1WJ7A

Solution structure of rsgi ruh-015, a uba domain from mouse cdna
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
104
structure length
104
Chain Sequence
GSSGSSGNQNQTQHKQRPQATAEQIRLAQMISDHNDADFEEKVKQLIDITGKNQDECVIALHDCNGDVNRAINVLLEGNPDTHSWEMVGKKKGVSGQKSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein (RSGI RUH-015)
publication title Solution structure of RSGI RUH-015, a UBA domain from mouse cDNA
rcsb
source organism Mus musculus
molecule tags Structural genomics, unknown function
total genus 15
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2004-05-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 1wj7A01
2O25A 2JUJA 2LVNC 1VEKA 4WP2A 2K9DA 2MGWA 2LBCA 1NV9A 1ZV1A 3B89A 2LVQD 4Q7JA 1EFUB 1UFZA 2DHYA 4F2LA 1CUKA 3F92A 1R4GA 2QSFX 1XXHE 2OO9A 3LCUA 2DAMA 3E46A 2B3TA 2G3QA 3GLGE 1BVSA 2DKLA 2KNAA 1GO5A 2CWBA 1F4IA 1G41A 2KNZA 3BBZA 1OTRA 1P3QQ 1VEGA 3K9OA 2DAIA 1QZEA 2JY7A 2OOBA 3GLIE 3T6PA 1IFYA 1G4AE 1V92A 1VEJA 3FRIA 1IXSA 1WGNA 2EJSA 2JZ1A 3GLHE 4HEOA 2LTUA 2EKKA 2MR9A 1WR1B 4R71A 1WIVA 3H4JA 3E21A 1OAIA 1IM2A 1HJPA 4DBGB 3MMPA 1PGYA 3FE3A 1OKSA 1Q02A 1T6OA 2ZTDA 2JP7A 2JY5A 1AIPC 1VDLA 3LCVB 5JI2E 2WZJA 2LVOC 1WJ7A 1XB2B 1Y8GA 2DAGA 2DNAA 1NV8A 3GLFE 1A5TA 2K0BX 2CP8A 2DZLA 2HAKA 4GEWA 1C7YA 2JY8A 2BWEA 1TTEA 1DO2A 3IHPA 1MN3A 1VQ1A 1JR3E 2L4EA 2JY6B 2DAKA 2HWJA 1ZMVA 1HT1E 4F1IA 2DENA 1YLAA 1E94E 1DO0A 2DAEA 2QHOB 2JZ0A 2L4FA 1KYIA 2LVPC 1VG5A 1ZMWA 2L2DA 3K9PA 1OQYA 2DI0A 1SG9A 1DV0A 1HT2E 1WHCA 1ZMUA 1G3IA 2EKFA 2JNHA 2RRUA 2LVAA 2ZTCA 1WGLA 2KHHA 2BWBA 3FRHA 1TR8A 2OOAA 3IECA 1HQYE 2QNJA 4UN2B 2MROB 5DFLA 2H5XA 1T43A 2R0IA 4G3OA 2MJ5B 2KNVA
chains in the Genus database with same CATH superfamily
2WSCF 2LVNC 4S12A 4AZFA 3SAVA 1QANA 1MU5A 2LHGA 3B9PA 4MM3B 2ZM6M 1E32A 3U60B 1KFVA 1MJGM 1R6BX 8CATA 2LVQD 3B74A 1EFUB 5FTMA 1PJTA 1ZAEA 4F2LA 3GLHA 2G8LA 4TUWA 1R4GA 2C96A 1XXHE 4FD2A 3LCUA 3WHLA 3RGSA 3SARA 2B3TA 2L7HA 4L15A 4II7A 3GQ4A 2DKLA 4RF1A 2K6BA 4GC5A 2R45A 2CWBA 2VF8A 5DYGA 1Q3CA 1F4IA 3GLGA 5GKNA 2DZNB 2YQZA 3B7ZA 1XMQM 1XXHB 3ZC7B 2CV2A 4X66M 1H6UA 3KXEC 3UMMA 2F5QA 1IFYA 3FRIA 4G4RA 1IXSA 1WGNA 2QBYA 4AKIA 3VKGA 3GLHE 5EP2A 1TH4A 5L8RF 2KRUA 4AG6A 1XHBA 4LJ7A 4LFBM 1WR1B 2HKJA 2I7NA 4LY6A 4DV2M 3B7NA 3L27A 2ZBKB 3H4JA 2XEPA 3E21A 4XK8F 1OAIA 2EUCA 2LH0A 3AOGA 2FOIC 3MMPA 4L6V6 4JI4M 3UZUA 2CHGA 3KP0E 2HL7A 3GRYA 5ITTA 2EA0A 4FCVA 1XNRM 1T6OA 3EIEA 2JY5A 3PNYA 2UXDM 4QHSA 4FWGA 3J80S 3SASA 4LGYA 1DGHB 3LCVB 3HU1A 1NO1A 5FSWA 3WHKA 4LFAM 1SXJC 4NXNM 5JI2E 5FTLA 4DR6M 2K47A 2R6FA 3GLGB 1QDTA 2LVOC 4JI6M 3MJ5A 3U6LA 4JYAM 3VFDA 2C98A 4RNAA 3A45A 1XNQM 3AKZA 1NV8A 2YFQA 2OQ4A 3U6DA 3SBJA 2K0BX 3CF6E 