1WJ7A

Solution structure of rsgi ruh-015, a uba domain from mouse cdna
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
104
structure length
104
Chain Sequence
b'GSSGSSGNQNQTQHKQRPQATAEQIRLAQMISDHNDADFEEKVKQLIDITGKNQDECVIALHDCNGDVNRAINVLLEGNPDTHSWEMVGKKKGVSGQKSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein (RSGI RUH-015)
publication title Solution structure of RSGI RUH-015, a UBA domain from mouse cDNA
rcsb
source organism Mus musculus
molecule tags Structural genomics, unknown function
total genus 15
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2004-05-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 1wj7A01
2DAEA 4R71A 2OO9A 2LVQD 1A5TA 5DFLA 1CUKA 1KYIA 1WJ7A 2ZTCA 1NV9A 2QNJA 2JP7A 3K9PA 2MJ5B 1SG9A 2JUJA 1R4GA 2JZ0A 2WZJA 2LBCA 2EKKA 1E94E 1G41A 4DBGB 2L2DA 2KHHA 1IFYA 2CP8A 3IHPA 2DENA 4F2LA 1JR3E 4HEOA 2H5XA 2KNAA 1YLAA 2EKFA 1AIPC 1BVSA 3GLFE 1PGYA 3GLGE 3E21A 4GEWA 1G3IA 2DAMA 1XB2B 1WHCA 1DO2A 2DAKA 4UN2B 2BWEA 2OOBA 3T6PA 1IXSA 1TTEA 2L4FA 1VDLA 2MROB 3E46A 2JY7A 1VEGA 2O25A 1HT2E 4WP2A 1P3QQ 2KNVA 1V92A 3B89A 3LCUA 2MR9A 3BBZA 2LVOC 1NV8A 1ZMVA 2LVAA 2QHOB 3FRIA 3GLHE 2JY5A 1OKSA 2LVNC 2RRUA 1TR8A 2K9DA 1C7YA 2DHYA 1QZEA 2L4EA 2EJSA 1DO0A 2HWJA 1UFZA 2OOAA 2HAKA 1IM2A 1WGNA 2JZ1A 2DZLA 1WR1B 1F4IA 2DAGA 1GO5A 2LVPC 2R0IA 2K0BX 1DV0A 1VG5A 2ZTDA 1ZV1A 2CWBA 2JY8A 1OQYA 1VEKA 2QSFX 1WGLA 1HQYE 1Q02A 3K9OA 4G3OA 2DKLA 3IECA 3LCVB 2DAIA 4Q7JA 1HT1E 1MN3A 1VEJA 1VQ1A 1ZMUA 2BWBA 3F92A 2G3QA 3GLIE 2DI0A 1T6OA 3H4JA 2JY6B 3FRHA 1OAIA 2LTUA 1OTRA 1XXHE 2MGWA 1HJPA 5JI2E 2DNAA 3FE3A 1ZMWA 2KNZA 2JNHA 1EFUB 1T43A 2B3TA 3MMPA 4F1IA 1Y8GA 1G4AE 1WIVA
chains in the Genus database with same CATH superfamily
2OO9A 2MH8A 4MB7A 5DFLA 3WHLA 4GC5A 1KYIA 1WJ7A 3HU1A 2BJVA 2HKJA 1TDHA 1OFIA 5EP3A 4QOZC 2XH9A 4LJ5A 4AG5A 5ITQA 2WZJA 3BXWA 2LBCA 2EKKA 2VQFM 2KXEA 1G41A 2X4AA 3K1JA 3NWLA 1K3XA 3FTDA 2UXBM 2XF3A 1TH2A 1V33A 3KOXE 2CP8A 3SMPA 3VLFB 2FH0A 3IHPA 4LCBA 2JXNA 3TL4X 3B7NA 4DV2M 3QYBA 3I04M 2DWLA 4LZJA 1KFVA 2H5XA 5A2QS 2CRUA 3HHZA 4PDIA 3KSJA 3RFWA 5KPTA 3I4YA 5ITTA 5FLXS 2KEBA 1N77A 1JB0F 1AIPC 2A5YB 4MGZE 4RNAA 3HWSA 1Z59A 2YFQA 1DGHA 4PCZA 1TH3A 3UGJA 4GEWA 2APLA 4DV5M 2DAMA 3B7QA 1OIZA 5IWAM 1XB2B 3UMMA 1DO2A 2DAKA 1J7KA 3GPUA 4ZPXA 3T6PA 1IXSA 1TTEA 1NNJA 4KHPM 2R18A 2R4JA 1V34A 4IBJA 3GQ3A 1TF0B 2WSCF 1TH4A 1HT2E 3L26A 4CIZA 4FWHA 1X37A 2KNVA 5KPRA 3A46A 2BJWA 3GLFB 2LHCA 3GLIA 5DNYA 1IN4A 2DZNB 4HLQA 3QAUA 2DHYA 1DO0A 4X64M 2R4EA 4DR7M 2HAKA 4QHTA 4NRVA 1WGNA 3C58A 5KO3A 2DZLA 3KXEC 1QAMA 3A98B 4A3VB 5FSWA 4MGKE 4IBKA 2V1UA 4B3MM 3QYEA 2J7NA 1R6BX 2ZBKB 2R0IA 2K0BX 4GKKM 1HQCA 2Y20A 4FCWA 2CWBA 1DGGA 