1WJNA

Solution structure of the c-terminal ubiquitin-like domain of mouse tubulin-specific chaperone e
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
97
structure length
97
Chain Sequence
GSSGSSGQLLTLKIKCSNQPERQILEKQLPDSMTVQKVKGLLSRLLKVPVSELLLSYESSKMPGREIELENDLQPLQFYSVENGDCLLVRWSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tubulin-folding protein TBCE
publication title Solution structure of the C-terminal ubiquitin-like domain of mouse tubulin-specific chaperone e
rcsb
source organism Mus musculus
molecule tags Chaperone
total genus 15
structure length 97
sequence length 97
ec nomenclature
pdb deposition date 2004-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14560 Ubiquitin_2 Ubiquitin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1wjnA00
1BT0A 2K8HA 2NBVB 3TMPB 5BO4B 2MSED 4GB9A 4X57B 1GJZA 5JHAA 3APFA 2DYOA 4B6WA 1WJ4A 5KHQA 3A1QA 3KVFB 4GMVA 3NHEB 1CMXB 3TJPA 2LWPA 4HXDA 3QJZA 3RYTA 2MQJA 2EKEC 2BKRB 3DVNV 4KVGB 3SHQA 4EZKA 2UYZB 4HCNB 4HWIB 2KHWB 2ZNVB 5L95C 2KMAA 3A4RA 3TL5A 4DHZB 4DWFA 2MCNB 3T8MA 2WYQA 2MA9B 1IYFA 3PZDA 5FR6A 1SE9A 1UD7A 1R4NI 3VVWB 3JVZX 3UQBA 2MBHA 1OGWA 4MJSB 3L0WB 2XBBC 5CHVC 1WJUA 1F9JA 1WGRA 4B9KA 2PPHA 1YIWA 3T9LA 1K8RB 1EF5A 2I1KA 3VH4B 4GDLA 3VTWA 4MGIE 2G3QB 3MJWA 2EMTA 3HM6X 2CHXA 5LXHA 3DVGX 1E5WA 2JY6A 4MELA 3ZRCA 2N9XA 4W9FA 1WZ0A 2L00B 2XK5B 1E90A 3ZIMA 2BGFA 3ONSA 3NY5A 4N9F4 2LASA 3VXWA 1E8YA 3KYDD 2N9EB 1EF1A 3PLUA 1WIAA 3CSFA 1WM3A 1EUVB 2R2QA 3OLMD 3QHTA 4TKNA 4E71A 3K9PB 4MGZE 3S2AA 3HK0A 2W9NA 1V2YA 4RMAA 4MJSA 5HKHA 1AARA 1WR1A 3DVNU 4NAWA 2D11A 3L08A 4PS7A 2KJ6A 3ZO5B 3BY4B 4YL8A 1V5OA 1NBFC 2KTRB 3IVFA 3PPAA 3ML8A 4FLHA 4W9JA 4ZYNA 4BOZB 5L83A 2KNBA 1IP9A 5JHBA 2MRPA 2K25A 1XQQA 2FCNA 2FCMA 3X0WA 1P0RA 2YVCA 3UINB 2K39A 1GC7A 3ZTDA 5CX3A 3EC8A 3WIMA 3ENEA 5E6OA 3H9DA 4ANVA 4ASWC 1R4MI 3DQVA 1OEYJ 3APCA 4EZJA 3O65B 4FULA 3V61A 2C7NB 4F1SA 