1WJCA

Solution structure of the n-terminal zn binding domain of hiv-1 integrase (e form), nmr, regularized mean structure
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
47
structure length
47
Chain Sequence
FLDGIDKAQEEHEKYHSNWRAMASDFNLPPVVAKEIVASCDKCQLKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the N-terminal zinc binding domain of HIV-1 integrase.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Zn-binding protein
molecule keywords HIV-1 INTEGRASE
total genus 16
structure length 47
sequence length 47
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1997-05-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02022 Integrase_Zn Integrase Zinc binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.200 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 1wjcA00
3HPHA 1WJDA 1WJBA 1E0EA 1MW7A 1WJFA 4F3QA 1KONA 1WJCA 1K6YA 1LFPA 3F9KA 3HPGA 1WJEA 1WJAA
chains in the Genus database with same CATH superfamily
2EZLA 2DA7A 1JKQC 4IHYA 1V5GA 2MGQA 1MKMA 4KN7X 2P81A 3TQNA 1YRNB 4G6DA 3MQ0A 5FLXZ 5HLGA 3S1NJ 3O2PE 1H0MA 5EZHA 4XKBA 1Z9CA 3QPTA 1HOMA 5CVJA 1X1PA 1ZRDA 2A69F 2DI3A 2OF7A 3G1OA 1LPQA 2FE3A 3QQAA 1XN7A 2ZSHB 4RB0A 5FKMA 3F23A 1IDZA 1TBXA 3R4KA 1OCRH 4BE2A 2EH3A 1QZYA 3S14J 1TWCJ 2CQKA 4UUSB 2V9VA 1HW2A 3EQLF 3QPLA 3HRUA 5ILVA 2W7NA 1KU9A 3GVAA 3SDBA 3PIOF 5D5XB 2OD5A 1NTCA 1TL8A 1E17A 3HXLA 3AG2H 2Y2ZA 1IN5A 2FF4A 3V42A 1YYVA 3H3ZA 3S1QJ 4R79A 1ETKA 1TWFJ 2X4HA 1YJNI 5E1WA 5GTIC 1K83J 1HKSA 1Q1HA 3HGGA 3K69A 4E70A 1GT0C 3GFIA 4LOCA 1V55H 3BZ6A 1SD4A 1Y8RB 2KFDA 1K79A 2BW3A 3PUFA 3P9CA 4AC0A 2MC3A 4AIKA 1NK3P 4XLHA 4XOPA 5H20A 4HF1A 5BOXA 1R1TA 1ZTRA 2M1BA 5CLSA 3WE3A 3EPZA 4BJ5C 4YEJA 2LNBA 3T8RA 4XRSG 5ILUA 4I09A 2XRLA 5D6EA 3A01B 3SFIA 4Q48A 5J3LA 1D5VA 4IOAF 1JHFA 4O5VA 2L54A 3GTGJ 2BY0A 2Q2EB 4P9FA 2XF5A 2LYCA 1YS6A 2EZHA 4PGGA 1R1VA 1A5JA 3LSMA 4LGWA 1OCCH 2OC6A 3ROUA 4QWQA 1AOYA 1I3QJ 2JPCA 2G7HA 4UVBA 5M5XJ 2PLYA 2ME0A 2LRDA 4WX9A 5A2QZ 1Z3XA 1U78A 4L18B 3ZQ7A 5HS9A 2LY9A 2W82A 4KIBA 4BQQA 2GWRA 5F27A 3CP8A 2HNHA 3EDPA 1IN4A 4G9YA 5DUKA 2N8GA 4EATA 3GTPJ 3K1PA 2JUGA 1LKXA 4FE7A 3F3XA 1R49A 1UCRA 2M8GX 3KYLA 1BR2A 3S1RJ 4II2A 3G2BA 4R1HA 4BGDA 3QYFA 2W84A 3GBGA 2BYVE 1R00A 2KZGA 2K3FA 3PUBA 4ON0A 1C0WA 1BIAA 2B9SA 2EBIA 4RDUA 1TW2A 2PI0A 1DUXC 1HQCA 3D0SA 3IH2A 4MQ9F 2FBIA 3VSLA 4ANJA 3HKZA 4AIDA 3PQJA 3Q9SA 2EA2A 4D1QA 1FLIA 2COMA 4BYYA 5L3GA 1Z3YA 1U5TA 3I55I 5B1BH 4D7MA 1XPXA 1S29A 3WODF 4IOCF 3OYAA 3KP4A 3ZMVA 2LF7A 1PJRA 3BG5A 4G6TB 3L00A 1KYZA 3ZQCA 3M8EA 4IZZA 4IVNA 4LK0F 4M3FA 3HRMA 1OLTA 5ILSA 2DOEA 1SMYF 4Y3OA 1LVKA 1BR4A 4C2MJ 4WK8F 2B7EA 4OIRF 2VOOA 3MKYB 4IXAA 2IPQX 3OS0A 1N25A 5F1JA 1AKHA 1ZELA 5M3MJ 3SFZA 4XLCA 3GCMA 4RM2A 3OYEA 3W2AA 3LQQA 3FX3A 1MJBA 2EILH 2JSPA 2CMPA 3KPHA 4D7NA 2QSGX 1HSJA 4ASNA 5D8LB 5E3MA 4BDZA 3HGYA 2ZMEC 4YIFA 2YX4A 4G7ZF 3Q3SA 5E17F 5ICGA 5HNHA 1IC8A 2COBA 4PFOA 4YELA 3S32A 2FBKA 2D45A 2V79A 1TNSA 5L3CA 4AIJA 4IHXA 4PJJA 2DQRA 1GV2A 1ZGAA 2EK5A 1NH3A 1ETQA 3K4KA 1JT6A 4XRMA 2UUZA 3T1BA 3GZ6A 1O4XA 4BJ6C 3K9TA 1BIBA 4EEFG 2OCCH 3RKYA 1QZZA 5J1UA 4E7HA 3CF5F 3I59A 1RRJA 2L7MP 1YLFA 4F3QA 5F04A 2STWA 2K4BA 5CPRB 1XSXA 1OYWA 3QP5A 4KISA 1I39A 1HDPA 4EMSA 1J75A 5ICEA 3E6CC 5K5QA 4XL9A 5FROA 2QVOA 5AIPA 3G1MA 1KGSA 4ZDLA 1Y0NA 5GADJ 1O3QA 4PDKA 4CCMA 1I5ZA 3M1CA 4CCJA 2HDDA 2MSYA 5JLWA 3KP6A 2CW8A 2ZMEA 3H5AA 3BJOA 4U0WA 3RKWA 3F6OA 5EYRA 3RZOJ 2CSOA 1H9TA 3I54A 4IKFA 1D5YA 1LFPA 1G4DA 1OISA 3BC8A 3ZGKA 1SFOJ 1IRGA 2RV8A 2BW3B 3LSPA 1IJWC 2DFHA 3ZMZA 2GQQA 1EKEA 3FKJA 1ONVA 2V26A 4L9NA 3CMYA 3IHUA 3J7YJ 3WTVC 1EV7A 3OOUA 1TWHJ 2FXAA 1D1CA 3U21A 2XSDC 3CCYA 1BOAA 3CJTB 5EJCA 1VQKI 2RKHA 4I6ZA 2WY8Q 3L9FA 4JX6A 2L01A 2FMLA 4BXUA 3SJMA 2M4GA 5DDGA 3K70D 2DYRH 2QBYB 4GRIA 1O7LA 1X4OA 2R7VA 2XKOA 3VYRB 1QGPA 4CZZA 3S3MA 1LQ1A 2X51A 3KP5A 1J0RA 1QVTA 2J5OA 1WJFA 4UUSA 1PYVA 2XAQA 2CQXA 3VWBA 4BEHA 2R0QC 5L3DA 1W7PD 2H6CA 4FX4A 1ETOA 3GTJJ 3ECOA 2O03A 2HDCA 3LA7A 1HDDC 2DT6A 2EQRA 1R7JA 3GYHX 3QU6A 2QZ8A 2HPMA 1Z7LA 2EIMH 4IQJA 1OYIA 2EIJH 3MCZA 5IP7J 3L2QA 1LE8B 4HF2A 1ZK8A 5CYVA 3D1NI 2HYFA 4G6QA 2P5LC 5DCMA 1R36A 2E5ZA 3ABUA 2XRNA 1OCPA 4LMYA 5DS9A 4BE1A 4BH9A 3TL4X 2BVMA 4MTDA 1B9NA 4G7OF 3SHFA 4A0ZA 3BWGA 5GAEJ 5DM7F 3JRDA 2HFHA 1A35A 4L5IA 4UVAA 2AQFA 3H5RA 4PK4A 3DF8A 1N78A 2DA1A 1LVAA 1L0OC 3F0CA 1Z6RA 3VPRA 1YTYA 2OCEA 4XMYA 1W36C 1X19A 2WY7Q 2VI6A 4YIIA 1VFCA 2E36A 5J6XA 1O3SA 1PUEE 3OOPA 1YOVB 2MH9A 3FBNB 3R0JA 4C2TA 4BU2A 1EJ9A 2WB1N 1Z91A 4AD9A 2H8RA 4M3DA 2E5NA 1SFEA 4HPQA 1TQMA 5JLXA 3SYTA 2RGVA 4KT6A 1GUUA 4CCOA 2R4GA 4IRIA 2EV0A 1S7EA 2QQ8A 4IHVA 4HV6A 1UG0A 1ZKGA 1Z05A 3NEUA 4IEJA 1HKQA 2DN0A 3I59B 3S3OA 3F22A 2EZIA 3LSJA 1RPWA 4Y52J 1ZLJA 1MBFA 3MZYA 3KX2A 1MSFC 1S8NA 3EETA 3F8CA 2ZJQF 3CCRI 2FU4A 2OTLI 3I4PA 1X2NA 2VKHA 4BXXJ 3WTXC 4ENKA 4HNTA 4FCYA 2CV1A 1JKRC 2NOJB 2P8TA 2FRHA 3VODA 2DU9A 1U8RA 2YR2A 2MC4A 4XR6A 3DPTA 1B59A 1XX5A 4ZJZA 2NVUB 2RDPA 4O6JA 5KK1A 2GIVA 5H2FC 3RPUA 4CH7A 1DP3A 1U2WA 4QPOA 3BPVA 3UR3C 5FKOA 2VL8A 2QKMB 3H92A 4CSWA 3GW2A 4XONA 4BACA 5E8IA 2LKPA 2PMUA 2X6WA 1QZEA 2CS3A 4KICA 4UUTA 3CC4I 1Z7UA 2RREA 2WAQA 3D5SC 2HOSA 1LEAA 5EEGA 1ZGJA 3KCCA 4C2UA 2KRCA 3CQZJ 3PFYA 1T08B 2KRHA 2FSWA 3I71A 2QSFX 6PAXA 3F72A 4D5CA 5J4YA 1VQ5I 4EM1A 2VBZA 3ZQIA 5J47A 1VQLI 1VQ9I 1YE9A 4A5MA 3M8JA 1E2XA 4RA2A 4C30A 3JRIA 1A6QA 2JN6A 3RQIA 1LFUP 3ZRGA 4XM3A 4DYCA 1P4XA 2FBHA 2X85A 1QA6A 2I5UA 1SD6A 3BR5A 4GFBA 2FX0A 3DU6A 5IT9K 2XGCA 2EFWA 1V5EA 2QF7A 1QO0D 1G3SA 2L9VA 2ZXJA 1OYYA 2DO7A 1LEBA 1J5YA 1MMNA 3LMMA 3LSKA 2VIXA 1ZR2A 5EG0A 2DA3A 4XORA 2E71A 4M73A 1O3TA 1FSHA 2H1LA 1EH8A 3LSIA 2K86A 1K6OA 1VQPI 2XAHA 1JGSA 3K1MA 2DA6A 1DQUA 1H88C 4XRSA 2HKOA 5HLIA 3A2KA 3GTMJ 3SEQA 4A6DA 1OMIA 1OQYA 3IL2A 2MFZA 4EVIA 2XUBA 2B0LA 3GTQJ 3KP2A 2WC2A 4E7ZA 2EV5A 5E3OA 3IV5A 3CDIA 4P96A 3AKZA 2P7VB 4A3IJ 1UHSA 5TGTA 1WHUA 3DKYA 2M0MA 2X1DA 3LWFA 4Y15A 3U2RA 5C4JJ 2AXLA 3QODA 1BJZA 3L2CA 1SANA 3A4CA 3D5RC 2IS1A 2CYYA 1TQIA 3TDZC 4I99C 5F64A 2XV4S 3E5XA 3MVPA 1Y56A 2QWWA 1I27A 2UZKA 3QAHA 2V1UA 3RJPA 3WTZA 1X1DA 1DPRA 2NVYJ 4UUVA 3HRSA 2NVTJ 4WWCA 1XGNA 1X58A 1YG2A 2WWYA 5BPDA 3CCUI 4XN0A 4IF4A 1FJLA 5HNFA 5EEAA 1Y39A 1GVDA 4Q47A 5D4RA 3O6BB 4A3KJ 2UV1A 4U87A 3HC7A 3FXJA 1W7PA 3KYDB 2FOWA 5JFRA 3JSPA 1I6XA 2K9MA 5DEQA 1VQ6I 1WJDA 1KQ8A 2HKXA 1KQ9A 2HWVA 5H6QA 1K4TA 3S2HJ 1CF7B 2KPMA 1ZN2A 2HVQA 1RIOH 2QQAA 4ZZDA 5K5RA 4OWRB 2JSCA 2CQQA 3F8MA 1QHGA 4B3XA 5LHHA 3G71I 3F21A 4LB5A 1FZPB 3H9GA 1AKHB 3T8TA 2WTEA 3I53A 2A61A 4GXOA 2VQLA 2L7FP 2K3PA 1TLHB 2F4MB 4BE0A 5FFZA 1A31A 2W1OA 4BHCA 2ESNA 2ZNYA 4AU7A 2QENA 2K4JA 4XLEA 5EGOA 1FSEA 1ZARA 2OV7A 3WGHA 5CVRA 1GVJA 3IP4B 4DOZA 1P2FA 5EEHA 2MLGA 1IUFA 3CDLA 5K5OA 3DFGA 2W00A 1PP8F 1USSA 5EF6A 2Y9ZA 4A6EA 5M3FJ 1MNEA 3U9GA 4E7IA 1BJAA 5LHGA 3ABTA 1LB2A 3UKGA 1ZG5A 1SAUA 5E8GA 2OJED 2OQRA 3FHNA 4UB6C 1T33A 3ABMH 4UV8A 1LDJA 2HZTA 1VZ0A 3SEZA 3DEUA 2FQ3A 2OAZA 2H6BA 4W1UA 3HRTA 3QPSA 1WCMJ 3J7ZI 2WV1A 3ASOH 4LG0A 3FMSA 3WTYC 3CMMA 3CUQB 3P9KA 1FMWA 4A0XA 2ACJA 3CD6I 3KP7A 3I4MJ 3F8BA 5J1RA 5FO5A 4LG0B 2NS8A 3O8HA 2XAUA 4KIFA 3IKTA 4AYBN 3E7LA 2L7KA 2UXNA 1HSTA 3WHCA 4EJTA 3GFLA 3IUOA 4IPAA 2EINH 4XKVA 3J81K 4V19K 4EJOA 5FRMA 2XIGA 1FT9A 3OIPA 4MGRA 1JI8A 2BY3A 1TQPA 3M9AA 4B43A 1HCRA 3BZCA 5FKNA 1W36D 4LG3A 3QYBA 4JP0A 3B73A 1P4AA 2E7WA 1UFMA 4P55A 2TCTA 1VQ4I 2QGUA 3N05A 2JQ7A 4HAMA 2PMHA 4M6XA 1IRXA 1MZBA 4S05A 4MFDA 2KZVA 2VE9A 1IAWA 