1OQYA 3J27B 4G6ZA 4D82A 2ZAOA 3HHYA 2RGHA 1VEKA 3CF0A 4MGHA 4LF8M 3PVSA 3SATA 2K6BA 4YHHM 2I7PA 3LVVA 3KOWE 1HQYE 4GHLA 2DKLA 1D2NA 3SHFA 1E9RA 2P5TA 4GH9A 1ZMUA 2QENA 3B9PA 3FUVA 4LF7M 3THGA 3GLIE 4DV0M 2F4VM 3V76A 3AL0C 2EO2A 3H4JA 1IY1A 2JY6B 3FUTA 4M0DA 1OAIA 2LTUA 2XGNA 2UU9M 1NY5A 4I5SA 4L8RC 3U6SA 4LG2A 4EIWA 2VF8A 5JI2E 3FE3A 1N78A 3FUUA 3J7BA 2B3TA 3KP1E 3UK6A 4D81A 2L09A 2M5ZA 3KSXA 3MK6A 1PJIA 1L1TA 2C9CA 4DR4M 1G59A 3SYLA 4DR5M 2CHQA 1CUKA 2OPFA 1NV9A 2L6OA 1QYRA 1QUTA 3AKZA 1UM8A 3MJ5A 4R7GA 3T38A 3C3EA 1NHWC 1TDZA 1R4GA 2E5LM 2JZ0A 4WURA 4JV5M 1XXHB 4DR2M 1E94E 2KHHA 2XZFA 3GPYA 4B08A 1PJJA 3KFUG 4JYAM 3U60A 3SBJA 4F2LA 2GQFA 2QP9X 3SASA 4HEOA 2KNAA 1QUSA 1YLAA 1QAOA 4LY6A 3T1YM 4KODA 3VDPA 3IG8A 3J2PB 4NXNM 1IBLM 3A45A 3E21A 2GNOA 3FUXA 4RKUF 1L8QA 1OJLA 3U5ZA 2G5GX 1WXQA 2W82A 4UN2B 4GRIA 4L4UA 2OOBA 1C1KA 4JI8M 1I4WA 4JI0M 4KLNA 3E46A 2XSZA 1VEGA 2O25A 4IIWA 1RU3A 1D0LA 2LH0A 4AQYM 4WP2A 4LJ4A 1IXZA 4TUWA 3B89A 3TWKA 4M9XA 3LCUA 1HNXM 1FJGM 4M9ZA 1Z6TA 2BNKA 2LVOC 4OVZB 3SAWA 1ZMVA 4FW9A 5FTNA 4CISA 2LVAA 2KZUA 3I51A 3KS4A 3GPPA 4AW4A 4LF6M 4DUYM 2KZSA 4PD2A 4LJAA 3U6EA 3JR5A 1OFHA 3U6CA 2L4EA 3RE8A 4IBDA 2EJSA 2HWJA 1QDTA 5E6JA 4XBOA 4LJ8A 3L25A 5LMUM 2OOAA 4HL4A 1NVMA 2D7GA 2I7NA 3KOZE 1IM2A 1T3TA 3FKEA 4NSOB 1HNWM 3U61B 4B7GA 1L2CA 2FS1A 4QNRA 4JI4M 4Z8XA 1OAOC 3J80S 4XK8F 4LGMA 4OU7A 4OVZA 1NJFA 4GIPA 1K82A 2VIIA 2Y0TA 4X62M 4DV4M 1N32M 4MM3B 4GMQA 1IN7A 1ORYB 2FFJA 2QZ4A 2NQ8C 3AV0A 3PNVA 4FWGA 4IBEA 2JY8A 4L78A 1JQJC 3VKGA 2DVWB 5JI3E 1IN5A 1DGFA 3KP0E 3MHVC 3SYKA 3SFZA 4L6V6 3GLGB 1PRBA 2XEPA 3HU2A 2CEAA 2O01F 2XZUA 1PJSA 1Q02A 3K9OA 1MU5A 4MGIE 4RF0A 3IECA 4BLCA 4WW0A 3U61A 2G8LA 4DV3M 4G4NA 1MN3A 3FD9A 4NOOB 4FWDA 4DR6M 1E32A 3AJIB 1G8PA 2D7EA 2X49A 4IBIA 1PM5A 3SHGB 3HJ8A 3VDUA 4ITQA 2C96A 2DWMA 5IT9S 4YY3M 4DV6M 3M7GA 1XC8A 3GLFA 2ZAMA 2JNHA 1EFUB 3GLHB 3BOSA 3QWLA 1Y8GA 1G4AE 2CV1A 1FNNA 4II7A 3HX3A 2XFSA 1WIVA 3L29A 3HJSA 1IBKM 2DAEA 2YR0A 5E26A 4R71A 2LVQD 4LRSA 1W5TA 1ZQ9A 4B7FA 2ZTCA 4JI5M 3PNYA 4FD2A 4LJ9A 2JP7A 2CHGA 2MJ5B 3L2AA 3B74A 4B7HA 4P17A 1K3WA 3NBIA 1Z5CA 1VDDA 2QBYB 4I4LA 3GRVA 2L2DA 2K47A 1IFYA 4MGYE 4B3TM 4K0KM 1NSFA 2C99A 1Z5BA 2QCUA 2JWSA 3HY5A 4PT5A 2F5OA 3UZUA 3WHKA 2XLJA 3AOEA 3CF6E 3IG5A 3FTFA 2DWZB 5EXXA 5ITXA 1EIJA 4NC6A 5FTKA 3HHXA 2EA0A 2XSZD 1H6UA 1S3SA 3K2LA 3GO8A 3GQ4A 1QDRA 3FYCA 3Q8XA 4Z6YA 3GLFE 4GKJM 3FYDA 5EJCA 3DZDA 3GLGE 4G4OA 4L15A 2DZOB 2LWXA 5L8RF 3LMMA 1AUAA 4LRTA 3VKHA 1GL6A 1R5LA 1SXJB 1GLNA 2MROB 2KDLA 4REZA 5DYIA 2JY7A 3LVWA 5EP4A 3GRUA 1LV7A 2YNMD 3W67A 2V1CA 3U6DA 3M6AA 3PFIA 2CUZA 2M60A 3Q8GA 1L1ZA 1XWIA 3ILKA 1P3QQ 3NBXX 4I8OA 1XMOM 2WSFF 2MR9A 3T1HM 3VK8A 3R9XB 