1WJNA

Solution structure of the c-terminal ubiquitin-like domain of mouse tubulin-specific chaperone e
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
97
structure length
97
Chain Sequence
GSSGSSGQLLTLKIKCSNQPERQILEKQLPDSMTVQKVKGLLSRLLKVPVSELLLSYESSKMPGREIELENDLQPLQFYSVENGDCLLVRWSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the C-terminal ubiquitin-like domain of mouse tubulin-specific chaperone e
rcsb
source organism Mus musculus
molecule tags Chaperone
molecule keywords Tubulin-folding protein TBCE
total genus 15
structure length 97
sequence length 97
ec nomenclature
pdb deposition date 2004-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14560 Ubiquitin_2 Ubiquitin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1wjnA00
2KJHB 2A4ZA 1VCBA 3ZTCA 1TTNA 3DBRI 2C9WB 3L08A 1P3QU 4P7IA 4IG7B 3WAPA 3DBHI 1F9JA 3PVLA 4KV2A 4G3XB 2IO0B 2VRRB 4NJ6A 3TL5A 2V3SA 4W9FA 3VH3B 2K25A 1V81A 2FCQA 4K7SA 3DVNU 3WALA 1WM2A 4GOCA 2MX2A 3AU5A 4BBNC 4AJYB 4PS8A 5KHQA 2DYOA 1Q1OA 3L0WB 4DXAB 2LGYA 5J18A 4RM8A 3SU8X 4KIKA 1E7UA 1KJTA 2KVRA 4GN1A 4EZJA 1WGDA 1V2YA 3K9OB 2NS5A 2CHXA 3RUIB 3TMPB 5HKHA 3V61A 2RSUA 3U7DA 3PRZA 3VUXA 2GBJA 2EMSA 2N7DA 1FXTB 2KDFB 2KJRA 2KN5A 2J0MA 3T9LA 3L17A 4LDTD 4M0WB 1WI0A 3PRMB 2JT4B 1OGWA 4WJOA 1UELA 3QJZA 4WJNA 1R4MI 3U30A 2IO3B 4DBGA 4WJQA 2M0XA 3NS8A 1JRUA 4IWPA 1V80A 2FAZA 3ML8A 2GOWA 1XT9B 3JSVB 1I35A 3CMMB 4ZDVA 3UQBA 1J19A 3PS6A 2MBBB 4WWPA 2M8SA 4BKSD 4K81A 5FR6A 2KZRA 4FJZA 2L8JA 4GU2A 2DYMA 4GDKB 4ANWA 4HCPB 2KQSA 3DPDA 3ZTDA 1WFYA 2O2VB 2MBQA 1UGMA 2LI5A 3L10B 1H4RA 3N3KB 1TZ1A 2LXAA 2KK8A 3JVZX 1RAXA 3O65B 5JHBA 3PV1A 3ZNZB 4MH0E 4FHKA 2G4DB 1P0RA 1V9JA 1YD8U 3N32A 3VQIA 5CX3A 3HHMA 5D2MB 3ZIMA 2GBNA 4FA6A 2MBHA 2GBMA 3ML9A 2FIDA 4K7WA 3A33B 4A3OA 3QCAA 2IZVB 2B3AA 2NVUI 5J2RA 3VVWB 4TUUA 4HXDA 4M8NA 2J0JA 3V6CB 5LXIB 1WXSA 3BINA 3JW0X 1ZW7A 4HJKA 1D3ZA 1A5RA 3SHQA 1WMHB 2LVPA 1YX5B 2BYEA 3UGBB 3QAQA 3QIJA 3PPAA 4KIKB 2A5UA 4YL8A 1G6JA 1GC7A 4KZCA 4IWQA 2CS4A 2IYDB 4BKGA 1ZKHA 4FLHA 3QA8A 4PS3A 2CHZA 4G11A 5C23A 5EDSA 1SIFA 3ENEA 3B1LX 3H7PB 1GG3A 4EZKA 2LVQA 4MM3A 2JY6A 2C60A 4NPNA 4IM3A 2YVCA 4EKUA 4HVBA 4G50A 2M4NA 3W1YA 2KFKA 1IP9A 1WX9A 4K1RB 4MGIE 2WWZA 3DOWA 3UIPB 2WYQA 3KW5B 1KLVA 1HE8A 5CHVC 2AL3A 2C7HA 4KSLC 2MP2B 2O6VB 2XK5A 3A9JA 2N7EA 1V6EA 2K39A 2MSED 2BKRB 1WGYA 5IA7A 4HDQA 3SD5A 3UINB 1YX6B 4FJYA 4HPMB 1KM7A 2NBWB 2M1MA 5E6PA 3W1SC 4TKNA 1WGGA 2JF5A 2KXJA 2NBVB 1Z2MA 2ZJDA 5E6OA 3NZUA 2HE7A 3BY4B 1RFAA 3R7QA 3TIXA 4BOSC 4HWIB 4AWJA 5AZHA 4ANUA 3Q3JA 2LASA 1WJ6A 3AI5A 3M3JA 4FBJB 1QZEA 2KFJA 3M63B 1T0YA 1WIAA 2UWQA 2AYOB 2KTFA 2XEWA 5C1ZA 4MJSB 3V62A 2LUEA 3IHPC 3KUDB 4MGZE 2MQJA 4A20A 3R3MA 1WXAA 4XC2A 4AOFA 2PE6B 3LDZE 2GBKA 1LM8B 2KTRB 2FNJB 2L00B 3RZFA 2XK5B 4FADA 1P98A 3A9JB 1P1AA 2NPTB 2QHOA 2KD0A 1E8XA 2G3QB 3QC8B 3R66C 3DDCB 3I3TB 4HPLB 2DZJA 1I42A 3PSEB 4DHZB 2KANA 3T8MA 2K8HA 4DHJD 2JRHA 2KC1A 3A4SC 4I6LB 4LJPB 2C7NB 3VFKA 4GDLA 2KC2A 4GMVA 3QX1A 4JL9A 3JYUA 4ANXA 3ONSA 1GNUA 2L0FA 4B6WA 4B9KA 2CR5A 2JZZA 2FCMA 3HIZA 3ZRCA 1EF1A 3UF8A 1WJUA 4GSWA 3KYDD 1OQYA 1WXVA 1YIWA 2KDIA 2MCNB 3UQAA 3M62B 1S3SG 1E90A 3JSVA 4W9EA 3RZWC 4ASWC 2ZEQA 3HM3A 4BVUC 3QK0A 1GJZA 2DX5B 4II2B 3HM6X 1Q0WB 1OTRB 2KMCA 2NPTA 4MSMB 4IUMB 2MP2A 2O6VA 2LVOA 3KH0A 3PRPB 2L0TA 3EC8A 2ZPYA 4JLCA 4ZYNA 2KX0A 2MBOA 2IY1B 2V1YA 2REXA 1WYWB 3AULA 3RULA 4GDLB 3QARA 2EMTA 5DPSA 4W9LA 2WX1A 3ZKJC 2LRWA 4WAAA 1WGRA 3S2AA 1AARA 3VTUA 1SE9A 3VAWA 4IM0A 4ICUA 2MBEA 3A1QA 2CKHB 5CHWA 3VH4B 4E3CA 3MTNB 2DZMA 1CMXB 3SDLC 4FJVB 3A9KB 4F1SA 2JXXA 2ZVNA 1WZ3A 4EEWA 3EHVA 4EUTA 2L76A 3EFUA 4WWOA 1L7YA 4GGQA 2ZVOA 2WX0A 2EKEC 2L3ZA 5LXHA 3MJWA 2KNBA 2KMAA 3Q3FA 1WE7A 4WQOB 2JWZA 5DCNA 5CHFA 2J7QB 1WX8A 3H1UA 4F8CB 3ALBA 1NDDA 2LJ5A 2CHWA 3ZRFA 2ZNVB 3PHWB 4OVVA 4XZ4A 1E5WA 1S1QB 4NAWB 5L95C 2MWSB 2NR2A 1UH6A 1TBEA 3QQ8B 2K8CA 4GDKA 4KVGB 3X23A 1E8ZA 1YQBA 3V60A 2K1FA 2BF8B 2BYVE 2LZ6A 3KUCB 3QHTA 4KDLB 2JPHA 2KWVB 1XQQA 1XD3B 2LGXA 1VD2A 4II3B 4FHJA 4I6NB 2ASQA 5AZGA 2KX3A 4NQLB 1PQSA 2AWTA 2G45B 4TQ1A 1LXDA 2IO2B 2IY0B 1EF5A 2ZZPB 3APDA 4G0NB 3VXWA 3NY5A 2R2QA 5GMVA 4PS7A 2MRPA 2ZPNA 2GMIC 3KVFB 2JUOA 3NOBA 2BKFA 1WY8A 2K6QA 4XX5A 3WAMA 3MHSD 2KDEB 3ZVVA 3PGEA 5AZFA 2M17A 2KO3A 2Y5BB 4NQKE 1WJ4A 3DBSA 2KWCA 1P9DU 3IFWB 4ZRJA 2BWFA 4K7UA 4IC7B 5IAAC 1M94A 5KHOA 4AJWA 3OJ4B 4A3PA 3APFA 3RYTA 2BGFA 3ZNID 2ZNVC 5JH5C 1WX7A 4GIVA 1GC6A 2C7MB 2GBRA 1LFDA 4ICVA 3ZW3A 3D32A 2JVCA 4DDGD 4KZ0A 5BO4B 2PPHA 2KLGA 2N1VA 4W9HA 1Z5SB 2K8BA 3PLVA 1V5TA 2FCNA 2RD0A 3AXCA 4W9CA 5TR5A 3VUWA 3WANA 2RGFA 3ZNGC 3ZNHB 1WXMA 4GXBA 2KFKB 2KWUB 4JQWC 1WR6E 3H7SA 3IG3A 4HLEA 1J0GA 2G4SA 5G2NA 3ZDMC 4WJPA 2KLCA 3PREA 4BKTA 1R4NI 2JRIB 2PE9A 3RCZA 1WGHA 3VDZA 2BYFA 3A4RA 3TJPA 4HDOA 1IPGA 4NNJB 2N4FA 1UBIA 2O6VD 5DPRA 1WZ0A 2DHZA 1NI2A 2Z0DB 2K6DB 2LRUA 3APCA 4NAWA 3B0AA 4W9JA 2BPSA 2KHWB 4EOYA 4RMAA 2V4LA 1UD7A 3L54A 3RT3B 2DYBA 1LQBA 3PZDA 2L7RA 4MGKE 3VTVA 4BBNF 5D7GA 3DVNV 4BOZB 1V5OA 2LWPA 4LDTB 4X57B 5E6NA 4IWOA 3PTFC 4DDID 2IBIB 2MA9B 2R2OA 4CHKA 4NJ7A 1C3TA 1X1MA 4I6PA 2DAFA 1YJ1A 1SGHA 2D10A 2Z0EB 4PYZA 1H8CA 4KSKC 4URKA 2CU1A 2D07B 2I1JA 4WWNA 3NZSA 2DZIA 3DVGX 1UZXB 2NCNA 3V6EB 3ZLZA 1WF9A 1WJNA 1Q5WB 3GZNI 3KYCD 1NBFC 1WMHA 2D2QA 3WIMA 3ZUNA 4MSQB 3CF6E 2KQ7A 2N9XA 4JIOU 2D3GA 2UYZB 4FULA 4LCDE 1U4AA 4W9IA 1E8YA 1WM3A 1WH3A 3M95A 5CTRC 2L05A 4J6IA 2PJHA 5JHAA 1WRDB 5J17A 4F7ZA 2XBBC 3R7RA 2DAJA 3KUZA 2OOBB 1IYFA 4GB9A 4FN2A 1BT0A 4W9DA 1Y8RC 4DHJB 4DWFA 4ZRKA 4N9F4 1OEYJ 4KDIC 2LXCA 4OVUA 5DPWA 4NY0A 1J8CA 3A9KA 2FIFA 2LGDA 5AEKB 2MLBA 3C0RB 3K9PB 3L13A 4M8MA 3OJ3A 2J0KA 2DENB 3ECIA 3W1SA 4MDKE 3P2BA 1OEYA 3TBLD 5DPTA 3GOEA 1ZGUB 5L83A 1WE6A 1UBQA 2ZCCA 4IW0A 3IVFA 3ZO5B 1RRBA 2DZKA 2YLMA 2FUHB 2KKCA 2LD9A 2W9NA 4BFRA 4MGYE 1EO6A 2BWES 4CYEA 3WAOA 3RD2A 1L2NA 1C1YB 2HD5B 3OLMD 5D94A 1V86A 4HCNB 3DBLI 2HJ8A 4MEMA 4RM9A 2NBUA 4DHZE 4IM2A 2N9EB 2JZ3B 4AUQC 3TCAA 3DCGA 4ZRIA 2I1KA 2KDBA 3EECA 2AEHA 1RLFA 4TQ0A 3H9DA 3WA0A 2RPQA 3U8ZA 2MW5A 2Z59B 3NHEB 4EFOA 1EUVB 3VTWA 3AU4A 3N30A 5JZEB 4AP4C 5G55A 2ZCBA 4E74A 3UIOB 4BKSA 1E7VA 3HK0A 3H7PA 3IBEA 3CSTA 2AL6A 1MG8A 2IO1B 1E8WA 4ANVA 3H6NA 3L16A 3A1QB 1WR1A 2KOXA 2WDTB 2N1WA 4LJOB 4MELA 4MJSA 4PYUA 4TV3A 4W9KA 4CO7A 4E71A 4EZLA 2C5LC 5D6JB 1K8RB 2FCSA 2RR9A 4B95A 2KTRA 3B08A 4DK5A 2HTHA 4JGHB 1V49A 3PT2B 3CSFA 3VUYA 2D11A 3PLUA 3DQVA 1GUAB 1ISNA 2PEAA 3ZDTA 3DVGY 3PHXB 3VHTC 3OAWA 1KOTA 3QWZB 3X0WA 2KJ6A 2N9PC 3LJ3A 2O2VA 5LLIA 1TGZB 4HK2A 4W9GA 2OJRA
chains in the Genus database with same CATH superfamily
