ZBKB 4GKKM 4P16A 1N32M 3LCUA 4LFCM 3HKPA 3U6MA 3TL4X 3HX3A 3I04M 3JR5A 4G4OA 4OX9M 2G3QA 5FTNA 2OOAA 4LJ9A 5IT9S 2L2DA 3GQ3A 1XNRM 1GABA 1OTRA 4I8OA 1IQPA 2VIIA 1ZQ9A 3GLFE 4Z8XA 4LJ6A 4L78A 4MGYE 3SATA 1HT2E 2R46A 3B74A 1SXJD 3UK6A 3I01M 4WW0A 3U61A 1G71A 3TWLA 2D7HA 1G3IA 1GLNA 1SG9A 2DWNA 1OKSA 4LGYA 4HL4A 2JWSA 1DGHA 2GNOA 5GKNA 2JNHA 3PNYA 1OIPA 1IN5A 2FFJA 4IJFA 5JI2E 2FS1A 5BR8M 4LF5M 4QHSA 2Z4RA 4QOZC 3KSXA 2CUZA 1E9SA 1DO0A 3KOZE 3KVWA 1WJ7A 3NWLA 1SXJC 1TTEA 2KZSA 4BLCA 4GHLA 4CISA 1EE8A 2RRUA 3EIHA 2YQZA 2JA2A 1GL6A 3C3DA 3NBXX 4M9SA 4WP2A 4R71A 3KFUG 1I4WA 3HHWA 1IM2A 3J81S 4DV0M 3QAUA 1PRBA 3B89A 2ZTCA 4LJ8A 2XZFA 1W5SA 4HEOA 4LZZA 3A98B 3GLHA 1YLAA 3LQQA 2MR9A 4JYAM 3B7NA 1QANA 2UUBM 2VF8A 1AUAA 3J27B 2X49A 3CF6E 2CFOA 4ZPXA 4P17A 5EP3A 4BBAA 2LNHC 4PD2A 2KNZA 2YFQA 2F5OA 3J7AS 4IIWA 3GLIE 1NJGA 5ITXA 4S12A 4M0DA 4IBEA 4L16A 3K2LA 3FUVA 4X62M 3U5ZA 1N77A 3T38A 4LJ4A 3GLIB 1Q3BA 2JP7A 2LXEA 1VEJA 3FUXA 2LWXA 3M7GA 4MM3B 5E6JA 3VKGA 2LTUA 5DNYA 4KT0F 4GMQA 3E46A 3RE8A 1YE9A 3RGSA 1NSFA 2HCBA 3MK6A 1HQYE 3L26A 4OVZB 2AHMA 2R4JA 1IY0A 1JR3D 3AV0A 2L6OA 2O25A 3FUWA 4AG5A 3HZJA 1I94M 2DHYA 2DHRA 4B3MM 3H4JA 1UFZA 4LJAA 3SAUA 4L4UA 1IBKM 1OQYA 2X4AA 1DGHB 3FRIA 3TQSA 1VG5A 1MJGM 2G5GX 4WURA 1K3WA 4GITA 4DBGB 1PJTA 3HHZA 2M60A 1R2ZA 3I51A 2VQEM 2R6FA 1QZMA 4R7GA 3LW5F 1Z59A 4AI6A 1IN4A 1NY6A 5KPZA 3AL0C 2YR0A 3HGIA 3IG8A 3UZUA 2R18A 1MX0A 4DR6M 3L27A 3WHKA 4L15A 4KLNA 1E9RA 4IBKA 5EP4A 3SMPA 5KQ8A 3U6SA 1R2YA 3W0LB 3KSJA 5ITTA 2CHGA 3K92A 2DAEA 1NO1A 1ORYB 3E9SA 3A46A 4AKIA 1NVMA 5FTKA 4KODA 1NY5A 1HT1E 2L7IA 2VF7A 3B9PA 5H37D 1JQJC 3FE3A 4M0WA 2DAMA 3QWLA 4LCBA 4MB7A 4BB9A 4PDGA 4NXNM 1WIVA 4GRIA 2KDLA 5DYGA 2WZJA 4NOOB 1YUBA 3U6PA 2KA6B 4D82A 1AIPC 1QDTA 3GRRA 2E5LM 4LZJA 3KDSE 4EIWA 2Y0QA 5EXPA 1E32A 3GRVA 5DFLA 2ERCA 3E4RA 4X64M 4FVMA 1G4AE 1IFYA 3PNVA 4FCVA 3UMMA 3CF2A 1G8PA 2X8AA 3RGPA 1T43A 1L1TA 2XGNA 4KHPM 2QQ8A 2XFTA 3JAMS 4PCZA 2UXBM 3T15A 1Z5BA 3FRHA 4CHTB 1BVSA 2JY5A 1Q39A 1QAQA 1Z6TA 3ILKA 3R8FA 1TDHA 1XXHB 2BJWA 2C9CA 4NRVA 5A2QS 2K0BX 4KO8A 3W67A 5FTJA 3GO8A 3U6CA 2OPFA 1G59A 5FTMA 2JY7A 2HKJA 1JB0F 2R4EA 3QYBA 5JI3E 1L2DA 4B7HA 3BOSA 2EJSA 5FTLA 1QZEA 4GIPA 1FNNA 2KHHA 4B7FA 1WGNA 1K82A 4LF9M 4DR7M 1PJSA 5FLXS 2KXEA 2WSEF 3MJ5A 1UM8A 1C1KA 1TF0B 2ZANA 3GPXA 1L2BA 2UXDM 2DAIA 1HR0M 2FE8A 3HWSA 1MN3A 5KQDA 4II7A 4DR3M 4G3OA 4DV3M 1DGFA 2F5SA 5KO3A 1NNJA 2A5YB 4LGMA 4NC6A 2XH9A 1QAOA 2K47A 3VDUA 3VFDA 