3OYCA 4WF2A 5LEJA 3ZMDA 3MKZA 2KDZA 2X6XA 2ZKZA 3K10A 2AXTC 2XPWA 3PSFA 3MZHA 3AL0C 5AONA 4LITA 4IX7A 3BR2A 4AVZA 1E3HA 2HQRA 1MGTA 4PJLA 3MAJA 1Q1VA 2ZFUA 1SD7A 3BPXA 4JX5A 1IXSB 4CYCB 2F4OB 2HZDA 3ELKA 5EZGA 3HYIA 2KQRA 2P0WA 2KP6A 3CC2I 3ULQB 1MW7A 2A68F 3KEQA 3IRQA 2WB1A 4KUMA 2R7DA 3NWSA 3HSEA 3S2DJ 1NK2P 2L4AA 3JAMZ 2BZTA 4DIQA 2DOFA 2W57A 3S8PA 1MMAA 5F6FA 3BG9A 4XIDA 1IF1A 3S2WA 2LKSA 3K1NA 2KL4A 3PFIA 4QSHA 4WXDA 1Y1VJ 3NRVA 4CA0A 1Y6IA 3HM5A 3CO6C 2NRAC 3W3CA 4XSXF 5KCMA 2TDXA 2VONA 1K4SA 2V4JC 1P92A 1DU0A 3OYMA 2DLLA 4IQ4A 3TP3A 2VODA 1LDKB 1ZR4A 3MN2A 3MEXA 1POGA 4ZDOA 4XBFA 2JA5J 1XC5A 1MH3A 2F5VA 1W4MA 4M3BA 1S5LC 5F0CA 5FLVA 2LH9A 2RNGA 3WGIA 2AO9A 2AS5F 2L2OA 4Y7NJ 2GOXB 4ENNA 2ZJPF 2WAQN 4BBSJ 5F08A 1P7JA 2HI3A 3G4SI 2DA5A 3F8FA 2DJNA 2A5YB 3U1DA 3M3YJ 3S93A 3E6DA 3GLLA 4N9IA 2ZXIA 1V54H 1DGWY 2LBFA 1BBYA 3V7SA 5LRSA 2QKLB 2JJ7A 5BMZA 2A6EF 4LD5A 2QM3A 3H5NA 1MNMC 3QWLA 1MBKA 3TMOA 4AM3A 4M6YA 1T56A 1FWZA 2JUCA 2LC2A 3MKWB 1O57A 4A3DJ 5FKKA 4EJVA 2M9HA 5HVQC 2YPRA 1T98A 1BC8C 3TO9A 1FYKA 3Q0UA 1S6LA 1R5HA 3BJ6A 1KYWA 1FC3A 2WAFA 1G59A 3DBLB 2VXDA 4IHSA 1KQ0A 3ECHA 1UHWA 1SVLA 5IPAA 3P7NA 4F92B 3FXQA 1W5CC 4DJAA 5J8FA 1STZA 4Z6YA 3JRAA 3LOCA 2FEZA 3ZMTA 4ZZLA 2XPVA 2DT5A 4LFUA 5FD6A 1FX7A 2Z16A 3BT9A 4BXFA 4UNOA 5F1RA 3KYCB 3RPQA 3K4BA 4F52A 1T8IA 3RCOA 1VNDA 2GZWA 1P9QC 1AHDP 1RC9A 4N4NB 4UB8C 2CUZA 1WJ5A 5L3BA 1Z21A 5LD2C 3FZVA 1MMSA 5E3LA 2M7AA 4G94A 1K78A 1JKOC 1O3RA 1YW7A 1N77A 2ZBKA 1F1ZA 4A2UA 3W2VA 3W6JB 1FMVA 2XPUA 4G8XA 3WTUC 1SFUA 3PJRA 5FGMA 1RKTA 1WKMA 2GA1A 2IA1A 1QHHD 2LR8A 2DBBA 1JUMA 2G7UA 2ZXHA 3ONQA 2Z9OA 4XN3A 1X3ZB 5KAFC 3CLOA 2DXIA 3K0LA 2DMQA 2HTJA 3H9JA 3TOBA 4PJNA 3VYSB 1BI1A 2WAEA 2RVCA 2EV6A 3I56I 4MEYF 4MLOA 1WI3A 4HLXA 4CYCA 3OYIA 3FHZA 2NVXJ 1QBJA 5FRNA 1VTNC 3WE2A 4CUGA 4ZYAA 1MDMA 1J09A 3BG6A 3LAPA 4QLCU 2MA3A 2LBFB 1ITYA 3TP0A 5IOZA 4ENMA 3PO2J 4LLLA 1U9OA 3DEEA 3WHBA 3JSOA 4EM0B 1FOXA 1TNTA 2RAEA 2XF7A 2R7XA 4HG2A 2XAFA 3HL2A 4AUXA 1YHQI 2V1XA 2BHYA 1Z0XA 5IYCJ 4KN4X 3VDXA 4M71A 2H09A 1REPC 2NOGA 4ZH4F 2E1OA 1IN7A 3ZMSA 2NNYA 2EA4A 4GDFA 1HW1A 4BAYA 5KHDA 5DUIA 4RMNA 5JHFA 1I50J 2DFEA 3HB9A 3ZN1A 1TTYA 1B8IA 1S7AA 2L0KA 5DM6F 2QUFA 1TP4A 1UELB 3W6KB 3HOXJ 1MD0A 2OZ6A 2IA2A 3FK6A 2GAUA 4A3EJ 2W25A 5HLHA 2LMDA 4BHPA 2RNJA 4Z2YA 1BA5A 1KA8A 3MFKA 3E97A 3K70C 4ZC3A 4OMYA 2M7BA 2CUFA 2PJRA 4A3BJ 3TW6A 2CU7A 5DV5A 4B09A 1VQMI 2LDUA 3WG7H 3HOVJ 2M0CA 2XGDA 1V4RA 2G9WA 2LSOA 3SZGA 1WPKA 3FXLA 2IJLA 3NQOA 3J80Z 1FYMA 2JA6J 1XTAA 4UXNA 1FY7A 3CESA 1UG2A 2H1KA 3LSGA 2K9LA 1MJ9A 2LREA 2VT2A 3H0GJ 4XSZF 4E6KG 3QOPA 1S72I 4N4OB 4XLNF 3VYTB 1ODDA 1QVUA 4JBAA 2CRGA 2XDVA 2DMTA 4RLQA 4E4HA 3RYRA 4KITB 1HBXG 3KP3A 1V3FA 2KISA 2W48A 1RKWA 5AIQA 4LIUA 3T5XA 3ZOBA 5E3NA 3LA3A 3LSRA 5K7FA 3GTKJ 4B4CA 2QLZA 5ERIA 4H4KC 5BS6A 2GIZA 1RUOA 3WTSC 4FX0A 5J1YA 4FETA 3RTRA 3CC7I 4BS9A 2V9KA 1GLNA 3PSIA 3I9V2 3OYBA 3DLLF 2OA4A 1HLVA 1HA8A 2VJJA 3LAJA 1OCZH 2L7ZA 1IZ1A 4B47A 1FBSA 2HS5A 3I5UA 1T2KA 2EB7A 3V8LA 4ABZA 4IO9F 3HPGA 1XG1A 2Z2SB 3CMAI 2DTRA 2BXYA 2KMUA 4OINF 2DK5A 1U9NA 4U0VA 2BEOA 2XROA 2KRFA 3K7AJ 2ZJ2A 4CCLA 2JA2A 3JRGA 1B9MA 2R7FA 1OR7C 1UB9A 4YG2F 4HNVA 2R92J 3IC7A 2O7OA 2DFIA 2OUMA 3QP6A 5CJ9A 4EM2A 3GWZA 2YSRA 4CXFA 3CCSI 3RZDJ 5EGOB 1RETA 2FQ4A 3EYIA 4IHWA 3HSFA 1ZRCA 2DPUA 1PVEA 5IY5H 3TW7A 4I76A 4MEXF 2F48A 2DPDA 1HW5A 4AIHA 4ZTFA 2KIUA 3TKYA 4YFNF 1QU3A 3SZPA 1YFHA 4GCVA 1DPUA 4EGZA 5FLXK 1B8IB 4U0YA 1KU3A 1P7IA 3HZJA 3BCAA 4KIGA 2WV0A 1WQ2A 4Y13A 3OSGA 2NS0A 2HR3A 2EFNA 4XRFA 1QQIA 1U6GA 3E0JB 3A0BC 3WGGA 2ELHA 3S1MJ 5GP9A 2JA8J 1A6IA 1ETYA 3CCQI 1AA7A 2NAZA 3H36A 3OV8A 2XHKA 1EF4A 4GYIA 3W6VA 2H27A 4F93B 3GFJA 4L9JA 3JTHA 4KT5C 3L2UA 5J40A 2X6OA 1IG7A 1R71A 2CO5A 2XAJA 2HVSA 1YIOA 4OAZA 3GTOJ 3HUGB 2VBXA 4Y4RA 4PFPA 2XASA 1JXSA 2V1NA 5CVVA 1W0UA 5FB2A 1ZGWA 1H9GA 3CZ6A 2LLKA 2HDWA 1NG7A 4NUBA 4NHJA 2CUJA 4OIOF 4J19A 5LGTA 2FJ1A 9ANTA 3C3WA 4MO7A 4BBRJ 1XMAA 2GLOA 1GV5A 4KYWA 1VQNI 4RM3A 1ON1A 4U7DA 3HJEA 3OS1A 3RI4A 2DK8A 3ERED 3H35A 2VC0A 2FOKA 3Q0WA 1MH4A 2G0EA 4DW6A 4AYBA 1ZG1A 1U8BA 2ESHA 3C1DA 2VE8A 2EFQA 2R7QA 4S04A 1J2XA 1W1WE 2O61A 2E2HJ 1IO2A 5DD4A 4NDLA 2LTPA 1UMQA 2PN6A 4HX4A 1XCVA 4RB2C 3ABKH 5ICFA 4N0BA 5DCFA 4A3JJ 3J7AY 1ETXA 2HGCA 2OQGA 1D0YA 3OYJA 3GX4X 2JMWA 4M9SA 4Q5SF 2GXGA 4RGUA 2VUMJ 4DYRA 3FK7A 5E1ZB 1VQOI 1LDDA 2XF6A 1WJBA 1FPQA 1CGPA 2HOTA 4UHTA 3OL3A 4RGSA 5IT9Z 2KHMA 4CDGA 1JUSA 4HRIA 5LRRA 3K4LA 4C9YA 2PFBA 4KFCA 3CP2A 3I3LA 3ERMA 3IWZA 1F43A 4O3MA 4EV0A 1GDTA 1D1BA 2KIFA 1E3PA 3EUHC 1K61A 3DTIA 3FF5A 2DW4A 1ETWA 4XKWA 5B5EC 5CQEA 3SXYA 3L2RA 2PG4A 3IAM2 4HYEA 2FNPA 4M3GA 1KZHA 3A0HC 5LFAA 5JVTA 3CF2A 4X1EA 4MNUA 1JTXA 4NQWA 4ENJA 3DU5A 1TW3A 5LHIA 2X1CA 1FIAA 5KAIC 4LIVA 3HOSA 5HDKA 1YW9A 3AL0B 2MH2A 3BQYA 4FT8A 1KONA 3B6AA 3FXUA 5HOOA 3KFWX 2O6GE 3S3NA 4L9TA 1FEXA 1BR1A 2EIKH 2E7XA 4ZTJA 4B8XA 1WFXA 3FISA 5IT3A 1BL0A 4B48A 3GEZA 4F55A 1FNNA 2LP0A 3M1EA 5HODA 1YJWI 4G12A 2QEXI 1VF9A 4E7KA 3R60A 3GLXA 2CFOA 3H3UA 4H0EA 1PP7U 3ZQFA 1T39A 2EWNA 1T0FA 5DYMA 4CICA 3HHHA 1FBUA 2CW7A 3FM3A 3B02A 3OYDA 2R5ZB 4ZDPA 3DKXA 1BI2A 2A07F 2BXZA 2JWTA 3ZCOA 2D5VA 3COAC 5E1XA 1X4PA 4A93J 3M4OJ 3O8GA 5D4SA 1K6YA 3ZPLA 1DDNA 4F91B 2LVSA 1YQAA 3HOZJ 3FKIJ 3HG9A 3A1YA 4OOIA 2K5CA 1PDNC 3OL4A 1WVRA 1SD5A 4KMUX 3MWMA 2ZFWA 2OU2A 4QIWN 3V7CA 4KDPA 1OCTC 3TBIA 4GYGA 1XDSA 2R7OA 3OR1C 4TV7A 4HW0A 3A02A 2M87A 2YUSA 3VOEA 2VQHA 1IV6A 3ZXSA 1ZQ3P 2L3DA 2K40A 4WXCA 2GM4A 2P5VA 1R22A 5C44J 5DCMB 5E18F 4UVCA 1QPIA 1D8KA 2Z99A 2DT7B 2R5YA 1R6RA 4F7ZA 2A6TA 2O3FA 1J59A 2DDAA 1ZRFA 3HIFA 3HOUJ 3OR2C 5ICCA 2F2EA 3AG4H 4XOTA 4DNCA 3I0TA 3LFKA 4XLAA 2HYJA 4CCNA 1LE8A 2R5ZA 2M2EA 1W5TA 3HTSB 3E5UA 1MNDA 3CJRB 5F0FA 1JUPA 4MHGA 2XC7A 3VFZA 3MZ8A 2CV2A 4HDVA 1FTTA 3LL7A 2M3AA 3TGNA 4A3MJ 4JYKA 3RYPA 4L5JA 2ZCWA 3DTEA 3L1PA 1R23A 3HUGA 2DODA 4NC6A 3BTLA 2DAOA 4I98B 4CGZA 4BY1J 2H8WA 2HU9A 2X6YA 4E7LA 2CG4A 2QQ9A 2IAIA 2IXSA 1SVOA 2OBPA 3K4JA 2FD5A 1BC7C 1LJ9A 2BY1A 1I3AA 2JZYA 5D5UB 5FJ8J 5JR3A 2CH0A 4HNUA 3WU0A 5HLTA 1FYLA 2JA7J 2VT3A 2AHQA 2ID3A 1W7PB 4XICA 2O5RA 4XLPF 4A12A 5BNGA 1BOBA 2RN7A 3H1CA 5HS8A 4Q4ZF 3GZ5A 3RQ4A 2LOOA 1VQ7I 3A01A 1JJ6C 5JHUA 2XKPA 1RR7A 1VI0A 4WXHA 3JR9A 2V6CA 2FA5A 2CQNA 1U5TB 3JRFA 4A3LJ 1IUYA 1MMDA 5D5WB 1D8JA 3KLOA 1YIJI 2M5WA 4JK1X 1MMGA 3QOEA 2KIMA 3BG3A 3ESWB 2ZB9A 3DQVC 1RR8C 2ZMEB 2F5CA 1MBGA 2KKOA 1ZLKA 2HQ5A 1WJCA 2PEXA 4DBQA 2HTSA 4RGXA 2ELJA 4OMZA 2CV0A 2LD5A 1UAAA 3C2GA 5IP6A 2JRTA 3J81Z 3DKWA 3BZKA 4E7SA 3OS2A 2PJRB 1TWGJ 5B1AH 1G3WA 3ML6A 1G3YA 3QPHA 4BY7J 3TEDA 2O8KA 2D1VA 2E2JJ 1USTA 1R4NB 3X2QH 2JPBA 4XNFA 2K02A 2Y31A 2VBYA 4V2GA 3OSFA 2O8XA 4HX7A 2DMUA 3DXJF 1FP2A 4EQQA 1ZHFA 4FE4A 2MYSA 3GF2A 4B3AA 3V8KA 4UY8I 1XSDA 2R7UA 5ED4A 1IRFA 2ECCA 2W4SA 3LSHA 4HLYA 2PJPA 2GBYA 4PJMA 4B44A 2JK3A 3J7AO 2HOEA 1JTYA 2CWEA 5TJJA 2FUG2 3DPUA 2DCEA 2ICWG 4C3JJ 2P5KA 1VQ8I 5LGUA 5F0HA 1XD7A 2C6YA 3BCBA 5EDNA 1FIPA 1WWXA 2ZXWH 4HBLA 1AU7A 4BKXA 2AQEA 3HKZN 3WG9A 1S9HA 4L0ZB 1MBHA 3D5LA 3OY9A 4YFKF 1V5FA 1R58A 1TWAJ 4DGWB 1SC7A 1SEUA 2MLKA 1MSEC 3KETA 1B72A 1OFCX 1X2MA 1SFXA 2HXIA 3OIOA 3FXRA 1F5TA 3OIQA 2QSHX 3PQKA 2IT0A 2P6TA 2VJIA 1L3LA 1SVMA 2F5EA 1R1UA 2M30A 4U88A 1YITI 1Y0UA 2M4KA 1LUJB 4PGHA 5CKTA 3P5JA 2K9SA 2NNNA 3PNVA 3F8NA 2XAGA 3SDGA 5GTHC 1B6AA 1GXQA 3DTKA 3AG3H 2IA0A 3DLAA 3L09A 3ZP5A 2QA4I 3IWFA 2D2WA 3RKQA 3EUHA 1S3JA 5GPAA 2JVGA 4BUPA 4HX8A 1R4MB 1TC3C 1ULYA 4J01A 4YFXF 3E1SA 