1DGBA 1T3TA 2DZLA 4GEWA 1C7YA 5FTNA 2L6OA 2BWEA 1TTEA 3FTEA 1NJFA 1IXSB 3IHPA 3SFZA 2VQFM 4AI6A 1VQ1A 3JAMS 4B3TM 2HWJA 2LHCA 3C9PA 1G59A 3FUVA 1HNXM 3HJ8A 4LF4M 1K82A 1EE8A 2DZOB 1YLAA 2XZFA 4LJ4A 2W82A 4AKGA 3LVWA 4LRTA 1V33A 3K8ZA 3VK7A 4D82A 2VF7A 2JZ0A 3K2LA 1QAMA 4LF7M 2L2DA 3NBIA 4G4QA 2CHVA 1OQYA 2DI0A 1SG9A 1D0KA 1ZMUA 5JI3E 1D0MA 2Y0TA 4LF8M 2LVAA 1R2ZA 2ZTCA 1VDDA 4ZPXA 2CV1A 4D80A 5EP4A 5C18A 1TR8A 1Z6TA 4DR5M 4K0KM 2QPAA 4M9ZA 4B7GA 3BXWA 1IBMM 3HHYA 1OJLA 2QP9X 2KNVA 2WSFF 3M6AA 3DFZA 3A98B 1VEKA 2K9DA 3Q8XA 4WW0A 2LBCA 2YR0A 1NV9A 4FWDA 3HY5A 2X4AA 2Z4SA 1ZV1A 2HHHM 3GLIA 2KDLA 4HL4A 3EIHA 1Z59A 1UFZA 4Q7JA 1TH3A 3HJSA 3TL4X 3SHFA 1TDHA 1J09A 3PXGA 4AQYM 1K3WA 3R8FA 1N36M 4L16A 4G6ZA 2BJVA 3E46A 1C1KA 4LCBA 3SHGB 1BVSA 1I4WA 1GO5A 3U5ZA 4B3SM 3GRVA 1HNZM 2LNHC 3OTOM 2QENA 4G4NA 3FUTA 3K9OA 4AW4A 4CJ6A 3GP1A 3NWLA 1IQPA 2Z4RA 3U6QA 5DYIA 4OVZA 2F5NA 2OOBA 4XBOA 3GLIE 4L4UA 2MH8A 3KSXA 2M5ZA 2R44A 4GC9A 3FKEA 2JZ1A 4BB9A 4LF9M 2LTUA 3A42A 3HX3A 4R71A 1IY0A 1WIVA 1S3SA 1QAQA 2VIIA 3J7BA 4IIWA 2CUZA 1YSYA 2XFSA 4P16A 2GQFA 3GLIB 1LTMA 3L28A 3L26A 2RKOA 5EP3A 5KPTA 3SAWA 2EO2A 1QQWA 4IJFA 1SXJA 3SYLA 4IJEA 3HU2A 3FTDA 1SXJD 1IBKM 1OKSA 3SMSA 3FTFA 3TWKA 4M0WA 3A46A 2UU9M 1Z5AA 1IN8A 1OAOC 5F3WA 3KVWA 3FUUA 5DNYA 3UK6A 4LZZA 4B3RM 5IT9S 4LGMA 2XGNA 2DVWB 5KQDA 2DNAA 4M9XA 3C3DA 2XF3A 1A5TA 4FW9A 4JI8M 3D8LA 4I8OA 2JY8A 1YE9A 4DR7M 1NY5A 3D8BA 3PNVA 1HR0M 3FTCA 3QAUA 2KZUA 4NSRA 1SXJE 3I4VA 5KO3A 2G5GX 3AOEC 3HWSA 1ZMVA 1PJQA 1Q3BA 1IN5A 3ILKA 3U6MA 3J27B 3JR5A 2BJWA 3GLHB 1NHGC 1N75A 4KLNA 3U6SA 1E94E 1PM5A 1IY1A 4DUZM 1DO0A 1AUAA 1L1ZA 5ITYA 1G71A 5IZ7D 3W67A 4KODA 2LVPC 4GMQA 1JB0F 4IBDA 2F5OA 1VG5A 2C99A 5FTJA 1ZMWA 3J2PB 3VKHA 2KZSA 3M7GA 4R7GA 2UXCM 2FH0A 4PD2A 2F4VM 3R9XB 3VDUA 1G3IA 2KRKA 4ANRA 3VK8A 2EKFA 2JNHA 4HLQA 4LF5M 4GH9A 4L78A 2CFOA 1W5TA 3IECA 1IN4A 4X65M 2XH9A 1GVNA 1W5SA 2QNJA 4UN2B 4D81A 2MROB 2QBYB 4A3VB 3TE6A 5DFLA 3U6CA 4Y28F 4ITQA 4G3OA 4B7FA 3LW5F 3CF2A 3KS4A 4YHHM 1YUBA 2JUJA 2F5SA 3CF0A 2DWNA 2KA6B 4WURA 2Z3XA 4WP2A 1NNJA 2UXBM 4L8RC 3I4YA 2MGWA 2DXIA 4MGZE 1XC8A 5BPVA 4GHAA 4DV4M 3JR4A 2J7NA 2DHYA 1N78A 2R46A 1IN6A 3E4RA 1IBLM 1KSFX 5A2QS 1CUKA 3F92A 1E9RA 2H1RA 3M0EA 1Z5BA 2C9OA 3NBXX 3GRUA 4AG5A 5E6JA 2E5LM 1JQJC 4MGKE 4DV7M 2UUAM 2G3QA 2Z7JA 2KNAA 2R18A 1QAOA 2D7EA 2X49A 2XZUA 1ORYB 4LF6M 4OU7A 2KNZA 1D0LA 5ITXA 3KS8A 3BBZA 1P3QQ 1VEGA 5IWAM 4YY3M 3UJNA 4NRWA 1QZEA 4JI3M 3CTWB 3GRRA 4QHTA 1K3XA 2RGOA 4X62M 4MB7A 3T6PA 3K92A 1G4AE 1V92A 3W0LB 1L2CA 4CISA 1OFHA 2EJSA 2ZAMA 4RF0A 1PJJA 3U6PA 2V1UA 3U61A 3GQ5A 4HEOA 2C9CA 4MGIE 4NRVA 1NJGA 2EKKA 2MR9A 5IREB 1LV7A 3C3EA 4BLCA 5KPZA 4B3MM 4QOZC 2QQ8A 