2XSZA 1XC8A 2CV2A 5E26A 3W68A 4RNAA 4DUZM 4JI5M 2L09A 2CEAA 4A3VB 4DV5M 1N34M 2Z8YM 2RKOA 4OU7A 1VEGA 1Q02A 2CE7A 2R45A 2Z7JA 2JZ0A 2DNAA 4LRSA 1QYRA 3T1HM 5LMNM 3GRYA 4GHAA 1J5EM 2ZAOA 2BWEA 3KS4A 3LMMA 4AG6A 3BXWA 1T3TA 1EIJA 2MJ5B 1OFIA 3SARA 3D8BA 4RF0A 2Y0TA 2BWBA 4QNRA 1GKIA 2CHVA 2LVPC 3Q8XA 5ITYA 4LRTA 4MGIE 5ITQA 2UXCM 1V33A 2LVQD 1XWIA 1H6UA 1IBMM 3U6DA 4NL4H 1WHCA 4DV4M 5ITRA 1VQ1A 3KOYE 4UN2B 2HL7A 4OVZA 4CGYB 4I81A 8CATA 4IJEA 1S3SA 5F3WA 4IBJA 1TDZA 1DV0A 2O5RA 4W5WA 1SXJA 2F5QA 2CHQA 1ZMVA 5L8RF 3KXEC 1IN7A 4ITQA 2DI0A 3DZDA 1VDDA 2ZAMA 4DR5M 1K3XA 1T6OA 1L8QA 1XXHE 2RGHA 4I4LA 2DAKA 4X65M 3KOWE 4DR2M 2FOIC 3GP1A 4FWHA 2LBCA 3VK7A 3J80S 1KYIA 2KRKA 1FJGM 2BNKA 4LJ7A 1R6BX 4XK8F 3GLFA 1QUTA 3E21A 4GKJM 1WGLA 4I5SA 3NBIA 1QDRA 4G4RA 3KOXE 3A42A 3MHVC 2CP8A 2VQFM 3B7ZA 1C7YA 2NQ8C 2F5PA 3VDPA 1ZMUA 2XSZD 3AOEA 3IHPA 4JI8M 2R0IA 3U6OA 4D80A 2DAGA 2D7EA 3AJIB 1IY1A 3HJQA 5IREB 4Z6YA 4JV5M 3UJNA 1IY2A 3BBZA 1HNXM 1XMQM 1WR1B 3CF0A 1NV9A 2QBYA 3K1JA 1IXZA 2Y20A 3KP1E 4MGKE 3SHFA 3DOAA 4XGIA 3R9XB 3ZCBB 4RF1A 5BPVA 5ITXE 4MGHA 2CV1A 2LVOC 2LHCA 1KSFX 2J7NA 1N78A 1VEKA 4JI4M 2HHHM 5DYIA 2OOBA 3C58A 4AW4A 4OW0A 3AOGA 3FD9A 3FYCA 4JI0M 1SXJE 2R62A 4REZA 2APLA 4NSRA 3HJ8A 3AOEC 2XZUA 4LY6A 4M9ZA 4IBDA 4F1IA 2JY8A 5C18A 1HJPA 1NHWC 5EJCA 3U6LA 1SXJB 1XHBA 3L2AA 4YY3M 4B3SM 1XNQM 3IECA 1IXSA 1IXSB 1KFVA 2QPAA 2DWMA 3GQ5A 3HHXA 1HNWM 2OO9A 1Z5AA 4DV2M 4DR4M 4PT5A 5C1BA 1GVNA 4LFBM 4GC9A 5KPTA 3M6AA 1OJLA 2DZLA 1PJJA 3T6PA 4FWDA 2L4EA 4FD2A 4M9XA 3JR4A 3EIEA 4Y28F 3SYLA 4B3TM 4NRWA 4G4QA 4K0KM 4AKGA 2Y21A 1GO5A 2JY6B 3K9PA 3RFWA 2EO2A 3C3EA 3VK8A 3HY5A 1DO2A 1ZV1A 4LF7M 3FTFA 3OTOM 1W5TA 4IBCA 1OIZA 2DXIA 4GH9A 3SMSA 1GJTA 1TH4A 2JXNA 3TWKA 2KNAA 3TWMA 3SAWA 3HHYA 2JZ1A 1QAMA 2B3TA 4DV7M 4FCTA 1D0MA 1MU5A 2KZUA 1GJSA 3U60B 3SBJA 4LFAM 2LHGA 2L4FA 4JI3M 2QENA 2MROB 4QHTA 2Z3XA 1JR3A 2LVAA 2CV0A 2V1UA 2QSFX 2QNJA 3U6EA 1VDLA 3GLIA 2UUCM 1G41A 3K8ZA 2G8LA 2DKLA 4CIZA 4B3RM 3FYDA 1V34A 4D81A 4QOSA 4MH0E 2ZM6M 2RGOA 3SYKA 3VKHA 4F2LA 1D2NA 4R3DA 1NNUC 4G6ZA 2M5ZA 2J7OA 1A5TA 1OAIA 2DZOB 3LQRA 1N33M 4B08A 3C9PA 2ZTDA 2H5XA 1J7KA 2VDBB 2CWBA 3GLHB 1HQCA 3B7QA 3J7BA 1X37A 2K6BA 2Z4SA 3SAVA 2I7NA 4FW9A 2MH8A 3FKEA 2C5RA 1XXHA 1JR3E 3FUTA 3KP0E 1LTMA 4JI6M 3W0FA 1TH3A 2KNVA 2DZNB 2QZ4A 3Q8GA 3FTCA 3FTDA 4JXJA 3GRUA 3SHGB 3ZH9B 1IXRC 1WXQA 2P5TA 2OQ4A 2K9DA 5KPRA 3DA1A 1Q3CA 2V6ZM 3SC3A 3CGWA 3V76A 3FTEA 3AKZA 1R7RA 2HWJA 4DUYM 