2L83A 2KJHB 2RDHA 1FPYA 4QAYA 1UF0A 2C9WB 4IG7B 3NS1A 1F9JA 3PVLA 2WDRB 2G1EA 3AEEB 2B76B 4K7SA 3DVNU 1QLBB 1JROA 2DYOA 4DXAB 2GB1A 3BK1A 1E7UA 1WGDA 3MFGA 3KWVA 5HKHA 3PRZA 1KLGD 3DHHC 2KN5A 2N7DA 1DOXA 3W2DA 3CIRB 2QC8A 3L17A 4M0WB 2I2YA 1UELA 3J9CA 5IN7A 4WJNA 4DBGA 2IO3B 3Q6BA 1Q10A 1V80A 2FAZA 3ML8A 4IWPA 1TYGB 4XWWA 1XT9B 2CJNA 1J19A 1IBXB 1ZP0B 4WWPA 2MBBB 2KZRA 3C8YA 4GDKB 3DPDA 1I4RA 2O2VB 4ZRQA 3GB1A 2LXAA 2V3PA 3JVZX 3PV1A 1P7EA 2JWUA 1YNTE 3ZJUA 2G4DB 1V9JA 2W3SA 5CX3A 3HHMA 3AE1B 1NEKB 2LFIA 3AV8A 3EGRA 4OW0A 4K7WA 4S17A 3QCAA 2V0GA 1RWSA 2K5PA 5HFYA 1C79A 1I7HA 2LUMA 2Z8LA 5LXIB 3FKYA 1TS5A 3N1YC 1A5RA 2LVPA 3UGBB 3QAQA 3QIJA 3RMKC 4Q2JA 4BKGA 5FKAC 4G11A 5EDSA 2N7JA 4NPNA 2PVOD 1HTOA 4G50A 1TKGA 1SE4A 3W1YA 3HVZA 1IP9A 1WX9A 4MGIE 2WWZA 4WURA 1KLVA 1PDXA 2AL3A 4KSLC 2O6VB 4AQ7A 4K3CA 1CK1A 3BVZA 2N7EA 2K39A 2M0AA 4ZOHC 2M56B 2NMQA 4HDQA 4FJYA 1UWXA 4NAMA 1DOIA 2KXJA 1V97A 1BXTA 2NBVB 2ZJDA 2HE7A 1I4PA 4AWJA 2LASA 1RYJA 2KFJA 3M63B 1T0YA 4YXDB 2QILA 2KTFA 4MJSB 3R3MA 1WXAA 2GBKA 1LM8B 2KTRB 1J7BA 2L00B 4FADA 1P1AA 3RNAC 2KD0A 1I42A 1ZDVA 1F77A 4LNIA 5MPOA 4DHJD 4I6LB 3I5JC 3RNCC 3ABVB 3HIZA 2PTLA 1EF1A 1NENB 4JWSC 4S0RA 2MCNB 3Q69A 4ASWC 4US8A 2V4IB 2KMCA 2NPTA 2MHJA 4IUMB 1KTKA 3ZQ4A 3PRPB 2INCC 2ICIA 2L0TA 4BZAA 3PZ8A 2V1YA 2REXA 3AULA 2IDYA 3QARA 2W55A 2EMTA 1K52A 1E6EB 3IT6B 1FCLA 3GE8C 2BQQA 1TJEA 2MBEA 2CKHB 1TZOA 1IUEA 4FJVB 3C19A 4KGSA 4EEWA 2ZVNA 1WZ3A 1FFVA 3EHVA 5BMGA 2L3ZA 2KNBA 3ZGZA 2JWZA 3KLSX 5CHFA 1N63A 4OVVA 4XZ4A 1E5WA 4NAWB 3LXFA 3GE3C 1UH6A 4IKGA 3RPFC 1VZ6A 2HDEA 2HJ1A 3URYA 2BYVE 2LZ6A 3Q8CA 2LGXA 1XLQA 3RFZB 2KX3A 2AWTA 2Y5PA 4TQ1A 4LNKA 2IY0B 2ZZPB 2BKFA 3WAMA 3TSSA 1YJJA 3DBHB 4A90A 4NQKE 1WJ4A 3IFWB 1EWCA 1SBBB 3FAHA 2PW9A 1N5WA 4DXGA 3RYTA 3AEFB 2QJLA 4ZHOA 1GC6A 1C9FA 1VRAB 2CU3A 1JWSD 3SFEB 1F2RC 3WANA 1YQ3B 3AXCA 4W9CA 4JQWC 2RDBC 2AQ3B 2KLCA 2PE9A 2WGSA 1WGHA 1C78A 2Z0DB 2DHZA 1NI2A 5IOIA 4NAWA 1JW9D 1ACCA 1D5MC 3RT3B 1PFDA 3N20C 1NYRA 2N9KA 2KQ4X 3PTFC 2MA9B 2DAFA 3BZDB 1B9RA 2D10A 1H8CA 4KSKC 5H8YE 3NZSA 2OHFA 1WF9A 1WJNA 2DNFA 3BYTB 2D2QA 3ZUNA 2INPE 3CF6E 2WS3B 2N9XA 4FULA 1U4AA 2H88B 5CTRC 2PKOA 4HROA 4F7ZA 3R7RA 1AW7A 1XCTL 4ZRKA 1OEYJ 5I4DA 2LXCA 2Q5WD 1J8CA 4NY0A 2MLBA 3K9PB 3L13A 5HG2A 1OEYA 1YN5A 3ZO5B 2YLMA 3IXSA 2FUHB 2KKCA 2LD9A 4MGYE 3BK2A 4CYEA 1L4ZB 2I38A 4RM9A 2WNMA 2GI9A 2JZ3B 4AUQC 5FR3A 2KDBA 3IAM1 2RPQA 3U8ZA 1EUVB 3N30A 2WXRA 4AP4C 4BKSA 3CSTA 1E8WA 1F52A 3L16A 5E6JA 1WR1A 2KOXA 4LJOB 3U7ZA 1T0QC 3MC9A 4CO7A 1EM7A 3Q8BA 4B95A 2KTRA 2G9HD 4DK5A 1AN8A 4WH4A 5EE1A 4C7ZA 1C77A 3DQVA 2PEAA 3DVGY 5G5GA 1KOTA 1FD6A 2N9PC 3LJ3A 4KKIA 3TEZA 1TGZB 3BYYB 3NZ3A 2J53A 1GPXA 1VCBA 2WHIA 3DBRI 4LNOA 4BAXA 3L08A 1N60A 4P7IA 3MJ5A 2WXJA 3R8BA 5D3DA 4YSYB 4P1CC 4G3XB 3VH3B 2M19A 3AE6B 1SSNA 3AU5A 5KHQA 2WXNA 1P7FA 3L0WB 4KIKA 1V2YA 2PLPA 4USAA 1GAQB 3TMPB 2D3AA 4LLGM 2RSUA 2EMSA 2KDFB 1L4DB 1JALA 1FNUA 1R4MI 2LGIA 4WJQA 2M0XA 4KKJA 1EWYC 2GOWA 1KF6B 1R4NB 3N1ZC 2M8SA 4HJGE 4GU2A 4ANWA 4HCPB 2RMMA 5IP4D 4M00A 4C7YA 2MBQA 1JWAD 1UGMA 3N3KB 1H4RA 2OJWA 4GLSC 2KK8A 3O65B 5JHBA 3ZNZB 4FHKA 2NTTA 2H89B 1YD8U 3N32A 5D2MB 2MBHA 3ML9A 2KYWA 2IZVB 5J2RA 1D5ZC 4HXDA 2J0JA 1WXSA 3BINA 3JW0X 4L1BA 1D3ZA 4YWGG 3NVYA 1B1ZA 1FXAA 1WMHB 2BYEA 4WIPA 1CZPA 4IWQA 2CS4A 1SXTA 2IYDB 4FLHA 2BVCA 3QA8A 4PS3A 1GOZA 3AE4B 5C23A 2MEKA 3B1LX 1FNVA 1GG3A 2LVQA 2JY6A 1Y56A 2AQ2B 4IM3A 2YVCA 2ON8A 3AN1A 2KFKA 2JQRB 4HKZE 3DOWA 3UIPB 2J4XA 3A9JA 1V6EA 5G5HA 3SD5A 1YX6B 1QOFA 1WGKA 4HPMB 5E6PA 4TKNA 1WGGA 2JF5A 1Z2MA 3TEXA 3R7QA 1MFWA 4BOSC 4HWIB 4ANUA 3AI5A 2UWQA 5C1ZA 1ROEA 3P63A 3V62A 3IHPC 4MGZE 1JWBD 4AOFA 1BUIC 2FNJB 2IPKD 1MJDA 5TSSA 2VZKD 2XK5B 4TMAB 2QHOA 3R66C 3DDCB 3I3TB 2DZJA 4A9AA 2K8HA 3GZNB 4LJPB 2YEPF 3ETRA 2KC2A 3QX1A 1CJEA 4ANXA 3ONSA 1GNUA 4OHJA 4B6WA 4EE2A 2DBYA 2CR5A 3T3NA 3Q3MC 3AB5A 3KYDD 1WXVA 2KDIA 1XCQL 1E90A 4W9EA 3RZWC 2ZEQA 3HM3A 5GXGB 2DX5B 3AE8B 3HM6X 4HKQA 4RF1A 2LVOA 1FRDA 3OG5A 3EC8A 2WU2B 4ZYNA 2KWDA 1D5XC 1YQ4B 3ZKJC 3NRZA 1SE9A 4JX1C 5BYRA 3MTNB 2DZMA 1CMXB 4F1SA 2JXXA 4HPPA 3DWGC 3O13A 4EUTA 1HZ5A 4WWOA 1L7YA 4DXFA 4GGQA 2WX0A 4US9A 2EKEC 5LXHA 3MJWA 1WE7A 1YMHE 4HRSA 1WSPA 1NDDA 2LJ5A 3ZRFA 3PHWB 3L4PA 4A8XC 4M02A 4TSSA 1S1QB 1D6EC 2MWSB 2NR2A 1RFKA 4GDKA 5T8IA 2BB5A 1OQRA 3QHTA 2KWVB 1XQQA 5AZGA 4RFBA 1V1OA 4NQLB 1PQSA 2D3CA 2PVGC 1LXDA 1AYFA 1FXIA 1EF5A 1FM0D 5AUKA 4B0MA 1ZOYB 4MT5A 5GMVA 5BYQA 2ZPNA 3KVFB 3NOBA 2JUOA 3LB8C 2HTME 3ZVVA 2UU7A 2Y5BB 1NVID 1K51A 1KH0A 2VH1A 5KHOA 4RGTA 4YSXB 3ZNID 1BMLC 3FC4A 5JH5C 2IGGA 3D32A 3RNGC 2JVCA 3RNBC 4DDGD 4KZ0A 2PPHA 4R3DA 4LK0M 3AEBB 2JZPA 1V5TA 3VUWA 4YSZB 1EU4A 1K50A 3MHZA 4DQOC 4WJPA 4BKTA 1R4NI 2JRIB 3RCZA 2JSVX 3AM9A 4HDOA 2O6VD 4ZRPA 3APCA 4RH6A 2K6DB 4W9JA 2BPSA 4OZBA 2V4LA 4OZCA 1JQ4A 4BBNF 5D7GA 4BOZB 4X57B 4IWOA 2WXFA 3VR9B 2R2OA 1C3TA 1MPEA 4M0WA 4XGAB 1R7SA 4PYZA 4URKA 5JXVA 5EE0A 1XLOA 3WIMA 2KQ7A 4JIOU 2WXQA 1WH3A 2Y3AA 3M95A 2L05A 3OWEB 2XBBC 1IYFA 1BT0A 1Y8RC 2AQ1B 4DWFA 1IGCA 4N9F4 3I63C 3A9KA 2FIFA 2LGDA 4HK2A 3C0RB 3ECIA 1SJED 5L83A 3P2BA 3TBLD 2BTEA 4IOIE 1SJHD 1WE6A 1RRBA 4BFRA 3R2TA 3WAOA 2AX5A 3TEWA 3OLMD 1V86A 3AECB 4HCNB 4MEMA 2E3TA 1L6UA 3Q3OC 3E56A 3DCGA 5HI1A 3EECA 1I4QA 2RDGA 3VTWA 4OZAA 1FCCC 4E74A 1C4CA 2AL6A 4ANVA 3H6NA 4PYUA 3KQ4A 3RZFA 2WDTB 4E71A 3AH7A 5D6JB 2RR9A 2HTHA 4JGHB 3PT2B 5BMIA 2MJ3A 3RI7C 1T6BX 2J52A 3X0WA 2WXPA 4RNAA 5C3JB 4WWNA 2Y5CA 2A4ZA 1TIFA 1FNWA 1L0VB 4N59A 1WWTA 1HTQA 1P3QU 5D3IB 3WAPA 1JCKB 1TY2A 1WYGA 2IO0B 3TL5A 3PZ7A 1V81A 1WM2A 4GOCA 3UI3A 1I4XA 4PS8A 1Q1OA 4RM8A 3SU8X 1KJTA 3LYYA 2KVRA 3K9OB 1QKZA 3RUIB 3V61A 1FXTB 2WXKA 4LDTD 3PRMB 1FRRA 3BIID 2JT4B 1OGWA 4WJOA 3Q14C 4RF0A 1F1HA 1M4VA 1IGDA 5FK9C 3CMMB 3P4QB 3FILB 4C00A 3N1XC 3UQBA 4H2AA 1ZUD2 4BKSD 5FR6A 1YN4A 2DYMA 3ZTDA 3L10B 2LI5A 1TZ1A 4JE3B 1RAXA 2L32A 5EE9A 3VQIA 3N9YC 4REZA 4ARIA 2GBNA 2GBMA 1MHHE 2B3AA 3VVWB 4M8NA 1J7CA 1ZW7A 4HJKA 1TY0A 3SHQA 1YX5B 3PPAA 4YL8A 1G6JA 1C4AA 2CHZA 3NJTA 1SIFA 3ENEA 3SFDB 2WP9B 3U4EG 4RGNA 4EZKA 2C60A 4A55A 3P4PB 4EKUA 4HVBA 3Q8AA 4N58A 2SAKA 2WYQA 3E9SA 1HE8A 5CHVC 1C4PA 2XK5A 1SE2A 2MSED 2BS3B 2BKRB 1WGYA 5IA7A 2XNAC 3UINB 2INDC 2NBWB 2K0PA 3W5UB 1YOVB 5E6OA 3NZUA 1HQRD 2ZW0A 1WJ6A 1JMLA 3M3JA 4FBJB 1QZEA 2XEWA 2AYOB 1TKEA 3KUDB 2MQJA 1OFFA 4XC2A 4N6EB 2QSDA 3KWLA 1N6ZA 3A9JB 2WXOA 1E8XA 2WXIA 3QC8B 4HPLB 4DHZB 4JPSA 2JRHA 2QDFA 2INNE 3A4SC 2C7NB 2FE8A 3VFKA 1LGRA 3JYUA 3V3XA 4B9KA 2FCMA 3ZRCA 3UF8A 2JYTA 4ZYSA 1S3SG 3NVZA 4NJCA 4II2B 1Q0WB 4MSMB 1IBXA 2O6VA 1TS4A 1XO3A 2ZPYA 3EFCA 2BT6A 3B9JA 4RCOA 4JLCA 2CJOA 4HEA1 2MBOA 4P16A 3RULA 1WYWB 3EA6A 4GDLB 4FXCA 1NI3A 4W9LA 4ZHPA 3S2AA 1WGRA 1AARA 4ITKA 3VAWA 4IM0A 3A1QA 5CHWA 4B0EA 3SDLC 2L76A 3EFUA 4P6VF 2BS4B 2KMAA 3Q3FA 1DOYA 1N61A 5DCNA 1WX8A 4RGOS 3H1UA 4F8CB 2CHWA 2ZNVB 4XWTA 1PUTA 1PGBA 4C80A 3QQ8B 3T3OA 4KVGB 1E8ZA 2BYTA 2MJDA 4II3B 3B2FA 4FHJA 2ASQA 3RN9C 2W3RA 2IO2B 3APDA 3VXWA 2R2QA 3NUHB 1EU3A 2QMTA 4PS7A 2MRPA 1WY8A 2K6QA 4C4VB 2KDEB 1YJIA 1TS2A 1UUPA 3PO0A 1TT5B 1VDVA 2KO3A 3DBSA 2W82A 2KWCA 5IAAC 3B2GA 4AJWA 3OJ4B 1XLNA 4A3PA 1ENFA 2ZNVC 1WX7A 1LFDA 3CWIA 4ICVA 3ZW3A 5IO9A 2X8XX 5BO4B 4MH8A 2KLGA 5BYSA 4W9HA 3PLVA 2FCNA 5BMHA 5TR5A 1C76A 3ZNHB 2KFKB 1SB3C 2KWUB 4HLEA 1WR6E 1J0GA 2G4SA 5G2NA 3AMZA 3FILA 3PREA 1KFYB 4OVZA 3VDZA 3A4RA 3AE9B 3TJPA 2BB6A 2N4FA 1L0YB 5DPRA 1RM6C 2LRUA 3B0AA 4EOYA 4A6QA 1HZ6A 1UD7A 3L54A 2DYBA 4MGKE 3VTVA 3DVNV 2MJEA 2TSSA 2LWPA 4LDTB 5E6NA 4DDID 4MACA 4I6PA 1ZPSA 1YJ1A 2GLSA 1I4GA 2ACZB 2PMVA 2IGHA 3W9CB 1XXGA 2D07B 2IJ0A 3V6EB 2DZIA 3ZLZA 1UZXB 2NCNA 2WXGA 1Q5WB 3GZNI 3KYCD 3U2SC 4MSQB 1JRPA 2UYZB 4LCDE 4W9IA 2E6XA 4J6IA 2PJHA 4L23A 1WRDB 3AEDB 5JHAA 3P4RB 2DAJA 4GB9A 4FN2A 4W9DA 1V1PB 4KDIC 2WXHA 4OVUA 5DPWA 3AE3B 