2DENB 1FXTB 2LD9A 2J0KA 2BWES 1VCBA 3A9JA 3UQAA 2Y5BB 1Q1OA 1V80A 2BPSA 1X1MA 3WAOA 2G4SA 4E74A 2KDIA 3RT3B 1UZXB 2IY1B 1GC6A 4IC7B 1E8XA 1Q0WB 1S1QB 4W9EA 1TZ1A 2KMCA 2KC2A 2MP2B 3DCGA 2KC1A 1HE8A 5IAAC 4BKSA 2MW5A 2K8BA 5G2NA 4WWNA 2A4ZA 4ANXA 1UH6A 2WX0A 3D32A 2GMIC 2JZZA 2MBOA 4HCPB 4W9IA 4GDKA 1UBIA 3QQ8B 3A9KB 1G6JA 2JVCA 1WGGA 4DDGD 2L8JA 4GU2A 2FCSA 4GIVA 1WGDA 4BOSC 4RM9A 1WMHA 3QA8A 1GUAB 3K9OB 4J6IA 4NQLB 3H7PB 1PQSA 3QK0A 3W1SA 4MSQB 3M62B 2VRRB 2RGFA 3NS8A 3OJ3A 4II3B 1E7VA 4K1RB 2RSUA 2NS5A 3IFWB 2V1YA 2D2QA 4KIKA 4GSWA 4WJOA 3ZDMC 5AEKB 4HK2A 1A5RA 1J8CA 3VH3B 4G0NB 5DPRA 2IO0B 1H4RA 2KXJA 2RD0A 4KSKC 3UIPB 4FJYA 3WANA 4I6PA 1WX9A 2NVUI 2J0MA 2PE9A 1LM8B 2O2VB 5E6NA 3Q3JA 2ASQA 2O6VA 5C1ZA 2DX5B 2L0FA 1WXAA 2BWFA 2M1MA 1P9DU 2L3ZA 1J0GA 2MWSB 3OJ4B 2KDFB 2NPTA 2LJ5A 2GBNA 3PTFC 3R3MA 1WX7A 3N30A 2IO2B 2ZPNA 4M8NA 4DHJB 2JRHA 2REXA 1TBEA 2Z0DB 1TGZB 3MHSD 3PSEB 4K7SA 3B0AA 3VUWA 1QZEA 2HE7A 2LVOA 3TIXA 2IO1B 2K1FA 4HPMB 4MSMB 1WR6E 4DHJD 4W9LA 5AZFA 1LQBA 2BF8B 1UELA 3AU5A 4W9HA 2C7MB 4FN2A 2BYVE 4LJOB 3B1LX 3H1UA 2L7RA 1ISNA 3W1SC 1EO6A 4XZ4A 3V6CB 4CYEA 4FA6A 3PT2B 4K7UA 2CR5A 4LDTD 4TUUA 4OVVA 2KQSA 4GGQA 3DVGY 3DBRI 2XEWA 4BBNC 1V5TA 4BBNF 4JIOU 4JLCA 2V4LA 2DHZA 3JSVB 3JYUA 3IHPC 3PRZA 1L2NA 2KK8A 5DPTA 3PRMB 3DBHI 4W9GA 4IWOA 1VD2A 2ZCBA 5LXIB 3HM3A 1Z5SB 2YLMA 2MBEA 2KWVB 2KDEB 3ALBA 1ZW7A 4ZRKA 4PS3A 4TQ0A 1SGHA 2KQ7A 2XK5A 3JW0X 3RZWC 2LGDA 1XD3B 1V81A 2N7DA 4ANUA 2KX3A 1TTNA 2DZIA 1WGYA 1OQYA 2N4FA 3NZUA 2IO3B 4KZCA 4BVUC 3R7QA 3VQIA 4IWPA 4PYZA 3HIZA 3JSVA 4NPNA 1P1AA 4EFOA 1WGHA 3U30A 5J2RA 3ZDTA 2B3AA 2KTFA 1RFAA 3P2BA 3Q3FA 4HLEA 4GXBA 2K6DB 4JGHB 2KANA 2OJRA 2IZVB 2JUOA 2KTRA 1V49A 1OTRB 2BKFA 2M8SA 2LGXA 4ZRIA 4GN1A 2Z59B 1WI0A 4FJVB 3ZTCA 2FNJB 4NQKE 1I35A 2LVPA 4TQ1A 2NR2A 2Z0EB 5GMVA 2DYMA 4XC2A 1GG3A 2M0XA 1WXSA 2ZNVC 1WRDB 2M17A 3QAQA 4FHKA 4JL9A 4W9DA 4W9KA 5DPWA 4AJYB 3ZNGC 4ICVA 