4DR1M 1HNZM 3FUUA 4YHHM 1ZMWA 3I4YA 3GPPA 1TR8A 3UGJA 3GPUA 1PJIA 2C98A 3THGA 3SASA 4LF6M 2C99A 1IN8A 1XMOM 2QP9X 2XFSA 3AFHA 2EA0A 4JI7M 4IBGA 2QBYB 2KRUA 2WSFF 4DV6M 2XEPA 3A45A 4TUWA 4JI1M 1GL7A 4XBOA 4FCWA 4LG2A 1V92A 3HU3A 2DWLA 4G4NA 3HJSA 3MMPA 4AKHA 1OAOC 1TH2A 3M0EA 2C9OA 2R65A 3PVSA 3U61B 2DWZB 2HAKA 1OFHA 4DV1M 2F5NA 3PFIA 2QCUA 3J2PB 3U5ZB 2YNMD 3LVVA 3GQ4A 4B7GA 1QVRA 2LVNC 1DGGA 3QYEA 3F92A 1F4IA 4ANRA 5ITUA 2L7HA 5LMUM 1DGBA 2O01F 4GC5A 3L28A 3GLFB 1Y8GA 3HU1A 2EUCA 1TGUA 5EP2A 1NV8A 3CTWB 1QQWA 1L2CA 4L8RC 1XB2B 3GPYA 2LH0A 1Z5CA 1RU3A 2EKKA 3U6QA 3GLGA 1IN6A 1R4GA 3SFZA 2CRUA 1D0LA 3TPZA 4JI2M 2F4VM 4IBFA 3IG5A 4AQYM 3LVWA 4JN6A 4PDIA 3LCVB 2UU9M 3HU2A 1N75A 5EXSA 1PJQA 1YSYA 4FWGA 4QNMA 5EXTA 3U60A 2V1CA 5EQTA 2QHOB 3L25A 2FNAA 2R44A 1PGYA 2KW0A 1J09A 5IWAM 4LJ5A 5IZ7D 4Q7JA 4AZFA 3I4VA 3ZQJA 2WSCF 3H4MA 4HLQA 4MGZE 2EKFA 3ZC7B 2J5YA 2BJVA 4RKUF 1R5LA 2FH0A 2N35A 3GLHE 1NHGC 4L6V6 2D7GA 1QUSA 2I7PA 3K9OA 1L1ZA 1PM5A 4LF8M 4CJ6A 4IBIA 3DFZA 1LV7A 1P3QQ 1CUKA 3KW6A 4GEWA 1D0KA 4NXMM 1N36M 3L29A 2JUJA 2C96A 3PXGA 4X66M 1E94E 2KEBA 7CATA 2Q2EB 2XLJA 2MGWA 3T1YM 2DVWB 4NSOB 5FSWA 3GLGE 1EFUB 1NJFA
chains in the Genus database with same CATH topology
2DENA 1DV0A 4F2LA 1ZMVA 2DI0A 1A5TA 1OAIA 1T6OA 1XXHE 2ZTDA 2H5XA 2DAKA 2CWBA 2DAEA 3LCUA 2LBCA 1KYIA 1HT1E 3FE3A 2DAMA 2G3QA 3E21A 1WGLA 1WIVA 2OOAA 2L2DA 1JR3E 2WZJA 1OTRA 2CP8A 1C7YA 2KNVA 1AIPC 3GLFE 1ZMUA 3IHPA 1HT2E 2R0IA 5DFLA 2K9DA 2DAGA 1G4AE 1G3IA 1IFYA 1SG9A 1OKSA 3BBZA 2HWJA 1WR1B 1NV9A 1ZMWA 2JNHA 1T43A 1TR8A 5JI2E 3FRHA 1BVSA 2LVOC 2JY5A 1DO0A 1VEKA 1V92A 1WJ7A 1TTEA 3MMPA 2K0BX 2RRUA 4R71A 2OOBA 4WP2A 2HAKA 2JY7A 1IM2A 2EJSA 1QZEA 2LVNC 2KHHA 1WGNA 3F92A 1F4IA 3B89A 2ZTCA 1Y8GA 4HEOA 4F1IA 2JY8A 1HJPA 2DAIA 1YLAA 2MR9A 1NV8A 1XB2B 3IECA 1MN3A 4G3OA 1IXSA 2EKKA 1R4GA 2KNZA 3GLIE 2OO9A 3LCVB 2DZLA 3T6PA 2L4EA 2QHOB 2JP7A 1VEJA 1VEGA 1Q02A 1PGYA 2LTUA 2JZ0A 4Q7JA 1GO5A 2DNAA 2JY6B 3E46A 3K9PA 2BWEA 2EKFA 1HQYE 1DO2A 1ZV1A 3GLHE 2MJ5B 2O25A 3K9OA 2BWBA 2KNAA 2DHYA 2JZ1A 1P3QQ 1CUKA 1UFZA 2B3TA 2LVPC 3H4JA 4GEWA 1OQYA 3FRIA 1VG5A 2JUJA 2L4FA 4DBGB 1E94E 2LVQD 2MROB 2LVAA 2QSFX 1WHCA 2QNJA 2MGWA 1VDLA 1VQ1A 4UN2B 1G41A 2DKLA 3GLGE 1EFUB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DEN A;  1DV0 A;  4F2L A;  1ZMV A;  2DI0 A;  1A5T A;  1OAI A;  1T6O A;  1XXH E;  2ZTD A;  2H5X A;  2DAK A;  2CWB A;  2DAE A;  3LCU A;  2LBC A;  1KYI A;  1HT1 E;  3FE3 A;  