3V05A 3W1SA 3OJ3A 2J0KA 2DENB 3GOEA 1ZGUB 2ZCCA 2DZKA 3VRAB 1VJKA 1EO6A 1AWDA 3RD2A 1L2NA 5D94A 3I9V1 1DYQA 5AUIA 4DHZE 4IM2A 1T0RC 2LGSA 4ZRIA 3TCAA 1CQVA 4TQ0A 3H9DA 3BVMA 5JZEB 4XDCA 3IBEA 1E7VA 3H7PA 3EUB2 4MJSA 1JWMD 2N1WA 3Q8EA 4MELA 4W9KA 1MVKA 1HEZE 1K8RB 2FCSA 3B08A 2NTSA 3U52E 1V49A 3VUYA 2D11A 2WU5B 1WXQA 1GUAB 3AEGB 3ZDTA 2D3BA 3PHXB 1VR9A 3QWZB 1SF0A 2KJ6A 1K53A 5LLIA 1F2RI 4W9GA 2OJRA 4YTMB 4YTPB 2JYEA 3ZTCA 1TTNA 1FIQA 1KLUD 3DBHI 4KV2A 2VRRB 4NJ6A 5IKCM 2V3SA 4LNFA 4W9FA 2K25A 2FCQA 3WALA 4BBNC 2MX2A 1YN3A 4AJYB 3BWUD 5J18A 1SIJA 1VZ7A 2LGYA 1A70A 4GN1A 4EZJA 2NS5A 2V3NA 2CHXA 3SR6A 2GRIA 4XE0A 1WRIA 3MC0B 3U7DA 3VUXA 2GBJA 2LJIA 2KJRA 3NVVA 2PIAA 2J0MA 1TKYA 1L0XB 3T9LA 1WI0A 2JU6X 5C2TB 3QJZA 3ZXRA 4WAFA 1KRHA 3U30A 3NS8A 4WWMA 1JRUA 4ARCA 3JSVB 2QEJC 1I35A 4ZDVA 2DWQA 3PS6A 1ET9A 2DLBA 2JXTA 1STEA 3DHIC 4K81A 4FJZA 2L8JA 4NZLB 2KQSA 1WFYA 2WQYB 3IAS1 1QILA 4MH0E 2EELA 2K3UA 1P0RA 2KN4A 1E10A 4LNNA 4PK1A 4LTUA 3ZIMA 4FA6A 2LHDA 2FIDA 3A33B 4A3OA 2NVUI 3NVWA 1PGXA 4TUUA 1J7AA 3V6CB 3DHGC 3P4SB 4RGMA 4UDUC 4D2KA 4KIKB 2A5UA 3Q3NC 1GC7A 4KZCA 1ZKHA 3Q8FA 3W5VB 1FMAD 3H7PB 1SE3A 4MM3A 2L52A 1FFUA 1MHXA 2M4NA 4PT5A 3I57A 3HVDA 4K1RB 4IDIA 4JWUC 3KW5B 2C7HA 2MP2B 1HA5A 1V8CA 2KVZA 1NYQA 1PYWD 4O1NA 1E9MA 1KM7A 2M1MA 3W1SC 4KX6B 1T3QA 4AS1A 2RPVA 3BY4B 1GB1A 2OEDA 1RFAA 3HRDD 3TIXA 3AEAB 2BW2A 1MG4A 5AZHA 3Q3JA 1UWMA 1FO4A 3IT4B 1WIAA 2LUEA 2LHEA 4A20A 3DBRB 2ONQA 2KDMA 2PE6B 3LDZE 1P98A 2NPTB 2R61A 2G3QB 5H92C 3PSEB 1ZXHA 2KANA 3T8MA 2KC1A 2VH2A 4M01A 3ZYYX 4JL9A 2J42A 4GDLA 4GMVA 1MI0A 4K3BA 2L0FA 2JZZA 4MM3B 1F0ZA 1WJUA 4GSWA 1OQYA 1YIWA 3UQAA 3M62B 1ET6A 3JSVA 4BVUC 3QK0A 1GJZA 2V9HA 3RNEC 1OTRB 1QT9A 2XN9C 2KMMA 2MP2A 3DBLB 3KH0A 1T5XD 4XDDA 2KX0A 1XLPA 2IY1B 3SEBA 1PGAA 4J3OD 3HUIA 1XEEA 5DPSA 1N5XA 2WX1A 2LRWA 4WAAA 1R4MB 1DGJA 3VTUA 4ICUA 4E3CA 3VH4B 1ZE3D 3A9KB 2WXMA 2ZVOA 4WQOB 3ZXVA 2J7QB 3ALBA 5L95C 1FEHA 1L6VA 1TBEA 2K8CA 3MP9A 3X23A 1YQBA 2K9XA 3V60A 2K1FA 4C56C 2BF8B 3KUCB 4KDLB 2WLBA 1T0SC 2JPHA 2VZKB 4ACFA 1XD3B 1VD2A 4I6NB 1XF5L 2G45B 2D5GA 2QIEB 4G0NB 1VLBA 4YT0B 3NY5A 2LEKA 2L1AA 1I4HA 2GMIC 2KT7A 4XX5A 1HXYD 3MHSD 3VRBB 3PGEA 3RNFC 5AZFA 2M17A 3P42A 1P9DU 1ZDXA 4ZRJA 2BWFA 4K7UA 4IC7B 1M94A 5HHDG 2KAJA 3ZJVA 2FBWB 4WQMA 3APFA 2BGFA 5EE3A 4GIVA 2C7MB 2GBRA 1L5PA 2N1VA 1Z5SB 2K8BA 1E7PB 2RD0A 3ZNGC 2RGFA 1WXMA 4GXBA 3H7SA 3IG3A 3AE2B 4C4VA 3ZDMC 3P1MA 2WDVB 1D4BA 1LO5D 2QCZA 3R2IA 2W54A 2BYFA 3TEYA 1IPGA 1UBIA 1QOAA 2JX5A 1WZ0A 2KHWB 4RMAA 2MH7A 1ZXIA 1LQBA 3PZDA 1E0ZA 2L7RA 2BS2B 1V5OA 2IBIB 4CHKA 3Q2AC 4NJ7A 3MC8A 2SEBD 1X1MA 3WCQA 3NG0A 1SGHA 2Z0EB 4KGTA 1JWUD 2CU1A 1N62A 2I1JA 3DVGX 1SEBD 1NBFC 1WMHA 4L2YA 2D3GA 2WDQB 1E8YA 1WM3A 4KGRA 3TUOA 3AE7B 2ZW1A 4XYCA 5J17A 1TS3A 3H8HA 3KUZA 2OOBB 3ZJTA 3DWMA 4P1BC 4DHJB 4YTNB 2LMCA 5AEKB 2KACA 2BBCA 4M8MA 4MDKE 5DPTA 3VR8B 1UBQA 4IW0A 3IVFA 2W9NA 2BWES 1QQRA 1C1YB 2HD5B 3DBLI 1QOBA 2HJ8A 2NBUA 3GP7A 2N9EB 2I1KA 2AEHA 1RLFA 2FUG1 2X38A 3WA0A 2MW5A 2Z59B 3NHEB 4EFOA 2K22A 1UNSA 3AU4A 1V1PA 5G55A 2ZCBA 2N9LA 3UIOB 3AE5B 3HK0A 1MG8A 2IO1B 2YEPB 3A1QB 4TV3A 4EZLA 2WXLA 2C5LC 2IGDA 4CQNA 5LNK1 1GB4A 3CSFA 1VZ8A 3PLUA 1ESFA 1ISNA 1QF6A 1QOGA 3VHTC 3OAWA 2O2VA 2N0SB 3GS2A 1UGJA 3BVGA 2EKIA 4NNJB 1OQQA
chains in the Genus database with same CATH topology
2KJHB 2A4ZA 1VCBA 3ZTCA 1TTNA 3DBRI 2C9WB 3L08A 1P3QU 4P7IA 4IG7B 3WAPA 3DBHI 1F9JA 3PVLA 4KV2A 4G3XB 2IO0B 2VRRB 4NJ6A 3TL5A 2V3SA 4W9FA 3VH3B 2K25A 1V81A 2FCQA 4K7SA 3DVNU 3WALA 1WM2A 4GOCA 2MX2A 3AU5A 4BBNC 4AJYB 4PS8A 5KHQA 2DYOA 1Q1OA 3L0WB 4DXAB 2LGYA 5J18A 4RM8A 3SU8X 4KIKA 1E7UA 1KJTA 2KVRA 4GN1A 4EZJA 1WGDA 1V2YA 3K9OB 2NS5A 2CHXA 3RUIB 3TMPB 5HKHA 3V61A 2RSUA 3U7DA 3PRZA 3VUXA 2GBJA 2EMSA 2N7DA 1FXTB 2KDFB 2KJRA 2KN5A 2J0MA 3T9LA 3L17A 4LDTD 4M0WB 1WI0A 3PRMB 2JT4B 1OGWA 4WJOA 1UELA 3QJZA 4WJNA 1R4MI 3U30A 2IO3B 4DBGA 4WJQA 2M0XA 3NS8A 1JRUA 4IWPA 1V80A 2FAZA 3ML8A 2GOWA 1XT9B 3JSVB 1I35A 3CMMB 4ZDVA 3UQBA 1J19A 3PS6A 2MBBB 4WWPA 2M8SA 4BKSD 4K81A 5FR6A 2KZRA 4FJZA 2L8JA 4GU2A 2DYMA 4GDKB 4ANWA 4HCPB 2KQSA 3DPDA 3ZTDA 1WFYA 2O2VB 2MBQA 1UGMA 2LI5A 3L10B 1H4RA 3N3KB 1TZ1A 2LXAA 2KK8A 3JVZX 1RAXA 3O65B 5JHBA 3PV1A 3ZNZB 4MH0E 4FHKA 2G4DB 1P0RA 1V9JA 1YD8U 3N32A 3VQIA 5CX3A 3HHMA 5D2MB 3ZIMA 2GBNA 4FA6A 2MBHA 2GBMA 3ML9A 2FIDA 4K7WA 3A33B 4A3OA 3QCAA 2IZVB 2B3AA 2NVUI 5J2RA 3VVWB 4TUUA 4HXDA 4M8NA 2J0JA 3V6CB 5LXIB 1WXSA 3BINA 3JW0X 1ZW7A 4HJKA 1D3ZA 1A5RA 3SHQA 1WMHB 2LVPA 1YX5B 2BYEA 3UGBB 3QAQA 3QIJA 3PPAA 4KIKB 2A5UA 4YL8A 1G6JA 1GC7A 4KZCA 4IWQA 2CS4A 2IYDB 4BKGA 1ZKHA 4FLHA 3QA8A 4PS3A 2CHZA 4G11A 5C23A 5EDSA 1SIFA 3ENEA 3B1LX 3H7PB 1GG3A 4EZKA 2LVQA 4MM3A 2JY6A 2C60A 4NPNA 4IM3A 2YVCA 4EKUA 4HVBA 4G50A 2M4NA 3W1YA 2KFKA 1IP9A 1WX9A 4K1RB 4MGIE 2WWZA 3DOWA 3UIPB 2WYQA 3KW5B 1KLVA 1HE8A 5CHVC 2AL3A 2C7HA 4KSLC 2MP2B 2O6VB 2XK5A 3A9JA 2N7EA 1V6EA 2K39A 2MSED 2BKRB 1WGYA 5IA7A 4HDQA 3SD5A 3UINB 1YX6B 4FJYA 4HPMB 1KM7A 2NBWB 2M1MA 5E6PA 3W1SC 4TKNA 1WGGA 2JF5A 2KXJA 2NBVB 1Z2MA 2ZJDA 5E6OA 3NZUA 2HE7A 3BY4B 1RFAA 3R7QA 3TIXA 4BOSC 4HWIB 4AWJA 5AZHA 4ANUA 3Q3JA 2LASA 1WJ6A 3AI5A 3M3JA 4FBJB 1QZEA 2KFJA 3M63B 1T0YA 1WIAA 2UWQA 2AYOB 2KTFA 2XEWA 5C1ZA 4MJSB 3V62A 2LUEA 3IHPC 3KUDB 4MGZE 2MQJA 4A20A 3R3MA 1WXAA 4XC2A 4AOFA 2PE6B 3LDZE 2GBKA 1LM8B 2KTRB 2FNJB 2L00B 3RZFA 2XK5B 4FADA 1P98A 3A9JB 1P1AA 2NPTB 2QHOA 2KD0A 1E8XA 2G3QB 3QC8B 3R66C 3DDCB 3I3TB 4HPLB 2DZJA 1I42A 3PSEB 4DHZB 2KANA 3T8MA 2K8HA 4DHJD 2JRHA 2KC1A 3A4SC 4I6LB 4LJPB 2C7NB 3VFKA 4GDLA 2KC2A 4GMVA 3QX1A 4JL9A 3JYUA 4ANXA 3ONSA 1GNUA 2L0FA 4B6WA 4B9KA 2CR5A 2JZZA 2FCMA 3HIZA 3ZRCA 1EF1A 3UF8A 1WJUA 4GSWA 3KYDD 1OQYA 1WXVA 1YIWA 2KDIA 2MCNB 3UQAA 3M62B 1S3SG 1E90A 3JSVA 4W9EA 3RZWC 4ASWC 2ZEQA 3HM3A 4BVUC 3QK0A 1GJZA 2DX5B 4II2B 3HM6X 1Q0WB 1OTRB 2KMCA 2NPTA 4MSMB 4IUMB 2MP2A 2O6VA 2LVOA 3KH0A 3PRPB 2L0TA 3EC8A 2ZPYA 4JLCA 4ZYNA 2KX0A 2MBOA 2IY1B 2V1YA 2REXA 1WYWB 3AULA 3RULA 4GDLB 3QARA 2EMTA 5DPSA 4W9LA 2WX1A 3ZKJC 2LRWA 4WAAA 1WGRA 3S2AA 1AARA 3VTUA 1SE9A 3VAWA 4IM0A 4ICUA 2MBEA 3A1QA 2CKHB 5CHWA 3VH4B 4E3CA 3MTNB 2DZMA 1CMXB 3SDLC 4FJVB 3A9KB 4F1SA 2JXXA 2ZVNA 1WZ3A 4EEWA 3EHVA 4EUTA 2L76A 3EFUA 4WWOA 1L7YA 4GGQA 2ZVOA 2WX0A 2EKEC 2L3ZA 5LXHA 3MJWA 2KNBA 2KMAA 3Q3FA 1WE7A 4WQOB 2JWZA 5DCNA 5CHFA 2J7QB 1WX8A 3H1UA 4F8CB 3ALBA 1NDDA 2LJ5A 2CHWA 3ZRFA 2ZNVB 3PHWB 4OVVA 4XZ4A 1E5WA 1S1QB 4NAWB 5L95C 2MWSB 2NR2A 1UH6A 1TBEA 3QQ8B 2K8CA 4GDKA 4KVGB 3X23A 1E8ZA 1YQBA 3V60A 2K1FA 2BF8B 2BYVE 2LZ6A 3KUCB 3QHTA 4KDLB 2JPHA 2KWVB 1XQQA 1XD3B 2LGXA 1VD2A 4II3B 4FHJA 4I6NB 2ASQA 5AZGA 2KX3A 4NQLB 1PQSA 2AWTA 2G45B 4TQ1A 1LXDA 2IO2B 2IY0B 1EF5A 2ZZPB 3APDA 4G0NB 3VXWA 3NY5A 2R2QA 5GMVA 4PS7A 2MRPA 2ZPNA 2GMIC 3KVFB 2JUOA 3NOBA 2BKFA 1WY8A 2K6QA 4XX5A 3WAMA 3MHSD 2KDEB 3ZVVA 3PGEA 5AZFA 2M17A 2KO3A 2Y5BB 4NQKE 1WJ4A 3DBSA 2KWCA 1P9DU 3IFWB 4ZRJA 2BWFA 4K7UA 4IC7B 5IAAC 1M94A 5KHOA 4AJWA 3OJ4B 4A3PA 3APFA 3RYTA 2BGFA 3ZNID 2ZNVC 5JH5C 1WX7A 4GIVA 1GC6A 2C7MB 2GBRA 1LFDA 4ICVA 3ZW3A 3D32A 2JVCA 4DDGD 4KZ0A 5BO4B 2PPHA 2KLGA 2N1VA 4W9HA 1Z5SB 2K8BA 3PLVA 1V5TA 2FCNA 2RD0A 3AXCA 4W9CA 5TR5A 3VUWA 3WANA 2RGFA 3ZNGC 3ZNHB 1WXMA 4GXBA 2KFKB 