1DGFA 2DWMA 3KOWE 3U60A 3SYKA 4LFCM 3FUWA 2FFJA 4PDIA 1TF0B 4DBGB 1TDZA 2N35A 4CIZA 1QUTA 4QNMA 3FE3A 5ITXE 1JR3A 2A5YB 1N32M 3KDSE 1JR3D 3FYCA 3T1HM 1Q02A 2ZTDA 3HHWA 4M0DA 3SAUA 1AIPC 1VDLA 1R5LA 3AV0A 4AKHA 2Y21A 3HHZA 3LQRA 4JI7M 2APLA 4IBCA 3GQ3A 2WZJA 4CHTB 5EXPA 1XB2B 1DGGA 1Y8GA 3HZJA 3RFWA 2KW0A 2VQEM 2JXNA 1NNUC 1GLNA 2CP8A 2HAKA 3MK6A 1XWIA 4DV1M 1Z5CA 4DV3M 4NL4H 1HNWM 1X37A 3HU3A 4XGIA 3KOXE 4FCTA 1MN3A 1L2DA 1UM8A 3I51A 1JR3E 2JY6B 3I04M 2D7HA 4KT0F 4PT5A 4F1IA 4G4OA 4I5SA 4IBEA 4KO8A 2L09A 3ZQJA 5FTKA 1QDRA 3E9SA 3K1JA 5KQ8A 1GL6A 2DAEA 2XSZA 2QHOB 2L4FA 7CATA 2R4EA 4PDGA 4JV5M 2XSZD 3KP1E 5ITQA 3UGJA 3QYEA 3IG5A 4DR2M 2QCUA 3DZDA 4EIWA 5BR8M 4W5WA 1RU3A 4DV5M 1OIZA 3K9PA 4DUYM 3U5ZB 4GRIA 1HT2E 2L7IA 4MGHA 4LJ8A 2RRUA 2UUBM 1WGLA 2BNKA 4X64M 3AL0C 1IXRC 4OVZB 2KEBA 5H37D 4OW0A 1DGHA 2O01F 3HJQA 3TQSA 3GPUA 2O5RA 2OPFA 2M60A 3H4MA 3LMMA 2H5XA 1T43A 2R0IA 1IXZA 3B7QA 2MJ5B 4GKJM 4NXMM 1FNNA 1L8QA 5LMUM 1TGUA 2O25A 2F5PA 4IBBA 5ITRA 1GJTA 1V34A 3Q8GA 4GITA 3U6OA 3FD9A 4NC6A 1XMOM 1TH2A 1GL7A 1N34M 4JXJA 4LJ5A 4MGYE 4B7HA 5LMNM 3B89A 1I94M 3KSJA 1GJSA 3ZCBB 5ITUA 1GABA 4LG2A 2J5YA 3GPPA 1SXJB 2HCBA 3DOAA 4FCWA 4DR1M 1ZQ9A 1NVMA 1QUSA 2DWZB 2KXEA 3RE8A 2QSFX 4I4LA 2OO9A 2Y20A 2CEAA 2DAMA 3AJIB 3DA1A 3PVSA 2D7GA 3V76A 5KPRA 4JI1M 2CRUA 3HGIA 4MH0E 2V6ZM 4FVMA 2RGHA 3GLGE 3KW6A 1QYRA 3GPXA 1R2YA 2UUCM 1NSFA 1G41A 5EXXA 1J5EM 2FNAA 4QOSA 1OTRA 4RKUF 1MX0A 3KOYE 2DAIA 3ZH9B 2AHMA 3T38A 3PFIA 3QYBA 2JY7A 3THGA 1OIPA 1L1TA 2CHQA 4Z8XA 1R7RA 2WSEF 1VEJA 5EXSA 4IBJA 4R3DA 2DHRA 2FS1A 2J7OA 3W0FA 2DWLA 1Q39A 4IBGA 4OX9M 1IN7A 2VDBB 1PJIA 2Q2EB 2ZAOA 3GLFA 3SATA 2GNOA 3KOZE 5EXTA 3IG8A 4CGYB 1IM2A 1HJPA 2R4JA 3LQQA 3L29A 4IBFA 4LJAA 4JN6A 4NOOB 4GHLA 1PGYA 1QVRA 3TPZA 4NSOB 4DR3M 2JP7A 2CE7A 4IBKA 4LJ6A 4REZA 2XLJA 2FE8A 2Z8YM 2LWXA 2NQ8C 3GO8A 3TWMA 4P17A 4IBIA 3FYDA 2P5TA 2CV0A 2QZ4A 1OFIA 4LRSA 3FUXA 2LXEA 1WJ7A 2R65A 1E9SA 2DAGA 1L2BA 2R62A 3T15A 3LVVA 1N33M 3C58A 3GLFE 1EIJA 3AFHA 3GPYA 1HQCA 4DR4M 1PRBA 3HKPA 5EJCA 2XFTA 4M9SA 1DO2A 4JI0M 3J7AS 4FWHA 4DV6M 2ZANA 3TWLA 2L4EA 2DAKA 2JWSA 2JA2A 4PCZA 1HT1E 4BBAA 3CGWA 2DENA 4JI5M 3KFUG 1D2NA 3GLFB 4GIPA 1NHWC 4QNRA 1G8PA 1QZMA 4LJ9A 4DV0M 1J7KA 1KYIA 3I01M 3MHVC 4KHPM 1IY2A 4GKKM 5E26A 3W68A 4I81A 3SC3A 2C5RA 1DV0A 1WHCA 3VLFB 2I7PA 1NY6A 3VDPA 1N77A 2X8AA 3L25A 2ERCA 4JI2M 3BOSA 3L2AA 3RGPA 4B08A 2V1CA 2KHHA 1GKIA 2BWBA 2Y0QA 3AOEA 3FRHA 3SMPA 1PJSA 2OOAA 3HHXA 1WXQA 1XXHA 4Z6YA 5C1BA 3J81S 3U6EA 1HQYE 3T1YM 5EP1A 3QWLA 1FJGM 4LZJA 2YNMD 3U61B 5FLXS 5EQTA
chains in the Genus database with same CATH topology