1I1SA 3REOA 4NC8A 3C2HA 2F4IA 2NXNB 3BR6A 2QCOA 4FASD 5E20A 4HQMA 1Y1WJ 4M74A 2DJIA 4RS8A 2L9RA 1DGRM 2K85A 1K7AA 3QYEA 2RC4A 1ZAOA 4R8HA 4RB1A 2IGKA 2Q1ZB 2Y9YA 3DCFA 2GXBA 1XGOA 2YU9J 3GFMA 2L9NA 3M7GA 3P9IA 1OR7A 3HTUA 2IEKA 5IOYA 3G73A 4I0AA 3AAFA 2XVCA 2DA4A 1G3TA 2DTZA 2E35A 2MD5A 1J9IA 2KJBA 4QTRA 1XSVA 1FOYA 2NYXA 2XSJC 3Q5FA 2E1CA 4ESBA 2E1MC 3FWEA 2DQLA 2BHZA 2PQ8A 1YJ9I 1APLC 3N97A 1UZCA 3SZTA 2KLOA 3MD2A 2BV6A 3LA2A 4M6VA 2HEOA 2I8DA 1GHCA 1SMTA 3OYGA 5D6FA 2L02A 4BQAA 4BQNA 3QRFF 2EPFA 1YO5C 2Y48A 3C18A 2WADA 1RI7A 4EJWA 2R3SA 2E2IJ 2GXAA 1RNLA 4BEHB 2MD0A 3ABLH 5FFXA 2XGXA 1XGMA 3CUQA 3CDHA 3V8JA 2ZO4A 4NC7A 3DPLC 4E7JA 4KJZA 1TZLA 2E1MB 1EH7A 3DWLE 3IH4A 3NWTA 4M72A 2VKEA 2JT1A 2Y0SN 3ZQLA 3AG1H 4IRGA 2E34A 5KNLA 2WBMA 3Q0VA 2VPLA 4I0BA 4NQWB 4CCKA 1IDYA 2VC1A 2ZSIB 4FHTA 2VN2A 1G6NA 4EGYA 1PUFA 2NVQJ 3FIWA 2B63J 3BLYA 3FMRA 2X48A 2VOPA 1FTZA 2VKDA 5GAGJ 1BW5A 1FOWA 4P5OA 3M07A 3BROA 2ZJRF 3OYHA 4ZYHA 1X3UA 3CCMI 1WZ2A 4PSXA 2IGMA 4MFEA 2EJRA 3ASNH 4BJTA 1R9TJ 3MKLA 4LK1F 2JVHA 2V7FA 5CQGA 2QBYA 3E3VA 2CFXA 2VQGA 3I4NJ 3ZQGA 1M1EB 3PIPF 2KDOA 4FTHA 3R61A 4HSTA 2NS7A 4YRVA 1X1AA 2CJJA 3QU3A 2Q8KA 3HPHA 2EFOA 3KZIC 2VASA 1CF7A 1EH6A 2QQBA 2A6HF 4ESFA 3A03A 2VQCA 5B66C 2EFPA 2XGEA 4ITVA 3FXMA 1W5SA 1W0TA 3IKVA 1ENHA 2KIQA 1N75A 1RUNA 3BTIA 2E19A 2X1EA 4OIPF 1ETVA 4MIMA 2HOAA 4LLNA 5C4XJ 3OYKA 1ON2A 2P7CB 1B1BA 3C7JA 4J00A 2OPTA 3ZN0A 2Z1DA 2L9SA 1Z1DA 2V1DA 1U0JA 4HF0A 1ERDA 2DYSH 4CO8A 3CUOA 3CMEI 1MBJA 1BN5A 3LSTA 4ZYGA 3EUKL 1NHAA 2R7WA 3HOTA 1D0XA 1FP1D 2ZNZA 4HOBA 1JGGA 1PUFB 1RZ4A 2XB0X 5CVUA 3GMEA 3NAUA 2HQNA 5LGNA 2CW0F 1OJLA 3S16J 1LNWA 3G6EI 2ID6A 2P6SA 3EUAA 4C3IJ 1Z67A 3BQZA 2QYOA 3I64A 1XGSA 3H0DA 3GTLJ 1Z77A 1JT0A 1UJ8A 1X1BA 4G7HF 2MBFA 1WH7A 5M5WJ 2A3SA 3DBRB 3KE2A 1F9NA 3KEOA 1BI0A 2BE5F 2K9NA 3JRHA 3DV8A 3JTGA 2UWMA 5E79C 1SAXA 1MBEA 4NBQA 4ESJA 3MMYB 4HSRA 1R5GA 2IP2A 5HS7A 3AFHA 3O3KA 1J7KA 2RQPA 3BR1A 4XK4A 1F36A 1UHMA 4RAYA 3K6GA 2Z5UA 5BQTA 3U1KA 4L9VA 5LEKA 1IXCA 4K2EA 3OYFA 3PM1A 4CHUA 3FXKA 1I1GA 5HDNA 1T38A 1AWCA 3K4CA 1T95A 2VJ5A 1EA3A 4Y17A 3HDDA 1JKPC 3L2VA 3NARA 1D3YA 1QPMA 3FXOA 2PX9A 4GO1A 3TOAA 4RLFA 2V9PA 1D0ZA 4LJZF 5DTDA 3B6CA 4M9XA 3Q9VA 3L2WA 4CZCA 2W85A 2MABA 2Y75A 1P4WA 3ZQHA 5GAHJ 3GZNB 5TRDA 2IS6A 4A3FJ 2MW8A 3E5QA 3IH3A 3IRRA 1H8AC 2VKVA 2OTJI 1T0FC 4PJ0C 3KZZA 1JHHA 2L4MA 3WTWC 1D1AA 3R6SA 4D9JA 1YI2I 3BG7A 5CVIA 3S17J 2IGOA 3GUDA 1U3EM 1HKTA 1YX3A 4Y33A 4YIRX 3KLNA 4A0YA 5FLMJ 4OU0A 4I01A 3SQNA 2HQAA 3VEPA 5K1YA 4P9UA 3BDDA 1A04A 3WU2C 4MQVA 1MIJA 2ETHA 2IVMA 2BOLA 1BI3A 2E1NA 1IW7F 2E60A 4FQGA 1FOKA 1KU7A 3K2ZA 2GA2A 3FBIB 3HSRA 2ADUA 2DFFA 5K7HA 3BTJA 4ZYEA 1SFKA 4U7BA 2I10A 3BOQA 1HC8A 4B1RA 4V2FA 1JJ8C 2BBYA 3RKXA 3TO7A 4UV9A 5K7ZA 4AWXB 2IW5A 3K4NA 5TISC 2O0YA 1QRYA 3V4GA 3CCEI 3F6VA 3HHGA 4RB3C 5H6RA 4PUSA 1H89C 4XQFA 1A36A 3DP7A 3ZMUA 3CCJI 3V7RA 3IAS2 3R0AA 4C3HJ 1E0EA 3LFUA 5D5VB 2CQ7A 4L0YB 3FM5A 3F9KA 3DBHB 1X3WB 3BP8A 4A69C 2R7RA 5LLQA 2Y69H 4RBOA 2M34A 3JW4A 2HVRA 4M3EA 1IRZA 4OIQF 3OMYA 3PNTA 3TO6A 2H94A 1LFBA 2UXXA 2FMYA 1G8XA 3BJAA 1B4AA 1MJAA 3ZR8X 3CTAA 1HF0A 2L5QA 4FISA 4DYQA 3I58A 3LQRA 3FDYA 4D5FA 4KMFA 3RDIA 3VB2A 3TDUC 2DMNA 2J5PA 3E6BA 1B72B 3GO5A 3CJQB 3DEWA 2D1HA 1F4KA 2ME6A 4HEA2 1XMXA 1OKRA 2F6CA 3HOWJ 2Q2EA 5J8CA 5EG0B 3VSKA 3S15J 4WCGA 2Z33A 3CJNA 3ISPA 2KT0A 1T6SA 5D8KB 1ZG3A 3KIOA 1QNTA 3JREA 3UNGC 1Y8QB 5L3FA 2ISZA 2F5FA 2KJCA 2HXOA 2IBDA 2A05A 4RGRA 4KA4A 2M8EA 5DD8A 4IL6C 4M9ZA 1K78B 1IN8A 2ECBA 3C2BA 4D0PA 4MTEA 3T0YA 4A3CJ 3G1LA 2BVLA 4II3A 4P1WA 4RAFA 2W24A 1WRJA 2DDBA 2A5WA 4RAZA 1WH5A 4X0GA 1I6HJ 5KVRA 5JI6A 1OCOH 4BQOA 3OYLA 2CGPA 4QPQA 1WGXA 4PZJA 1X1CA 3GXOA 2K9QA 2VBWA 5IP9J 4DQ2A 4XLFA 4JQFA 1YW8A 2R93J 1DP7P 4LB6B 2VPRA 2V6EA 3M8FA 1JE8A 1WSUA 1MDMB 3K4MA 2VXZA 2LY2A 5HDGA 3RIRA 4PSWA 1WJEA 4JOMA 5C3EJ 3BR0A 1U5TC 2PMZA 5IYBJ 2LY1A 5LBQA 1IXRC 1HXDA 4I02A 4IJAA 1BM9A 4NB5A 2LK2A 3E6MA 2O9LA 2CUEA 1OPCA 2R7TA 4I7HA 2IS2A 3CUQC 1FBQA 3W2WA 1IGNA 3H3VK 3BR3A 2BY2A 3HBLA 3PO3J 1DU6A 2Y0SA 2F5DA 2YS9A 2LFBA 5L3EA 2GOMA 3KEYA 2HYGD 4EJUA 5J4VA 3H9QA 2FNAA 3JCUC 3OYNA 4XKCA 1ZYRF 2WA0A 1GXPA 5M5YJ 4PCQA 2LG4A 2PMZN 2R5YB 4ZYDA 1YRNA 2VJ4A 1O7FA 1RESA 2P4WA 2DMPA 2X9DA 2EZKA 2X0LA 3HOYJ 1WJAA 1IN6A 1WI9A 3OWTA 5JVGF 3BY6A 3WU1B 3HEFA 4L5EA 4KNYA 4ETSA 4HA8A 3JAMK 1NG6A 4HV5A 1S7OA 2HPIA 4N9HA 2R7ZJ 2YU3A 3G3ZA 2IRFG 2OZUA 4BNCA 1BW6A 5A2QK 2M45A 3N4MA 2Y30A 1YS7A 3PL8A 5B3SH 1ZH5A 2ELKA 1ORKA 2VB6A 2Y0MA 4X6AJ 4JX4A 5BPIA 4HDUA 3CCVI 1E3OC 3CLQA 3FMQA 4OAYA 1XS9A 1XCBA 2K27A 2K7LA 4CYDA 4BDYA 4GGGA 3WTTC 3J80K 2VLAA 2TRTA 2MG4A 2Z3YA 4RAGA 2JRMA 2ISYA 4A5NA 1XB4A 2JTVA 4IHTA 1ACIA 2STTA 5FKLA 1XDUA 3K2AA 2LF8A 4W97A 3JRCA 4LLGF 4I2OA 3JRBA 1XMKA 5FD5A 3ZQQA 4S0HB 5GPCA 4AVPA 1YX5A 3BTCA 3RPUD 1IV8A 1R5ID 3CO7C 4DBRA 2IS4A 4A3GJ 1KU2A 1P6RA 3RSNA 4DZJA 3VYUB 2DOAA 4HQEA 1TT0A 1G2HA 3PNYA 3EYYA 1ZREA 3KZYA 4BL0B 4NNJA 2ZC2A 2LKXA 3LNQA 4HZFA 2YX7A 4DZPA 2R7SA 2Q0OA 2IGNA 1Z6TA 4IRHA 2DA2A 2XB5A 2RQQA 3CCLI 2PBIA 3L7WA 1CQTA 5IYDJ 2BGCA 4BHBA 1TT5B
chains in the Genus database with same CATH topology
2DJIA 1DGRM 3LSIA 1V5GA 3QYEA 2OUMA 1DQUA 2IGKA 2Q1ZB 3A2KA 3SEQA 4XKBA 2L9NA 2MFZA 4E7ZA 3AKZA 2ZSHB 4ZTFA 5TGTA 3DKYA 2M0MA 2X1DA 1QU3A 2XSJC 4BE2A 3QODA 2E1MC 3A4CA 3D5RC 2IS1A 2KLOA 3MD2A 2I8DA 1Y56A 3BCAA 3OYGA 1X1DA 4BQNA 2W7NA 3E0JB 3SDBA 3HXLA 3V42A 2WADA 1AA7A 4R79A 4BEHB 4F93B 2MD0A 4XN0A 3L2UA 5HNFA 4E7JA 2HVSA 4NC7A 4OAZA 3HUGB 3DPLC 2BW3A 2UV1A 1TZLA 2E1MB 4KJZA 4U87A 3HC7A 4PFPA 3DWLE 3NWTA 4XLHA 4Y4RA 4XOPA 2V1NA 2K9MA 3CZ6A 1WJDA 5KNLA 2WBMA 2VPLA 4NQWB 2HDWA 4CCKA 2KPMA 3EPZA 1NG7A 2HVQA 4NUBA 2ZSIB 4OWRB 4YEJA 4BJ5C 2CUJA 1QHGA 4B3XA 3BLYA 3H9GA 2VKDA 4P5OA 2VQLA 4RM3A 3OS1A 2K3PA 3OYHA 4BE0A 3H35A 2W1OA 4PSXA 2IGMA 4AU7A 4XLEA 4BJTA 2OV7A 4AYBA 2JVHA 2V7FA 3IP4B 2Q2EB 5CQGA 4DOZA 2XF5A 2LYCA 2VQGA 2R7QA 2W00A 2KDOA 4HSTA 4YRVA 1X1AA 3LSMA 1MNEA 2OC6A 3HPHA 4E7IA 2VASA 1SAUA 3FHNA 1VZ0A 2VQCA 3SEZA 2LRDA 3J7AY 1Z3XA 4ITVA 1D0YA 2W82A 4BQQA 3OYJA 1N75A 3CMMA 3CP8A 2HNHA 1FMWA 2X1EA 2XF6A 1WJBA 3OYKA 3OL3A 4EATA 2KHMA 2XAUA 4HRIA 2JUGA 1LKXA 4J00A 3K4LA 4C9YA 2L7KA 3KYLA 1BR2A 2Z1DA 2L9SA 3CP2A 1U0JA 3I3LA 3G2BA 4II2A 1ERDA 1D1BA 4BGDA 3QYFA 3GBGA 3IUOA 3EUHC 3DTIA 5FRMA 4XKVA 4XKWA 3EUKL 1JI8A 3OIPA 5CQEA 2R7WA 3PUBA 4B43A 3L2RA 1D0XA 3HOTA 3IAM2 1W36D 5LFAA 4LG3A 3CF2A 3QYBA 3N05A 3DU5A 3EUAA 1IRXA 3VSLA 4ANJA 3HKZA 2X1CA 4LIVA 3HOSA 2KZVA 3H0DA 3AL0B 4D1QA 3OYCA 1KONA 5HOOA 3MKZA 1X1BA 1Z3YA 3S3NA 2X6XA 3K10A 1BR1A 4ZTJA 3OYAA 1WFXA 3PSFA 4B48A 3AL0C 4F55A 2UWMA 4LITA 1PJRA 4IX7A 4AVZA 4G6TB 4PJLA 3MMYB 4HSRA 2ZFUA 3AFHA 2HZDA 2KQRA 2P0WA 2KP6A 4E7KA 4IZZA 1MW7A 2CFOA 1OLTA 3K6GA 3OYFA 2WB1A 4Y3OA 1LVKA 1BR4A 3NWSA 3K4CA 1T95A 2VJ5A 2CW7A 1EA3A 3MKYB 3OS0A 3OYDA 3L2VA 4ZDPA 4DIQA 1ZELA 3DKXA 4RLFA 3S8PA 1D0ZA 1MMAA 4XLCA 3ZCOA 3L2WA 4CZCA 4RM2A 2MABA 3OYEA 2KL4A 3W2AA 1X4PA 2IS6A 1K6YA 2JSPA 2CMPA 4CA0A 4F91B 1T0FC 1Y6IA 4BDZA 3W3CA 3HG9A 5KCMA 3A1YA 1D1AA 4D9JA 3BG7A 2IGOA 2V4JC 5HNHA 2K5CA 3OL4A 1YX3A 4PFOA 4YELA 4Y33A 3S32A 3OYMA 4IQ4A 1LDKB 2HQAA 4PJJA 4ZDOA 3TBIA 2F5VA 2R7OA 3OR1C 2BOLA 3K4KA 2LH9A 2E60A 2RNGA 2UUZA 2VQHA 2L2OA 3FBIB 4BJ6C 2GOXB 3ZXSA 1SFKA 4U7BA 4E7HA 4F3QA 5CPRB 2DT7B 3K4NA 3S93A 4KISA 2ZXIA 1DGWY 1R6RA 2LBFA 4PUSA 2A6TA 4XL9A 5FROA 2QKLB 4XQFA 3H5NA 3OR2C 4ZDLA 3TMOA 4CCMA 3IAS2 3M1CA 4XOTA 4CCJA 1E0EA 2LC2A 3LFUA 4XLAA 