2DAM A;  2G3Q A;  3E21 A;  1WGL A;  1WIV A;  2OOA A;  2L2D A;  1JR3 E;  2WZJ A;  1OTR A;  2CP8 A;  1C7Y A;  2KNV A;  1AIP C;  3GLF E;  1ZMU A;  3IHP A;  1HT2 E;  2R0I A;  5DFL A;  2K9D A;  2DAG A;  1G4A E;  1G3I A;  1IFY A;  1SG9 A;  1OKS A;  3BBZ A;  2HWJ A;  1WR1 B;  1NV9 A;  1ZMW A;  2JNH A;  1T43 A;  1TR8 A;  5JI2 E;  3FRH A;  1BVS A;  2LVO C;  2JY5 A;  1DO0 A;  1VEK A;  1V92 A;  1WJ7 A;  1TTE A;  3MMP A;  2K0B X;  2RRU A;  4R71 A;  2OOB A;  4WP2 A;  2HAK A;  2JY7 A;  1IM2 A;  2EJS A;  1QZE A;  2LVN C;  2KHH A;  1WGN A;  3F92 A;  1F4I A;  3B89 A;  2ZTC A;  1Y8G A;  4HEO A;  4F1I A;  2JY8 A;  1HJP A;  2DAI A;  1YLA A;  2MR9 A;  1NV8 A;  1XB2 B;  3IEC A;  1MN3 A;  4G3O A;  1IXS A;  2EKK A;  1R4G A;  2KNZ A;  3GLI E;  2OO9 A;  3LCV B;  2DZL A;  3T6P A;  2L4E A;  2QHO B;  2JP7 A;  1VEJ A;  1VEG A;  1Q02 A;  1PGY A;  2LTU A;  2JZ0 A;  4Q7J A;  1GO5 A;  2DNA A;  2JY6 B;  3E46 A;  3K9P A;  2BWE A;  2EKF A;  1HQY E;  1DO2 A;  1ZV1 A;  3GLH E;  2MJ5 B;  2O25 A;  3K9O A;  2BWB A;  2KNA A;  2DHY A;  2JZ1 A;  1P3Q Q;  1CUK A;  1UFZ A;  2B3T A;  2LVP C;  3H4J A;  4GEW A;  1OQY A;  3FRI A;  1VG5 A;  2JUJ A;  2L4F A;  4DBG B;  1E94 E;  2LVQ D;  2MRO B;  2LVA A;  2QSF X;  1WHC A;  2QNJ A;  2MGW A;  1VDL A;  1VQ1 A;  4UN2 B;  1G41 A;  2DKL A;  3GLG E;  1EFU B; 
#chains in the Genus database with same CATH topology
 2DEN A;  3KS8 A;  3TE6 A;  4IBB A;  2UUA M;  3D8L A;  5EXX A;  3GLG B;  4LF4 M;  2XF3 A;  3VLF B;  2H1R A;  3WHL A;  2GQF A;  2W82 A;  1ZAE A;  5EP1 A;  1IBL M;  2ZBK B;  4GKK M;  4P16 A;  1N32 M;  3LCU A;  4LFC M;  3HKP A;  3U6M A;  3TL4 X;  3HX3 A;  3I04 M;  3JR5 A;  4G4O A;  4OX9 M;  2G3Q A;  5FTN A;  2OOA A;  4LJ9 A;  5IT9 S;  2L2D A;  3GQ3 A;  1XNR M;  1GAB A;  1OTR A;  4I8O A;  1IQP A;  2VII A;  1ZQ9 A;  3GLF E;  4Z8X A;  4LJ6 A;  4L78 A;  4MGY E;  3SAT A;  1HT2 E;  2R46 A;  3B74 A;  1SXJ D;  3UK6 A;  3I01 M;  4WW0 A;  3U61 A;  1G71 A;  3TWL A;  2D7H A;  1G3I A;  1GLN A;  1SG9 A;  2DWN A;  1OKS A;  4LGY A;  4HL4 A;  2JWS A;  1DGH A;  2GNO A;  5GKN A;  2JNH A;  3PNY A;  1OIP A;  1IN5 A;  2FFJ A;  4IJF A;  5JI2 E;  2FS1 A;  5BR8 M;  4LF5 M;  4QHS A;  2Z4R A;  4QOZ C;  3KSX A;  2CUZ A;  1E9S A;  1DO0 A;  3KOZ E;  3KVW A;  1WJ7 A;  3NWL A;  1SXJ C;  1TTE A;  2KZS A;  4BLC A;  4GHL A;  4CIS A;  1EE8 A;  2RRU A;  3EIH A;  2YQZ A;  2JA2 A;  1GL6 A;  3C3D A;  3NBX X;  4M9S A;  4WP2 A;  4R71 A;  3KFU G;  1I4W A;  3HHW A;  1IM2 