4W5WA 4G4RA 4X66M 3FRIA 1D0MA 2RKOA 2JY5A 1IN6A 3GLHE 4KT0F 4IJEA 1OKSA 7CATA 2LVNC 2RRUA 3KS8A 2YQZA 3SAVA 2XFTA 1TR8A 2K9DA 3L28A 1QZEA 5GKNA 3U60B 4DR3M 1UFZA 2CFOA 1XXHA 3TPZA 5ITXE 1L2BA 5IREB 2FOIC 4GHAA 4B3RM 1WR1B 1YE9A 1N36M 4LF4M 2DAGA 1Q3BA 2R65A 2UXDM 5EXSA 1Q3CA 4QOSA 1NJGA 3T15A 2F5NA 3HHWA 5ITYA 1HNZM 4LF9M 1QAQA 4M0WA 1GO5A 1VG5A 2Y21A 2N35A 3EIHA 3GRYA 5H37D 4DV1M 4JXJA 5FTJA 4DV7M 3SAUA 3K8ZA 3W68A 4I81A 2DWNA 4OX9M 2Y0QA 2QSFX 1WGLA 5FTLA 3I01M 5KQ8A 1N75A 4G3OA 1W5SA 5ITUA 2DAIA 1HT1E 1G71A 1VEJA 4FCTA 4IJFA 3W0FA 3F92A 3B7ZA 1J5EM 1DGHB 2G3QA 2R45A 5DYGA 3TWMA 4AKGA 1EE8A 4JI3M 1JR3A 3VFDA 4AKIA 4BB9A 5EQTA 2F5QA 2DXIA 3U6QA 1NHGC 3DFZA 1QZMA 4CJ6A 1I94M 3PXGA 1OTRA 1MX0A 1R7RA 1IXSB 1XXHE 1HJPA 1SXJE 2LHGA 2V6ZM 4LJ7A 2KNZA 3ZH9B 3RGPA 1YUBA 3MMPA 2KW0A 1NNUC 2KA6B 2R62A 3A42A 3L27A 1QVRA 3U6PA 2LXEA 2UUAM 4JI2M 3HJQA 4QHSA 3D8LA 3DOAA 2CV2A 4BBAA 2KRUA 4GITA 1A5TA 4LZZA 1PJTA 3FUWA 3SC3A 4CHTB 3JAMS 2Z3XA 2Z4SA 5EXTA 3GLIB 4NXMM 2VQEM 4LJ6A 2QNJA 3K9PA 1ZAEA 4B3SM 1SG9A 2JUJA 2C5RA 1IY0A 2R46A 1HR0M 4DBGB 2CE7A 1Q39A 3U6MA 4JI1M 3GRRA 4DUZM 1QANA 3FTCA 2AHMA 2C98A 2DENA 8CATA 4RF1A 3ZCBB 3DA1A 2HHHM 1IXRC 3GLGA 1XMQM 2L7IA 2UXCM 1J09A 1JR3E 1NO1A 1XHBA 4XGIA 1GABA 3AOEC 4GC9A 3LW5F 5LMNM 1IBMM 2EKFA 4JI7M 2ERCA 3J81S 2J7OA 4JN6A 4MH0E 4NSRA 2F5SA 1BVSA 1R2ZA 2QPAA 4Y28F 1PGYA 4LFAM 3U6OA 2JA2A 3CGWA 1G3IA 2LNHC 1D0KA 2R44A 4AKHA 1WHCA 1DGBA 3KDSE 1GJTA 2BWEA 3KW6A 3CF2A 4IBFA 2QQ8A 3E4RA 2L4FA 4QNMA 5EXPA 4AG6A 1VDLA 1GJSA 2CV0A 1GVNA 3GPXA 1R2YA 3GLHA 3ZC7B 2UUBM 4IBBA 2O5RA 3LQRA 2C9OA 3C3DA 4S12A 2J5YA 4FVMA 4NL4H 5EP1A 5KQDA 1SXJD 3K92A 4DR1M 4JI6M 1PJQA 1V92A 1N33M 2KRKA 4AZFA 3BBZA 4ANRA 3HGIA 4LFCM 1NV8A 1GKIA 3UJNA 2QHOB 4OW0A 2ZANA 3VK7A 1XNRM 4KO8A 3J7AS 1TGUA 2Q2EB 1YSYA 2R6FA 3R8FA 1C7YA 2DHRA 3E9SA 1OIPA 2EUCA 3C9PA 3H4MA 2QBYA 4P16A 4LGYA 1Z5AA 2JZ1A 2D7HA 3TQSA 1SXJC 2HL7A 1F4IA 1L2DA 3TE6A 4AI6A 5ITRA 5KPZA 3GP1A 2LVPC 5C18A 3GQ5A 3LQQA 1QQWA 1NY6A 1MJGM 1DV0A 2ZTDA 1ZV1A 3EIEA 5IZ7D 5BR8M 4FCVA 3HKPA 1IN8A 1JR3D 2F5PA 2OQ4A 4LF5M 5FTMA 1E9SA 3I4VA 4L16A 1IQPA 2H1RA 2FNAA 3TWLA 3W0LB 3OTOM 2VF7A 3RGSA 2X8AA 3KVWA 4G4QA 1N34M 2HCBA 2CHVA 3JR4A 2Z8YM 3LCVB 3M0EA 2UUCM 4Q7JA 4CGYB 2FE8A 1VQ1A 1XNQM 1SXJA 1IY2A 2BWBA 3D8BA 2Z4RA 5EP2A 4NRWA 2WSEF 3HZJA 2DI0A 1LTMA 2Z7JA 3SMSA 4LFBM 1T6OA 2L7HA 4R3DA 3SARA 2RGOA 4M9SA 4X65M 5C1BA 3U6LA 3U5ZB 3FRHA 4D80A 2VDBB 3HU3A 3KOYE 4IBGA 2MGWA 5F3WA 3ZQJA 2DNAA 1ZMWA 1KSFX 3AFHA 3AOGA 4PDGA 1T43A 4F1IA 3FTEA 3CTWB 4IBCA 5BPVA 1GL7A 2ZM6M
chains in the Genus database with same CATH topology