3MKWB 4CCNA 2CW8A 3H5AA 3F9KA 1MNDA 3CJRB 5HVQC 2R7RA 2XC7A 4IKFA 2CV2A 2HVRA 3LL7A 2M3AA 3OMYA 1LFPA 3PNTA 1G59A 2WAFA 3BC8A 3ZGKA 2VXDA 3DTEA 1G8XA 2BW3B 4F92B 3ZR8X 4DJAA 3FKJA 2HU9A 2X6YA 4E7LA 2L5QA 2V26A 2IXSA 3FDYA 3OOUA 3U21A 1D1CA 3K4JA 2Z16A 4BXFA 2CH0A 3CJQB 4HNUA 5HLTA 2WY8Q 3K4BA 4HEA2 4F52A 2M4GA 2O5RA 2F6CA 3K70D 2R7VA 4GRIA 1X4OA 3RCOA 1BOBA 3VSKA 3VYRB 1P9QC 4N4NB 3RQ4A 2LOOA 2CUZA 1WJ5A 3S3MA 1Z21A 2X51A 5LD2C 1WJFA 2M7AA 1PYVA 3UNGC 3VWBA 4BEHA 1N77A 3W2VA 1FMVA 3PJRA 1MMDA 1QHHD 2DT6A 2BVLA 2ZXHA 3ONQA 4II3A 4P1WA 4XN3A 2A5WA 1MMGA 2HPMA 1Z7LA 3QOEA 2DXIA 4X0GA 4IQJA 3H9JA 4PJNA 3VYSB 2WAEA 3DQVC 4BQOA 3L2QA 4MLOA 3OYLA 4QPQA 3OYIA 1X1CA 1WJCA 5FRNA 4DBQA 4XLFA 2ELJA 2E5ZA 2CV0A 4CUGA 4JQFA 4ZYAA 1UAAA 4BE1A 1J09A 3BG6A 3TL4X 2BVMA 3C2GA 4E7SA 2V6EA 3OS2A 2PJRB 2LBFB 3DEEA 3K4MA 2VXZA 2LY2A 4PSWA 2AQFA 1WJEA 4JOMA 3H5RA 4PK4A 2XF7A 1N78A 4XNFA 2PMZA 2R7XA 4HG2A 2LY1A 3HL2A 4XMYA 3VDXA 1X19A 2MYSA 1W36C 2WY7Q 2R7UA 2R7TA 2IS2A 3W2WA 3FBNB 2Y0SA 4C2TA 2W4SA 3LSHA 4BU2A 5KHDA 2GOMA 3KEYA 4RMNA 3H9QA 4PJMA 4B44A 5JHFA 3OYNA 2E5NA 4XKCA 4HPQA 2WA0A 3SYTA 4KT6A 2FUG2 3DPUA 2LG4A 2DCEA 4CCOA 2R4GA 1UELB 2VJ4A 1UG0A 3BCBA 3S3OA 1WJAA 2AQEA 3OWTA 3K70C 4ZC3A 2M7BA 3KX2A 1S9HA 2PJRA 3D5LA 1NG6A 3OY9A 2VKHA 1V5FA 4DGWB 2HPIA 4HNTA 2CV1A 3SZGA 2NOJB 4XR6A 2MC4A 3DPTA 3PL8A 4ZJZA 3CESA 3OIQA 3LSGA 2VB6A 2K9LA 2LREA 2VJIA 4CH7A 1DP3A 4QPOA 3UR3C 4E6KG 2VL8A 2QKMB 4N4OB 3VYTB 4CSWA 2XDVA 2M4KA 4XONA 4BACA 4OAYA 4RLQA 5CKTA 4E4HA 4KITB 2X6WA 2CS3A 4BDYA 4LIUA 2VLAA 2RREA 2WAQA 3PNVA 3D5SC 4H4KC 4C2UA 2KRCA 3PFYA 4FETA 3RTRA 2KRHA 4BS9A 3DTKA 2V9KA 1GLNA 3PSIA 3I9V2 3OYBA 3DLAA 1HA8A 2VJJA 1YE9A 3M8JA 3ZQQA 4C30A 1YX5A 3RPUD 2IS4A 4DBRA 3ZRGA 4B47A 2JVGA 4BUPA 3RSNA 4XM3A 3VYUB 2DOAA 2X85A 1TT0A 3HPGA 3PNYA 2Z2SB 4J01A 2KMUA 3DU6A 3E1SA 4BL0B 1V5EA 4NNJA 4NC8A 3C2HA 2F4IA 2R7SA 2IGNA 1MMNA 3LMMA 3LSKA 4FASD 4CCLA 2JA2A 2VIXA 2RQQA 1OR7C 4XORA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HPH A;  1WJD A;  1WJB A;  1E0E A;  1MW7 A;  1WJF A;  4F3Q A;  1KON A;  1WJC A;  1K6Y A;  1LFP A;  3F9K A;  3HPG A;  1WJE A;  1WJA A; 
#chains in the Genus database with same CATH topology
 2EZL A;  2DA7 A;  1JKQ C;  4IHY A;  1V5G A;  2MGQ A;  1MKM A;  4KN7 X;  2P81 A;  3TQN A;  1YRN B;  4G6D A;  3MQ0 A;  5FLX Z;  5HLG A;  3S1N J;  3O2P E;  1H0M A;  5EZH A;  4XKB A;  1Z9C A;  3QPT A;  1HOM A;  5CVJ A;  1X1P A;  1ZRD A;  2A69 F;  2DI3 A;  2OF7 A;  3G1O A;  1LPQ A;  2FE3 A;  3QQA A;  1XN7 A;  2ZSH B;  4RB0 A;  5FKM A;  3F23 A;  1IDZ A;  1TBX A;  3R4K A;  1OCR H;  4BE2 A;  2EH3 A;  1QZY A;  3S14 J;  1TWC J;  2CQK A;  4UUS B;  2V9V A;  1HW2 A;  3EQL F;  3QPL A;  3HRU A;  5ILV A;  2W7N A;  1KU9 A;  3GVA A;  3SDB A;  3PIO F;  5D5X B;  2OD5 A;  1NTC A;  1TL8 A;  1E17 A;  3HXL A;  3AG2 H;  2Y2Z A;  1IN5 A;  2FF4 A;  3V42 A;  1YYV A;  3H3Z A;  3S1Q J;  4R79 A;  1ETK A;  1TWF J;  2X4H A;  1YJN I;  5E1W A;  5GTI C;  1K83 J;  1HKS A;  1Q1H A;  3HGG A;  3K69 A;  4E70 A;  1GT0 C;  3GFI A;  4LOC A;  1V55 H;  3BZ6 A;  1SD4 A;  1Y8R B;  2KFD A;  1K79 A;  2BW3 A;  3PUF A;  3P9C A;  4AC0 A;  2MC3 A;  4AIK A;  1NK3 P;  4XLH A;  4XOP A;  5H20 A;  4HF1 A;  5BOX A;  1R1T A;  1ZTR A;  2M1B A;  5CLS A;  3WE3 A;  3EPZ A;  4BJ5 C;  4YEJ A;  2LNB A;  3T8R A;  4XRS G;  5ILU A;  4I09 A;  2XRL A;  5D6E A;  3A01 B;  3SFI A;  4Q48 A;  5J3L A;  1D5V A;  4IOA F;  1JHF A;  4O5V A;  2L54 A;  3GTG J;  2BY0 A;  2Q2E B;  4P9F A;  2XF5 A;  2LYC A;  1YS6 A;  2EZH A;  4PGG A;  1R1V A;  1A5J A;  3LSM A;  4LGW A;  1OCC H;  2OC6 A;  3ROU A;  4QWQ A;  1AOY A;  1I3Q J;  2JPC A;  2G7H A;  4UVB A;  5M5X J;  2PLY A;  2ME0 A;  2LRD A;  4WX9 A;  5A2Q Z;  1Z3X A;  1U78 A;  4L18 B;  3ZQ7 A;  5HS9 A;  2LY9 A;  2W82 A;  4KIB A;  4BQQ A;  2GWR A;  5F27 A;  3CP8 A;  2HNH A;  3EDP A;  1IN4 A;  4G9Y A;  5DUK A;  2N8G A;  4EAT A;  3GTP J;  3K1P A;  2JUG A;  1LKX A;  4FE7 A;  3F3X A;  1R49 A;  1UCR A;  2M8G X;  3KYL A;  1BR2 A;  3S1R J;  4II2 A;  3G2B A;  4R1H A;  4BGD A;  3QYF A;  2W84 A;  3GBG A;  2BYV E;  1R00 A;  2KZG A;  2K3F A;  3PUB A;  4ON0 A;  1C0W A;  1BIA A;  2B9S A;  2EBI A;  4RDU A;  1TW2 A;  2PI0 A;  1DUX C;  1HQC A;  3D0S A;  3IH2 A;  4MQ9 F;  2FBI A;  3VSL A;  4ANJ A;  3HKZ A;  4AID A;  3PQJ A;  3Q9S A;  2EA2 A;  4D1Q A;  1FLI A;  2COM A;  4BYY A;  5L3G A;  1Z3Y A;  1U5T A;  3I55 I;  5B1B H;  4D7M A;  1XPX A;  1S29 A;  3WOD F;  4IOC F;  3OYA A;  3KP4 A;  3ZMV A;  2LF7 A;  1PJR A;  3BG5 A;  4G6T B;  3L00 A;  1KYZ A;  3ZQC A;  3M8E A;  4IZZ A;  4IVN A;  4LK0 F;  4M3F A;  3HRM A;  1OLT A;  5ILS A;  2DOE A;  1SMY F;  4Y3O A;  1LVK A;  1BR4 A;  4C2M J;  4WK8 F;  2B7E A;  4OIR F;  2VOO A;  3MKY B;  4IXA A;  2IPQ X;  3OS0 A;  1N25 A;  5F1J A;  1AKH A;  1ZEL A;  5M3M J;  3SFZ A;  4XLC A;  3GCM A;  4RM2 A;  3OYE A;  3W2A A;  3LQQ A;  3FX3 A;  1MJB A;  2EIL H;  2JSP A;  2CMP A;  3KPH A;  4D7N A;  2QSG X;  1HSJ A;  4ASN A;  5D8L B;  5E3M A;  4BDZ A;  3HGY A;  2ZME C;  4YIF A;  2YX4 A;  4G7Z F;  3Q3S A;  5E17 F;  5ICG A;  5HNH A;  1IC8 A;  2COB A;  4PFO A;  4YEL A;  3S32 A;  2FBK A;  2D45 A;  2V79 A;  1TNS A;  5L3C A;  4AIJ A;  4IHX A;  4PJJ A;  2DQR A;  1GV2 A;  1ZGA A;  2EK5 A;  1NH3 A;  1ETQ A;  3K4K A;  1JT6 A;  4XRM A;  2UUZ A;  3T1B A;  3GZ6 A;  1O4X A;  4BJ6 C;  3K9T A;  1BIB A;  4EEF G;  2OCC H;  3RKY A;  1QZZ A;  5J1U A;  4E7H A;  3CF5 F;  3I59 A;  1RRJ A;  2L7M P;  1YLF A;  4F3Q A;  5F04 A;  2STW A;  2K4B A;  5CPR B;  1XSX A;  1OYW A;  3QP5 A;  4KIS A;  1I39 A;  1HDP A;  4EMS A;  1J75 A;  5ICE A;  3E6C C;  5K5Q A;  4XL9 A;  5FRO A;  2QVO A;  5AIP A;  3G1M A;  1KGS A;  4ZDL A;  1Y0N A;  5GAD J;  1O3Q A;  4PDK A;  4CCM A;  1I5Z A;  3M1C A;  4CCJ A;  2HDD A;  2MSY A;  5JLW A;  3KP6 A;  2CW8 A;  2ZME A;  3H5A A;  3BJO A;  4U0W A;  3RKW A;  3F6O A;  5EYR A;  3RZO J;  2CSO A;  1H9T A;  3I54 A;  4IKF A;  1D5Y A;  1LFP A;  1G4D A;  1OIS A;  3BC8 A;  3ZGK A;  1SFO J;  1IRG A;  2RV8 A;  2BW3 B;  3LSP A;  1IJW C;  2DFH A;  3ZMZ A;  2GQQ A;  1EKE A;  3FKJ A;  1ONV A;  2V26 A;  4L9N A;  3CMY A;  3IHU A;  3J7Y J;  3WTV C;  1EV7 A;  3OOU A;  1TWH J;  2FXA A;  1D1C A;  3U21 A;  2XSD C;  3CCY A;  1BOA A;  3CJT B;  5EJC A;  1VQK I;  2RKH A;  4I6Z A;  2WY8 Q;  3L9F A;  4JX6 A;  2L01 A;  2FML A;  4BXU A;  3SJM A;  2M4G A;  5DDG A;  3K70 D;  2DYR H;  2QBY B;  4GRI A;  1O7L A;  1X4O A;  2R7V A;  2XKO A;  3VYR B;  1QGP A;  4CZZ A;  3S3M A;  1LQ1 A;  2X51 A;  3KP5 A;  1J0R A;  1QVT A;  2J5O A;  1WJF A;  4UUS A;  1PYV A;  2XAQ A;  2CQX A;  3VWB A;  4BEH A;  2R0Q C;  5L3D A;  1W7P D;  2H6C A;  4FX4 A;  1ETO A;  3GTJ J;  3ECO A;  2O03 A;  2HDC A;  3LA7 A;  1HDD C;  2DT6 A;  2EQR A;  1R7J A;  3GYH X;  3QU6 A;  2QZ8 A;  2HPM A;  1Z7L A;  2EIM H;  4IQJ A;  1OYI A;  2EIJ H;  3MCZ A;  5IP7 J;  3L2Q A;  1LE8 B;  4HF2 A;  1ZK8 A;  5CYV A;  3D1N I;  2HYF A;  4G6Q A;  2P5L C;  5DCM A;  1R36 A;  2E5Z A;  3ABU A;  2XRN A;  1OCP A;  4LMY A;  5DS9 A;  4BE1 A;  4BH9 A;  3TL4 X;  2BVM A;  4MTD A;  1B9N A;  4G7O F;  3SHF A;  4A0Z A;  3BWG A;  5GAE J;  5DM7 F;  3JRD A;  2HFH A;  1A35 A;  4L5I A;  4UVA A;  2AQF A;  3H5R A;  4PK4 A;  3DF8 A;  1N78 A;  2DA1 A;  1LVA A;  1L0O C;  3F0C A;  1Z6R A;  3VPR A;  1YTY A;  2OCE A;  4XMY A;  1W36 C;  1X19 A;  2WY7 Q;  2VI6 A;  4YII A;  1VFC A;  2E36 A;  5J6X A;  1O3S A;  1PUE E;  3OOP A;  1YOV B;  2MH9 A;  3FBN B;  