4E3CA 2D07B 1WM2A 3GZNI 3CF6E 3APDA 4IM3A 3UIOB 4FBJB 2L05A 3CMMB 1RRBA 2G45B 2AEHA 2KZRA 2ZPYA 2FAZA 5D6JB 3ZUNA 1D3ZA 3IG3A 4HJKA 2LVQA 3KUDB 2JF5A 1XT9B 1YJ1A 4WJNA 2HTHA 2MLBA 1NI2A 2NBUA 3V62A 1WZ3A 1U4AA 1SIFA 1LXDA 2MP2A 2N1VA 4B95A 2IY0B 3RULA 3VUYA 2QHOA 1WFYA 3PVLA 5D7GA 2FCQA 2WX1A 3VTVA 1JRUA 2C9WB 2KJHB 1ZGUB 1Q5WB 2KLGA 2RPQA 4I6LB 5J17A 4IG7B 1OEYA 1YQBA 4FJZA 4GOCA 4HPLB 5D94A 3A1QB 4ZRJA 2FIDA 3DDCB 3PHWB 4AOFA 4F8CB 2RR9A 4AP4C 3RD2A 2IYDB 3A9KA 1WX8A 3KW5B 2K6QA 4PS8A 5CTRC 4EOYA 2JRIB 2M4NA 3QWZB 2FUHB 2WDTB 4EEWA 2KOXA 2UWQA 2AL3A 4FHJA 1T0YA 4MGYE 4DDID 3H7PA 5CHFA 2KJRA 1E7UA 1KJTA 3L10B 2GBJA 4G3XB 1WF9A 5E6PA 1P98A 5LLIA 1M94A 3VAWA 2NCNA 1WY8A 2MX2A 2OOBB 1KM7A 3V6EB 1C1YB 1E8ZA 2LZ6A 4DBGA 3AULA 3ZNID 1RAXA 3PGEA 4BFRA 5AZGA 3BINA 1WH3A 4GDLB 4I6NB 2D10A 4MGKE 5DCNA 2JT4B 2KD0A 4IW0A 4KSLC 2KFJA 4AWJA 2O2VA 2FIFA 4IUMB 3DBLI 3U7DA 5IA7A 3ZW3A 3M95A 4NJ7A 2D3GA 2C5LC 3M3JA 3IBEA 4BKTA 4LDTB 2G4DB 3VUXA 3VTUA 4OVUA 1S3SG 3I3TB 4LCDE 3X23A 3SU8X 3ZLZA 2ZZPB 4HVBA 1WYWB 4EZLA 4NY0A 4MEMA 4A3OA 1KLVA 2CKHB 2PEAA 2KWCA 4JQWC 3ZNHB 1H8CA 2KFKB 3L54A 1ZKHA 4WWPA 3RUIB 3H7SA 1WJNA 3KH0A 4W9CA 4NAWB 4XX5A 2V3SA 3PV1A 3NZSA 2KN5A 4IM0A 4A20A 4BKGA 4MM3A 5KHOA 3LDZE 2EMSA 3W1YA 4WAAA 3ZKJC 3WA0A 2ZEQA 2LGYA 3GOEA 3ZVVA 4MDKE 1RLFA 4RM8A 2GBMA 3U8ZA 3VFKA 3KUCB 5D2MB 2C60A 2AYOB 2ZCCA 3CSTA 4KDIC 1NDDA 4M8MA 4II2B 3N32A 1L7YA 1WXVA 2JWZA 3M63B 4LJPB 2R2OA 3LJ3A 4M0WB 2N1WA 1GNUA 2DZKA 3TBLD 4WJPA 1V86A 1E8WA 2LRUA 4ICUA 3WAPA 4KV2A 4AUQC 4ANWA 3KYCD 4AJWA 3R66C 2KFKA 2C7HA 3VHTC 1YX6B 1Z2MA 2GBRA 4P7IA 2LUEA 4WJQA 2A5UA 3A33B 3A9JB 5C23A 3PS6A 3N3KB 2BYEA 2JPHA 5CHWA 4DXAB 3PLVA 5TR5A 4HDQA 3ECIA 4DK5A 2IBIB 4CHKA 2CS4A 3R7RA 3QX1A 5G55A 3SDLC 2CHWA 2AL6A 4MH0E 3UF8A 3ZNZB 1YD8U 1WE6A 2KKCA 3HHMA 4GDKB 4EKUA 4WWOA 2ZJDA 1V6EA 3EFUA 4BKSD 1IPGA 3L13A 2CU1A 4K81A 2GBKA 2WWZA 5JH5C 4CO7A 3RZFA 3ZRFA 