2O25A 2JUJA 2LVNC 1VEKA 4WP2A 2K9DA 2MGWA 2LBCA 1NV9A 1ZV1A 3B89A 2LVQD 4Q7JA 1EFUB 1UFZA 2DHYA 4F2LA 1CUKA 3F92A 1R4GA 2QSFX 1XXHE 2OO9A 3LCUA 2DAMA 3E46A 2B3TA 2G3QA 3GLGE 1BVSA 2DKLA 2KNAA 1GO5A 2CWBA 1F4IA 1G41A 2KNZA 3BBZA 1OTRA 1P3QQ 1VEGA 3K9OA 2DAIA 1QZEA 2JY7A 2OOBA 3GLIE 3T6PA 1IFYA 1G4AE 1V92A 1VEJA 3FRIA 1IXSA 1WGNA 2EJSA 2JZ1A 3GLHE 4HEOA 2LTUA 2EKKA 2MR9A 1WR1B 4R71A 1WIVA 3H4JA 3E21A 1OAIA 1IM2A 1HJPA 4DBGB 3MMPA 1PGYA 3FE3A 1OKSA 1Q02A 1T6OA 2ZTDA 2JP7A 2JY5A 1AIPC 1VDLA 3LCVB 5JI2E 2WZJA 2LVOC 1WJ7A 1XB2B 1Y8GA 2DAGA 2DNAA 1NV8A 3GLFE 1A5TA 2K0BX 2CP8A 2DZLA 2HAKA 4GEWA 1C7YA 2JY8A 2BWEA 1TTEA 1DO2A 3IHPA 1MN3A 1VQ1A 1JR3E 2L4EA 2JY6B 2DAKA 2HWJA 1ZMVA 1HT1E 4F1IA 2DENA 1YLAA 1E94E 1DO0A 2DAEA 2QHOB 2JZ0A 2L4FA 1KYIA 2LVPC 1VG5A 1ZMWA 2L2DA 3K9PA 1OQYA 2DI0A 1SG9A 1DV0A 1HT2E 1WHCA 1ZMUA 1G3IA 2EKFA 2JNHA 2RRUA 2LVAA 2ZTCA 1WGLA 2KHHA 2BWBA 3FRHA 1TR8A 2OOAA 3IECA 1HQYE 2QNJA 4UN2B 2MROB 5DFLA 2H5XA 1T43A 2R0IA 4G3OA 2MJ5B 2KNVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2O25 A;  2JUJ A;  2LVN C;  1VEK A;  4WP2 A;  2K9D A;  2MGW A;  2LBC A;  1NV9 A;  1ZV1 A;  3B89 A;  2LVQ D;  4Q7J A;  1EFU B;  1UFZ A;  2DHY A;  4F2L A;  1CUK A;  3F92 A;  1R4G A;  2QSF X;  1XXH E;  2OO9 A;  3LCU A;  2DAM A;  3E46 A;  2B3T A;  2G3Q A;  3GLG E;  1BVS A;  2DKL A;  2KNA A;  1GO5 A;  2CWB A;  1F4I A;  1G41 A;  2KNZ A;  3BBZ A;  1OTR A;  1P3Q Q;  1VEG A;  3K9O A;  2DAI A;  1QZE A;  2JY7 A;  2OOB A;  3GLI E;  3T6P A;  1IFY A;  1G4A E;  1V92 A;  1VEJ A;  3FRI A;  1IXS A;  1WGN A;  2EJS A;  2JZ1 A;  3GLH E;  4HEO A;  2LTU A;  2EKK A;  2MR9 A;  1WR1 B;  4R71 A;  1WIV A;  3H4J A;  3E21 A;  1OAI A;  1IM2 A;  1HJP A;  4DBG B;  3MMP A;  1PGY A;  3FE3 A;  1OKS A;  1Q02 A;  1T6O A;  2ZTD A;  2JP7 A;  2JY5 A;  1AIP C;  1VDL A;  3LCV B;  5JI2 E;  2WZJ A;  2LVO C;  1WJ7 A;  1XB2 B;  1Y8G A;  2DAG A;  2DNA A;  1NV8 A;  3GLF E;  1A5T A;  2K0B X;  2CP8 A;  2DZL A;  2HAK A;  4GEW A;  1C7Y A;  2JY8 A;  2BWE A;  1TTE A;  1DO2 A;  3IHP A;  1MN3 A;  1VQ1 A;  1JR3 E;  2L4E A;  2JY6 B;  2DAK A;  2HWJ A;  1ZMV A;  1HT1 E;  4F1I A;  2DEN A;  1YLA A;  1E94 E;  1DO0 A;  2DAE A;  2QHO B;  2JZ0 A;  2L4F A;  1KYI A;  2LVP C;  1VG5 A;  1ZMW A;  2L2D A;  3K9P A;  1OQY A;  2DI0 A;  1SG9 A;  1DV0 A;  1HT2 E;  1WHC A;  1ZMU A;  1G3I A;  2EKF A;  2JNH A;  2RRU A;  2LVA A;  2ZTC A;  1WGL A;  2KHH A;  2BWB A;  3FRH A;  1TR8 A;  2OOA A;  3IEC A;  1HQY E;  2QNJ A;  4UN2 B;  2MRO B;  5DFL A;  2H5X A;  1T43 A;  2R0I A;  4G3O A;  2MJ5 B;  2KNV A; 
#chains in the Genus database with same CATH topology