2KWUB 4JQWC 1WR6E 3H7SA 3IG3A 4HLEA 1J0GA 2G4SA 5G2NA 3ZDMC 4WJPA 2KLCA 3PREA 4BKTA 1R4NI 2JRIB 2PE9A 3RCZA 1WGHA 3VDZA 2BYFA 3A4RA 3TJPA 4HDOA 1IPGA 4NNJB 2N4FA 1UBIA 2O6VD 5DPRA 1WZ0A 2DHZA 1NI2A 2Z0DB 2K6DB 2LRUA 3APCA 4NAWA 3B0AA 4W9JA 2BPSA 2KHWB 4EOYA 4RMAA 2V4LA 1UD7A 3L54A 3RT3B 2DYBA 1LQBA 3PZDA 2L7RA 4MGKE 3VTVA 4BBNF 5D7GA 3DVNV 4BOZB 1V5OA 2LWPA 4LDTB 4X57B 5E6NA 4IWOA 3PTFC 4DDID 2IBIB 2MA9B 2R2OA 4CHKA 4NJ7A 1C3TA 1X1MA 4I6PA 2DAFA 1YJ1A 1SGHA 2D10A 2Z0EB 4PYZA 1H8CA 4KSKC 4URKA 2CU1A 2D07B 2I1JA 4WWNA 3NZSA 2DZIA 3DVGX 1UZXB 2NCNA 3V6EB 3ZLZA 1WF9A 1WJNA 1Q5WB 3GZNI 3KYCD 1NBFC 1WMHA 2D2QA 3WIMA 3ZUNA 4MSQB 3CF6E 2KQ7A 2N9XA 4JIOU 2D3GA 2UYZB 4FULA 4LCDE 1U4AA 4W9IA 1E8YA 1WM3A 1WH3A 3M95A 5CTRC 2L05A 4J6IA 2PJHA 5JHAA 1WRDB 5J17A 4F7ZA 2XBBC 3R7RA 2DAJA 3KUZA 2OOBB 1IYFA 4GB9A 4FN2A 1BT0A 4W9DA 1Y8RC 4DHJB 4DWFA 4ZRKA 4N9F4 1OEYJ 4KDIC 2LXCA 4OVUA 5DPWA 4NY0A 1J8CA 3A9KA 2FIFA 2LGDA 5AEKB 2MLBA 3C0RB 3K9PB 3L13A 4M8MA 3OJ3A 2J0KA 2DENB 3ECIA 3W1SA 4MDKE 3P2BA 1OEYA 3TBLD 5DPTA 3GOEA 1ZGUB 5L83A 1WE6A 1UBQA 2ZCCA 4IW0A 3IVFA 3ZO5B 1RRBA 2DZKA 2YLMA 2FUHB 2KKCA 2LD9A 2W9NA 4BFRA 4MGYE 1EO6A 2BWES 4CYEA 3WAOA 3RD2A 1L2NA 1C1YB 2HD5B 3OLMD 5D94A 1V86A 4HCNB 3DBLI 2HJ8A 4MEMA 4RM9A 2NBUA 4DHZE 4IM2A 2N9EB 2JZ3B 4AUQC 3TCAA 3DCGA 4ZRIA 2I1KA 2KDBA 3EECA 2AEHA 1RLFA 4TQ0A 3H9DA 3WA0A 2RPQA 3U8ZA 2MW5A 2Z59B 3NHEB 4EFOA 1EUVB 3VTWA 3AU4A 3N30A 5JZEB 4AP4C 5G55A 2ZCBA 4E74A 3UIOB 4BKSA 1E7VA 3HK0A 3H7PA 3IBEA 3CSTA 2AL6A 1MG8A 2IO1B 1E8WA 4ANVA 3H6NA 3L16A 3A1QB 1WR1A 2KOXA 2WDTB 2N1WA 4LJOB 4MELA 4MJSA 4PYUA 4TV3A 4W9KA 4CO7A 4E71A 4EZLA 2C5LC 5D6JB 1K8RB 2FCSA 2RR9A 4B95A 2KTRA 3B08A 4DK5A 2HTHA 4JGHB 1V49A 3PT2B 3CSFA 3VUYA 2D11A 3PLUA 3DQVA 1GUAB 1ISNA 2PEAA 3ZDTA 3DVGY 3PHXB 3VHTC 3OAWA 1KOTA 3QWZB 3X0WA 2KJ6A 2N9PC 3LJ3A 2O2VA 5LLIA 1TGZB 4HK2A 4W9GA 2OJRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KJH B;  2A4Z A;  1VCB A;  3ZTC A;  1TTN A;  3DBR I;  2C9W B;  3L08 A;  1P3Q U;  4P7I A;  4IG7 B;  3WAP A;  3DBH I;  1F9J A;  3PVL A;  4KV2 A;  4G3X B;  2IO0 B;  2VRR B;  4NJ6 A;  3TL5 A;  2V3S A;  4W9F A;  3VH3 B;  2K25 A;  1V81 A;  2FCQ A;  4K7S A;  3DVN U;  3WAL A;  1WM2 A;  4GOC A;  2MX2 A;  3AU5 A;  4BBN C;  4AJY B;  4PS8 A;  5KHQ A;  2DYO A;  1Q1O A;  3L0W B;  4DXA B;  2LGY A;  5J18 A;  4RM8 A;  3SU8 X;  4KIK A;  1E7U A;  1KJT A;  2KVR A;  4GN1 A;  4EZJ A;  1WGD A;  1V2Y A;  3K9O B;  2NS5 A;  2CHX A;  3RUI B;  3TMP B;  5HKH A;  3V61 A;  2RSU A;  3U7D A;  3PRZ A;  3VUX A;  2GBJ A;  2EMS A;  2N7D A;  1FXT B;  2KDF B;  2KJR A;  2KN5 A;  2J0M A;  3T9L A;  3L17 A;  4LDT D;  4M0W B;  1WI0 A;  3PRM B;  2JT4 B;  1OGW A;  4WJO A;  1UEL A;  3QJZ A;  4WJN A;  1R4M I;  3U30 A;  2IO3 B;  4DBG A;  4WJQ A;  2M0X A;  3NS8 A;  1JRU A;  4IWP A;  1V80 A;  2FAZ A;  3ML8 A;  2GOW A;  1XT9 B;  3JSV B;  1I35 A;  3CMM B;  4ZDV A;  3UQB A;  1J19 A;  3PS6 A;  2MBB B;  4WWP A;  2M8S A;  4BKS D;  4K81 A;  5FR6 A;  2KZR A;  4FJZ A;  2L8J A;  4GU2 A;  2DYM A;  4GDK B;  4ANW A;  4HCP B;  2KQS A;  3DPD A;  3ZTD A;  1WFY A;  2O2V B;  2MBQ A;  1UGM A;  2LI5 A;  3L10 B;  1H4R A;  3N3K B;  1TZ1 A;  2LXA A;  2KK8 A;  3JVZ X;  1RAX A;  3O65 B;  5JHB A;  3PV1 A;  3ZNZ B;  4MH0 E;  4FHK A;  2G4D B;  1P0R A;  1V9J A;  1YD8 U;  3N32 A;  3VQI A;  5CX3 A;  3HHM A;  5D2M B;  3ZIM A;  2GBN A;  4FA6 A;  2MBH A;  2GBM A;  3ML9 A;  2FID A;  4K7W A;  3A33 B;  4A3O A;  3QCA A;  2IZV B;  2B3A A;  2NVU I;  5J2R A;  3VVW B;  4TUU A;  4HXD A;  4M8N A;  2J0J A;  3V6C B;  5LXI B;  1WXS A;  3BIN A;  3JW0 X;  1ZW7 A;  4HJK A;  1D3Z A;  1A5R A;  3SHQ A;  1WMH B;  2LVP A;  1YX5 B;  2BYE A;  3UGB B;  3QAQ A;  3QIJ A;  3PPA A;  4KIK B;  2A5U A;  4YL8 A;  1G6J A;  1GC7 A;  4KZC A;  4IWQ A;  2CS4 A;  2IYD B;  4BKG A;  1ZKH A;  4FLH A;  3QA8 A;  4PS3 A;  2CHZ A;  4G11 A;  5C23 A;  5EDS A;  1SIF A;  3ENE A;  3B1L X;  3H7P B;  1GG3 A;  4EZK A;  2LVQ A;  4MM3 A;  2JY6 A;  2C60 A;  4NPN A;  4IM3 A;  2YVC A;  4EKU A;  4HVB A;  4G50 A;  2M4N A;  3W1Y A;  2KFK A;  1IP9 A;  1WX9 A;  4K1R B;  4MGI E;  2WWZ A;  3DOW A;  3UIP B;  2WYQ A;  3KW5 B;  1KLV A;  1HE8 A;  5CHV C;  2AL3 A;  2C7H A;  4KSL C;  2MP2 B;  2O6V B;  2XK5 A;  3A9J A;  2N7E A;  1V6E A;  2K39 A;  2MSE D;  2BKR B;  1WGY A;  5IA7 A;  4HDQ A;  3SD5 A;  3UIN B;  1YX6 B;  4FJY A;  4HPM B;  1KM7 A;  2NBW B;  2M1M A;  5E6P A;  3W1S C;  4TKN A;  1WGG A;  2JF5 A;  2KXJ A;  2NBV B;  1Z2M A;  2ZJD A;  5E6O A;  3NZU A;  2HE7 A;  3BY4 B;  1RFA A;  3R7Q A;  3TIX A;  4BOS C;  4HWI B;  4AWJ A;  5AZH A;  4ANU A;  3Q3J A;  2LAS A;  1WJ6 A;  3AI5 A;  3M3J A;  4FBJ B;  1QZE A;  2KFJ A;  3M63 B;  1T0Y A;  1WIA A;  2UWQ A;  2AYO B;  2KTF A;  2XEW A;  5C1Z A;  4MJS B;  3V62 A;  2LUE A;  3IHP C;  3KUD B;  4MGZ E;  2MQJ A;  4A20 A;  3R3M A;  1WXA A;  4XC2 A;  4AOF A;  2PE6 B;  3LDZ E;  2GBK A;  1LM8 B;  2KTR B;  2FNJ B;  2L00 B;  3RZF A;  2XK5 B;  4FAD A;  1P98 A;  3A9J B;  1P1A A;  2NPT B;  2QHO A;  2KD0 A;  1E8X A;  2G3Q B;  3QC8 B;  3R66 C;  3DDC B;  3I3T B;  4HPL B;  2DZJ A;  1I42 A;  3PSE B;  4DHZ B;  2KAN A;  3T8M A;  2K8H A;  4DHJ D;  2JRH A;  2KC1 A;  3A4S C;  4I6L B;  4LJP B;  2C7N B;  3VFK A;  4GDL A;  2KC2 A;  4GMV A;  3QX1 A;  4JL9 A;  3JYU A;  4ANX A;  3ONS A;  1GNU A;  2L0F A;  4B6W A;  4B9K A;  2CR5 A;  2JZZ A;  2FCM A;  3HIZ A;  3ZRC A;  1EF1 A;  3UF8 A;  1WJU A;  4GSW A;  3KYD D;  1OQY A;  1WXV A;  1YIW A;  2KDI A;  2MCN B;  3UQA A;  3M62 B;  1S3S G;  1E90 A;  3JSV A;  4W9E A;  3RZW C;  4ASW C;  2ZEQ A;  3HM3 A;  4BVU C;  3QK0 A;  1GJZ A;  2DX5 B;  4II2 B;  3HM6 X;  1Q0W B;  1OTR B;  2KMC A;  2NPT A;  4MSM B;  4IUM B;  2MP2 A;  2O6V A;  2LVO A;  3KH0 A;  3PRP B;  2L0T A;  3EC8 A;  2ZPY A;  4JLC A;  4ZYN A;  2KX0 A;  2MBO A;  2IY1 B;  2V1Y A;  2REX A;  1WYW B;  3AUL A;  3RUL A;  4GDL B;  3QAR A;  2EMT A;  5DPS A;  4W9L A;  2WX1 A;  3ZKJ C;  2LRW A;  4WAA A;  1WGR A;  3S2A A;  1AAR A;  3VTU A;  1SE9 A;  3VAW A;  4IM0 A;  4ICU A;  2MBE A;  3A1Q A;  2CKH B;  5CHW A;  3VH4 B;  4E3C A;  3MTN B;  2DZM A;  1CMX B;  3SDL C;  4FJV B;  3A9K B;  4F1S A;  2JXX A;  2ZVN A;  1WZ3 A;  4EEW A;  3EHV A;  4EUT A;  2L76 A;  3EFU A;  4WWO A;  1L7Y A;  4GGQ A;  2ZVO A;  2WX0 A;  2EKE C;  2L3Z A;  5LXH A;  3MJW A;  2KNB A;  2KMA A;  3Q3F A;  1WE7 A;  4WQO B;  2JWZ A;  5DCN A;  5CHF A;  2J7Q B;  1WX8 A;  3H1U A;  4F8C B;  3ALB A;  1NDD A;  2LJ5 A;  2CHW A;  3ZRF A;  2ZNV B;  3PHW B;  4OVV A;  4XZ4 A;  1E5W A;  1S1Q B;  4NAW B;  5L95 C;  2MWS B;  2NR2 A;  1UH6 A;  1TBE A;  3QQ8 B;  2K8C A;  4GDK A;  4KVG B;  3X23 A;  1E8Z A;  1YQB A;  3V60 A;  2K1F A;  2BF8 B;  2BYV E;  2LZ6 A;  3KUC B;  3QHT A;  4KDL B;  2JPH A;  2KWV B;  1XQQ A;  1XD3 B;  2LGX A;  1VD2 A;  4II3 B;  4FHJ A;  4I6N B;  2ASQ A;  5AZG A;  2KX3 A;  4NQL B;  1PQS A;  2AWT A;  2G45 B;  4TQ1 A;  1LXD A;  2IO2 B;  2IY0 B;  1EF5 A;  2ZZP B;  3APD A;  4G0N B;  3VXW A;  3NY5 A;  2R2Q A;  5GMV A;  4PS7 A;  2MRP A;  2ZPN A;  2GMI C;  3KVF B;  2JUO A;  3NOB A;  2BKF A;  1WY8 A;  2K6Q A;  4XX5 A;  3WAM A;  3MHS D;  2KDE B;  3ZVV A;  3PGE A;  5AZF A;  2M17 A;  2KO3 A;  2Y5B