2DAEA 4R71A 2OO9A 2LVQD 1A5TA 5DFLA 1CUKA 1KYIA 1WJ7A 2ZTCA 1NV9A 2QNJA 2JP7A 3K9PA 2MJ5B 1SG9A 2JUJA 1R4GA 2JZ0A 2WZJA 2LBCA 2EKKA 1E94E 1G41A 4DBGB 2L2DA 2KHHA 1IFYA 2CP8A 3IHPA 2DENA 4F2LA 1JR3E 4HEOA 2H5XA 2KNAA 1YLAA 2EKFA 1AIPC 1BVSA 3GLFE 1PGYA 3GLGE 3E21A 4GEWA 1G3IA 2DAMA 1XB2B 1WHCA 1DO2A 2DAKA 4UN2B 2BWEA 2OOBA 3T6PA 1IXSA 1TTEA 2L4FA 1VDLA 2MROB 3E46A 2JY7A 1VEGA 2O25A 1HT2E 4WP2A 1P3QQ 2KNVA 1V92A 3B89A 3LCUA 2MR9A 3BBZA 2LVOC 1NV8A 1ZMVA 2LVAA 2QHOB 3FRIA 3GLHE 2JY5A 1OKSA 2LVNC 2RRUA 1TR8A 2K9DA 1C7YA 2DHYA 1QZEA 2L4EA 2EJSA 1DO0A 2HWJA 1UFZA 2OOAA 2HAKA 1IM2A 1WGNA 2JZ1A 2DZLA 1WR1B 1F4IA 2DAGA 1GO5A 2LVPC 2R0IA 2K0BX 1DV0A 1VG5A 2ZTDA 1ZV1A 2CWBA 2JY8A 1OQYA 1VEKA 2QSFX 1WGLA 1HQYE 1Q02A 3K9OA 4G3OA 2DKLA 3IECA 3LCVB 2DAIA 4Q7JA 1HT1E 1MN3A 1VEJA 1VQ1A 1ZMUA 2BWBA 3F92A 2G3QA 3GLIE 2DI0A 1T6OA 3H4JA 2JY6B 3FRHA 1OAIA 2LTUA 1OTRA 1XXHE 2MGWA 1HJPA 5JI2E 2DNAA 3FE3A 1ZMWA 2KNZA 2JNHA 1EFUB 1T43A 2B3TA 3MMPA 4F1IA 1Y8GA 1G4AE 1WIVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DAE A;  4R71 A;  2OO9 A;  2LVQ D;  1A5T A;  5DFL A;  1CUK A;  1KYI A;  1WJ7 A;  2ZTC A;  1NV9 A;  2QNJ A;  2JP7 A;  3K9P A;  2MJ5 B;  1SG9 A;  2JUJ A;  1R4G A;  2JZ0 A;  2WZJ A;  2LBC A;  2EKK A;  1E94 E;  1G41 A;  4DBG B;  2L2D A;  2KHH A;  1IFY A;  2CP8 A;  3IHP A;  2DEN A;  4F2L A;  1JR3 E;  4HEO A;  2H5X A;  2KNA A;  1YLA A;  2EKF A;  1AIP C;  1BVS A;  3GLF E;  1PGY A;  3GLG E;  3E21 A;  4GEW A;  1G3I A;  2DAM A;  1XB2 B;  1WHC A;  1DO2 A;  2DAK A;  4UN2 B;  2BWE A;  2OOB A;  3T6P A;  1IXS A;  1TTE A;  2L4F A;  1VDL A;  2MRO B;  3E46 A;  2JY7 A;  1VEG A;  2O25 A;  1HT2 E;  4WP2 A;  1P3Q Q;  2KNV A;  1V92 A;  3B89 A;  3LCU A;  2MR9 A;  3BBZ A;  2LVO C;  1NV8 A;  1ZMV A;  2LVA A;  2QHO B;  3FRI A;  3GLH E;  2JY5 A;  1OKS A;  2LVN C;  2RRU A;  1TR8 A;  2K9D A;  1C7Y A;  2DHY A;  1QZE A;  2L4E A;  2EJS A;  1DO0 A;  2HWJ A;  1UFZ A;  2OOA A;  2HAK A;  1IM2 A;  1WGN A;  2JZ1 A;  2DZL A;  1WR1 B;  1F4I A;  2DAG A;  1GO5 A;  2LVP C;  2R0I A;  2K0B X;  1DV0 A;  1VG5 A;  2ZTD A;  1ZV1 A;  2CWB A;  2JY8 A;  1OQY A;  1VEK A;  2QSF X;  1WGL A;  1HQY E;  1Q02 A;  3K9O A;  4G3O A;  2DKL A;  3IEC A;  3LCV B;  2DAI A;  4Q7J A;  1HT1 E;  1MN3 A;  1VEJ A;  1VQ1 A;  1ZMU A;  2BWB A;  3F92 A;  2G3Q A;  3GLI E;  2DI0 A;  1T6O A;  3H4J A;  2JY6 B;  3FRH A;  1OAI A;  2LTU A;  1OTR A;  1XXH E;  2MGW A;  1HJP A;  5JI2 E;  2DNA A;  3FE3 A;  1ZMW A;  2KNZ A;  2JNH A;  1EFU B;  1T43 A;  2B3T A;  3MMP A;  4F1I A;  1Y8G A;  1G4A E;  1WIV A; 
#chains in the Genus database with same CATH topology