1WXMA 3UGBB 5AZHA 3KUZA 1WMHB 4NNJB 1C3TA 3V60A 2GOWA 3QC8B 2J7QB 2MBBB 3C0RB 3AI5A 4G11A 2DAJA 2DAFA 2JXXA 2LRWA 2HD5B 2L0TA 3QCAA 4KIKB 3NOBA 3PHXB 3WAMA 2MBQA 1YX5B 2J0JA 2DZMA 2KLCA 4NJ6A 2CHZA 2KVRA 1I42A 4HDOA 1Y8RC 3EECA 2LXAA 3QIJA 4DHZE 4IM2A 4WQOB 1WE7A 1MG8A 2ZVOA 1UGMA 3QARA 1UBQA 2KDBA 2I1JA 3RCZA 3DOWA 4TV3A 2KWUB 3MTNB 2DZJA 3EHVA 3AU4A 2PE6B 2NBWB 3H6NA 4EUTA 2O6VB 2JZ3B 3B08A 4IWQA 4FADA 5EDSA 5JZEB 1WJ6A 2BYFA 2K8CA 2L76A 3WALA 4PYUA 1P3QU 2ZVNA 3AXCA 2HJ8A 3L17A 4A3PA 4ZDVA 4K7WA 2NPTB 3DBSA 3A4SC 3SD5A 4F7ZA 3PREA 3TCAA 2O6VD 1LFDA 3ML9A 1V9JA 2AWTA 3VDZA 5J18A 2KX0A 1J19A 2DYBA 2KO3A 3DPDA 2PJHA 2LI5A 3OAWA 5DPSA 2N7EA 4URKA 1KOTA 4KDLB 2LXCA 3L16A 2N9PC 4G50A 3PRPB 4KZ0A
chains in the Genus database with same CATH superfamily
3BK2A 2K8HA 1PFDA 5JHAA 5KHQA 3A1QA 3NHEB 1C4AA 3RYTA 2MQJA 1V1PB 3SHQA 1C76A 3RFZB 4HWIB 2KHWB 2ZNVB 4US8A 4HROA 2JSVX 3T8MA 1N6ZA 3L0WB 2V3PA 5H92C 4C7YA 5CHVC 1WJUA 1YIWA 3T9LA 3U2SC 3GB1A 1E10A 3MC9A 2JY6A 3ZRCA 3ZJTA 1E90A 4A90A 2PVOD 1E8YA 3AMZA 1WM3A 1J7CA 1EUVB 3S2AA 1RM6C 2N9LA 2Q5WD 1NENB 1DYQA 1TY2A 4PS7A 3ZO5B 3BY4B 1YQ3B 4YL8A 2KTRB 3IVFA 4BOZB 1ACCA 5JHBA 3Q8CA 2AQ1B 2ICIA 4S0RA 1DOXA 1TT5B 2INNE 3BZDB 3WIMA 3DQVA 2DWQA 4FULA 2C7NB 4F1SA 3MHZA 3WCQA 1TY0A 2HDEA 1VCBA 1V80A 1X1MA 3WAOA 1FRRA 3Q14C 3FILA 1GC6A 1ZDVA 4IC7B 1I4QA 2HTME 1QF6A 2KC1A 2JWUA 5IAAC 4BKSA 2MW5A 2A4ZA 1HXYD 1UH6A 2MH7A 2ZW0A 5D3DA 4BAXA 4W9IA 2W55A 4GDKA 4US9A 4C80A 3QQ8B 4GU2A 4BOSC 1WGDA 2JU6X 1ZXHA 4J6IA 4JWSC 3QK0A 3M62B 2RGFA 1F0ZA 3OJ3A 1AWDA 2WGSA 4KIKA 4XDCA 1SJHD 3P63A 1R7SA 2D5GA 3VH3B 2DLBA 1NEKB 4KSKC 3WANA 1WX9A 1LM8B 4K3BA 5E6NA 2O6VA 1XLPA 3MJ5A 1TKYA 1NYRA 2MWSB 1E7PB 2GI9A 3R3MA 3N30A 1HZ5A 5FK9C 4DHJB 1D5MC 4K7SA 1PGAA 4XE0A 3AE2B 3RNEC 1K53A 2HE7A 4M02A 3TIXA 1AW7A 4MSMB 1ZUD2 4A6QA 3FAHA 3GZNB 2BF8B 1FCLA 4KGSA 3B1LX 4CYEA 1EO6A 3PT2B 4P1CC 1WWTA 2KQSA 2XEWA 4BBNF 3IHPC 