A;  3J81 S;  4DV0 M;  3QAU A;  1PRB A;  3B89 A;  2ZTC A;  4LJ8 A;  2XZF A;  1W5S A;  4HEO A;  4LZZ A;  3A98 B;  3GLH A;  1YLA A;  3LQQ A;  2MR9 A;  4JYA M;  3B7N A;  1QAN A;  2UUB M;  2VF8 A;  1AUA A;  3J27 B;  2X49 A;  3CF6 E;  2CFO A;  4ZPX A;  4P17 A;  5EP3 A;  4BBA A;  2LNH C;  4PD2 A;  2KNZ A;  2YFQ A;  2F5O A;  3J7A S;  4IIW A;  3GLI E;  1NJG A;  5ITX A;  4S12 A;  4M0D A;  4IBE A;  4L16 A;  3K2L A;  3FUV A;  4X62 M;  3U5Z A;  1N77 A;  3T38 A;  4LJ4 A;  3GLI B;  1Q3B A;  2JP7 A;  2LXE A;  1VEJ A;  3FUX A;  2LWX A;  3M7G A;  4MM3 B;  5E6J A;  3VKG A;  2LTU A;  5DNY A;  4KT0 F;  4GMQ A;  3E46 A;  3RE8 A;  1YE9 A;  3RGS A;  1NSF A;  2HCB A;  3MK6 A;  1HQY E;  3L26 A;  4OVZ B;  2AHM A;  2R4J A;  1IY0 A;  1JR3 D;  3AV0 A;  2L6O A;  2O25 A;  3FUW A;  4AG5 A;  3HZJ A;  1I94 M;  2DHY A;  2DHR A;  4B3M M;  3H4J A;  1UFZ A;  4LJA A;  3SAU A;  4L4U A;  1IBK M;  1OQY A;  2X4A A;  1DGH B;  3FRI A;  3TQS A;  1VG5 A;  1MJG M;  2G5G X;  4WUR A;  1K3W A;  4GIT A;  4DBG B;  1PJT A;  3HHZ A;  2M60 A;  1R2Z A;  3I51 A;  2VQE M;  2R6F A;  1QZM A;  4R7G A;  3LW5 F;  1Z59 A;  4AI6 A;  1IN4 A;  1NY6 A;  5KPZ A;  3AL0 C;  2YR0 A;  3HGI A;  3IG8 A;  3UZU A;  2R18 A;  1MX0 A;  4DR6 M;  3L27 A;  3WHK A;  4L15 A;  4KLN A;  1E9R A;  4IBK A;  5EP4 A;  3SMP A;  5KQ8 A;  3U6S A;  1R2Y A;  3W0L B;  3KSJ A;  5ITT A;  2CHG A;  3K92 A;  2DAE A;  1NO1 A;  1ORY B;  3E9S A;  3A46 A;  4AKI A;  1NVM A;  5FTK A;  4KOD A;  1NY5 A;  1HT1 E;  2L7I A;  2VF7 A;  3B9P A;  5H37 D;  1JQJ C;  3FE3 A;  4M0W A;  2DAM A;  3QWL A;  4LCB A;  4MB7 A;  4BB9 A;  4PDG A;  4NXN M;  1WIV A;  4GRI A;  2KDL A;  5DYG A;  2WZJ A;  4NOO B;  1YUB A;  3U6P A;  2KA6 B;  4D82 A;  1AIP C;  1QDT A;  3GRR A;  2E5L M;  4LZJ A;  3KDS E;  4EIW A;  2Y0Q A;  5EXP A;  1E32 A;  3GRV A;  5DFL A;  2ERC A;  3E4R A;  4X64 M;  4FVM A;  1G4A E;  1IFY A;  3PNV A;  4FCV A;  3UMM A;  3CF2 A;  1G8P A;  2X8A A;  3RGP A;  1T43 A;  1L1T A;  2XGN A;  4KHP M;  2QQ8 A;  2XFT A;  3JAM S;  4PCZ A;  2UXB M;  3T15 A;  1Z5B A;  3FRH A;  4CHT B;  1BVS A;  2JY5 A;  1Q39 A;  1QAQ A;  1Z6T A;  3ILK A;  3R8F A;  1TDH A;  1XXH B;  2BJW A;  2C9C A;  4NRV A;  5A2Q S;  2K0B X;  4KO8 A;  3W67 A;  5FTJ A;  3GO8 A;  3U6C A;  2OPF A;  1G59 A;  5FTM A;  2JY7 A;  2HKJ A;  1JB0 F;  2R4E A;  3QYB A;  5JI3 E;  1L2D A;  4B7H A;  3BOS A;  2EJS A;  5FTL A;  1QZE A;  4GIP A;  1FNN A;  2KHH A;  4B7F A;  1WGN A;  1K82 A;  4LF9 M;  4DR7 M;  