 2WSC F;  2LVN C;  4S12 A;  4AZF A;  3SAV A;  1QAN A;  1MU5 A;  2LHG A;  3B9P A;  4MM3 B;  2ZM6 M;  1E32 A;  3U60 B;  1KFV A;  1MJG M;  1R6B X;  8CAT A;  2LVQ D;  3B74 A;  1EFU B;  5FTM A;  1PJT A;  1ZAE A;  4F2L A;  3GLH A;  2G8L A;  4TUW A;  1R4G A;  2C96 A;  1XXH E;  4FD2 A;  3LCU A;  3WHL A;  3RGS A;  3SAR A;  2B3T A;  2L7H A;  4L15 A;  4II7 A;  3GQ4 A;  2DKL A;  4RF1 A;  2K6B A;  4GC5 A;  2R45 A;  2CWB A;  2VF8 A;  5DYG A;  1Q3C A;  1F4I A;  3GLG A;  5GKN A;  2DZN B;  2YQZ A;  3B7Z A;  1XMQ M;  1XXH B;  3ZC7 B;  2CV2 A;  4X66 M;  1H6U A;  3KXE C;  3UMM A;  2F5Q A;  1IFY A;  3FRI A;  4G4R A;  1IXS A;  1WGN A;  2QBY A;  4AKI A;  3VKG A;  3GLH E;  5EP2 A;  1TH4 A;  5L8R F;  2KRU A;  4AG6 A;  1XHB A;  4LJ7 A;  4LFB M;  1WR1 B;  2HKJ A;  2I7N A;  4LY6 A;  4DV2 M;  3B7N A;  3L27 A;  2ZBK B;  3H4J A;  2XEP A;  3E21 A;  4XK8 F;  1OAI A;  2EUC A;  2LH0 A;  3AOG A;  2FOI C;  3MMP A;  4L6V 6;  4JI4 M;  3UZU A;  2CHG A;  3KP0 E;  2HL7 A;  3GRY A;  5ITT A;  2EA0 A;  4FCV A;  1XNR M;  1T6O A;  3EIE A;  2JY5 A;  3PNY A;  2UXD M;  4QHS A;  4FWG A;  3J80 S;  3SAS A;  4LGY A;  1DGH B;  3LCV B;  3HU1 A;  1NO1 A;  5FSW A;  3WHK A;  4LFA M;  1SXJ C;  4NXN M;  5JI2 E;  5FTL A;  4DR6 M;  2K47 A;  2R6F A;  3GLG B;  1QDT A;  2LVO C;  4JI6 M;  3MJ5 A;  3U6L A;  4JYA M;  3VFD A;  2C98 A;  4RNA A;  3A45 A;  1XNQ M;  3AKZ A;  1NV8 A;  2YFQ A;  2OQ4 A;  3U6D A;  3SBJ A;  2K0B X;  3CF6 E;  1DGB A;  1T3T A;  2DZL A;  4GEW A;  1C7Y A;  5FTN A;  2L6O A;  2BWE A;  1TTE A;  3FTE A;  1NJF A;  1IXS B;  3IHP A;  3SFZ A;  2VQF M;  4AI6 A;  1VQ1 A;  3JAM S;  4B3T M;  2HWJ A;  2LHC A;  3C9P A;  1G59 A;  3FUV A;  1HNX M;  3HJ8 A;  4LF4 M;  1K82 A;  1EE8 A;  2DZO B;  1YLA A;  2XZF A;  4LJ4 A;  2W82 A;  4AKG A;  3LVW A;  4LRT A;  1V33 A;  3K8Z A;  3VK7 A;  4D82 A;  2VF7 A;  2JZ0 A;  3K2L A;  1QAM A;  4LF7 M;  2L2D A;  3NBI A;  4G4Q A;  2CHV A;  1OQY A;  2DI0 A;  1SG9 A;  1D0K A;  1ZMU A;  5JI3 E;  1D0M A;  2Y0T A;  4LF8 M;  2LVA A;  1R2Z A;  2ZTC A;  1VDD A;  4ZPX A;  2CV1 A;  4D80 A;  5EP4 A;  5C18 A;  1TR8 A;  1Z6T A;  4DR5 M;  4K0K M;  2QPA A;  4M9Z A;  4B7G A;  3BXW A;  1IBM M;  3HHY A;  1OJL A;  2QP9 X;  2KNV A;  2WSF F;  3M6A A;  3DFZ A;  3A98 B;  1VEK A;  2K9D A;  3Q8X A;  4WW0 A;  2LBC A;  2YR0 A;  1NV9 A;  4FWD A;  3HY5 A;  2X4A A;  2Z4S A;  1ZV1 A;  2HHH M;  3GLI A;  2KDL A;  4HL4 A;  3EIH A;  1Z59 A;  1UFZ A;  4Q7J A;  1TH3 A;  3HJS A;  3TL4 X;  3SHF A;  1TDH A;  1J09 A;  3PXG A;  4AQY M;  1K3W A;  3R8F A;  1N36 M;  4L16 A;  4G6Z A;  2BJV A;  3E46 A;  1C1K A;  4LCB A;  3SHG B;  1BVS A;  1I4W A;  1GO5 A;  3U5Z A;  4B3S M;  3GRV A;  1HNZ M;  2LNH C;  3OTO M;  2QEN A;  4G4N A;  3FUT A;  3K9O A;  4AW4 A;  4CJ6 A;  3GP1 A;  3NWL A;  1IQP A;  2Z4R A;  3U6Q A;  5DYI A;  4OVZ A;  2F5N A;  2OOB A;  4XBO A;  3GLI E;  4L4U A;  