4L1BA 5DPTA 3PRMB 4W9GA 2ZW1A 2K5PA 1VD2A 2YEPF 4DQOC 4JPSA 3IT4B 4HKZE 2KWVB 3ALBA 2J53A 2AX5A 4PS3A 2KQ7A 2LGDA 1V81A 2N7DA 1V8CA 1FD6A 2KQ4X 1MHXA 2N4FA 1JALA 3NZUA 2IO3B 4BVUC 2PIAA 3VQIA 4IWPA 4AS1A 1M4VA 3HIZA 1P1AA 4Q2JA 4EFOA 1WGHA 3U30A 2B3AA 2W82A 3Q3FA 4HLEA 4GXBA 2K6DB 2GB1A 1XCTL 1MPEA 1V49A 1FNWA 3EA6A 1OQQA 2HJ1A 1HTOA 4XC2A 1GG3A 4OVZA 4W9DA 5DPWA 4ICVA 2D07B 1UWMA 3APDA 4FBJB 2L05A 1IGDA 2KZRA 2XNAC 2ZPYA 3IG3A 1XT9B 4WJNA 3DBHB 1NI2A 1WZ3A 1SIFA 2MP2A 4B95A 3PVLA 5D7GA 2WX1A 2KJHB 1FM0D 1YQ4B 2KLGA 2RPQA 3ZJUA 4N6EB 4GOCA 4AOFA 5EE9A 1VZ8A 1MG4A 3A9KA 3KW5B 4ARIA 2M4NA 3AE5B 2UU7A 3MFGA 2NTSA 2UWQA 4DDID 3H7PA 2WS3B 1WF9A 1M94A 3CWIA 2KACA 2NCNA 2MX2A 1KM7A 1C1YB 1CK1A 1TYGB 3PGEA 3IXSA 2FBWB 3ZXVA 2KFJA 4AWJA 2O2VA 3ZW3A 2C5LC 3IBEA 3W9CB 1QILA 2G4DB 1TS5A 2Y3AA 2FUG1 3ZLZA 3MC0B 1WYWB 4NY0A 1KLVA 2RDHA 2PEAA 4JQWC 3Q3MC 4WWPA 4HJGE 2I2YA 3KH0A 2V3SA 4LNFA 2KN5A 4RFBA 4A20A 4BKGA 4KX6B 3P4PB 4WAAA 3WA0A 2ZEQA 1LO5D 2BVCA 1RLFA 1SIJA 5D2MB 3RPFC 3CSTA 4D2KA 2PLPA 4MT5A 1WXVA 4LJPB 2R2OA 5AUKA 2DZKA 2V3NA 4KV2A 3Q8AA 3VHTC 1Y56A 3NZ3A 2BYEA 2JPHA 3O13A 4EE2A 1EWYC 1TS4A 3DWGC 1SE4A 1YN5A 2QCZA 1GB1A 3R7RA 2V9HA 1T0QC 3QX1A 5BYQA 3SDLC 5EE3A 2AL6A 3R2TA 2KKCA 2N0SB 4WWOA 1V6EA 4BKSD 2VZKD 1ZOYB 3TSSA 2QJLA 2LGSA 3ZRFA 1WXMA 3KWLA 1XLQA 2GOWA 5C2TB 2DAFA 3P4SB 2LRWA 1I4GA 3WAMA 2MBQA 1YX5B 3ETRA 2KLCA 4NJ6A 4IM2A 1QOBA 2ZVOA 2KDBA 1NI3A 3DOWA 3RCZA 2V0GA 4RNAA 4RGTA 3MTNB 2Z8LA 2PE6B 1GAQB 2K8CA 2DNFA 4PYUA 2ZVNA 1L0YB 3L17A 3TCAA 2O6VD 3MP9A 1J19A 3DPDA 2N7EA 4URKA 2BS3B 1KOTA 4HXDA 4G50A 3PRPB 2W3RA 4KZ0A 3TMPB 1GJZA 3APFA 1KRHA 1CMXB 3QJZA 1WRIA 2BKRB 1FO4A 2WXOA 4EZKA 4HCNB 1C78A 5L95C 2KMAA 2MCNB 1F2RC 3W2DA 1HQRD 4C4VB 5BMHA 3PZDA 1R4NI 3JVZX 1YJJA 3Q8FA 4MJSB 2XBBC 1JWSD 4B9KA 4RGNA 3AE8B 3VH4B 4GDLA 4MGIE 2G3QB 4ITKA 3BK1A 3HM6X 5LXHA 3DVGX 1E5WA 2LEKA 4MELA 2N9XA 2D3CA 1WZ0A 2K0PA 4W9FA 3ONSA 