 2OO9 A;  2MH8 A;  4MB7 A;  5DFL A;  3WHL A;  4GC5 A;  1KYI A;  1WJ7 A;  3HU1 A;  2BJV A;  2HKJ A;  1TDH A;  1OFI A;  5EP3 A;  4QOZ C;  2XH9 A;  4LJ5 A;  4AG5 A;  5ITQ A;  2WZJ A;  3BXW A;  2LBC A;  2EKK A;  2VQF M;  2KXE A;  1G41 A;  2X4A A;  3K1J A;  3NWL A;  1K3X A;  3FTD A;  2UXB M;  2XF3 A;  1TH2 A;  1V33 A;  3KOX E;  2CP8 A;  3SMP A;  3VLF B;  2FH0 A;  3IHP A;  4LCB A;  2JXN A;  3TL4 X;  3B7N A;  4DV2 M;  3QYB A;  3I04 M;  2DWL A;  4LZJ A;  1KFV A;  2H5X A;  5A2Q S;  2CRU A;  3HHZ A;  4PDI A;  3KSJ A;  3RFW A;  5KPT A;  3I4Y A;  5ITT A;  5FLX S;  2KEB A;  1N77 A;  1JB0 F;  1AIP C;  2A5Y B;  4MGZ E;  4RNA A;  3HWS A;  1Z59 A;  2YFQ A;  1DGH A;  4PCZ A;  1TH3 A;  3UGJ A;  4GEW A;  2APL A;  4DV5 M;  2DAM A;  3B7Q A;  1OIZ A;  5IWA M;  1XB2 B;  3UMM A;  1DO2 A;  2DAK A;  1J7K A;  3GPU A;  4ZPX A;  3T6P A;  1IXS A;  1TTE A;  1NNJ A;  4KHP M;  2R18 A;  2R4J A;  1V34 A;  4IBJ A;  3GQ3 A;  1TF0 B;  2WSC F;  1TH4 A;  1HT2 E;  3L26 A;  4CIZ A;  4FWH A;  1X37 A;  2KNV A;  5KPR A;  3A46 A;  2BJW A;  3GLF B;  2LHC A;  3GLI A;  5DNY A;  1IN4 A;  2DZN B;  4HLQ A;  3QAU A;  2DHY A;  1DO0 A;  4X64 M;  2R4E A;  4DR7 M;  2HAK A;  4QHT A;  4NRV A;  1WGN A;  3C58 A;  5KO3 A;  2DZL A;  3KXE C;  1QAM A;  3A98 B;  4A3V B;  5FSW A;  4MGK E;  4IBK A;  2V1U A;  4B3M M;  3QYE A;  2J7N A;  1R6B X;  2ZBK B;  2R0I A;  2K0B X;  4GKK M;  1HQC A;  2Y20 A;  4FCW A;  2CWB A;  1DGG A;  1OQY A;  3J27 B;  4G6Z A;  4D82 A;  2ZAO A;  3HHY A;  2RGH A;  1VEK A;  3CF0 A;  4MGH A;  4LF8 M;  3PVS A;  3SAT A;  2K6B A;  4YHH M;  2I7P A;  3LVV A;  3KOW E;  1HQY E;  4GHL A;  2DKL A;  1D2N A;  3SHF A;  1E9R A;  2P5T A;  4GH9 A;  1ZMU A;  2QEN A;  3B9P A;  3FUV A;  4LF7 M;  3THG A;  3GLI E;  4DV0 M;  2F4V M;  3V76 A;  3AL0 C;  2EO2 A;  3H4J A;  1IY1 A;  2JY6 B;  3FUT A;  4M0D A;  1OAI A;  2LTU A;  2XGN A;  2UU9 M;  1NY5 A;  4I5S A;  4L8R C;  3U6S A;  4LG2 A;  4EIW A;  2VF8 A;  5JI2 E;  3FE3 A;  1N78 A;  3FUU A;  3J7B A;  2B3T A;  3KP1 E;  3UK6 A;  4D81 A;  2L09 A;  2M5Z A;  3KSX A;  3MK6 A;  1PJI A;  1L1T A;  2C9C A;  4DR4 M;  1G59 A;  3SYL A;  4DR5 M;  2CHQ A;  1CUK A;  2OPF A;  1NV9 A;  2L6O A;  1QYR A;  1QUT A;  3AKZ A;  1UM8 A;  3MJ5 A;  4R7G A;  3T38 A;  3C3E A;  1NHW C;  1TDZ A;  1R4G A;  2E5L M;  2JZ0 A;  4WUR A;  4JV5 M;  1XXH B;  4DR2 M;  1E94 E;  2KHH A;  2XZF A;  3GPY A;  4B08 A;  1PJJ A;  3KFU G;  4JYA M;  3U60 A;  3SBJ A;  4F2L A;  2GQF A;  2QP9 X;  3SAS A;  4HEO A;  2KNA A;  1QUS A;  1YLA A;  1QAO A;  4LY6 A;  3T1Y M;  4KOD A;  3VDP A;  3IG8 A;  3J2P B;  4NXN M;  1IBL M;  3A45 A;  3E21 A;  2GNO A;  3FUX A;  4RKU F;  1L8Q A;  1OJL A;  3U5Z A;  2G5G X;  1WXQ A;  2W82 A;  4UN2 B;  4GRI A;  4L4U A;  2OOB A;  1C1K A;  4JI8 M;  1I4W A;  4JI0 M;  4KLN A;  3E46 A;  2XSZ A;  1VEG A;  2O25 A;  4IIW A;  1RU3 A;  1D0L A;  2LH0 A;  