2MH8 A;  3KSX A;  2M5Z A;  2R44 A;  4GC9 A;  3FKE A;  2JZ1 A;  4BB9 A;  4LF9 M;  2LTU A;  3A42 A;  3HX3 A;  4R71 A;  1IY0 A;  1WIV A;  1S3S A;  1QAQ A;  2VII A;  3J7B A;  4IIW A;  2CUZ A;  1YSY A;  2XFS A;  4P16 A;  2GQF A;  3GLI B;  1LTM A;  3L28 A;  3L26 A;  2RKO A;  5EP3 A;  5KPT A;  3SAW A;  2EO2 A;  1QQW A;  4IJF A;  1SXJ A;  3SYL A;  4IJE A;  3HU2 A;  3FTD A;  1SXJ D;  1IBK M;  1OKS A;  3SMS A;  3FTF A;  3TWK A;  4M0W A;  3A46 A;  2UU9 M;  1Z5A A;  1IN8 A;  1OAO C;  5F3W A;  3KVW A;  3FUU A;  5DNY A;  3UK6 A;  4LZZ A;  4B3R M;  5IT9 S;  4LGM A;  2XGN A;  2DVW B;  5KQD A;  2DNA A;  4M9X A;  3C3D A;  2XF3 A;  1A5T A;  4FW9 A;  4JI8 M;  3D8L A;  4I8O A;  2JY8 A;  1YE9 A;  4DR7 M;  1NY5 A;  3D8B A;  3PNV A;  1HR0 M;  3FTC A;  3QAU A;  2KZU A;  4NSR A;  1SXJ E;  3I4V A;  5KO3 A;  2G5G X;  3AOE C;  3HWS A;  1ZMV A;  1PJQ A;  1Q3B A;  1IN5 A;  3ILK A;  3U6M A;  3J27 B;  3JR5 A;  2BJW A;  3GLH B;  1NHG C;  1N75 A;  4KLN A;  3U6S A;  1E94 E;  1PM5 A;  1IY1 A;  4DUZ M;  1DO0 A;  1AUA A;  1L1Z A;  5ITY A;  1G71 A;  5IZ7 D;  3W67 A;  4KOD A;  2LVP C;  4GMQ A;  1JB0 F;  4IBD A;  2F5O A;  1VG5 A;  2C99 A;  5FTJ A;  1ZMW A;  3J2P B;  3VKH A;  2KZS A;  3M7G A;  4R7G A;  2UXC M;  2FH0 A;  4PD2 A;  2F4V M;  3R9X B;  3VDU A;  1G3I A;  2KRK A;  4ANR A;  3VK8 A;  2EKF A;  2JNH A;  4HLQ A;  4LF5 M;  4GH9 A;  4L78 A;  2CFO A;  1W5T A;  3IEC A;  1IN4 A;  4X65 M;  2XH9 A;  1GVN A;  1W5S A;  2QNJ A;  4UN2 B;  4D81 A;  2MRO B;  2QBY B;  4A3V B;  3TE6 A;  5DFL A;  3U6C A;  4Y28 F;  4ITQ A;  4G3O A;  4B7F A;  3LW5 F;  3CF2 A;  3KS4 A;  4YHH M;  1YUB A;  2JUJ A;  2F5S A;  3CF0 A;  2DWN A;  2KA6 B;  4WUR A;  2Z3X A;  4WP2 A;  1NNJ A;  2UXB M;  4L8R C;  3I4Y A;  2MGW A;  2DXI A;  4MGZ E;  1XC8 A;  5BPV A;  4GHA A;  4DV4 M;  3JR4 A;  2J7N A;  2DHY A;  1N78 A;  2R46 A;  1IN6 A;  3E4R A;  1IBL M;  1KSF X;  5A2Q S;  1CUK A;  3F92 A;  1E9R A;  2H1R A;  3M0E A;  1Z5B A;  2C9O A;  3NBX X;  3GRU A;  4AG5 A;  5E6J A;  2E5L M;  1JQJ C;  4MGK E;  4DV7 M;  2UUA M;  2G3Q A;  2Z7J A;  2KNA A;  2R18 A;  1QAO A;  2D7E A;  2X49 A;  2XZU A;  1ORY B;  4LF6 M;  4OU7 A;  2KNZ A;  1D0L A;  5ITX A;  3KS8 A;  3BBZ A;  1P3Q Q;  1VEG A;  5IWA M;  4YY3 M;  3UJN A;  4NRW A;  1QZE A;  4JI3 M;  3CTW B;  3GRR A;  4QHT A;  1K3X A;  2RGO A;  4X62 M;  4MB7 A;  3T6P A;  3K92 A;  1G4A E;  1V92 A;  3W0L B;  1L2C A;  4CIS A;  1OFH A;  2EJS A;  2ZAM A;  4RF0 A;  1PJJ A;  3U6P A;  2V1U A;  3U61 A;  3GQ5 A;  4HEO A;  2C9C A;  4MGI E;  4NRV A;  1NJG A;  2EKK A;  2MR9 A;  5IRE B;  1LV7 A;  3C3E A;  4BLC A;  5KPZ A;  4B3M M;  4QOZ C;  2QQ8 A;  1DGF A;  2DWM A;  3KOW E;  3U60 A;  3SYK A;  4LFC M;  3FUW A;  