1PJS A;  5FLX S;  2KXE A;  2WSE F;  3MJ5 A;  1UM8 A;  1C1K A;  1TF0 B;  2ZAN A;  3GPX A;  1L2B A;  2UXD M;  2DAI A;  1HR0 M;  2FE8 A;  3HWS A;  1MN3 A;  5KQD A;  4II7 A;  4DR3 M;  4G3O A;  4DV3 M;  1DGF A;  2F5S A;  5KO3 A;  1NNJ A;  2A5Y B;  4LGM A;  4NC6 A;  2XH9 A;  1QAO A;  2K47 A;  3VDU A;  3VFD A;  2XSZ A;  1XC8 A;  2CV2 A;  5E26 A;  3W68 A;  4RNA A;  4DUZ M;  4JI5 M;  2L09 A;  2CEA A;  4A3V B;  4DV5 M;  1N34 M;  2Z8Y M;  2RKO A;  4OU7 A;  1VEG A;  1Q02 A;  2CE7 A;  2R45 A;  2Z7J A;  2JZ0 A;  2DNA A;  4LRS A;  1QYR A;  3T1H M;  5LMN M;  3GRY A;  4GHA A;  1J5E M;  2ZAO A;  2BWE A;  3KS4 A;  3LMM A;  4AG6 A;  3BXW A;  1T3T A;  1EIJ A;  2MJ5 B;  1OFI A;  3SAR A;  3D8B A;  4RF0 A;  2Y0T A;  2BWB A;  4QNR A;  1GKI A;  2CHV A;  2LVP C;  3Q8X A;  5ITY A;  4LRT A;  4MGI E;  5ITQ A;  2UXC M;  1V33 A;  2LVQ D;  1XWI A;  1H6U A;  1IBM M;  3U6D A;  4NL4 H;  1WHC A;  4DV4 M;  5ITR A;  1VQ1 A;  3KOY E;  4UN2 B;  2HL7 A;  4OVZ A;  4CGY B;  4I81 A;  8CAT A;  4IJE A;  1S3S A;  5F3W A;  4IBJ A;  1TDZ A;  1DV0 A;  2O5R A;  4W5W A;  1SXJ A;  2F5Q A;  2CHQ A;  1ZMV A;  5L8R F;  3KXE C;  1IN7 A;  4ITQ A;  2DI0 A;  3DZD A;  1VDD A;  2ZAM A;  4DR5 M;  1K3X A;  1T6O A;  1L8Q A;  1XXH E;  2RGH A;  4I4L A;  2DAK A;  4X65 M;  3KOW E;  4DR2 M;  2FOI C;  3GP1 A;  4FWH A;  2LBC A;  3VK7 A;  3J80 S;  1KYI A;  2KRK A;  1FJG M;  2BNK A;  4LJ7 A;  1R6B X;  4XK8 F;  3GLF A;  1QUT A;  3E21 A;  4GKJ M;  1WGL A;  4I5S A;  3NBI A;  1QDR A;  4G4R A;  3KOX E;  3A42 A;  3MHV C;  2CP8 A;  2VQF M;  3B7Z A;  1C7Y A;  2NQ8 C;  2F5P A;  3VDP A;  1ZMU A;  2XSZ D;  3AOE A;  3IHP A;  4JI8 M;  2R0I A;  3U6O A;  4D80 A;  2DAG A;  2D7E A;  3AJI B;  1IY1 A;  3HJQ A;  5IRE B;  4Z6Y A;  4JV5 M;  3UJN A;  1IY2 A;  3BBZ A;  1HNX M;  1XMQ M;  1WR1 B;  3CF0 A;  1NV9 A;  2QBY A;  3K1J A;  1IXZ A;  2Y20 A;  3KP1 E;  4MGK E;  3SHF A;  3DOA A;  4XGI A;  3R9X B;  3ZCB B;  4RF1 A;  5BPV A;  5ITX E;  4MGH A;  2CV1 A;  2LVO C;  2LHC A;  1KSF X;  2J7N A;  1N78 A;  1VEK A;  4JI4 M;  2HHH M;  5DYI A;  2OOB A;  3C58 A;  4AW4 A;  4OW0 A;  3AOG A;  3FD9 A;  3FYC A;  4JI0 M;  1SXJ E;  2R62 A;  4REZ A;  2APL A;  4NSR A;  3HJ8 A;  3AOE C;  2XZU A;  4LY6 A;  4M9Z A;  4IBD A;  4F1I A;  2JY8 A;  5C18 A;  1HJP A;  1NHW C;  5EJC A;  3U6L A;  1SXJ B;  1XHB A;  3L2A A;  4YY3 M;  4B3S M;  1XNQ M;  3IEC A;  1IXS A;  1IXS B;  1KFV A;  2QPA A;  2DWM A;  3GQ5 A;  3HHX A;  1HNW M;  2OO9 A;  1Z5A A;  4DV2 M;  4DR4 M;  4PT5 A;  5C1B A;  1GVN A;  4LFB M;  4GC9 A;  5KPT A;  3M6A A;  1OJL A;  2DZL A;  1PJJ A;  3T6P A;  4FWD A;  2L4E A;  4FD2 A;  4M9X A;  3JR4 A;  3EIE A;  4Y28 F;  3SYL A;  4B3T M;  4NRW A;  4G4Q A;  4K0K M;  4AKG A;  2Y21 A;  1GO5 A;  2JY6 B;  3K9P A;  3RFW A;  2EO2 A;  3C3E A;  3VK8 A;  3HY5 A;  1DO2 A;  1ZV1 A;  4LF7 M;  3FTF A;  3OTO M;  1W5T A;  4IBC A;  1OIZ A;  2DXI A;  4GH9 A;  3SMS A;  1GJT A;  1TH4 A;  2JXN A;  3TWK A;  2KNA A;  3TWM A;  3SAW A;  3HHY A;  2JZ1 A;  1QAM A;  2B3T A;  4DV7 M;  4FCT A;  1D0M A;  1MU5 A;  2KZU A;  1GJS A;  3U60 B;  3SBJ A;  4LFA M;  2LHG A;  2L4F A;  4JI3 M;  2QEN A;  2MRO B;  4QHT A;  2Z3X A;  1JR3 A;  2LVA A;  2CV0 A;  2V1U A;  2QSF X;  2QNJ A;  3U6E A;  1VDL A;  3GLI A;  2UUC M;  1G41 A;  3K8Z A;  2G8L A;  2DKL A;  4CIZ A;  4B3R M;  3FYD A;  1V34 A;  4D81 A;  4QOS A;  4MH0 E;  2ZM6 M;  2RGO A;  3SYK A;  3VKH A;  4F2L A;  1D2N A;  4R3D A;  1NNU C;  4G6Z A;  2M5Z A;  2J7O A;  1A5T A;  1OAI A;  2DZO B;  3LQR A;  1N33 M;  4B08 A;  3C9P A;  2ZTD A;  2H5X A;  1J7K A;  2VDB B;  2CWB A;  3GLH B;  1HQC A;  3B7Q A;  3J7B A;  1X37 A;  2K6B A;  2Z4S A;  3SAV A;  2I7N A;  4FW9 A;  2MH8 A;  3FKE A;  2C5R A;  1XXH A;  1JR3 E;  3FUT A;  3KP0 E;  1LTM A;  4JI6 M;  3W0F A;  1TH3 A;  2KNV A;  2DZN B;  2QZ4 A;  3Q8G A;  3FTC A;  3FTD A;  4JXJ A;  3GRU A;  3SHG B;  3ZH9 B;  1IXR C;  1WXQ A;  2P5T A;  2OQ4 A;  2K9D A;  5KPR A;  3DA1 A;  1Q3C A;  2V6Z M;  3SC3 A;  3CGW A;  3V76 A;  3FTE A;  3AKZ A;  1R7R A;  2HWJ A;  4DUY M;  4DR1 M;  1HNZ M;  3FUU A;  4YHH M;  1ZMW A;  3I4Y A;  3GPP A;  1TR8 A;  3UGJ A;  3GPU A;  1PJI A;  2C98 A;  3THG A;  3SAS A;  4LF6 M;  2C99 A;  1IN8 A;  1XMO M;  2QP9 X;  2XFS A;  3AFH A;  2EA0 A;  4JI7 M;  4IBG A;  2QBY B;  2KRU A;  2WSF F;  4DV6 M;  2XEP A;  3A45 A;  4TUW A;  4JI1 M;  1GL7 A;  4XBO A;  4FCW A;  4LG2 A;  1V92 A;  3HU3 A;  2DWL A;  4G4N A;  3HJS A;  3MMP A;  4AKH A;  1OAO C;  1TH2 A;  3M0E A;  2C9O A;  2R65 A;  3PVS A;  3U61 B;  2DWZ B;  2HAK A;  1OFH A;  4DV1 M;  2F5N A;  3PFI A;  2QCU A;  3J2P B;  3U5Z B;  2YNM D;  3LVV A;  3GQ4 A;  4B7G A;  1QVR A;  2LVN C;  1DGG A;  3QYE A;  3F92 A;  1F4I A;  4ANR A;  5ITU A;  2L7H A;  5LMU M;  1DGB A;  2O01 F;  4GC5 A;  3L28 A;  3GLF B;  1Y8G A;  3HU1 A;  2EUC A;  1TGU A;  5EP2 A;  1NV8 A;  3CTW B;  1QQW A;  1L2C A;  4L8R C;  1XB2 B;  3GPY A;  2LH0 A;  1Z5C A;  1RU3 A;  2EKK A;  3U6Q A;  3GLG A;  1IN6 A;  1R4G