4AQY M;  4WP2 A;  4LJ4 A;  1IXZ A;  4TUW A;  3B89 A;  3TWK A;  4M9X A;  3LCU A;  1HNX M;  1FJG M;  4M9Z A;  1Z6T A;  2BNK A;  2LVO C;  4OVZ B;  3SAW A;  1ZMV A;  4FW9 A;  5FTN A;  4CIS A;  2LVA A;  2KZU A;  3I51 A;  3KS4 A;  3GPP A;  4AW4 A;  4LF6 M;  4DUY M;  2KZS A;  4PD2 A;  4LJA A;  3U6E A;  3JR5 A;  1OFH A;  3U6C A;  2L4E A;  3RE8 A;  4IBD A;  2EJS A;  2HWJ A;  1QDT A;  5E6J A;  4XBO A;  4LJ8 A;  3L25 A;  5LMU M;  2OOA A;  4HL4 A;  1NVM A;  2D7G A;  2I7N A;  3KOZ E;  1IM2 A;  1T3T A;  3FKE A;  4NSO B;  1HNW M;  3U61 B;  4B7G A;  1L2C A;  2FS1 A;  4QNR A;  4JI4 M;  4Z8X A;  1OAO C;  3J80 S;  4XK8 F;  4LGM A;  4OU7 A;  4OVZ A;  1NJF A;  4GIP A;  1K82 A;  2VII A;  2Y0T A;  4X62 M;  4DV4 M;  1N32 M;  4MM3 B;  4GMQ A;  1IN7 A;  1ORY B;  2FFJ A;  2QZ4 A;  2NQ8 C;  3AV0 A;  3PNV A;  4FWG A;  4IBE A;  2JY8 A;  4L78 A;  1JQJ C;  3VKG A;  2DVW B;  5JI3 E;  1IN5 A;  1DGF A;  3KP0 E;  3MHV C;  3SYK A;  3SFZ A;  4L6V 6;  3GLG B;  1PRB A;  2XEP A;  3HU2 A;  2CEA A;  2O01 F;  2XZU A;  1PJS A;  1Q02 A;  3K9O A;  1MU5 A;  4MGI E;  4RF0 A;  3IEC A;  4BLC A;  4WW0 A;  3U61 A;  2G8L A;  4DV3 M;  4G4N A;  1MN3 A;  3FD9 A;  4NOO B;  4FWD A;  4DR6 M;  1E32 A;  3AJI B;  1G8P A;  2D7E A;  2X49 A;  4IBI A;  1PM5 A;  3SHG B;  3HJ8 A;  3VDU A;  4ITQ A;  2C96 A;  2DWM A;  5IT9 S;  4YY3 M;  4DV6 M;  3M7G A;  1XC8 A;  3GLF A;  2ZAM A;  2JNH A;  1EFU B;  3GLH B;  3BOS A;  3QWL A;  1Y8G A;  1G4A E;  2CV1 A;  1FNN A;  4II7 A;  3HX3 A;  2XFS A;  1WIV A;  3L29 A;  3HJS A;  1IBK M;  2DAE A;  2YR0 A;  5E26 A;  4R71 A;  2LVQ D;  4LRS A;  1W5T A;  1ZQ9 A;  4B7F A;  2ZTC A;  4JI5 M;  3PNY A;  4FD2 A;  4LJ9 A;  2JP7 A;  2CHG A;  2MJ5 B;  3L2A A;  3B74 A;  4B7H A;  4P17 A;  1K3W A;  3NBI A;  1Z5C A;  1VDD A;  2QBY B;  4I4L A;  3GRV A;  2L2D A;  2K47 A;  1IFY A;  4MGY E;  4B3T M;  4K0K M;  1NSF A;  2C99 A;  1Z5B A;  2QCU A;  2JWS A;  3HY5 A;  4PT5 A;  2F5O A;  3UZU A;  3WHK A;  2XLJ A;  3AOE A;  3CF6 E;  3IG5 A;  3FTF A;  2DWZ B;  5EXX A;  5ITX A;  1EIJ A;  4NC6 A;  5FTK A;  3HHX A;  2EA0 A;  2XSZ D;  1H6U A;  1S3S A;  3K2L A;  3GO8 A;  3GQ4 A;  1QDR A;  3FYC A;  3Q8X A;  4Z6Y A;  3GLF E;  4GKJ M;  3FYD A;  5EJC A;  3DZD A;  3GLG E;  4G4O A;  4L15 A;  2DZO B;  2LWX A;  5L8R F;  3LMM A;  1AUA A;  4LRT A;  3VKH A;  1GL6 A;  1R5L A;  1SXJ B;  1GLN A;  2MRO B;  2KDL A;  4REZ A;  5DYI A;  2JY7 A;  3LVW A;  5EP4 A;  3GRU A;  1LV7 A;  2YNM D;  3W67 A;  2V1C A;  3U6D A;  3M6A A;  3PFI A;  2CUZ A;  2M60 A;  3Q8G A;  1L1Z A;  1XWI A;  3ILK A;  1P3Q Q;  3NBX X;  4I8O A;  1XMO M;  2WSF F;  2MR9 A;  3T1H M;  3VK8 A;  3R9X B;  4W5W A;  4G4R A;  4X66 M;  3FRI A;  1D0M A;  2RKO A;  2JY5 A;  