B;  4NQK E;  1WJ4 A;  3DBS A;  2KWC A;  1P9D U;  3IFW B;  4ZRJ A;  2BWF A;  4K7U A;  4IC7 B;  5IAA C;  1M94 A;  5KHO A;  4AJW A;  3OJ4 B;  4A3P A;  3APF A;  3RYT A;  2BGF A;  3ZNI D;  2ZNV C;  5JH5 C;  1WX7 A;  4GIV A;  1GC6 A;  2C7M B;  2GBR A;  1LFD A;  4ICV A;  3ZW3 A;  3D32 A;  2JVC A;  4DDG D;  4KZ0 A;  5BO4 B;  2PPH A;  2KLG A;  2N1V A;  4W9H A;  1Z5S B;  2K8B A;  3PLV A;  1V5T A;  2FCN A;  2RD0 A;  3AXC A;  4W9C A;  5TR5 A;  3VUW A;  3WAN A;  2RGF A;  3ZNG C;  3ZNH B;  1WXM A;  4GXB A;  2KFK B;  2KWU B;  4JQW C;  1WR6 E;  3H7S A;  3IG3 A;  4HLE A;  1J0G A;  2G4S A;  5G2N A;  3ZDM C;  4WJP A;  2KLC A;  3PRE A;  4BKT A;  1R4N I;  2JRI B;  2PE9 A;  3RCZ A;  1WGH A;  3VDZ A;  2BYF A;  3A4R A;  3TJP A;  4HDO A;  1IPG A;  4NNJ B;  2N4F A;  1UBI A;  2O6V D;  5DPR A;  1WZ0 A;  2DHZ A;  1NI2 A;  2Z0D B;  2K6D B;  2LRU A;  3APC A;  4NAW A;  3B0A A;  4W9J A;  2BPS A;  2KHW B;  4EOY A;  4RMA A;  2V4L A;  1UD7 A;  3L54 A;  3RT3 B;  2DYB A;  1LQB A;  3PZD A;  2L7R A;  4MGK E;  3VTV A;  4BBN F;  5D7G A;  3DVN V;  4BOZ B;  1V5O A;  2LWP A;  4LDT B;  4X57 B;  5E6N A;  4IWO A;  3PTF C;  4DDI D;  2IBI B;  2MA9 B;  2R2O A;  4CHK A;  4NJ7 A;  1C3T A;  1X1M A;  4I6P A;  2DAF A;  1YJ1 A;  1SGH A;  2D10 A;  2Z0E B;  4PYZ A;  1H8C A;  4KSK C;  4URK A;  2CU1 A;  2D07 B;  2I1J A;  4WWN A;  3NZS A;  2DZI A;  3DVG X;  1UZX B;  2NCN A;  3V6E B;  3ZLZ A;  1WF9 A;  1WJN A;  1Q5W B;  3GZN I;  3KYC D;  1NBF C;  1WMH A;  2D2Q A;  3WIM A;  3ZUN A;  4MSQ B;  3CF6 E;  2KQ7 A;  2N9X A;  4JIO U;  2D3G A;  2UYZ B;  4FUL A;  4LCD E;  1U4A A;  4W9I A;  1E8Y A;  1WM3 A;  1WH3 A;  3M95 A;  5CTR C;  2L05 A;  4J6I A;  2PJH A;  5JHA A;  1WRD B;  5J17 A;  4F7Z A;  2XBB C;  3R7R A;  2DAJ A;  3KUZ A;  2OOB B;  1IYF A;  4GB9 A;  4FN2 A;  1BT0 A;  4W9D A;  1Y8R C;  4DHJ B;  4DWF A;  4ZRK A;  4N9F 4;  1OEY J;  4KDI C;  2LXC A;  4OVU A;  5DPW A;  4NY0 A;  1J8C A;  3A9K A;  2FIF A;  2LGD A;  5AEK B;  2MLB A;  3C0R B;  3K9P B;  3L13 A;  4M8M A;  3OJ3 A;  2J0K A;  2DEN B;  3ECI A;  3W1S A;  4MDK E;  3P2B A;  1OEY A;  3TBL D;  5DPT A;  3GOE A;  1ZGU B;  5L83 A;  1WE6 A;  1UBQ A;  2ZCC A;  4IW0 A;  3IVF A;  3ZO5 B;  1RRB A;  2DZK A;  2YLM A;  2FUH B;  2KKC A;  2LD9 A;  2W9N A;  4BFR A;  4MGY E;  1EO6 A;  2BWE S;  4CYE A;  3WAO A;  3RD2 A;  1L2N A;  1C1Y B;  2HD5 B;  3OLM D;  5D94 A;  1V86 A;  4HCN B;  3DBL I;  2HJ8 A;  4MEM A;  4RM9 A;  2NBU A;  4DHZ E;  4IM2 A;  2N9E B;  2JZ3 B;  4AUQ C;  3TCA A;  3DCG A;  4ZRI A;  2I1K A;  2KDB A;  3EEC A;  2AEH A;  1RLF A;  4TQ0 A;  3H9D A;  3WA0 A;  2RPQ A;  3U8Z A;  2MW5 A;  2Z59 B;  3NHE B;  4EFO A;  1EUV B;  3VTW A;  3AU4 A;  3N30 A;  5JZE B;  4AP4 C;  5G55 A;  2ZCB A;  4E74 A;  3UIO B;  4BKS A;  1E7V A;  3HK0 A;  3H7P A;  3IBE A;  3CST A;  2AL6 A;  1MG8 A;  2IO1 B;  1E8W A;  4ANV A;  3H6N A;  3L16 A;  3A1Q B;  1WR1 A;  2KOX A;  2WDT B;  2N1W A;  4LJO B;  4MEL A;  4MJS A;  4PYU A;  4TV3 A;  4W9K A;  4CO7 A;  4E71 A;  4EZL A;  2C5L C;  5D6J B;  1K8R B;  2FCS A;  2RR9 A;  4B95 A;  2KTR A;  3B08 A;  4DK5 A;  2HTH A;  4JGH B;  1V49 A;  3PT2 B;  3CSF A;  3VUY A;  2D11 A;  3PLU A;  3DQV A;  1GUA B;  1ISN A;  2PEA A;  3ZDT A;  3DVG Y;  3PHX B;  3VHT C;  3OAW A;  1KOT A;  3QWZ B;  3X0W A;  2KJ6 A;  2N9P C;  3LJ3 A;  2O2V A;  5LLI A;  1TGZ B;  4HK2 A;  4W9G A;  2OJR A; 
#chains in the Genus database with same CATH topology
 2L83 A;  2KJH B;  2RDH A;  1FPY A;  4QAY A;  1UF0 A;  2C9W B;  4IG7 B;  3NS1 A;  1F9J A;  3PVL A;  2WDR B;  2G1E A;  3AEE B;  2B76 B;  4K7S A;  3DVN U;  1QLB B;  1JRO A;  2DYO A;  4DXA B;  2GB1 A;  3BK1 A;  1E7U A;  1WGD A;  3MFG A;  3KWV A;  5HKH A;  3PRZ A;  1KLG D;  3DHH C;  2KN5 A;  2N7D A;  1DOX A;  3W2D A;  3CIR B;  2QC8 A;  3L17 A;  4M0W B;  2I2Y A;  1UEL A;  3J9C A;  5IN7 A;  4WJN A;  4DBG A;  2IO3 B;  3Q6B A;  1Q10 A;  1V80 A;  2FAZ A;  3ML8 A;  4IWP A;  1TYG B;  4XWW A;  1XT9 B;  2CJN A;  1J19 A;  1IBX B;  1ZP0 B;  4WWP A;  2MBB B;  2KZR A;  3C8Y A;  4GDK B;  3DPD A;  1I4R A;  2O2V B;  4ZRQ A;  3GB1 A;  2LXA A;  2V3P A;  3JVZ X;  3PV1 A;  1P7E A;  2JWU A;  1YNT E;  3ZJU A;  2G4D B;  1V9J A;  2W3S A;  5CX3 A;  3HHM A;  3AE1 B;  1NEK B;  2LFI A;  3AV8 A;  3EGR A;  4OW0 A;  4K7W A;  4S17 A;  3QCA A;  2V0G A;  1RWS A;  2K5P A;  5HFY A;  1C79 A;  1I7H A;  2LUM A;  2Z8L A;  5LXI B;  3FKY A;  1TS5 A;  3N1Y C;  1A5R A;  2LVP A;  3UGB B;  3QAQ A;  3QIJ A;  3RMK C;  4Q2J A;  4BKG A;  5FKA C;  4G11 A;  5EDS A;  2N7J A;  4NPN A;  2PVO D;  1HTO A;  4G50 A;  1TKG A;  1SE4 A;  3W1Y A;  3HVZ A;  1IP9 A;  1WX9 A;  4MGI E;  2WWZ A;  4WUR A;  1KLV A;  1PDX A;  2AL3 A;  4KSL C;  2O6V B;  4AQ7 A;  4K3C A;  1CK1 A;  3BVZ A;  2N7E A;  2K39 A;  2M0A A;  4ZOH C;  2M56 B;  2NMQ A;  4HDQ A;  4FJY A;  1UWX A;  4NAM A;  1DOI A;  2KXJ A;  1V97 A;  1BXT A;  2NBV B;  2ZJD A;  2HE7 A;  1I4P A;  4AWJ A;  2LAS A;  1RYJ A;  2KFJ A;  3M63 B;  1T0Y A;  4YXD B;  2QIL A;  2KTF A;  4MJS B;  3R3M A;  1WXA A;  2GBK A;  1LM8 B;  2KTR B;  1J7B A;  2L00 B;  4FAD A;  1P1A A;  3RNA C;  2KD0 A;  1I42 A;  1ZDV A;  1F77 A;  4LNI A;  5MPO A;  4DHJ D;  4I6L B;  3I5J C;  3RNC C;  3ABV B;  3HIZ A;  2PTL A;  1EF1 A;  1NEN B;  4JWS C;  4S0R A;  2MCN B;  3Q69 A;  4ASW C;  4US8 A;  2V4I B;  2KMC A;  2NPT A;  2MHJ A;  4IUM B;  1KTK A;  3ZQ4 A;  3PRP B;  2INC C;  2ICI A;  2L0T A;  4BZA A;  3PZ8 A;  2V1Y A;  2REX A;  3AUL A;  2IDY A;  3QAR A;  2W55 A;  2EMT A;  1K52 A;  1E6E B;  3IT6 B;  1FCL A;  3GE8 C;  2BQQ A;  1TJE A;  2MBE A;  2CKH B;  1TZO A;  1IUE A;  4FJV B;  3C19 A;  4KGS A;  4EEW A;  2ZVN A;  1WZ3 A;  1FFV A;  3EHV A;  5BMG A;  2L3Z A;  2KNB A;  3ZGZ A;  2JWZ A;  3KLS X;  5CHF A;  1N63 A;  4OVV A;  4XZ4 A;  1E5W A;  4NAW B;  3LXF A;  3GE3 C;  1UH6 A;  4IKG A;  3RPF C;  1VZ6 A;  2HDE A;  2HJ1 A;  3URY A;  2BYV E;  2LZ6 A;  3Q8C A;  2LGX A;  1XLQ A;  3RFZ B;  2KX3 A;  2AWT A;  2Y5P A;  4TQ1 A;  4LNK A;  2IY0 B;  2ZZP B;  2BKF A;  3WAM A;  3TSS A;  1YJJ A;  3DBH B;  4A90 A;  4NQK E;  1WJ4 A;  3IFW B;  1EWC A;  1SBB B;  3FAH A;  2PW9 A;  1N5W A;  4DXG A;  3RYT A;  3AEF B;  2QJL A;  4ZHO A;  1GC6 A;  1C9F A;  1VRA B;  2CU3 A;  1JWS D;  3SFE B;  1F2R C;  3WAN A;  1YQ3 B;  3AXC A;  4W9C A;  4JQW C;  2RDB C;  2AQ3 B;  2KLC A;  2PE9 A;  2WGS A;  1WGH A;  1C78 A;  2Z0D B;  2DHZ A;  1NI2 A;  5IOI A;  4NAW A;  1JW9 D;  1ACC A;  1D5M C;  3RT3 B;  1PFD A;  3N20 C;  1NYR A;  2N9K A;  2KQ4 X;  3PTF C;  2MA9 B;  2DAF A;  3BZD B;  1B9R A;  2D10 A;  1H8C A;  4KSK C;  5H8Y E;  3NZS A;  2OHF A;  1WF9 A;  1WJN A;  2DNF A;  3BYT B;  2D2Q A;  3ZUN A;  2INP E;  3CF6 E;  2WS3 B;  2N9X A;  4FUL A;  1U4A A;  2H88 B;  5CTR C;  2PKO A;  4HRO A;  4F7Z A;  3R7R A;  1AW7 A;  1XCT L;  4ZRK A;  1OEY J;  5I4D A;  2LXC A;  2Q5W D;  1J8C A;  4NY0 A;  2MLB A;  3K9P B;  3L13 A;  5HG2 A;  1OEY A;  1YN5 A;  3ZO5 B;  2YLM A;  3IXS A;  2FUH B;  2KKC A;  2LD9 A;  4MGY E;  3BK2 A;  4CYE A;  1L4Z B;  2I38 A;  4RM9 A;  2WNM A;  2GI9 A;  2JZ3 B;  4AUQ C;  5FR3 A;  2KDB A;  3IAM 1;  2RPQ A;  3U8Z A;  1EUV B;  3N30 A;  2WXR A;  4AP4 C;  4BKS A;  3CST A;  1E8W A;  1F52 A;  3L16 A;  5E6J A;  1WR1 A;  