A;  3SFZ A;  2CRU A;  1D0L A;  3TPZ A;  4JI2 M;  2F4V M;  4IBF A;  3IG5 A;  4AQY M;  3LVW A;  4JN6 A;  4PDI A;  3LCV B;  2UU9 M;  3HU2 A;  1N75 A;  5EXS A;  1PJQ A;  1YSY A;  4FWG A;  4QNM A;  5EXT A;  3U60 A;  2V1C A;  5EQT A;  2QHO B;  3L25 A;  2FNA A;  2R44 A;  1PGY A;  2KW0 A;  1J09 A;  5IWA M;  4LJ5 A;  5IZ7 D;  4Q7J A;  4AZF A;  3I4V A;  3ZQJ A;  2WSC F;  3H4M A;  4HLQ A;  4MGZ E;  2EKF A;  3ZC7 B;  2J5Y A;  2BJV A;  4RKU F;  1R5L A;  2FH0 A;  2N35 A;  3GLH E;  1NHG C;  4L6V 6;  2D7G A;  1QUS A;  2I7P A;  3K9O A;  1L1Z A;  1PM5 A;  4LF8 M;  4CJ6 A;  4IBI A;  3DFZ A;  1LV7 A;  1P3Q Q;  1CUK A;  3KW6 A;  4GEW A;  1D0K A;  4NXM M;  1N36 M;  3L29 A;  2JUJ A;  2C96 A;  3PXG A;  4X66 M;  1E94 E;  2KEB A;  7CAT A;  2Q2E B;  2XLJ A;  2MGW A;  3T1Y M;  2DVW B;  4NSO B;  5FSW A;  3GLG E;  1EFU B;  1NJF A; 
#chains in the Genus database with same CATH homology
 2DEN A;  1DV0 A;  4F2L A;  1ZMV A;  2DI0 A;  1A5T A;  1OAI A;  1T6O A;  1XXH E;  2ZTD A;  2H5X A;  2DAK A;  2CWB A;  2DAE A;  3LCU A;  2LBC A;  1KYI A;  1HT1 E;  3FE3 A;  2DAM A;  2G3Q A;  3E21 A;  1WGL A;  1WIV A;  2OOA A;  2L2D A;  1JR3 E;  2WZJ A;  1OTR A;  2CP8 A;  1C7Y A;  2KNV A;  1AIP C;  3GLF E;  1ZMU A;  3IHP A;  1HT2 E;  2R0I A;  5DFL A;  2K9D A;  2DAG A;  1G4A E;  1G3I A;  1IFY A;  1SG9 A;  1OKS A;  3BBZ A;  2HWJ A;  1WR1 B;  1NV9 A;  1ZMW A;  2JNH A;  1T43 A;  1TR8 A;  5JI2 E;  3FRH A;  1BVS A;  2LVO C;  2JY5 A;  1DO0 A;  1VEK A;  1V92 A;  1WJ7 A;  1TTE A;  3MMP A;  2K0B X;  2RRU A;  4R71 A;  2OOB A;  4WP2 A;  2HAK A;  2JY7 A;  1IM2 A;  2EJS A;  1QZE A;  2LVN C;  2KHH A;  1WGN A;  3F92 A;  1F4I A;  3B89 A;  2ZTC A;  1Y8G A;  4HEO A;  4F1I A;  2JY8 A;  1HJP A;  2DAI A;  1YLA A;  2MR9 A;  1NV8 A;  1XB2 B;  3IEC A;  1MN3 A;  4G3O A;  1IXS A;  2EKK A;  1R4G A;  2KNZ A;  3GLI E;  2OO9 A;  3LCV B;  2DZL A;  3T6P A;  2L4E A;  2QHO B;  2JP7 A;  1VEJ A;  1VEG A;  1Q02 A;  1PGY A;  2LTU A;  2JZ0 A;  4Q7J A;  1GO5 A;  2DNA A;  2JY6 B;  3E46 A;  3K9P A;  2BWE A;  2EKF A;  1HQY E;  1DO2 A;  1ZV1 A;  3GLH E;  2MJ5 B;  2O25 A;  3K9O A;  2BWB A;  2KNA A;  2DHY A;  2JZ1 A;  1P3Q Q;  1CUK A;  1UFZ A;  2B3T A;  2LVP C;  3H4J A;  4GEW A;  1OQY A;  3FRI A;  1VG5 A;  2JUJ A;  2L4F A;  4DBG B;  1E94 E;  2LVQ D;  2MRO B;  2LVA A;  2QSF X;  1WHC A;  2QNJ A;  2MGW A;  1VDL A;  1VQ1 A;  4UN2 B;  1G41 A;  2DKL A;  3GLG E;  1EFU B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...