3R0J A;  4C2T A;  4BU2 A;  1EJ9 A;  2WB1 N;  1Z91 A;  4AD9 A;  2H8R A;  4M3D A;  2E5N A;  1SFE A;  4HPQ A;  1TQM A;  5JLX A;  3SYT A;  2RGV A;  4KT6 A;  1GUU A;  4CCO A;  2R4G A;  4IRI A;  2EV0 A;  1S7E A;  2QQ8 A;  4IHV A;  4HV6 A;  1UG0 A;  1ZKG A;  1Z05 A;  3NEU A;  4IEJ A;  1HKQ A;  2DN0 A;  3I59 B;  3S3O A;  3F22 A;  2EZI A;  3LSJ A;  1RPW A;  4Y52 J;  1ZLJ A;  1MBF A;  3MZY A;  3KX2 A;  1MSF C;  1S8N A;  3EET A;  3F8C A;  2ZJQ F;  3CCR I;  2FU4 A;  2OTL I;  3I4P A;  1X2N A;  2VKH A;  4BXX J;  3WTX C;  4ENK A;  4HNT A;  4FCY A;  2CV1 A;  1JKR C;  2NOJ B;  2P8T A;  2FRH A;  3VOD A;  2DU9 A;  1U8R A;  2YR2 A;  2MC4 A;  4XR6 A;  3DPT A;  1B59 A;  1XX5 A;  4ZJZ A;  2NVU B;  2RDP A;  4O6J A;  5KK1 A;  2GIV A;  5H2F C;  3RPU A;  4CH7 A;  1DP3 A;  1U2W A;  4QPO A;  3BPV A;  3UR3 C;  5FKO A;  2VL8 A;  2QKM B;  3H92 A;  4CSW A;  3GW2 A;  4XON A;  4BAC A;  5E8I A;  2LKP A;  2PMU A;  2X6W A;  1QZE A;  2CS3 A;  4KIC A;  4UUT A;  3CC4 I;  1Z7U A;  2RRE A;  2WAQ A;  3D5S C;  2HOS A;  1LEA A;  5EEG A;  1ZGJ A;  3KCC A;  4C2U A;  2KRC A;  3CQZ J;  3PFY A;  1T08 B;  2KRH A;  2FSW A;  3I71 A;  2QSF X;  6PAX A;  3F72 A;  4D5C A;  5J4Y A;  1VQ5 I;  4EM1 A;  2VBZ A;  3ZQI A;  5J47 A;  1VQL I;  1VQ9 I;  1YE9 A;  4A5M A;  3M8J A;  1E2X A;  4RA2 A;  4C30 A;  3JRI A;  1A6Q A;  2JN6 A;  3RQI A;  1LFU P;  3ZRG A;  4XM3 A;  4DYC A;  1P4X A;  2FBH A;  2X85 A;  1QA6 A;  2I5U A;  1SD6 A;  3BR5 A;  4GFB A;  2FX0 A;  3DU6 A;  5IT9 K;  2XGC A;  2EFW A;  1V5E A;  2QF7 A;  1QO0 D;  1G3S A;  2L9V A;  2ZXJ A;  1OYY A;  2DO7 A;  1LEB A;  1J5Y A;  1MMN A;  3LMM A;  3LSK A;  2VIX A;  1ZR2 A;  5EG0 A;  2DA3 A;  4XOR A;  2E71 A;  4M73 A;  1O3T A;  1FSH A;  2H1L A;  1EH8 A;  3LSI A;  2K86 A;  1K6O A;  1VQP I;  2XAH A;  1JGS A;  3K1M A;  2DA6 A;  1DQU A;  1H88 C;  4XRS A;  2HKO A;  5HLI A;  3A2K A;  3GTM J;  3SEQ A;  4A6D A;  1OMI A;  1OQY A;  3IL2 A;  2MFZ A;  4EVI A;  2XUB A;  2B0L A;  3GTQ J;  3KP2 A;  2WC2 A;  4E7Z A;  2EV5 A;  5E3O A;  3IV5 A;  3CDI A;  4P96 A;  3AKZ A;  2P7V B;  4A3I J;  1UHS A;  5TGT A;  1WHU A;  3DKY A;  2M0M A;  2X1D A;  3LWF A;  4Y15 A;  3U2R A;  5C4J J;  2AXL A;  3QOD A;  1BJZ A;  3L2C A;  1SAN A;  3A4C A;  3D5R C;  2IS1 A;  2CYY A;  1TQI A;  3TDZ C;  4I99 C;  5F64 A;  2XV4 S;  3E5X A;  3MVP A;  1Y56 A;  2QWW A;  1I27 A;  2UZK A;  3QAH A;  2V1U A;  3RJP A;  3WTZ A;  1X1D A;  1DPR A;  2NVY J;  4UUV A;  3HRS A;  2NVT J;  4WWC A;  1XGN A;  1X58 A;  1YG2 A;  2WWY A;  5BPD A;  3CCU I;  4XN0 A;  4IF4 A;  1FJL A;  5HNF A;  5EEA A;  1Y39 A;  1GVD A;  4Q47 A;  5D4R A;  3O6B B;  4A3K J;  2UV1 A;  4U87 A;  3HC7 A;  3FXJ A;  1W7P A;  3KYD B;  2FOW A;  5JFR A;  3JSP A;  1I6X A;  2K9M A;  5DEQ A;  1VQ6 I;  1WJD A;  1KQ8 A;  2HKX A;  1KQ9 A;  2HWV A;  5H6Q A;  1K4T A;  3S2H J;  1CF7 B;  2KPM A;  1ZN2 A;  2HVQ A;  1RIO H;  2QQA A;  4ZZD A;  5K5R A;  4OWR B;  2JSC A;  2CQQ A;  3F8M A;  1QHG A;  4B3X A;  5LHH A;  3G71 I;  3F21 A;  4LB5 A;  1FZP B;  3H9G A;  1AKH B;  3T8T A;  2WTE A;  3I53 A;  2A61 A;  4GXO A;  2VQL A;  2L7F P;  2K3P A;  1TLH B;  2F4M B;  4BE0 A;  5FFZ A;  1A31 A;  2W1O A;  4BHC A;  2ESN A;  2ZNY A;  4AU7 A;  2QEN A;  2K4J A;  4XLE A;  5EGO A;  1FSE A;  1ZAR A;  2OV7 A;  3WGH A;  5CVR A;  1GVJ A;  3IP4 B;  4DOZ A;  1P2F A;  5EEH A;  2MLG A;  1IUF A;  3CDL A;  5K5O A;  3DFG A;  2W00 A;  1PP8 F;  1USS A;  5EF6 A;  2Y9Z A;  4A6E A;  5M3F J;  1MNE A;  3U9G A;  4E7I A;  1BJA A;  5LHG A;  3ABT A;  1LB2 A;  3UKG A;  1ZG5 A;  1SAU A;  5E8G A;  2OJE D;  2OQR A;  3FHN A;  4UB6 C;  1T33 A;  3ABM H;  4UV8 A;  1LDJ A;  2HZT A;  1VZ0 A;  3SEZ A;  3DEU A;  2FQ3 A;  2OAZ A;  2H6B A;  4W1U A;  3HRT A;  3QPS A;  1WCM J;  3J7Z I;  2WV1 A;  3ASO H;  4LG0 A;  3FMS A;  3WTY C;  3CMM A;  3CUQ B;  3P9K A;  1FMW A;  4A0X A;  2ACJ A;  3CD6 I;  3KP7 A;  3I4M J;  3F8B A;  5J1R A;  5FO5 A;  4LG0 B;  2NS8 A;  3O8H A;  2XAU A;  4KIF A;  3IKT A;  4AYB N;  3E7L A;  2L7K A;  2UXN A;  1HST A;  3WHC A;  4EJT A;  3GFL A;  3IUO A;  4IPA A;  2EIN H;  4XKV A;  3J81 K;  4V19 K;  4EJO A;  5FRM A;  2XIG A;  1FT9 A;  3OIP A;  4MGR A;  1JI8 A;  2BY3 A;  1TQP A;  3M9A A;  4B43 A;  1HCR A;  3BZC A;  5FKN A;  1W36 D;  4LG3 A;  3QYB A;  4JP0 A;  3B73 A;  1P4A A;  2E7W A;  1UFM A;  4P55 A;  2TCT A;  1VQ4 I;  2QGU A;  3N05 A;  2JQ7 A;  4HAM A;  2PMH A;  4M6X A;  1IRX A;  1MZB A;  4S05 A;  4MFD A;  2KZV A;  2VE9 A;  1IAW A;  3OYC A;  4WF2 A;  5LEJ A;  3ZMD A;  3MKZ A;  2KDZ A;  2X6X A;  2ZKZ A;  3K10 A;  2AXT C;  2XPW A;  3PSF A;  3MZH A;  3AL0 C;  5AON A;  4LIT A;  4IX7 A;  3BR2 A;  4AVZ A;  1E3H A;  2HQR A;  1MGT A;  4PJL A;  3MAJ A;  1Q1V A;  2ZFU A;  1SD7 A;  3BPX A;  4JX5 A;  1IXS B;  4CYC B;  2F4O B;  2HZD A;  3ELK A;  5EZG A;  3HYI A;  2KQR A;  2P0W A;  2KP6 A;  3CC2 I;  3ULQ B;  1MW7 A;  2A68 F;  3KEQ A;  3IRQ A;  2WB1 A;  4KUM A;  2R7D A;  3NWS A;  3HSE A;  3S2D J;  1NK2 P;  2L4A A;  3JAM Z;  2BZT A;  4DIQ A;  2DOF A;  2W57 A;  3S8P A;  1MMA A;  5F6F A;  3BG9 A;  4XID A;  1IF1 A;  3S2W A;  2LKS A;  3K1N A;  2KL4 A;  3PFI A;  4QSH A;  4WXD A;  1Y1V J;  3NRV A;  4CA0 A;  1Y6I A;  3HM5 A;  3CO6 C;  2NRA C;  3W3C A;  4XSX F;  5KCM A;  2TDX A;  2VON A;  1K4S A;  2V4J C;  1P92 A;  1DU0 A;  3OYM A;  2DLL A;  4IQ4 A;  3TP3 A;  2VOD A;  1LDK B;  1ZR4 A;  3MN2 A;  3MEX A;  1POG A;  4ZDO A;  4XBF A;  2JA5 J;  1XC5 A;  1MH3 A;  2F5V A;  1W4M A;  4M3B A;  1S5L C;  5F0C A;  5FLV A;  2LH9 A;  2RNG A;  3WGI A;  2AO9 A;  2AS5 F;  2L2O A;  4Y7N J;  2GOX B;  4ENN A;  2ZJP F;  2WAQ N;  4BBS J;  5F08 A;  1P7J A;  2HI3 A;  3G4S I;  2DA5 A;  3F8F A;  2DJN A;  2A5Y B;  3U1D A;  3M3Y J;  3S93 A;  3E6D A;  3GLL A;  4N9I A;  2ZXI A;  1V54 H;  1DGW Y;  2LBF A;  1BBY A;  3V7S A;  5LRS A;  2QKL B;  2JJ7 A;  5BMZ A;  2A6E F;  4LD5 A;  2QM3 A;  3H5N A;  1MNM C;  3QWL A;  1MBK A;  3TMO A;  4AM3 A;  4M6Y A;  1T56 A;  1FWZ A;  2JUC A;  2LC2 A;  3MKW B;  1O57 A;  4A3D J;  5FKK A;  4EJV A;  2M9H A;  5HVQ C;  2YPR A;  1T98 A;  1BC8 C;  3TO9 A;  1FYK A;  3Q0U A;  1S6L A;  1R5H A;  3BJ6 A;  1KYW A;  1FC3 A;  2WAF A;  1G59 A;  3DBL B;  2VXD A;  4IHS A;  1KQ0 A;  3ECH A;  1UHW A;  1SVL A;  5IPA A;  3P7N A;  4F92 B;  3FXQ A;  1W5C C;  4DJA A;  5J8F A;  1STZ A;  4Z6Y A;  3JRA A;  3LOC A;  2FEZ A;  3ZMT A;  4ZZL A;  2XPV A;  2DT5 A;  4LFU A;  5FD6 A;  1FX7 A;  2Z16 A;  3BT9 A;  4BXF A;  4UNO A;  5F1R A;  3KYC B;  3RPQ A;  3K4B A;  4F52 A;  1T8I A;  3RCO A;  1VND A;  2GZW A;  1P9Q C;  1AHD P;  1RC9 A;  4N4N B;  4UB8 C;  2CUZ A;  1WJ5 A;  5L3B A;  1Z21 A;  5LD2 C;  3FZV A;  1MMS A;  5E3L A;  2M7A A;  4G94 A;  1K78 A;  1JKO C;  1O3R A;  1YW7 A;  1N77 A;  2ZBK A;  1F1Z A;  4A2U A;  3W2V A;  3W6J B;  1FMV A;  2XPU A;  4G8X A;  3WTU C;  1SFU A;  3PJR A;  5FGM A;  1RKT A;  1WKM A;  2GA1 A;  2IA1 A;  1QHH D;  2LR8 A;  2DBB A;  1JUM A;  2G7U A;  2ZXH A;  3ONQ A;  2Z9O A;  4XN3 A;  1X3Z B;  5KAF C;  3CLO A;  2DXI A;  3K0L A;  2DMQ A;  2HTJ A;  3H9J A;  3TOB A;  4PJN A;  3VYS B;  1BI1 A;  2WAE A;  2RVC A;  2EV6 A;  3I56 I;  4MEY F;  4MLO A;  1WI3 A;  4HLX A;  4CYC A;  3OYI A;  3FHZ A;  2NVX J;  1QBJ A;  5FRN A;  1VTN C;  3WE2 A;  4CUG A;  4ZYA A;  1MDM A;  1J09 A;  3BG6 A;  3LAP A;  4QLC U;  2MA3 A;  2LBF B;  1ITY A;  3TP0 A;  5IOZ A;  4ENM A;  3PO2 J;  4LLL A;  1U9O A;  3DEE A;  3WHB A;  3JSO A;  4EM0 B;  1FOX A;  1TNT A;  2RAE A;  2XF7 A;  2R7X A;  4HG2 A;  