1IN6 A;  3GLH E;  4KT0 F;  4IJE A;  1OKS A;  7CAT A;  2LVN C;  2RRU A;  3KS8 A;  2YQZ A;  3SAV A;  2XFT A;  1TR8 A;  2K9D A;  3L28 A;  1QZE A;  5GKN A;  3U60 B;  4DR3 M;  1UFZ A;  2CFO A;  1XXH A;  3TPZ A;  5ITX E;  1L2B A;  5IRE B;  2FOI C;  4GHA A;  4B3R M;  1WR1 B;  1YE9 A;  1N36 M;  4LF4 M;  2DAG A;  1Q3B A;  2R65 A;  2UXD M;  5EXS A;  1Q3C A;  4QOS A;  1NJG A;  3T15 A;  2F5N A;  3HHW A;  5ITY A;  1HNZ M;  4LF9 M;  1QAQ A;  4M0W A;  1GO5 A;  1VG5 A;  2Y21 A;  2N35 A;  3EIH A;  3GRY A;  5H37 D;  4DV1 M;  4JXJ A;  5FTJ A;  4DV7 M;  3SAU A;  3K8Z A;  3W68 A;  4I81 A;  2DWN A;  4OX9 M;  2Y0Q A;  2QSF X;  1WGL A;  5FTL A;  3I01 M;  5KQ8 A;  1N75 A;  4G3O A;  1W5S A;  5ITU A;  2DAI A;  1HT1 E;  1G71 A;  1VEJ A;  4FCT A;  4IJF A;  3W0F A;  3F92 A;  3B7Z A;  1J5E M;  1DGH B;  2G3Q A;  2R45 A;  5DYG A;  3TWM A;  4AKG A;  1EE8 A;  4JI3 M;  1JR3 A;  3VFD A;  4AKI A;  4BB9 A;  5EQT A;  2F5Q A;  2DXI A;  3U6Q A;  1NHG C;  3DFZ A;  1QZM A;  4CJ6 A;  1I94 M;  3PXG A;  1OTR A;  1MX0 A;  1R7R A;  1IXS B;  1XXH E;  1HJP A;  1SXJ E;  2LHG A;  2V6Z M;  4LJ7 A;  2KNZ A;  3ZH9 B;  3RGP A;  1YUB A;  3MMP A;  2KW0 A;  1NNU C;  2KA6 B;  2R62 A;  3A42 A;  3L27 A;  1QVR A;  3U6P A;  2LXE A;  2UUA M;  4JI2 M;  3HJQ A;  4QHS A;  3D8L A;  3DOA A;  2CV2 A;  4BBA A;  2KRU A;  4GIT A;  1A5T A;  4LZZ A;  1PJT A;  3FUW A;  3SC3 A;  4CHT B;  3JAM S;  2Z3X A;  2Z4S A;  5EXT A;  3GLI B;  4NXM M;  2VQE M;  4LJ6 A;  2QNJ A;  3K9P A;  1ZAE A;  4B3S M;  1SG9 A;  2JUJ A;  2C5R A;  1IY0 A;  2R46 A;  1HR0 M;  4DBG B;  2CE7 A;  1Q39 A;  3U6M A;  4JI1 M;  3GRR A;  4DUZ M;  1QAN A;  3FTC A;  2AHM A;  2C98 A;  2DEN A;  8CAT A;  4RF1 A;  3ZCB B;  3DA1 A;  2HHH M;  1IXR C;  3GLG A;  1XMQ M;  2L7I A;  2UXC M;  1J09 A;  1JR3 E;  1NO1 A;  1XHB A;  4XGI A;  1GAB A;  3AOE C;  4GC9 A;  3LW5 F;  5LMN M;  1IBM M;  2EKF A;  4JI7 M;  2ERC A;  3J81 S;  2J7O A;  4JN6 A;  4MH0 E;  4NSR A;  2F5S A;  1BVS A;  1R2Z A;  2QPA A;  4Y28 F;  1PGY A;  4LFA M;  3U6O A;  2JA2 A;  3CGW A;  1G3I A;  2LNH C;  1D0K A;  2R44 A;  4AKH A;  1WHC A;  1DGB A;  3KDS E;  1GJT A;  2BWE A;  3KW6 A;  3CF2 A;  4IBF A;  2QQ8 A;  3E4R A;  2L4F A;  4QNM A;  5EXP A;  4AG6 A;  1VDL A;  1GJS A;  2CV0 A;  1GVN A;  3GPX A;  1R2Y A;  3GLH A;  3ZC7 B;  2UUB M;  4IBB A;  2O5R A;  3LQR A;  2C9O A;  3C3D A;  4S12 A;  2J5Y A;  4FVM A;  4NL4 H;  5EP1 A;  5KQD A;  1SXJ D;  3K92 A;  4DR1 M;  4JI6 M;  1PJQ A;  1V92 A;  1N33 M;  2KRK A;  4AZF A;  3BBZ A;  4ANR A;  3HGI A;  4LFC M;  1NV8 A;  1GKI A;  3UJN A;  2QHO B;  4OW0 A;  2ZAN A;  3VK7 A;  1XNR M;  4KO8 A;  3J7A S;  1TGU A;  2Q2E B;  1YSY A;  2R6F A;  3R8F A;  1C7Y A;  2DHR A;  3E9S A;  