2KOX A;  4LJO B;  3U7Z A;  1T0Q C;  3MC9 A;  4CO7 A;  1EM7 A;  3Q8B A;  4B95 A;  2KTR A;  2G9H D;  4DK5 A;  1AN8 A;  4WH4 A;  5EE1 A;  4C7Z A;  1C77 A;  3DQV A;  2PEA A;  3DVG Y;  5G5G A;  1KOT A;  1FD6 A;  2N9P C;  3LJ3 A;  4KKI A;  3TEZ A;  1TGZ B;  3BYY B;  3NZ3 A;  2J53 A;  1GPX A;  1VCB A;  2WHI A;  3DBR I;  4LNO A;  4BAX A;  3L08 A;  1N60 A;  4P7I A;  3MJ5 A;  2WXJ A;  3R8B A;  5D3D A;  4YSY B;  4P1C C;  4G3X B;  3VH3 B;  2M19 A;  3AE6 B;  1SSN A;  3AU5 A;  5KHQ A;  2WXN A;  1P7F A;  3L0W B;  4KIK A;  1V2Y A;  2PLP A;  4USA A;  1GAQ B;  3TMP B;  2D3A A;  4LLG M;  2RSU A;  2EMS A;  2KDF B;  1L4D B;  1JAL A;  1FNU A;  1R4M I;  2LGI A;  4WJQ A;  2M0X A;  4KKJ A;  1EWY C;  2GOW A;  1KF6 B;  1R4N B;  3N1Z C;  2M8S A;  4HJG E;  4GU2 A;  4ANW A;  4HCP B;  2RMM A;  5IP4 D;  4M00 A;  4C7Y A;  2MBQ A;  1JWA D;  1UGM A;  3N3K B;  1H4R A;  2OJW A;  4GLS C;  2KK8 A;  3O65 B;  5JHB A;  3ZNZ B;  4FHK A;  2NTT A;  2H89 B;  1YD8 U;  3N32 A;  5D2M B;  2MBH A;  3ML9 A;  2KYW A;  2IZV B;  5J2R A;  1D5Z C;  4HXD A;  2J0J A;  1WXS A;  3BIN A;  3JW0 X;  4L1B A;  1D3Z A;  4YWG G;  3NVY A;  1B1Z A;  1FXA A;  1WMH B;  2BYE A;  4WIP A;  1CZP A;  4IWQ A;  2CS4 A;  1SXT A;  2IYD B;  4FLH A;  2BVC A;  3QA8 A;  4PS3 A;  1GOZ A;  3AE4 B;  5C23 A;  2MEK A;  3B1L X;  1FNV A;  1GG3 A;  2LVQ A;  2JY6 A;  1Y56 A;  2AQ2 B;  4IM3 A;  2YVC A;  2ON8 A;  3AN1 A;  2KFK A;  2JQR B;  4HKZ E;  3DOW A;  3UIP B;  2J4X A;  3A9J A;  1V6E A;  5G5H A;  3SD5 A;  1YX6 B;  1QOF A;  1WGK A;  4HPM B;  5E6P A;  4TKN A;  1WGG A;  2JF5 A;  1Z2M A;  3TEX A;  3R7Q A;  1MFW A;  4BOS C;  4HWI B;  4ANU A;  3AI5 A;  2UWQ A;  5C1Z A;  1ROE A;  3P63 A;  3V62 A;  3IHP C;  4MGZ E;  1JWB D;  4AOF A;  1BUI C;  2FNJ B;  2IPK D;  1MJD A;  5TSS A;  2VZK D;  2XK5 B;  4TMA B;  2QHO A;  3R66 C;  3DDC B;  3I3T B;  2DZJ A;  4A9A A;  2K8H A;  3GZN B;  4LJP B;  2YEP F;  3ETR A;  2KC2 A;  3QX1 A;  1CJE A;  4ANX A;  3ONS A;  1GNU A;  4OHJ A;  4B6W A;  4EE2 A;  2DBY A;  2CR5 A;  3T3N A;  3Q3M C;  3AB5 A;  3KYD D;  1WXV A;  2KDI A;  1XCQ L;  1E90 A;  4W9E A;  3RZW C;  2ZEQ A;  3HM3 A;  5GXG B;  2DX5 B;  3AE8 B;  3HM6 X;  4HKQ A;  4RF1 A;  2LVO A;  1FRD A;  3OG5 A;  3EC8 A;  2WU2 B;  4ZYN A;  2KWD A;  1D5X C;  1YQ4 B;  3ZKJ C;  3NRZ A;  1SE9 A;  4JX1 C;  5BYR A;  3MTN B;  2DZM A;  1CMX B;  4F1S A;  2JXX A;  4HPP A;  3DWG C;  3O13 A;  4EUT A;  1HZ5 A;  4WWO A;  1L7Y A;  4DXF A;  4GGQ A;  2WX0 A;  4US9 A;  2EKE C;  5LXH A;  3MJW A;  1WE7 A;  1YMH E;  4HRS A;  1WSP A;  1NDD A;  2LJ5 A;  3ZRF A;  3PHW B;  3L4P A;  4A8X C;  4M02 A;  4TSS A;  1S1Q B;  1D6E C;  2MWS B;  2NR2 A;  1RFK A;  4GDK A;  5T8I A;  2BB5 A;  1OQR A;  3QHT A;  2KWV B;  1XQQ A;  5AZG A;  4RFB A;  1V1O A;  4NQL B;  1PQS A;  2D3C A;  2PVG C;  1LXD A;  1AYF A;  1FXI A;  1EF5 A;  1FM0 D;  5AUK A;  4B0M A;  1ZOY B;  4MT5 A;  5GMV A;  5BYQ A;  2ZPN A;  3KVF B;  3NOB A;  2JUO A;  3LB8 C;  2HTM E;  3ZVV A;  2UU7 A;  2Y5B B;  1NVI D;  1K51 A;  1KH0 A;  2VH1 A;  5KHO A;  4RGT A;  4YSX B;  3ZNI D;  1BML C;  3FC4 A;  5JH5 C;  2IGG A;  3D32 A;  3RNG C;  2JVC A;  3RNB C;  4DDG D;  4KZ0 A;  2PPH A;  4R3D A;  4LK0 M;  3AEB B;  2JZP A;  1V5T A;  3VUW A;  4YSZ B;  1EU4 A;  1K50 A;  3MHZ A;  4DQO C;  4WJP A;  4BKT A;  1R4N I;  2JRI B;  3RCZ A;  2JSV X;  3AM9 A;  4HDO A;  2O6V D;  4ZRP A;  3APC A;  4RH6 A;  2K6D B;  4W9J A;  2BPS A;  4OZB A;  2V4L A;  4OZC A;  1JQ4 A;  4BBN F;  5D7G A;  4BOZ B;  4X57 B;  4IWO A;  2WXF A;  3VR9 B;  2R2O A;  1C3T A;  1MPE A;  4M0W A;  4XGA B;  1R7S A;  4PYZ A;  4URK A;  5JXV A;  5EE0 A;  1XLO A;  3WIM A;  2KQ7 A;  4JIO U;  2WXQ A;  1WH3 A;  2Y3A A;  3M95 A;  2L05 A;  3OWE B;  2XBB C;  1IYF A;  1BT0 A;  1Y8R C;  2AQ1 B;  4DWF A;  1IGC A;  4N9F 4;  3I63 C;  3A9K A;  2FIF A;  2LGD A;  4HK2 A;  3C0R B;  3ECI A;  1SJE D;  5L83 A;  3P2B A;  3TBL D;  2BTE A;  4IOI E;  1SJH D;  1WE6 A;  1RRB A;  4BFR A;  3R2T A;  3WAO A;  2AX5 A;  3TEW A;  3OLM D;  1V86 A;  3AEC B;  4HCN B;  4MEM A;  2E3T A;  1L6U A;  3Q3O C;  3E56 A;  3DCG A;  5HI1 A;  3EEC A;  1I4Q A;  2RDG A;  3VTW A;  4OZA A;  1FCC C;  4E74 A;  1C4C A;  2AL6 A;  4ANV A;  3H6N A;  4PYU A;  3KQ4 A;  3RZF A;  2WDT B;  4E71 A;  3AH7 A;  5D6J B;  2RR9 A;  2HTH A;  4JGH B;  3PT2 B;  5BMI A;  2MJ3 A;  3RI7 C;  1T6B X;  2J52 A;  3X0W A;  2WXP A;  4RNA A;  5C3J B;  4WWN A;  2Y5C A;  2A4Z A;  1TIF A;  1FNW A;  1L0V B;  4N59 A;  1WWT A;  1HTQ A;  1P3Q U;  5D3I B;  3WAP A;  1JCK B;  1TY2 A;  1WYG A;  2IO0 B;  3TL5 A;  3PZ7 A;  1V81 A;  1WM2 A;  4GOC A;  3UI3 A;  1I4X A;  4PS8 A;  1Q1O A;  4RM8 A;  3SU8 X;  1KJT A;  3LYY A;  2KVR A;  3K9O B;  1QKZ A;  3RUI B;  3V61 A;  1FXT B;  2WXK A;  4LDT D;  3PRM B;  1FRR A;  3BII D;  2JT4 B;  1OGW A;  4WJO A;  3Q14 C;  4RF0 A;  1F1H A;  1M4V A;  1IGD A;  5FK9 C;  3CMM B;  3P4Q B;  3FIL B;  4C00 A;  3N1X C;  3UQB A;  4H2A A;  1ZUD 2;  4BKS D;  5FR6 A;  1YN4 A;  2DYM A;  3ZTD A;  3L10 B;  2LI5 A;  1TZ1 A;  4JE3 B;  1RAX A;  2L32 A;  5EE9 A;  3VQI A;  3N9Y C;  4REZ A;  4ARI A;  2GBN A;  2GBM A;  1MHH E;  2B3A A;  3VVW B;  4M8N A;  1J7C A;  1ZW7 A;  4HJK A;  1TY0 A;  3SHQ A;  1YX5 B;  3PPA A;  4YL8 A;  1G6J A;  1C4A A;  2CHZ A;  3NJT A;  1SIF A;  3ENE A;  3SFD B;  2WP9 B;  3U4E G;  4RGN A;  4EZK A;  2C60 A;  4A55 A;  3P4P B;  4EKU A;  4HVB A;  3Q8A A;  4N58 A;  2SAK A;  2WYQ A;  3E9S A;  1HE8 A;  5CHV C;  1C4P A;  2XK5 A;  1SE2 A;  2MSE D;  2BS3 B;  2BKR B;  1WGY A;  5IA7 A;  2XNA C;  3UIN B;  2IND C;  2NBW B;  2K0P A;  3W5U B;  1YOV B;  5E6O A;  3NZU A;  1HQR D;  2ZW0 A;  1WJ6 A;  1JML A;  3M3J A;  4FBJ B;  1QZE A;  2XEW A;  2AYO B;  1TKE A;  3KUD B;  2MQJ A;  1OFF A;  4XC2 A;  4N6E B;  2QSD A;  3KWL A;  1N6Z A;  3A9J B;  2WXO A;  1E8X A;  2WXI A;  3QC8 B;  4HPL B;  4DHZ B;  4JPS A;  2JRH A;  2QDF A;  2INN E;  3A4S C;  2C7N B;  2FE8 A;  3VFK A;  1LGR A;  3JYU A;  3V3X A;  4B9K A;  2FCM A;  3ZRC A;  3UF8 A;  2JYT A;  4ZYS A;  1S3S G;  3NVZ A;  4NJC A;  4II2 B;  1Q0W B;  4MSM B;  1IBX A;  2O6V A;  1TS4 A;  1XO3 A;  2ZPY A;  3EFC A;  2BT6 A;  3B9J A;  4RCO A;  4JLC A;  2CJO A;  4HEA 1;  2MBO A;  4P16 A;  3RUL A;  1WYW B;  3EA6 A;  4GDL B;  4FXC A;  1NI3 A;  4W9L A;  4ZHP A;  3S2A A;  1WGR A;  1AAR A;  4ITK A;  3VAW A;  4IM0 A;  3A1Q A;  5CHW A;  4B0E A;  3SDL C;  2L76 A;  3EFU A;  4P6V F;  2BS4 B;  2KMA A;  3Q3F A;  1DOY A;  1N61 A;  5DCN A;  1WX8 A;  4RGO S;  3H1U A;  4F8C B;  2CHW A;  2ZNV B;  4XWT A;  1PUT A;  1PGB A;  4C80 A;  3QQ8 B;  3T3O A;  4KVG B;  1E8Z A;  2BYT A;  2MJD A;  4II3 B;  3B2F A;  4FHJ A;  2ASQ A;  3RN9 C;  2W3R A;  2IO2 B;  3APD A;  3VXW A;  2R2Q A;  3NUH B;  1EU3 A;  2QMT A;  4PS7 A;  2MRP A;  1WY8 A;  2K6Q A;  4C4V B;  2KDE B;  1YJI A;  1TS2 A;  1UUP A;  3PO0 A;  1TT5 B;  1VDV A;  2KO3 A;  3DBS A;  2W82 A;  2KWC A;  5IAA C;  3B2G A;  4AJW A;  3OJ4 B;  1XLN A;  4A3P A;  1ENF A;  2ZNV C;  1WX7 A;  1LFD A;  3CWI A;  4ICV A;  3ZW3 A;  5IO9 A;  2X8X X;  5BO4 B;  4MH8 A;  2KLG A;  5BYS A;  4W9H A;  3PLV A;  2FCN A;  5BMH A;  5TR5 A;  1C76 A;  3ZNH B;  2KFK B;  1SB3 C;  2KWU B;  4HLE A;  1WR6 E;  1J0G A;  2G4S A;  5G2N A;  3AMZ A;  3FIL A;  3PRE A;  1KFY B;  4OVZ A;  3VDZ A;  3A4R A;  3AE9 B;  3TJP A;  2BB6 A;  2N4F A;  1L0Y B;  5DPR A;  1RM6 C;  2LRU A;  3B0A A;  4EOY A;  4A6Q A;  1HZ6 A;  1UD7 A;  3L54 A;  2DYB A;  4MGK E;  3VTV A;  3DVN V;  2MJE A;  2TSS A;  2LWP A;  4LDT B;  5E6N A;  4DDI D;  4MAC A;  4I6P A;  1ZPS A;  1YJ1 A;  2GLS A;  1I4G A;  2ACZ B;  2PMV A;  2IGH A;  3W9C B;  1XXG A;  2D07 B;  2IJ0 A;  3V6E B;  2DZI A;  3ZLZ A;  1UZX B;  2NCN A;  2WXG A;  1Q5W B;  3GZN I;  3KYC D;  3U2S C;  4MSQ B;  1JRP A;  2UYZ B;  4LCD E;  4W9I A;  2E6X A;  4J6I A;  2PJH A;  4L23 A;  1WRD B;  3AED B;  5JHA A;  3P4R B;  2DAJ A;  4GB9 A;  4FN2 A;  4W9D A;  1V1P B;  4KDI C;  2WXH A;  4OVU A;  5DPW A;  3AE3 B;  3V05 A;  3W1S A;  3OJ3 A;  2J0K A;  2DEN B;  3GOE A;  1ZGU B;  2ZCC A;  2DZK A;  3VRA B;  1VJK A;  1EO6 A;  1AWD A;  3RD2 A;  1L2N A;  5D94 A;  3I9V 1;  1DYQ A;  5AUI A;  4DHZ E;  4IM2 A;  1T0R C;  2LGS A;  4ZRI A;  3TCA A;  1CQV A;  4TQ0 A;  3H9D A;  3BVM A;  5JZE B;  4XDC A;  3IBE A;  1E7V A;  3H7P A;  3EUB 2;  4MJS A;  1JWM D;  2N1W A;  3Q8E A;  4MEL A;  4W9K A;  1MVK A;  1HEZ E;  1K8R B;  2FCS A;  3B08 A;  2NTS A;  3U52 E;  1V49 A;  3VUY A;  2D11 A;  2WU5 B;  1WXQ A;  1GUA B;  3AEG B;  3ZDT A;  2D3B A;  3PHX B;  1VR9 A;  3QWZ B;  1SF0 A;  2KJ6 A;  1K53 A;  5LLI A;  1F2R I;  4W9G A;  2OJR A;  4YTM B;  4YTP B;  2JYE A;  3ZTC A;  1TTN A;  1FIQ A;  1KLU D;  3DBH I;  4KV2 A;  2VRR B;  4NJ6 A;  5IKC M;  2V3S A;  4LNF A;  4W9F A;  2K25 A;  2FCQ A;  3WAL A;  4BBN C;  2MX2 A;  1YN3 A;  4AJY B;  3BWU D;  5J18 A;  1SIJ A;  1VZ7 A;  2LGY A;  1A70 A;  4GN1 A;  4EZJ A;  2NS5 A;  2V3N A;  2CHX A;  3SR6 A;  2GRI A;  4XE0 A;  1WRI A;  3MC0 B;  3U7D A;  3VUX A;  2GBJ A;  2LJI A;  2KJR A;  3NVV A;  2PIA A;  2J0M A;  1TKY A;  1L0X B;  3T9L A;  1WI0 A;  2JU6 X;  5C2T B;  3QJZ A;  3ZXR A;  4WAF A;  1KRH A;  3U30 A;  3NS8 A;  4WWM A;  1JRU A;  4ARC A;  3JSV B;  2QEJ C;  1I35 A;  4ZDV A;  2DWQ A;  3PS6 A;  1ET9 A;  2DLB A;  2JXT A;  1STE A;  3DHI C;  4K81 A;  4FJZ A;  2L8J A;  4NZL B;  2KQS A;  1WFY A;  2WQY B;  3IAS 1;  1QIL A;  4MH0 E;  2EEL A;  2K3U A;  1P0R A;  2KN4 A;  1E10 A;  4LNN A;  4PK1 A;  4LTU A;  3ZIM A;  4FA6 A;  2LHD A;  2FID A;  3A33 B;  4A3O A;  2NVU I;  3NVW A;  1PGX A;  4TUU A;  1J7A A;  3V6C B;  3DHG C;  3P4S B;  4RGM A;  4UDU C;  4D2K A;  4KIK B;  2A5U A;  3Q3N C;  1GC7 A;  4KZC A;  1ZKH A;  3Q8F A;  3W5V B;  1FMA D;  3H7P B;  1SE3 A;  4MM3 A;  2L52 A;  1FFU A;  1MHX A;  2M4N A;  4PT5 A;  3I57 A;  3HVD A;  4K1R B;  4IDI A;  4JWU C;  3KW5 B;  2C7H A;  2MP2 B;  1HA5 A;  1V8C A;  2KVZ A;  1NYQ A;  1PYW D;  4O1N A;  1E9M A;  1KM7 A;  2M1M A;  3W1S C;  4KX6 B;  1T3Q A;  4AS1 A;  2RPV A;  3BY4 B;  1GB1 A;  2OED A;  1RFA A;  3HRD D;  3TIX A;  3AEA B;  2BW2 A;  1MG4 A;  5AZH A;  3Q3J A;  1UWM A;  1FO4 A;  3IT4 B;  1WIA A;  2LUE A;  2LHE A;  4A20 A;  3DBR B;  2ONQ A;  2KDM A;  2PE6 B;  3LDZ E;  1P98 A;  2NPT B;  2R61 A;  2G3Q B;  5H92 C;  3PSE B;  1ZXH A;  2KAN A;  3T8M A;  2KC1 A;  2VH2 A;  4M01 A;  3ZYY X;  4JL9 A;  2J42 A;  4GDL A;  4GMV A;  1MI0 A;  4K3B A;  2L0F A;  2JZZ A;  4MM3 B;  1F0Z A;  1WJU A;  4GSW A;  1OQY A;  1YIW A;  3UQA A;  3M62 B;  1ET6 A;  3JSV A;  4BVU C;  3QK0 A;  1GJZ A;  2V9H A;  3RNE C;  1OTR B;  1QT9 A;  2XN9 C;  2KMM A;  2MP2 A;  3DBL B;  3KH0 A;  1T5X D;  4XDD A;  2KX0 A;  1XLP A;  2IY1 B;  3SEB A;  1PGA A;  4J3O D;  3HUI A;  1XEE A;  5DPS A;  1N5X A;  2WX1 A;  2LRW A;  4WAA A;  1R4M B;  1DGJ A;  3VTU A;  4ICU A;  4E3C A;  3VH4 B;  1ZE3 D;  3A9K B;  2WXM A;  2ZVO A;  4WQO B;  3ZXV A;  2J7Q B;  3ALB A;  5L95 C;  1FEH A;  1L6V A;  1TBE A;  2K8C A;  3MP9 A;  3X23 A;  1YQB A;  2K9X A;  3V60 A;  2K1F A;  4C56 C;  2BF8 B;  3KUC B;  4KDL B;  2WLB A;  1T0S C;  2JPH A;  2VZK B;  4ACF A;  1XD3 B;  1VD2 A;  4I6N B;  1XF5 L;  2G45 B;  2D5G A;  2QIE B;  4G0N B;  1VLB A;  4YT0 B;  3NY5 A;  2LEK A;  2L1A A;  1I4H A;  2GMI C;  2KT7 A;  4XX5 A;  1HXY D;  3MHS D;  3VRB B;  3PGE A;  3RNF C;  5AZF A;  2M17 A;  3P42 A;  1P9D U;  1ZDX A;  4ZRJ A;  2BWF A;  4K7U A;  4IC7 B;  1M94 A;  5HHD G;  2KAJ A;  3ZJV A;  2FBW B;  4WQM A;  3APF A;  2BGF A;  5EE3 A;  4GIV A;  2C7M B;  2GBR A;  1L5P A;  2N1V A;  1Z5S B;  2K8B A;  1E7P B;  2RD0 A;  3ZNG C;  2RGF A;  1WXM A;  4GXB A;  3H7S A;  3IG3 A;  3AE2 B;  4C4V A;  3ZDM C;  3P1M A;  2WDV B;  1D4B A;  1LO5 D;  2QCZ A;  3R2I A;  2W54 A;  2BYF A;  3TEY A;  1IPG A;  1UBI A;  1QOA A;  2JX5 A;  1WZ0 A;  2KHW B;  4RMA A;  2MH7 A;  1ZXI A;  1LQB A;  3PZD A;  1E0Z A;  2L7R A;  2BS2 B;  1V5O A;  2IBI B;  4CHK A;  3Q2A C;  4NJ7 A;  3MC8 A;  2SEB D;  1X1M A;  3WCQ A;  3NG0 A;  1SGH A;  2Z0E B;  4KGT A;  1JWU D;  2CU1 A;  1N62 A;  2I1J A;  3DVG X;  1SEB D;  1NBF C;  1WMH A;  4L2Y A;  2D3G A;  2WDQ B;  1E8Y A;  1WM3 A;  4KGR A;  3TUO A;  3AE7 B;  2ZW1 A;  4XYC A;  5J17 A;  1TS3 A;  3H8H A;  3KUZ A;  2OOB B;  3ZJT A;  3DWM A;  4P1B C;  4DHJ B;  4YTN B;  2LMC A;  5AEK B;  2KAC A;  2BBC A;  4M8M A;  4MDK E;  5DPT A;  3VR8 B;  1UBQ A;  4IW0 A;  3IVF A;  2W9N A;  2BWE S;  1QQR A;  1C1Y B;  2HD5 B;  3DBL I;  1QOB A;  2HJ8 A;  2NBU A;  3GP7 A;  2N9E B;  2I1K A;  2AEH A;  1RLF A;  2FUG 1;  2X38 A;  3WA0 A;  2MW5 A;  2Z59 B;  3NHE B;  4EFO A;  2K22 A;  1UNS A;  3AU4 A;  1V1P A;  5G55 A;  2ZCB A;  2N9L A;  3UIO B;  3AE5 B;  3HK0 A;  1MG8 A;  2IO1 B;  2YEP B;  3A1Q B;  4TV3 A;  4EZL A;  2WXL A;  2C5L C;  2IGD A;  4CQN A;  5LNK 1;  1GB4 A;  3CSF A;  1VZ8 A;  3PLU A;  1ESF A;  1ISN A;  1QF6 A;  1QOG A;  3VHT C;  3OAW A;  2O2V A;  2N0S B;  3GS2 A;  1UGJ A;  3BVG A;  2EKI A;  4NNJ B;  1OQQ A; 
#chains in the Genus database with same CATH homology
 2KJH B;  2A4Z A;  1VCB A;  3ZTC A;  1TTN A;  3DBR I;  2C9W B;  3L08 A;  1P3Q U;  4P7I A;  4IG7 B;  3WAP A;  3DBH I;  1F9J A;  3PVL A;  4KV2 A;  4G3X B;  2IO0 B;  2VRR B;  4NJ6 A;  3TL5 A;  2V3S A;  4W9F A;  3VH3 B;  2K25 A;  1V81 A;  2FCQ A;  4K7S A;  3DVN U;  3WAL A;  1WM2 A;  4GOC A;  2MX2 A;  3AU5 A;  4BBN C;  4AJY B;  4PS8 A;  5KHQ A;  2DYO A;  1Q1O A;  3L0W B;  4DXA B;  2LGY A;  5J18 A;  4RM8 A;  3SU8 X;  4KIK A;  1E7U A;  1KJT A;  2KVR A;  4GN1 A;  4EZJ A;  1WGD A;  1V2Y A;  3K9O B;  2NS5 A;  2CHX A;  3RUI B;  3TMP B;  5HKH A;  3V61 A;  2RSU A;  3U7D A;  3PRZ A;  3VUX A;  2GBJ A;  2EMS A;  2N7D A;  1FXT B;  2KDF B;  2KJR A;  2KN5 A;  2J0M A;  3T9L A;  3L17 A;  4LDT D;  4M0W B;  1WI0 A;  3PRM B;  2JT4 B;  1OGW A;  4WJO A;  1UEL A;  3QJZ A;  4WJN A;  1R4M I;  3U30 A;  2IO3 B;  4DBG A;  4WJQ A;  2M0X A;  3NS8 A;  1JRU A;  4IWP A;  1V80 A;  2FAZ A;  3ML8 A;  2GOW A;  1XT9 B;  3JSV B;  1I35 A;  3CMM B;  4ZDV A;  3UQB A;  1J19 A;  3PS6 A;  2MBB B;  4WWP A;  2M8S A;  4BKS D;  4K81 A;  5FR6 A;  2KZR A;  4FJZ A;  2L8J A;  4GU2 A;  2DYM A;  4GDK B;  4ANW A;  4HCP B;  2KQS A;  3DPD A;  3ZTD A;  1WFY A;  2O2V B;  2MBQ A;  1UGM A;  2LI5 A;  3L10 B;  1H4R A;  3N3K B;  1TZ1 A;  2LXA A;  2KK8 A;  3JVZ X;  1RAX A;  3O65 B;  5JHB A;  3PV1 A;  3ZNZ B;  4MH0 E;  4FHK A;  2G4D B;  1P0R A;  1V9J A;  1YD8 U;  3N32 A;  3VQI A;  5CX3 A;  3HHM A;  5D2M B;  3ZIM A;  2GBN A;  4FA6 A;  2MBH A;  2GBM A;  