2XAF A;  3HL2 A;  4AUX A;  1YHQ I;  2V1X A;  2BHY A;  1Z0X A;  5IYC J;  4KN4 X;  3VDX A;  4M71 A;  2H09 A;  1REP C;  2NOG A;  4ZH4 F;  2E1O A;  1IN7 A;  3ZMS A;  2NNY A;  2EA4 A;  4GDF A;  1HW1 A;  4BAY A;  5KHD A;  5DUI A;  4RMN A;  5JHF A;  1I50 J;  2DFE A;  3HB9 A;  3ZN1 A;  1TTY A;  1B8I A;  1S7A A;  2L0K A;  5DM6 F;  2QUF A;  1TP4 A;  1UEL B;  3W6K B;  3HOX J;  1MD0 A;  2OZ6 A;  2IA2 A;  3FK6 A;  2GAU A;  4A3E J;  2W25 A;  5HLH A;  2LMD A;  4BHP A;  2RNJ A;  4Z2Y A;  1BA5 A;  1KA8 A;  3MFK A;  3E97 A;  3K70 C;  4ZC3 A;  4OMY A;  2M7B A;  2CUF A;  2PJR A;  4A3B J;  3TW6 A;  2CU7 A;  5DV5 A;  4B09 A;  1VQM I;  2LDU A;  3WG7 H;  3HOV J;  2M0C A;  2XGD A;  1V4R A;  2G9W A;  2LSO A;  3SZG A;  1WPK A;  3FXL A;  2IJL A;  3NQO A;  3J80 Z;  1FYM A;  2JA6 J;  1XTA A;  4UXN A;  1FY7 A;  3CES A;  1UG2 A;  2H1K A;  3LSG A;  2K9L A;  1MJ9 A;  2LRE A;  2VT2 A;  3H0G J;  4XSZ F;  4E6K G;  3QOP A;  1S72 I;  4N4O B;  4XLN F;  3VYT B;  1ODD A;  1QVU A;  4JBA A;  2CRG A;  2XDV A;  2DMT A;  4RLQ A;  4E4H A;  3RYR A;  4KIT B;  1HBX G;  3KP3 A;  1V3F A;  2KIS A;  2W48 A;  1RKW A;  5AIQ A;  4LIU A;  3T5X A;  3ZOB A;  5E3N A;  3LA3 A;  3LSR A;  5K7F A;  3GTK J;  4B4C A;  2QLZ A;  5ERI A;  4H4K C;  5BS6 A;  2GIZ A;  1RUO A;  3WTS C;  4FX0 A;  5J1Y A;  4FET A;  3RTR A;  3CC7 I;  4BS9 A;  2V9K A;  1GLN A;  3PSI A;  3I9V 2;  3OYB A;  3DLL F;  2OA4 A;  1HLV A;  1HA8 A;  2VJJ A;  3LAJ A;  1OCZ H;  2L7Z A;  1IZ1 A;  4B47 A;  1FBS A;  2HS5 A;  3I5U A;  1T2K A;  2EB7 A;  3V8L A;  4ABZ A;  4IO9 F;  3HPG A;  1XG1 A;  2Z2S B;  3CMA I;  2DTR A;  2BXY A;  2KMU A;  4OIN F;  2DK5 A;  1U9N A;  4U0V A;  2BEO A;  2XRO A;  2KRF A;  3K7A J;  2ZJ2 A;  4CCL A;  2JA2 A;  3JRG A;  1B9M A;  2R7F A;  1OR7 C;  1UB9 A;  4YG2 F;  4HNV A;  2R92 J;  3IC7 A;  2O7O A;  2DFI A;  2OUM A;  3QP6 A;  5CJ9 A;  4EM2 A;  3GWZ A;  2YSR A;  4CXF A;  3CCS I;  3RZD J;  5EGO B;  1RET A;  2FQ4 A;  3EYI A;  4IHW A;  3HSF A;  1ZRC A;  2DPU A;  1PVE A;  5IY5 H;  3TW7 A;  4I76 A;  4MEX F;  2F48 A;  2DPD A;  1HW5 A;  4AIH A;  4ZTF A;  2KIU A;  3TKY A;  4YFN F;  1QU3 A;  3SZP A;  1YFH A;  4GCV A;  1DPU A;  4EGZ A;  5FLX K;  1B8I B;  4U0Y A;  1KU3 A;  1P7I A;  3HZJ A;  3BCA A;  4KIG A;  2WV0 A;  1WQ2 A;  4Y13 A;  3OSG A;  2NS0 A;  2HR3 A;  2EFN A;  4XRF A;  1QQI A;  1U6G A;  3E0J B;  3A0B C;  3WGG A;  2ELH A;  3S1M J;  5GP9 A;  2JA8 J;  1A6I A;  1ETY A;  3CCQ I;  1AA7 A;  2NAZ A;  3H36 A;  3OV8 A;  2XHK A;  1EF4 A;  4GYI A;  3W6V A;  2H27 A;  4F93 B;  3GFJ A;  4L9J A;  3JTH A;  4KT5 C;  3L2U A;  5J40 A;  2X6O A;  1IG7 A;  1R71 A;  2CO5 A;  2XAJ A;  2HVS A;  1YIO A;  4OAZ A;  3GTO J;  3HUG B;  2VBX A;  4Y4R A;  4PFP A;  2XAS A;  1JXS A;  2V1N A;  5CVV A;  1W0U A;  5FB2 A;  1ZGW A;  1H9G A;  3CZ6 A;  2LLK A;  2HDW A;  1NG7 A;  4NUB A;  4NHJ A;  2CUJ A;  4OIO F;  4J19 A;  5LGT A;  2FJ1 A;  9ANT A;  3C3W A;  4MO7 A;  4BBR J;  1XMA A;  2GLO A;  1GV5 A;  4KYW A;  1VQN I;  4RM3 A;  1ON1 A;  4U7D A;  3HJE A;  3OS1 A;  3RI4 A;  2DK8 A;  3ERE D;  3H35 A;  2VC0 A;  2FOK A;  3Q0W A;  1MH4 A;  2G0E A;  4DW6 A;  4AYB A;  1ZG1 A;  1U8B A;  2ESH A;  3C1D A;  2VE8 A;  2EFQ A;  2R7Q A;  4S04 A;  1J2X A;  1W1W E;  2O61 A;  2E2H J;  1IO2 A;  5DD4 A;  4NDL A;  2LTP A;  1UMQ A;  2PN6 A;  4HX4 A;  1XCV A;  4RB2 C;  3ABK H;  5ICF A;  4N0B A;  5DCF A;  4A3J J;  3J7A Y;  1ETX A;  2HGC A;  2OQG A;  1D0Y A;  3OYJ A;  3GX4 X;  2JMW A;  4M9S A;  4Q5S F;  2GXG A;  4RGU A;  2VUM J;  4DYR A;  3FK7 A;  5E1Z B;  1VQO I;  1LDD A;  2XF6 A;  1WJB A;  1FPQ A;  1CGP A;  2HOT A;  4UHT A;  3OL3 A;  4RGS A;  5IT9 Z;  2KHM A;  4CDG A;  1JUS A;  4HRI A;  5LRR A;  3K4L A;  4C9Y A;  2PFB A;  4KFC A;  3CP2 A;  3I3L A;  3ERM A;  3IWZ A;  1F43 A;  4O3M A;  4EV0 A;  1GDT A;  1D1B A;  2KIF A;  1E3P A;  3EUH C;  1K61 A;  3DTI A;  3FF5 A;  2DW4 A;  1ETW A;  4XKW A;  5B5E C;  5CQE A;  3SXY A;  3L2R A;  2PG4 A;  3IAM 2;  4HYE A;  2FNP A;  4M3G A;  1KZH A;  3A0H C;  5LFA A;  5JVT A;  3CF2 A;  4X1E A;  4MNU A;  1JTX A;  4NQW A;  4ENJ A;  3DU5 A;  1TW3 A;  5LHI A;  2X1C A;  1FIA A;  5KAI C;  4LIV A;  3HOS A;  5HDK A;  1YW9 A;  3AL0 B;  2MH2 A;  3BQY A;  4FT8 A;  1KON A;  3B6A A;  3FXU A;  5HOO A;  3KFW X;  2O6G E;  3S3N A;  4L9T A;  1FEX A;  1BR1 A;  2EIK H;  2E7X A;  4ZTJ A;  4B8X A;  1WFX A;  3FIS A;  5IT3 A;  1BL0 A;  4B48 A;  3GEZ A;  4F55 A;  1FNN A;  2LP0 A;  3M1E A;  5HOD A;  1YJW I;  4G12 A;  2QEX I;  1VF9 A;  4E7K A;  3R60 A;  3GLX A;  2CFO A;  3H3U A;  4H0E A;  1PP7 U;  3ZQF A;  1T39 A;  2EWN A;  1T0F A;  5DYM A;  4CIC A;  3HHH A;  1FBU A;  2CW7 A;  3FM3 A;  3B02 A;  3OYD A;  2R5Z B;  4ZDP A;  3DKX A;  1BI2 A;  2A07 F;  2BXZ A;  2JWT A;  3ZCO A;  2D5V A;  3COA C;  5E1X A;  1X4P A;  4A93 J;  3M4O J;  3O8G A;  5D4S A;  1K6Y A;  3ZPL A;  1DDN A;  4F91 B;  2LVS A;  1YQA A;  3HOZ J;  3FKI J;  3HG9 A;  3A1Y A;  4OOI A;  2K5C A;  1PDN C;  3OL4 A;  1WVR A;  1SD5 A;  4KMU X;  3MWM A;  2ZFW A;  2OU2 A;  4QIW N;  3V7C A;  4KDP A;  1OCT C;  3TBI A;  4GYG A;  1XDS A;  2R7O A;  3OR1 C;  4TV7 A;  4HW0 A;  3A02 A;  2M87 A;  2YUS A;  3VOE A;  2VQH A;  1IV6 A;  3ZXS A;  1ZQ3 P;  2L3D A;  2K40 A;  4WXC A;  2GM4 A;  2P5V A;  1R22 A;  5C44 J;  5DCM B;  5E18 F;  4UVC A;  1QPI A;  1D8K A;  2Z99 A;  2DT7 B;  2R5Y A;  1R6R A;  4F7Z A;  2A6T A;  2O3F A;  1J59 A;  2DDA A;  1ZRF A;  3HIF A;  3HOU J;  3OR2 C;  5ICC A;  2F2E A;  3AG4 H;  4XOT A;  4DNC A;  3I0T A;  3LFK A;  4XLA A;  2HYJ A;  4CCN A;  1LE8 A;  2R5Z A;  2M2E A;  1W5T A;  3HTS B;  3E5U A;  1MND A;  3CJR B;  5F0F A;  1JUP A;  4MHG A;  2XC7 A;  3VFZ A;  3MZ8 A;  2CV2 A;  4HDV A;  1FTT A;  3LL7 A;  2M3A A;  3TGN A;  4A3M J;  4JYK A;  3RYP A;  4L5J A;  2ZCW A;  3DTE A;  3L1P A;  1R23 A;  3HUG A;  2DOD A;  4NC6 A;  3BTL A;  2DAO A;  4I98 B;  4CGZ A;  4BY1 J;  2H8W A;  2HU9 A;  2X6Y A;  4E7L A;  2CG4 A;  2QQ9 A;  2IAI A;  2IXS A;  1SVO A;  2OBP A;  3K4J A;  2FD5 A;  1BC7 C;  1LJ9 A;  2BY1 A;  1I3A A;  2JZY A;  5D5U B;  5FJ8 J;  5JR3 A;  2CH0 A;  4HNU A;  3WU0 A;  5HLT A;  1FYL A;  2JA7 J;  2VT3 A;  2AHQ A;  2ID3 A;  1W7P B;  4XIC A;  2O5R A;  4XLP F;  4A12 A;  5BNG A;  1BOB A;  2RN7 A;  3H1C A;  5HS8 A;  4Q4Z F;  3GZ5 A;  3RQ4 A;  2LOO A;  1VQ7 I;  3A01 A;  1JJ6 C;  5JHU A;  2XKP A;  1RR7 A;  1VI0 A;  4WXH A;  3JR9 A;  2V6C A;  2FA5 A;  2CQN A;  1U5T B;  3JRF A;  4A3L J;  1IUY A;  1MMD A;  5D5W B;  1D8J A;  3KLO A;  1YIJ I;  2M5W A;  4JK1 X;  1MMG A;  3QOE A;  2KIM A;  3BG3 A;  3ESW B;  2ZB9 A;  3DQV C;  1RR8 C;  2ZME B;  2F5C A;  1MBG A;  2KKO A;  1ZLK A;  2HQ5 A;  1WJC A;  2PEX A;  4DBQ A;  2HTS A;  4RGX A;  2ELJ A;  4OMZ A;  2CV0 A;  2LD5 A;  1UAA A;  3C2G A;  5IP6 A;  2JRT A;  3J81 Z;  3DKW A;  3BZK A;  4E7S A;  3OS2 A;  2PJR B;  1TWG J;  5B1A H;  1G3W A;  3ML6 A;  1G3Y A;  3QPH A;  4BY7 J;  3TED A;  2O8K A;  2D1V A;  2E2J J;  1UST A;  1R4N B;  3X2Q H;  2JPB A;  4XNF A;  2K02 A;  2Y31 A;  2VBY A;  4V2G A;  3OSF A;  2O8X A;  4HX7 A;  2DMU A;  3DXJ F;  1FP2 A;  4EQQ A;  1ZHF A;  4FE4 A;  2MYS A;  3GF2 A;  4B3A A;  3V8K A;  4UY8 I;  1XSD A;  2R7U A;  5ED4 A;  1IRF A;  2ECC A;  2W4S A;  3LSH A;  4HLY A;  2PJP A;  2GBY A;  4PJM A;  4B44 A;  2JK3 A;  3J7A O;  2HOE A;  1JTY A;  2CWE A;  5TJJ A;  2FUG 2;  3DPU A;  2DCE A;  2ICW G;  4C3J J;  2P5K A;  1VQ8 I;  5LGU A;  5F0H A;  1XD7 A;  2C6Y A;  3BCB A;  5EDN A;  1FIP A;  1WWX A;  2ZXW H;  4HBL A;  1AU7 