1OIP A;  2EUC A;  3C9P A;  3H4M A;  2QBY A;  4P16 A;  4LGY A;  1Z5A A;  2JZ1 A;  2D7H A;  3TQS A;  1SXJ C;  2HL7 A;  1F4I A;  1L2D A;  3TE6 A;  4AI6 A;  5ITR A;  5KPZ A;  3GP1 A;  2LVP C;  5C18 A;  3GQ5 A;  3LQQ A;  1QQW A;  1NY6 A;  1MJG M;  1DV0 A;  2ZTD A;  1ZV1 A;  3EIE A;  5IZ7 D;  5BR8 M;  4FCV A;  3HKP A;  1IN8 A;  1JR3 D;  2F5P A;  2OQ4 A;  4LF5 M;  5FTM A;  1E9S A;  3I4V A;  4L16 A;  1IQP A;  2H1R A;  2FNA A;  3TWL A;  3W0L B;  3OTO M;  2VF7 A;  3RGS A;  2X8A A;  3KVW A;  4G4Q A;  1N34 M;  2HCB A;  2CHV A;  3JR4 A;  2Z8Y M;  3LCV B;  3M0E A;  2UUC M;  4Q7J A;  4CGY B;  2FE8 A;  1VQ1 A;  1XNQ M;  1SXJ A;  1IY2 A;  2BWB A;  3D8B A;  2Z4R A;  5EP2 A;  4NRW A;  2WSE F;  3HZJ A;  2DI0 A;  1LTM A;  2Z7J A;  3SMS A;  4LFB M;  1T6O A;  2L7H A;  4R3D A;  3SAR A;  2RGO A;  4M9S A;  4X65 M;  5C1B A;  3U6L A;  3U5Z B;  3FRH A;  4D80 A;  2VDB B;  3HU3 A;  3KOY E;  4IBG A;  2MGW A;  5F3W A;  3ZQJ A;  2DNA A;  1ZMW A;  1KSF X;  3AFH A;  3AOG A;  4PDG A;  1T43 A;  4F1I A;  3FTE A;  3CTW B;  4IBC A;  5BPV A;  1GL7 A;  2ZM6 M; 
#chains in the Genus database with same CATH homology
 2DAE A;  4R71 A;  2OO9 A;  2LVQ D;  1A5T A;  5DFL A;  1CUK A;  1KYI A;  1WJ7 A;  2ZTC A;  1NV9 A;  2QNJ A;  2JP7 A;  3K9P A;  2MJ5 B;  1SG9 A;  2JUJ A;  1R4G A;  2JZ0 A;  2WZJ A;  2LBC A;  2EKK A;  1E94 E;  1G41 A;  4DBG B;  2L2D A;  2KHH A;  1IFY A;  2CP8 A;  3IHP A;  2DEN A;  4F2L A;  1JR3 E;  4HEO A;  2H5X A;  2KNA A;  1YLA A;  2EKF A;  1AIP C;  1BVS A;  3GLF E;  1PGY A;  3GLG E;  3E21 A;  4GEW A;  1G3I A;  2DAM A;  1XB2 B;  1WHC A;  1DO2 A;  2DAK A;  4UN2 B;  2BWE A;  2OOB A;  3T6P A;  1IXS A;  1TTE A;  2L4F A;  1VDL A;  2MRO B;  3E46 A;  2JY7 A;  1VEG A;  2O25 A;  1HT2 E;  4WP2 A;  1P3Q Q;  2KNV A;  1V92 A;  3B89 A;  3LCU A;  2MR9 A;  3BBZ A;  2LVO C;  1NV8 A;  1ZMV A;  2LVA A;  2QHO B;  3FRI A;  3GLH E;  2JY5 A;  1OKS A;  2LVN C;  2RRU A;  1TR8 A;  2K9D A;  1C7Y A;  2DHY A;  1QZE A;  2L4E A;  2EJS A;  1DO0 A;  2HWJ A;  1UFZ A;  2OOA A;  2HAK A;  1IM2 A;  1WGN A;  2JZ1 A;  2DZL A;  1WR1 B;  1F4I A;  2DAG A;  1GO5 A;  2LVP C;  2R0I A;  2K0B X;  1DV0 A;  1VG5 A;  2ZTD A;  1ZV1 A;  2CWB A;  2JY8 A;  1OQY A;  1VEK A;  2QSF X;  1WGL A;  1HQY E;  1Q02 A;  3K9O A;  4G3O A;  2DKL A;  3IEC A;  3LCV B;  2DAI A;  4Q7J A;  1HT1 E;  1MN3 A;  1VEJ A;  1VQ1 A;  1ZMU A;  2BWB A;  3F92 A;  2G3Q A;  3GLI E;  2DI0 A;  1T6O A;  3H4J A;  2JY6 B;  3FRH A;  1OAI A;  2LTU A;  1OTR A;  1XXH E;  2MGW A;  1HJP A;  5JI2 E;  2DNA A;  3FE3 A;  1ZMW A;  2KNZ A;  2JNH A;  1EFU B;  1T43 A;  2B3T A;  3MMP A;  4F1I A;  1Y8G A;  1G4A E;  1WIV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...