3ML9 A;  2FID A;  4K7W A;  3A33 B;  4A3O A;  3QCA A;  2IZV B;  2B3A A;  2NVU I;  5J2R A;  3VVW B;  4TUU A;  4HXD A;  4M8N A;  2J0J A;  3V6C B;  5LXI B;  1WXS A;  3BIN A;  3JW0 X;  1ZW7 A;  4HJK A;  1D3Z A;  1A5R A;  3SHQ A;  1WMH B;  2LVP A;  1YX5 B;  2BYE A;  3UGB B;  3QAQ A;  3QIJ A;  3PPA A;  4KIK B;  2A5U A;  4YL8 A;  1G6J A;  1GC7 A;  4KZC A;  4IWQ A;  2CS4 A;  2IYD B;  4BKG A;  1ZKH A;  4FLH A;  3QA8 A;  4PS3 A;  2CHZ A;  4G11 A;  5C23 A;  5EDS A;  1SIF A;  3ENE A;  3B1L X;  3H7P B;  1GG3 A;  4EZK A;  2LVQ A;  4MM3 A;  2JY6 A;  2C60 A;  4NPN A;  4IM3 A;  2YVC A;  4EKU A;  4HVB A;  4G50 A;  2M4N A;  3W1Y A;  2KFK A;  1IP9 A;  1WX9 A;  4K1R B;  4MGI E;  2WWZ A;  3DOW A;  3UIP B;  2WYQ A;  3KW5 B;  1KLV A;  1HE8 A;  5CHV C;  2AL3 A;  2C7H A;  4KSL C;  2MP2 B;  2O6V B;  2XK5 A;  3A9J A;  2N7E A;  1V6E A;  2K39 A;  2MSE D;  2BKR B;  1WGY A;  5IA7 A;  4HDQ A;  3SD5 A;  3UIN B;  1YX6 B;  4FJY A;  4HPM B;  1KM7 A;  2NBW B;  2M1M A;  5E6P A;  3W1S C;  4TKN A;  1WGG A;  2JF5 A;  2KXJ A;  2NBV B;  1Z2M A;  2ZJD A;  5E6O A;  3NZU A;  2HE7 A;  3BY4 B;  1RFA A;  3R7Q A;  3TIX A;  4BOS C;  4HWI B;  4AWJ A;  5AZH A;  4ANU A;  3Q3J A;  2LAS A;  1WJ6 A;  3AI5 A;  3M3J A;  4FBJ B;  1QZE A;  2KFJ A;  3M63 B;  1T0Y A;  1WIA A;  2UWQ A;  2AYO B;  2KTF A;  2XEW A;  5C1Z A;  4MJS B;  3V62 A;  2LUE A;  3IHP C;  3KUD B;  4MGZ E;  2MQJ A;  4A20 A;  3R3M A;  1WXA A;  4XC2 A;  4AOF A;  2PE6 B;  3LDZ E;  2GBK A;  1LM8 B;  2KTR B;  2FNJ B;  2L00 B;  3RZF A;  2XK5 B;  4FAD A;  1P98 A;  3A9J B;  1P1A A;  2NPT B;  2QHO A;  2KD0 A;  1E8X A;  2G3Q B;  3QC8 B;  3R66 C;  3DDC B;  3I3T B;  4HPL B;  2DZJ A;  1I42 A;  3PSE B;  4DHZ B;  2KAN A;  3T8M A;  2K8H A;  4DHJ D;  2JRH A;  2KC1 A;  3A4S C;  4I6L B;  4LJP B;  2C7N B;  3VFK A;  4GDL A;  2KC2 A;  4GMV A;  3QX1 A;  4JL9 A;  3JYU A;  4ANX A;  3ONS A;  1GNU A;  2L0F A;  4B6W A;  4B9K A;  2CR5 A;  2JZZ A;  2FCM A;  3HIZ A;  3ZRC A;  1EF1 A;  3UF8 A;  1WJU A;  4GSW A;  3KYD D;  1OQY A;  1WXV A;  1YIW A;  2KDI A;  2MCN B;  3UQA A;  3M62 B;  1S3S G;  1E90 A;  3JSV A;  4W9E A;  3RZW C;  4ASW C;  2ZEQ A;  3HM3 A;  4BVU C;  3QK0 A;  1GJZ A;  2DX5 B;  4II2 B;  3HM6 X;  1Q0W B;  1OTR B;  2KMC A;  2NPT A;  4MSM B;  4IUM B;  2MP2 A;  2O6V A;  2LVO A;  3KH0 A;  3PRP B;  2L0T A;  3EC8 A;  2ZPY A;  4JLC A;  4ZYN A;  2KX0 A;  2MBO A;  2IY1 B;  2V1Y A;  2REX A;  1WYW B;  3AUL A;  3RUL A;  4GDL B;  3QAR A;  2EMT A;  5DPS A;  4W9L A;  2WX1 A;  3ZKJ C;  2LRW A;  4WAA A;  1WGR A;  3S2A A;  1AAR A;  3VTU A;  1SE9 A;  3VAW A;  4IM0 A;  4ICU A;  2MBE A;  3A1Q A;  2CKH B;  5CHW A;  3VH4 B;  4E3C A;  3MTN B;  2DZM A;  1CMX B;  3SDL C;  4FJV B;  3A9K B;  4F1S A;  2JXX A;  2ZVN A;  1WZ3 A;  4EEW A;  3EHV A;  4EUT A;  2L76 A;  3EFU A;  4WWO A;  1L7Y A;  4GGQ A;  2ZVO A;  2WX0 A;  2EKE C;  2L3Z A;  5LXH A;  3MJW A;  2KNB A;  2KMA A;  3Q3F A;  1WE7 A;  4WQO B;  2JWZ A;  5DCN A;  5CHF A;  2J7Q B;  1WX8 A;  3H1U A;  4F8C B;  3ALB A;  1NDD A;  2LJ5 A;  2CHW A;  3ZRF A;  2ZNV B;  3PHW B;  4OVV A;  4XZ4 A;  1E5W A;  1S1Q B;  4NAW B;  5L95 C;  2MWS B;  2NR2 A;  1UH6 A;  1TBE A;  3QQ8 B;  2K8C A;  4GDK A;  4KVG B;  3X23 A;  1E8Z A;  1YQB A;  3V60 A;  2K1F A;  2BF8 B;  2BYV E;  2LZ6 A;  3KUC B;  3QHT A;  4KDL B;  2JPH A;  2KWV B;  1XQQ A;  1XD3 B;  2LGX A;  1VD2 A;  4II3 B;  4FHJ A;  4I6N B;  2ASQ A;  5AZG A;  2KX3 A;  4NQL B;  1PQS A;  2AWT A;  2G45 B;  4TQ1 A;  1LXD A;  2IO2 B;  2IY0 B;  1EF5 A;  2ZZP B;  3APD A;  4G0N B;  3VXW A;  3NY5 A;  2R2Q A;  5GMV A;  4PS7 A;  2MRP A;  2ZPN A;  2GMI C;  3KVF B;  2JUO A;  3NOB A;  2BKF A;  1WY8 A;  2K6Q A;  4XX5 A;  3WAM A;  3MHS D;  2KDE B;  3ZVV A;  3PGE A;  5AZF A;  2M17 A;  2KO3 A;  2Y5B B;  4NQK E;  1WJ4 A;  3DBS A;  2KWC A;  1P9D U;  3IFW B;  4ZRJ A;  2BWF A;  4K7U A;  4IC7 B;  5IAA C;  1M94 A;  5KHO A;  4AJW A;  3OJ4 B;  4A3P A;  3APF A;  3RYT A;  2BGF A;  3ZNI D;  2ZNV C;  5JH5 C;  1WX7 A;  4GIV A;  1GC6 A;  2C7M B;  2GBR A;  1LFD A;  4ICV A;  3ZW3 A;  3D32 A;  2JVC A;  4DDG D;  4KZ0 A;  5BO4 B;  2PPH A;  2KLG A;  2N1V A;  4W9H A;  1Z5S B;  2K8B A;  3PLV A;  1V5T A;  2FCN A;  2RD0 A;  3AXC A;  4W9C A;  5TR5 A;  3VUW A;  3WAN A;  2RGF A;  3ZNG C;  3ZNH B;  1WXM A;  4GXB A;  2KFK B;  2KWU B;  4JQW C;  1WR6 E;  3H7S A;  3IG3 A;  4HLE A;  1J0G A;  2G4S A;  5G2N A;  3ZDM C;  4WJP A;  2KLC A;  3PRE A;  4BKT A;  1R4N I;  2JRI B;  2PE9 A;  3RCZ A;  1WGH A;  3VDZ A;  2BYF A;  3A4R A;  3TJP A;  4HDO A;  1IPG A;  4NNJ B;  2N4F A;  1UBI A;  2O6V D;  5DPR A;  1WZ0 A;  2DHZ A;  1NI2 A;  2Z0D B;  2K6D B;  2LRU A;  3APC A;  4NAW A;  3B0A A;  4W9J A;  2BPS A;  2KHW B;  4EOY A;  4RMA A;  2V4L A;  1UD7 A;  3L54 A;  3RT3 B;  2DYB A;  1LQB A;  3PZD A;  2L7R A;  4MGK E;  3VTV A;  4BBN F;  5D7G A;  3DVN V;  4BOZ B;  1V5O A;  2LWP A;  4LDT B;  4X57 B;  5E6N A;  4IWO A;  3PTF C;  4DDI D;  2IBI B;  2MA9 B;  2R2O A;  4CHK A;  4NJ7 A;  1C3T A;  1X1M A;  4I6P A;  2DAF A;  1YJ1 A;  1SGH A;  2D10 A;  2Z0E B;  4PYZ A;  1H8C A;  4KSK C;  4URK A;  2CU1 A;  2D07 B;  2I1J A;  4WWN A;  3NZS A;  2DZI A;  3DVG X;  1UZX B;  2NCN A;  3V6E B;  3ZLZ A;  1WF9 A;  1WJN A;  1Q5W B;  3GZN I;  3KYC D;  1NBF C;  1WMH A;  2D2Q A;  3WIM A;  3ZUN A;  4MSQ B;  3CF6 E;  2KQ7 A;  2N9X A;  4JIO U;  2D3G A;  2UYZ B;  4FUL A;  4LCD E;  1U4A A;  4W9I A;  1E8Y A;  1WM3 A;  1WH3 A;  3M95 A;  5CTR C;  2L05 A;  4J6I A;  2PJH A;  5JHA A;  1WRD B;  5J17 A;  4F7Z A;  2XBB C;  3R7R A;  2DAJ A;  3KUZ A;  2OOB B;  1IYF A;  4GB9 A;  4FN2 A;  1BT0 A;  4W9D A;  1Y8R C;  4DHJ B;  4DWF A;  4ZRK A;  4N9F 4;  1OEY J;  4KDI C;  2LXC A;  4OVU A;  5DPW A;  4NY0 A;  1J8C A;  3A9K A;  2FIF A;  2LGD A;  5AEK B;  2MLB A;  3C0R B;  3K9P B;  3L13 A;  4M8M A;  3OJ3 A;  2J0K A;  2DEN B;  3ECI A;  3W1S A;  4MDK E;  3P2B A;  1OEY A;  3TBL D;  5DPT A;  3GOE A;  1ZGU B;  5L83 A;  1WE6 A;  1UBQ A;  2ZCC A;  4IW0 A;  3IVF A;  3ZO5 B;  1RRB A;  2DZK A;  2YLM A;  2FUH B;  2KKC A;  2LD9 A;  2W9N A;  4BFR A;  4MGY E;  1EO6 A;  2BWE S;  4CYE A;  3WAO A;  3RD2 A;  1L2N A;  1C1Y B;  2HD5 B;  3OLM D;  5D94 A;  1V86 A;  4HCN B;  3DBL I;  2HJ8 A;  4MEM A;  4RM9 A;  2NBU A;  4DHZ E;  4IM2 A;  2N9E B;  2JZ3 B;  4AUQ C;  3TCA A;  3DCG A;  4ZRI A;  2I1K A;  2KDB A;  3EEC A;  2AEH A;  1RLF A;  4TQ0 A;  3H9D A;  3WA0 A;  2RPQ A;  3U8Z A;  2MW5 A;  2Z59 B;  3NHE B;  4EFO A;  1EUV B;  3VTW A;  3AU4 A;  3N30 A;  5JZE B;  4AP4 C;  5G55 A;  2ZCB A;  4E74 A;  3UIO B;  4BKS A;  1E7V A;  3HK0 A;  3H7P A;  3IBE A;  3CST A;  2AL6 A;  1MG8 A;  2IO1 B;  1E8W A;  4ANV A;  3H6N A;  3L16 A;  3A1Q B;  1WR1 A;  2KOX A;  2WDT B;  2N1W A;  4LJO B;  4MEL A;  4MJS A;  4PYU A;  4TV3 A;  4W9K A;  4CO7 A;  4E71 A;  4EZL A;  2C5L C;  5D6J B;  1K8R B;  2FCS A;  2RR9 A;  4B95 A;  2KTR A;  3B08 A;  4DK5 A;  2HTH A;  4JGH B;  1V49 A;  3PT2 B;  3CSF A;  3VUY A;  2D11 A;  3PLU A;  3DQV A;  1GUA B;  1ISN A;  2PEA A;  3ZDT A;  3DVG Y;  3PHX B;  3VHT C;  3OAW A;  1KOT A;  3QWZ B;  3X0W A;  2KJ6 A;  2N9P C;  3LJ3 A;  2O2V A;  5LLI A;  1TGZ B;  4HK2 A;  4W9G A;  2OJR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...