A;  4BKX A;  2AQE A;  3HKZ N;  3WG9 A;  1S9H A;  4L0Z B;  1MBH A;  3D5L A;  3OY9 A;  4YFK F;  1V5F A;  1R58 A;  1TWA J;  4DGW B;  1SC7 A;  1SEU A;  2MLK A;  1MSE C;  3KET A;  1B72 A;  1OFC X;  1X2M A;  1SFX A;  2HXI A;  3OIO A;  3FXR A;  1F5T A;  3OIQ A;  2QSH X;  3PQK A;  2IT0 A;  2P6T A;  2VJI A;  1L3L A;  1SVM A;  2F5E A;  1R1U A;  2M30 A;  4U88 A;  1YIT I;  1Y0U A;  2M4K A;  1LUJ B;  4PGH A;  5CKT A;  3P5J A;  2K9S A;  2NNN A;  3PNV A;  3F8N A;  2XAG A;  3SDG A;  5GTH C;  1B6A A;  1GXQ A;  3DTK A;  3AG3 H;  2IA0 A;  3DLA A;  3L09 A;  3ZP5 A;  2QA4 I;  3IWF A;  2D2W A;  3RKQ A;  3EUH A;  1S3J A;  5GPA A;  2JVG A;  4BUP A;  4HX8 A;  1R4M B;  1TC3 C;  1ULY A;  4J01 A;  4YFX F;  3E1S A;  1I1S A;  3REO A;  4NC8 A;  3C2H A;  2F4I A;  2NXN B;  3BR6 A;  2QCO A;  4FAS D;  5E20 A;  4HQM A;  1Y1W J;  4M74 A;  2DJI A;  4RS8 A;  2L9R A;  1DGR M;  2K85 A;  1K7A A;  3QYE A;  2RC4 A;  1ZAO A;  4R8H A;  4RB1 A;  2IGK A;  2Q1Z B;  2Y9Y A;  3DCF A;  2GXB A;  1XGO A;  2YU9 J;  3GFM A;  2L9N A;  3M7G A;  3P9I A;  1OR7 A;  3HTU A;  2IEK A;  5IOY A;  3G73 A;  4I0A A;  3AAF A;  2XVC A;  2DA4 A;  1G3T A;  2DTZ A;  2E35 A;  2MD5 A;  1J9I A;  2KJB A;  4QTR A;  1XSV A;  1FOY A;  2NYX A;  2XSJ C;  3Q5F A;  2E1C A;  4ESB A;  2E1M C;  3FWE A;  2DQL A;  2BHZ A;  2PQ8 A;  1YJ9 I;  1APL C;  3N97 A;  1UZC A;  3SZT A;  2KLO A;  3MD2 A;  2BV6 A;  3LA2 A;  4M6V A;  2HEO A;  2I8D A;  1GHC A;  1SMT A;  3OYG A;  5D6F A;  2L02 A;  4BQA A;  4BQN A;  3QRF F;  2EPF A;  1YO5 C;  2Y48 A;  3C18 A;  2WAD A;  1RI7 A;  4EJW A;  2R3S A;  2E2I J;  2GXA A;  1RNL A;  4BEH B;  2MD0 A;  3ABL H;  5FFX A;  2XGX A;  1XGM A;  3CUQ A;  3CDH A;  3V8J A;  2ZO4 A;  4NC7 A;  3DPL C;  4E7J A;  4KJZ A;  1TZL A;  2E1M B;  1EH7 A;  3DWL E;  3IH4 A;  3NWT A;  4M72 A;  2VKE A;  2JT1 A;  2Y0S N;  3ZQL A;  3AG1 H;  4IRG A;  2E34 A;  5KNL A;  2WBM A;  3Q0V A;  2VPL A;  4I0B A;  4NQW B;  4CCK A;  1IDY A;  2VC1 A;  2ZSI B;  4FHT A;  2VN2 A;  1G6N A;  4EGY A;  1PUF A;  2NVQ J;  3FIW A;  2B63 J;  3BLY A;  3FMR A;  2X48 A;  2VOP A;  1FTZ A;  2VKD A;  5GAG J;  1BW5 A;  1FOW A;  4P5O A;  3M07 A;  3BRO A;  2ZJR F;  3OYH A;  4ZYH A;  1X3U A;  3CCM I;  1WZ2 A;  4PSX A;  2IGM A;  4MFE A;  2EJR A;  3ASN H;  4BJT A;  1R9T J;  3MKL A;  4LK1 F;  2JVH A;  2V7F A;  5CQG A;  2QBY A;  3E3V A;  2CFX A;  2VQG A;  3I4N J;  3ZQG A;  1M1E B;  3PIP F;  2KDO A;  4FTH A;  3R61 A;  4HST A;  2NS7 A;  4YRV A;  1X1A A;  2CJJ A;  3QU3 A;  2Q8K A;  3HPH A;  2EFO A;  3KZI C;  2VAS A;  1CF7 A;  1EH6 A;  2QQB A;  2A6H F;  4ESF A;  3A03 A;  2VQC A;  5B66 C;  2EFP A;  2XGE A;  4ITV A;  3FXM A;  1W5S A;  1W0T A;  3IKV A;  1ENH A;  2KIQ A;  1N75 A;  1RUN A;  3BTI A;  2E19 A;  2X1E A;  4OIP F;  1ETV A;  4MIM A;  2HOA A;  4LLN A;  5C4X J;  3OYK A;  1ON2 A;  2P7C B;  1B1B A;  3C7J A;  4J00 A;  2OPT A;  3ZN0 A;  2Z1D A;  2L9S A;  1Z1D A;  2V1D A;  1U0J A;  4HF0 A;  1ERD A;  2DYS H;  4CO8 A;  3CUO A;  3CME I;  1MBJ A;  1BN5 A;  3LST A;  4ZYG A;  3EUK L;  1NHA A;  2R7W A;  3HOT A;  1D0X A;  1FP1 D;  2ZNZ A;  4HOB A;  1JGG A;  1PUF B;  1RZ4 A;  2XB0 X;  5CVU A;  3GME A;  3NAU A;  2HQN A;  5LGN A;  2CW0 F;  1OJL A;  3S16 J;  1LNW A;  3G6E I;  2ID6 A;  2P6S A;  3EUA A;  4C3I J;  1Z67 A;  3BQZ A;  2QYO A;  3I64 A;  1XGS A;  3H0D A;  3GTL J;  1Z77 A;  1JT0 A;  1UJ8 A;  1X1B A;  4G7H F;  2MBF A;  1WH7 A;  5M5W J;  2A3S A;  3DBR B;  3KE2 A;  1F9N A;  3KEO A;  1BI0 A;  2BE5 F;  2K9N A;  3JRH A;  3DV8 A;  3JTG A;  2UWM A;  5E79 C;  1SAX A;  1MBE A;  4NBQ A;  4ESJ A;  3MMY B;  4HSR A;  1R5G A;  2IP2 A;  5HS7 A;  3AFH A;  3O3K A;  1J7K A;  2RQP A;  3BR1 A;  4XK4 A;  1F36 A;  1UHM A;  4RAY A;  3K6G A;  2Z5U A;  5BQT A;  3U1K A;  4L9V A;  5LEK A;  1IXC A;  4K2E A;  3OYF A;  3PM1 A;  4CHU A;  3FXK A;  1I1G A;  5HDN A;  1T38 A;  1AWC A;  3K4C A;  1T95 A;  2VJ5 A;  1EA3 A;  4Y17 A;  3HDD A;  1JKP C;  3L2V A;  3NAR A;  1D3Y A;  1QPM A;  3FXO A;  2PX9 A;  4GO1 A;  3TOA A;  4RLF A;  2V9P A;  1D0Z A;  4LJZ F;  5DTD A;  3B6C A;  4M9X A;  3Q9V A;  3L2W A;  4CZC A;  2W85 A;  2MAB A;  2Y75 A;  1P4W A;  3ZQH A;  5GAH J;  3GZN B;  5TRD A;  2IS6 A;  4A3F J;  2MW8 A;  3E5Q A;  3IH3 A;  3IRR A;  1H8A C;  2VKV A;  2OTJ I;  1T0F C;  4PJ0 C;  3KZZ A;  1JHH A;  2L4M A;  3WTW C;  1D1A A;  3R6S A;  4D9J A;  1YI2 I;  3BG7 A;  5CVI A;  3S17 J;  2IGO A;  3GUD A;  1U3E M;  1HKT A;  1YX3 A;  4Y33 A;  4YIR X;  3KLN A;  4A0Y A;  5FLM J;  4OU0 A;  4I01 A;  3SQN A;  2HQA A;  3VEP A;  5K1Y A;  4P9U A;  3BDD A;  1A04 A;  3WU2 C;  4MQV A;  1MIJ A;  2ETH A;  2IVM A;  2BOL A;  1BI3 A;  2E1N A;  1IW7 F;  2E60 A;  4FQG A;  1FOK A;  1KU7 A;  3K2Z A;  2GA2 A;  3FBI B;  3HSR A;  2ADU A;  2DFF A;  5K7H A;  3BTJ A;  4ZYE A;  1SFK A;  4U7B A;  2I10 A;  3BOQ A;  1HC8 A;  4B1R A;  4V2F A;  1JJ8 C;  2BBY A;  3RKX A;  3TO7 A;  4UV9 A;  5K7Z A;  4AWX B;  2IW5 A;  3K4N A;  5TIS C;  2O0Y A;  1QRY A;  3V4G A;  3CCE I;  3F6V A;  3HHG A;  4RB3 C;  5H6R A;  4PUS A;  1H89 C;  4XQF A;  1A36 A;  3DP7 A;  3ZMU A;  3CCJ I;  3V7R A;  3IAS 2;  3R0A A;  4C3H J;  1E0E A;  3LFU A;  5D5V B;  2CQ7 A;  4L0Y B;  3FM5 A;  3F9K A;  3DBH B;  1X3W B;  3BP8 A;  4A69 C;  2R7R A;  5LLQ A;  2Y69 H;  4RBO A;  2M34 A;  3JW4 A;  2HVR A;  4M3E A;  1IRZ A;  4OIQ F;  3OMY A;  3PNT A;  3TO6 A;  2H94 A;  1LFB A;  2UXX A;  2FMY A;  1G8X A;  3BJA A;  1B4A A;  1MJA A;  3ZR8 X;  3CTA A;  1HF0 A;  2L5Q A;  4FIS A;  4DYQ A;  3I58 A;  3LQR A;  3FDY A;  4D5F A;  4KMF A;  3RDI A;  3VB2 A;  3TDU C;  2DMN A;  2J5P A;  3E6B A;  1B72 B;  3GO5 A;  3CJQ B;  3DEW A;  2D1H A;  1F4K A;  2ME6 A;  4HEA 2;  1XMX A;  1OKR A;  2F6C A;  3HOW J;  2Q2E A;  5J8C A;  5EG0 B;  3VSK A;  3S15 J;  4WCG A;  2Z33 A;  3CJN A;  3ISP A;  2KT0 A;  1T6S A;  5D8K B;  1ZG3 A;  3KIO A;  1QNT A;  3JRE A;  3UNG C;  1Y8Q B;  5L3F A;  2ISZ A;  2F5F A;  2KJC A;  2HXO A;  2IBD A;  2A05 A;  4RGR A;  4KA4 A;  2M8E A;  5DD8 A;  4IL6 C;  4M9Z A;  1K78 B;  1IN8 A;  2ECB A;  3C2B A;  4D0P A;  4MTE A;  3T0Y A;  4A3C J;  3G1L A;  2BVL A;  4II3 A;  4P1W A;  4RAF A;  2W24 A;  1WRJ A;  2DDB A;  2A5W A;  4RAZ A;  1WH5 A;  4X0G A;  1I6H J;  5KVR A;  5JI6 A;  1OCO H;  4BQO A;  3OYL A;  2CGP A;  4QPQ A;  1WGX A;  4PZJ A;  1X1C A;  3GXO A;  2K9Q A;  2VBW A;  5IP9 J;  4DQ2 A;  4XLF A;  4JQF A;  1YW8 A;  2R93 J;  1DP7 P;  4LB6 B;  2VPR A;  2V6E A;  3M8F A;  1JE8 A;  1WSU A;  1MDM B;  3K4M A;  2VXZ A;  2LY2 A;  5HDG A;  3RIR A;  4PSW A;  1WJE A;  4JOM A;  5C3E J;  3BR0 A;  1U5T C;  2PMZ A;  5IYB J;  2LY1 A;  5LBQ A;  1IXR C;  1HXD A;  4I02 A;  4IJA A;  1BM9 A;  4NB5 A;  2LK2 A;  3E6M A;  2O9L A;  2CUE A;  1OPC A;  2R7T A;  4I7H A;  2IS2 A;  3CUQ C;  1FBQ A;  3W2W A;  1IGN A;  3H3V K;  3BR3 A;  2BY2 A;  3HBL A;  3PO3 J;  1DU6 A;  2Y0S A;  2F5D A;  2YS9 A;  2LFB A;  5L3E A;  2GOM A;  3KEY A;  2HYG D;  4EJU A;  5J4V A;  3H9Q A;  2FNA A;  3JCU C;  3OYN A;  4XKC A;  1ZYR F;  2WA0 A;  1GXP A;  5M5Y J;  4PCQ A;  2LG4 A;  2PMZ N;  2R5Y B;  4ZYD A;  1YRN A;  2VJ4 A;  1O7F A;  1RES A;  2P4W A;  2DMP A;  2X9D A;  2EZK A;  2X0L A;  3HOY J;  1WJA A;  1IN6 A;  1WI9 A;  3OWT A;  5JVG F;  3BY6 A;  3WU1 B;  3HEF A;  4L5E A;  4KNY A;  4ETS A;  4HA8 A;  3JAM K;  1NG6 A;  4HV5 A;  1S7O A;  2HPI A;  4N9H A;  2R7Z J;  2YU3 A;  3G3Z A;  2IRF G;  2OZU A;  4BNC A;  1BW6 A;  5A2Q K;  2M45 A;  3N4M A;  2Y30 A;  1YS7 A;  3PL8 A;  5B3S H;  1ZH5 A;  2ELK A;  1ORK A;  2VB6 A;  2Y0M A;  4X6A J;  4JX4 A;  5BPI A;  4HDU A;  3CCV I;  1E3O C;  3CLQ A;  3FMQ A;  4OAY A;  1XS9 A;  1XCB A;  2K27 A;  2K7L A;  4CYD A;  4BDY A;  4GGG A;  3WTT C;  3J80 K;  2VLA A;  2TRT A;  2MG4 A;  2Z3Y A;  4RAG A;  2JRM A;  2ISY A;  4A5N A;  1XB4 A;  2JTV A;  4IHT A;  1ACI A;  2STT A;  5FKL A;  1XDU A;  3K2A A;  2LF8 A;  4W97 A;  3JRC A;  4LLG F;  4I2O A;  3JRB A;  1XMK A;  5FD5 A;  3ZQQ A;  4S0H B;  5GPC A;  4AVP A;  1YX5 A;  3BTC A;  3RPU D;  1IV8 A;  1R5I D;  3CO7 C;  4DBR A;  2IS4 A;  4A3G J;  1KU2 A;  1P6R A;  3RSN A;  4DZJ A;  3VYU B;  2DOA A;  4HQE A;  1TT0 A;  1G2H A;  3PNY A;  3EYY A;  1ZRE A;  3KZY A;  4BL0 B;  4NNJ A;  2ZC2 A;  2LKX A;  3LNQ A;  4HZF A;  2YX7 A;  4DZP A;  2R7S A;  2Q0O A;  2IGN A;  1Z6T A;  4IRH A;  2DA2 A;  2XB5 A;  2RQQ A;  3CCL I;  2PBI A;  3L7W A;  1CQT A;  5IYD J;  2BGC A;  4BHB A;  1TT5 B; 