2FFJ A;  4PDI A;  1TF0 B;  4DBG B;  1TDZ A;  2N35 A;  4CIZ A;  1QUT A;  4QNM A;  3FE3 A;  5ITX E;  1JR3 A;  2A5Y B;  1N32 M;  3KDS E;  1JR3 D;  3FYC A;  3T1H M;  1Q02 A;  2ZTD A;  3HHW A;  4M0D A;  3SAU A;  1AIP C;  1VDL A;  1R5L A;  3AV0 A;  4AKH A;  2Y21 A;  3HHZ A;  3LQR A;  4JI7 M;  2APL A;  4IBC A;  3GQ3 A;  2WZJ A;  4CHT B;  5EXP A;  1XB2 B;  1DGG A;  1Y8G A;  3HZJ A;  3RFW A;  2KW0 A;  2VQE M;  2JXN A;  1NNU C;  1GLN A;  2CP8 A;  2HAK A;  3MK6 A;  1XWI A;  4DV1 M;  1Z5C A;  4DV3 M;  4NL4 H;  1HNW M;  1X37 A;  3HU3 A;  4XGI A;  3KOX E;  4FCT A;  1MN3 A;  1L2D A;  1UM8 A;  3I51 A;  1JR3 E;  2JY6 B;  3I04 M;  2D7H A;  4KT0 F;  4PT5 A;  4F1I A;  4G4O A;  4I5S A;  4IBE A;  4KO8 A;  2L09 A;  3ZQJ A;  5FTK A;  1QDR A;  3E9S A;  3K1J A;  5KQ8 A;  1GL6 A;  2DAE A;  2XSZ A;  2QHO B;  2L4F A;  7CAT A;  2R4E A;  4PDG A;  4JV5 M;  2XSZ D;  3KP1 E;  5ITQ A;  3UGJ A;  3QYE A;  3IG5 A;  4DR2 M;  2QCU A;  3DZD A;  4EIW A;  5BR8 M;  4W5W A;  1RU3 A;  4DV5 M;  1OIZ A;  3K9P A;  4DUY M;  3U5Z B;  4GRI A;  1HT2 E;  2L7I A;  4MGH A;  4LJ8 A;  2RRU A;  2UUB M;  1WGL A;  2BNK A;  4X64 M;  3AL0 C;  1IXR C;  4OVZ B;  2KEB A;  5H37 D;  4OW0 A;  1DGH A;  2O01 F;  3HJQ A;  3TQS A;  3GPU A;  2O5R A;  2OPF A;  2M60 A;  3H4M A;  3LMM A;  2H5X A;  1T43 A;  2R0I A;  1IXZ A;  3B7Q A;  2MJ5 B;  4GKJ M;  4NXM M;  1FNN A;  1L8Q A;  5LMU M;  1TGU A;  2O25 A;  2F5P A;  4IBB A;  5ITR A;  1GJT A;  1V34 A;  3Q8G A;  4GIT A;  3U6O A;  3FD9 A;  4NC6 A;  1XMO M;  1TH2 A;  1GL7 A;  1N34 M;  4JXJ A;  4LJ5 A;  4MGY E;  4B7H A;  5LMN M;  3B89 A;  1I94 M;  3KSJ A;  1GJS A;  3ZCB B;  5ITU A;  1GAB A;  4LG2 A;  2J5Y A;  3GPP A;  1SXJ B;  2HCB A;  3DOA A;  4FCW A;  4DR1 M;  1ZQ9 A;  1NVM A;  1QUS A;  2DWZ B;  2KXE A;  3RE8 A;  2QSF X;  4I4L A;  2OO9 A;  2Y20 A;  2CEA A;  2DAM A;  3AJI B;  3DA1 A;  3PVS A;  2D7G A;  3V76 A;  5KPR A;  4JI1 M;  2CRU A;  3HGI A;  4MH0 E;  2V6Z M;  4FVM A;  2RGH A;  3GLG E;  3KW6 A;  1QYR A;  3GPX A;  1R2Y A;  2UUC M;  1NSF A;  1G41 A;  5EXX A;  1J5E M;  2FNA A;  4QOS A;  1OTR A;  4RKU F;  1MX0 A;  3KOY E;  2DAI A;  3ZH9 B;  2AHM A;  3T38 A;  3PFI A;  3QYB A;  2JY7 A;  3THG A;  1OIP A;  1L1T A;  2CHQ A;  4Z8X A;  1R7R A;  2WSE F;  1VEJ A;  5EXS A;  4IBJ A;  4R3D A;  2DHR A;  2FS1 A;  2J7O A;  3W0F A;  2DWL A;  1Q39 A;  4IBG A;  4OX9 M;  1IN7 A;  2VDB B;  1PJI A;  2Q2E B;  2ZAO A;  3GLF A;  3SAT A;  2GNO A;  3KOZ E;  5EXT A;  3IG8 A;  4CGY B;  1IM2 A;  1HJP A;  2R4J A;  3LQQ A;  3L29 A;  4IBF A;  4LJA A;  4JN6 A;  4NOO B;  4GHL A;  1PGY A;  1QVR A;  3TPZ A;  4NSO B;  4DR3 M;  2JP7 A;  2CE7 A;  4IBK A;  4LJ6 A;  4REZ A;  2XLJ A;  2FE8 A;  2Z8Y M;  2LWX A;  2NQ8 C;  3GO8 A;  3TWM A;  4P17 A;  4IBI A;  3FYD A;  2P5T A;  2CV0 A;  2QZ4 A;  1OFI A;  4LRS A;  3FUX A;  2LXE A;  1WJ7 A;  2R65 A;  1E9S A;  2DAG A;  1L2B A;  2R62 A;  3T15 A;  3LVV A;  1N33 M;  3C58 A;  3GLF E;  1EIJ A;  3AFH A;  3GPY A;  1HQC A;  4DR4 M;  1PRB A;  3HKP A;  5EJC A;  2XFT A;  4M9S A;  1DO2 A;  4JI0 M;  3J7A S;  4FWH A;  4DV6 M;  2ZAN A;  3TWL A;  2L4E A;  2DAK A;  2JWS A;  2JA2 A;  4PCZ A;  1HT1 E;  4BBA A;  3CGW A;  2DEN A;  4JI5 M;  3KFU G;  1D2N A;  3GLF B;  4GIP A;  1NHW C;  4QNR A;  1G8P A;  1QZM A;  4LJ9 A;  4DV0 M;  1J7K A;  1KYI A;  3I01 M;  3MHV C;  4KHP M;  1IY2 A;  4GKK M;  5E26 A;  3W68 A;  4I81 A;  3SC3 A;  2C5R A;  1DV0 A;  1WHC A;  3VLF B;  2I7P A;  1NY6 A;  3VDP A;  1N77 A;  2X8A A;  3L25 A;  2ERC A;  4JI2 M;  3BOS A;  3L2A A;  3RGP A;  4B08 A;  2V1C A;  2KHH A;  1GKI A;  2BWB A;  2Y0Q A;  3AOE A;  3FRH A;  3SMP A;  1PJS A;  2OOA A;  3HHX A;  1WXQ A;  1XXH A;  4Z6Y A;  5C1B A;  3J81 S;  3U6E A;  1HQY E;  3T1Y M;  5EP1 A;  3QWL A;  1FJG M;  4LZJ A;  2YNM D;  3U61 B;  5FLX S;  5EQT A; 
#chains in the Genus database with same CATH homology
 2O25 A;  2JUJ A;  2LVN C;  1VEK A;  4WP2 A;  2K9D A;  2MGW A;  2LBC A;  1NV9 A;  1ZV1 A;  3B89 A;  2LVQ D;  4Q7J A;  1EFU B;  1UFZ A;  2DHY A;  4F2L A;  1CUK A;  3F92 A;  1R4G A;  2QSF X;  1XXH E;  2OO9 A;  3LCU A;  2DAM A;  3E46 A;  2B3T A;  2G3Q A;  3GLG E;  1BVS A;  2DKL A;  2KNA A;  1GO5 A;  2CWB A;  1F4I A;  1G41 A;  2KNZ A;  3BBZ A;  1OTR A;  1P3Q Q;  1VEG A;  3K9O A;  2DAI A;  1QZE A;  2JY7 A;  2OOB A;  3GLI E;  3T6P A;  1IFY A;  1G4A E;  1V92 A;  1VEJ A;  3FRI A;  1IXS A;  1WGN A;  2EJS A;  2JZ1 A;  3GLH E;  4HEO A;  2LTU A;  2EKK A;  2MR9 A;  1WR1 B;  4R71 A;  1WIV A;  3H4J A;  3E21 A;  1OAI A;  1IM2 A;  1HJP A;  4DBG B;  3MMP A;  1PGY A;  3FE3 A;  1OKS A;  1Q02 A;  1T6O A;  2ZTD A;  2JP7 A;  2JY5 A;  1AIP C;  1VDL A;  3LCV B;  5JI2 E;  2WZJ A;  2LVO C;  1WJ7 A;  1XB2 B;  1Y8G A;  2DAG A;  2DNA A;  1NV8 A;  3GLF E;  1A5T A;  2K0B X;  2CP8 A;  2DZL A;  2HAK A;  4GEW A;  1C7Y A;  2JY8 A;  2BWE A;  1TTE A;  1DO2 A;  3IHP A;  1MN3 A;  1VQ1 A;  1JR3 E;  2L4E A;  2JY6 B;  2DAK A;  2HWJ A;  1ZMV A;  1HT1 E;  4F1I A;  2DEN A;  1YLA A;  1E94 E;  1DO0 A;  2DAE A;  2QHO B;  2JZ0 A;  2L4F A;  1KYI A;  2LVP C;  1VG5 A;  1ZMW A;  2L2D A;  3K9P A;  1OQY A;  2DI0 A;  1SG9 A;  1DV0 A;  1HT2 E;  1WHC A;  1ZMU A;  1G3I A;  2EKF A;  2JNH A;  2RRU A;  2LVA A;  2ZTC A;  1WGL A;  2KHH A;  2BWB A;  3FRH A;  1TR8 A;  2OOA A;  3IEC A;  1HQY E;  2QNJ A;  4UN2 B;  2MRO B;  5DFL A;  2H5X A;  1T43 A;  2R0I A;  4G3O A;  2MJ5 B;  2KNV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...