#chains in the Genus database with same CATH homology
 2DJI A;  1DGR M;  3LSI A;  1V5G A;  3QYE A;  2OUM A;  1DQU A;  2IGK A;  2Q1Z B;  3A2K A;  3SEQ A;  4XKB A;  2L9N A;  2MFZ A;  4E7Z A;  3AKZ A;  2ZSH B;  4ZTF A;  5TGT A;  3DKY A;  2M0M A;  2X1D A;  1QU3 A;  2XSJ C;  4BE2 A;  3QOD A;  2E1M C;  3A4C A;  3D5R C;  2IS1 A;  2KLO A;  3MD2 A;  2I8D A;  1Y56 A;  3BCA A;  3OYG A;  1X1D A;  4BQN A;  2W7N A;  3E0J B;  3SDB A;  3HXL A;  3V42 A;  2WAD A;  1AA7 A;  4R79 A;  4BEH B;  4F93 B;  2MD0 A;  4XN0 A;  3L2U A;  5HNF A;  4E7J A;  2HVS A;  4NC7 A;  4OAZ A;  3HUG B;  3DPL C;  2BW3 A;  2UV1 A;  1TZL A;  2E1M B;  4KJZ A;  4U87 A;  3HC7 A;  4PFP A;  3DWL E;  3NWT A;  4XLH A;  4Y4R A;  4XOP A;  2V1N A;  2K9M A;  3CZ6 A;  1WJD A;  5KNL A;  2WBM A;  2VPL A;  4NQW B;  2HDW A;  4CCK A;  2KPM A;  3EPZ A;  1NG7 A;  2HVQ A;  4NUB A;  2ZSI B;  4OWR B;  4YEJ A;  4BJ5 C;  2CUJ A;  1QHG A;  4B3X A;  3BLY A;  3H9G A;  2VKD A;  4P5O A;  2VQL A;  4RM3 A;  3OS1 A;  2K3P A;  3OYH A;  4BE0 A;  3H35 A;  2W1O A;  4PSX A;  2IGM A;  4AU7 A;  4XLE A;  4BJT A;  2OV7 A;  4AYB A;  2JVH A;  2V7F A;  3IP4 B;  2Q2E B;  5CQG A;  4DOZ A;  2XF5 A;  2LYC A;  2VQG A;  2R7Q A;  2W00 A;  2KDO A;  4HST A;  4YRV A;  1X1A A;  3LSM A;  1MNE A;  2OC6 A;  3HPH A;  4E7I A;  2VAS A;  1SAU A;  3FHN A;  1VZ0 A;  2VQC A;  3SEZ A;  2LRD A;  3J7A Y;  1Z3X A;  4ITV A;  1D0Y A;  2W82 A;  4BQQ A;  3OYJ A;  1N75 A;  3CMM A;  3CP8 A;  2HNH A;  1FMW A;  2X1E A;  2XF6 A;  1WJB A;  3OYK A;  3OL3 A;  4EAT A;  2KHM A;  2XAU A;  4HRI A;  2JUG A;  1LKX A;  4J00 A;  3K4L A;  4C9Y A;  2L7K A;  3KYL A;  1BR2 A;  2Z1D A;  2L9S A;  3CP2 A;  1U0J A;  3I3L A;  3G2B A;  4II2 A;  1ERD A;  1D1B A;  4BGD A;  3QYF A;  3GBG A;  3IUO A;  3EUH C;  3DTI A;  5FRM A;  4XKV A;  4XKW A;  3EUK L;  1JI8 A;  3OIP A;  5CQE A;  2R7W A;  3PUB A;  4B43 A;  3L2R A;  1D0X A;  3HOT A;  3IAM 2;  1W36 D;  5LFA A;  4LG3 A;  3CF2 A;  3QYB A;  3N05 A;  3DU5 A;  3EUA A;  1IRX A;  3VSL A;  4ANJ A;  3HKZ A;  2X1C A;  4LIV A;  3HOS A;  2KZV A;  3H0D A;  3AL0 B;  4D1Q A;  3OYC A;  1KON A;  5HOO A;  3MKZ A;  1X1B A;  1Z3Y A;  3S3N A;  2X6X A;  3K10 A;  1BR1 A;  4ZTJ A;  3OYA A;  1WFX A;  3PSF A;  4B48 A;  3AL0 C;  4F55 A;  2UWM A;  4LIT A;  1PJR A;  4IX7 A;  4AVZ A;  4G6T B;  4PJL A;  3MMY B;  4HSR A;  2ZFU A;  3AFH A;  2HZD A;  2KQR A;  2P0W A;  2KP6 A;  4E7K A;  4IZZ A;  1MW7 A;  2CFO A;  1OLT A;  3K6G A;  3OYF A;  2WB1 A;  4Y3O A;  1LVK A;  1BR4 A;  3NWS A;  3K4C A;  1T95 A;  2VJ5 A;  2CW7 A;  1EA3 A;  3MKY B;  3OS0 A;  3OYD A;  3L2V A;  4ZDP A;  4DIQ A;  1ZEL A;  3DKX A;  4RLF A;  3S8P A;  1D0Z A;  1MMA A;  4XLC A;  3ZCO A;  3L2W A;  4CZC A;  4RM2 A;  2MAB A;  3OYE A;  2KL4 A;  3W2A A;  1X4P A;  2IS6 A;  1K6Y A;  2JSP A;  2CMP A;  4CA0 A;  4F91 B;  1T0F C;  1Y6I A;  4BDZ A;  3W3C A;  3HG9 A;  5KCM A;  3A1Y A;  1D1A A;  4D9J A;  3BG7 A;  2IGO A;  2V4J C;  5HNH A;  2K5C A;  3OL4 A;  1YX3 A;  4PFO A;  4YEL A;  4Y33 A;  3S32 A;  3OYM A;  4IQ4 A;  1LDK B;  2HQA A;  4PJJ A;  4ZDO A;  3TBI A;  2F5V A;  2R7O A;  3OR1 C;  2BOL A;  3K4K A;  2LH9 A;  2E60 A;  2RNG A;  2UUZ A;  2VQH A;  2L2O A;  3FBI B;  4BJ6 C;  2GOX B;  3ZXS A;  1SFK A;  4U7B A;  4E7H A;  4F3Q A;  5CPR B;  2DT7 B;  3K4N A;  3S93 A;  4KIS A;  2ZXI A;  1DGW Y;  1R6R A;  2LBF A;  4PUS A;  2A6T A;  4XL9 A;  5FRO A;  2QKL B;  4XQF A;  3H5N A;  3OR2 C;  4ZDL A;  3TMO A;  4CCM A;  3IAS 2;  3M1C A;  4XOT A;  4CCJ A;  1E0E A;  2LC2 A;  3LFU A;  4XLA A;  3MKW B;  4CCN A;  2CW8 A;  3H5A A;  3F9K A;  1MND A;  3CJR B;  5HVQ C;  2R7R A;  2XC7 A;  4IKF A;  2CV2 A;  2HVR A;  3LL7 A;  2M3A A;  3OMY A;  1LFP A;  3PNT A;  1G59 A;  2WAF A;  3BC8 A;  3ZGK A;  2VXD A;  3DTE A;  1G8X A;  2BW3 B;  4F92 B;  3ZR8 X;  4DJA A;  3FKJ A;  2HU9 A;  2X6Y A;  4E7L A;  2L5Q A;  2V26 A;  2IXS A;  3FDY A;  3OOU A;  3U21 A;  1D1C A;  3K4J A;  2Z16 A;  4BXF A;  2CH0 A;  3CJQ B;  4HNU A;  5HLT A;  2WY8 Q;  3K4B A;  4HEA 2;  4F52 A;  2M4G A;  2O5R A;  2F6C A;  3K70 D;  2R7V A;  4GRI A;  1X4O A;  3RCO A;  1BOB A;  3VSK A;  3VYR B;  1P9Q C;  4N4N B;  3RQ4 A;  2LOO A;  2CUZ A;  1WJ5 A;  3S3M A;  1Z21 A;  2X51 A;  5LD2 C;  1WJF A;  2M7A A;  1PYV A;  3UNG C;  3VWB A;  4BEH A;  1N77 A;  3W2V A;  1FMV A;  3PJR A;  1MMD A;  1QHH D;  2DT6 A;  2BVL A;  2ZXH A;  3ONQ A;  4II3 A;  4P1W A;  4XN3 A;  2A5W A;  1MMG A;  2HPM A;  1Z7L A;  3QOE A;  2DXI A;  4X0G A;  4IQJ A;  3H9J A;  4PJN A;  3VYS B;  2WAE A;  3DQV C;  4BQO A;  3L2Q A;  4MLO A;  3OYL A;  4QPQ A;  3OYI A;  1X1C A;  1WJC A;  5FRN A;  4DBQ A;  4XLF A;  2ELJ A;  2E5Z A;  2CV0 A;  4CUG A;  4JQF A;  4ZYA A;  1UAA A;  4BE1 A;  1J09 A;  3BG6 A;  3TL4 X;  2BVM A;  3C2G A;  4E7S A;  2V6E A;  3OS2 A;  2PJR B;  2LBF B;  3DEE A;  3K4M A;  2VXZ A;  2LY2 A;  4PSW A;  2AQF A;  1WJE A;  4JOM A;  3H5R A;  4PK4 A;  2XF7 A;  1N78 A;  4XNF A;  2PMZ A;  2R7X A;  4HG2 A;  2LY1 A;  3HL2 A;  4XMY A;  3VDX A;  1X19 A;  2MYS A;  1W36 C;  2WY7 Q;  2R7U A;  2R7T A;  2IS2 A;  3W2W A;  3FBN B;  2Y0S A;  4C2T A;  2W4S A;  3LSH A;  4BU2 A;  5KHD A;  2GOM A;  3KEY A;  4RMN A;  3H9Q A;  4PJM A;  4B44 A;  5JHF A;  3OYN A;  2E5N A;  4XKC A;  4HPQ A;  2WA0 A;  3SYT A;  4KT6 A;  2FUG 2;  3DPU A;  2LG4 A;  2DCE A;  4CCO A;  2R4G A;  1UEL B;  2VJ4 A;  1UG0 A;  3BCB A;  3S3O A;  1WJA A;  2AQE A;  3OWT A;  3K70 C;  4ZC3 A;  2M7B A;  3KX2 A;  1S9H A;  2PJR A;  3D5L A;  1NG6 A;  3OY9 A;  2VKH A;  1V5F A;  4DGW B;  2HPI A;  4HNT A;  2CV1 A;  3SZG A;  2NOJ B;  4XR6 A;  2MC4 A;  3DPT A;  3PL8 A;  4ZJZ A;  3CES A;  3OIQ A;  3LSG A;  2VB6 A;  2K9L A;  2LRE A;  2VJI A;  4CH7 A;  1DP3 A;  4QPO A;  3UR3 C;  4E6K G;  2VL8 A;  2QKM B;  4N4O B;  3VYT B;  4CSW A;  2XDV A;  2M4K A;  4XON A;  4BAC A;  4OAY A;  4RLQ A;  5CKT A;  4E4H A;  4KIT B;  2X6W A;  2CS3 A;  4BDY A;  4LIU A;  2VLA A;  2RRE A;  2WAQ A;  3PNV A;  3D5S C;  4H4K C;  4C2U A;  2KRC A;  3PFY A;  4FET A;  3RTR A;  2KRH A;  4BS9 A;  3DTK A;  2V9K A;  1GLN A;  3PSI A;  3I9V 2;  3OYB A;  3DLA A;  1HA8 A;  2VJJ A;  1YE9 A;  3M8J A;  3ZQQ A;  4C30 A;  1YX5 A;  3RPU D;  2IS4 A;  4DBR A;  3ZRG A;  4B47 A;  2JVG A;  4BUP A;  3RSN A;  4XM3 A;  3VYU B;  2DOA A;  2X85 A;  1TT0 A;  3HPG A;  3PNY A;  2Z2S B;  4J01 A;  2KMU A;  3DU6 A;  3E1S A;  4BL0 B;  1V5E A;  4NNJ A;  4NC8 A;  3C2H A;  2F4I A;  2R7S A;  2IGN A;  1MMN A;  3LMM A;  3LSK A;  4FAS D;  4CCL A;  2JA2 A;  2VIX A;  2RQQ A;  1OR7 C;  4XOR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...