1SE3A 2LASA 1WYGA 3PLUA 3TEZA 4C4VA 3CSFA 3OLMD 3QHTA 4E71A 3K9PB 3HK0A 2W9NA 5EE0A 4LNIA 4RMAA 4MJSA 3DVNU 2D11A 2INDC 3GE8C 2WDQB 3AE9B 3IT6B 4ZYNA 1TIFA 3ML8A 4W9JA 1ET9A 2K25A 3IAS1 1AYFA 3RNCC 5BMIA 2K39A 4M0WA 3AV8A 3ENEA 2N7JA 1R4MI 3U52E 3APCA 2MHJA 4P1BC 1I4RA 2J0KA 5MPOA 3UQAA 2Y5BB 3LXFA 2BPSA 2G4SA 3RT3B 3VR8B 2IY1B 1E8XA 1TZ1A 2KMCA 5G2NA 4WIPA 3D32A 1FMAD 2JZZA 5EE1A 4XDDA 2AQ3B 1JWUD 2JVCA 4YXDB 3MC8A 3AEEB 2FCSA 1L4ZB 3SFEB 1WMHA 1GUAB 3K9OB 2BS2B 4NQLB 1PQSA 3TUOA 3W1SA 2WXQA 5HFYA 1E7VA 4K1RB 2RSUA 3IFWB 1XEEA 3NG0A 2V1YA 4GSWA 3GS2A 4WJOA 4HK2A 4IKGA 1UNSA 2WXGA 4GLSC 2NVUI 3RNGC 5C1ZA 2M1MA 2L3ZA 5IO9A 2K3UA 2ACZB 2KT7A 3PTFC 1TBEA 4JX1C 3PSEB 3L4PA 2VH1A 3FC4A 3B0AA 5T8IA 2J42A 3HVDA 1LQBA 1UELA 3AU5A 5LNK1 2C7MB 3SEBA 4OHJA 3VR9B 3H1UA 1V1PA 3W1SC 4XZ4A 1FXAA 5IKCM 4FXCA 4K7UA 3ZXRA 4GGQA 3DVGY 1ZXIA 4JIOU 1WSPA 3JSVB 3PRZA 2K22A 1L2NA 1C4PA 4IWOA 1MHHE 1I7HA 3OG5A 1Z5SB 1F77A 1EWCA 3EFCA 3JW0X 1MJDA 4ANUA 3C19A 4DXFA 1OQYA 4RGMA 4WURA 3Q3NC 5AUIA 3JSVA 3ZDTA 2IGHA 4JGHB 2KANA 2IZVB 3I57A 1HA5A 2JXTA 2KTRA 2M0AA 4ZRIA 4FJVB 4YT0B 1TS3A 1I35A 2ZNVC 1WRDB 4E3CA 1RYJA 4IM3A 3UIOB 3DBRB 2AQ2B 3ZUNA 2FAZA 5D6JB 2HTHA 2MLBA 2QEJC 1U4AA 2N1VA 1BUIC 3VUYA 1WFYA 3NVWA 2W54A 3VTVA 1BMLC 4IG7B 1OEYA 2PVGC 3PHWB 3RD2A 1FXIA 1WX8A 1VLBA 2K6QA 4PS8A 2JRIB 2FUHB 1YN3A 2WDTB 4EEWA 4FHJA 1T0YA 2X8XX 3Q2AC 5CHFA 4B0MA 2D3AA 2GLSA 1WY8A 2J52A 4A9AA 5JXVA 1HZ6A 2OOBB 3PZ7A 3V6EB 4S17A 4NAMA 3ZNID 4BFRA 3BINA 1FRDA 4I6NB 5DCNA 3Q69A 2JT4B 3N1YC 4XGAB 4IW0A 1J7BA 3U7DA 3M95A 4BKTA 4KKIA 4LDTB 3VTUA 4OVUA 3X23A 2ZZPB 4LLGM 1NYQA 2K9XA 4MEMA 4A3OA 1UUPA 3PO0A 1IGCA 4NAWB 4XX5A 5TSSA 1ZPSA 3NZSA 3AEDB 3W1YA 3GOEA 2KAJA 4MDKE 3U8ZA 3KUCB 2C60A 4M8MA 3AN1A 1L7YA 4R3DA 3M63B 3TBLD 1GNUA 4WJPA 1V86A 1E8WA 4ICUA 3WAPA 4AUQC 3KYCD 4AJWA 3AECB 2C7HA 1YX6B 4P7IA 2QDFA 4WJQA 3T3NA 3A9JB 5CHWA 3AM9A 4YSZB 2E6XA 1XCQL 1FIQA 2RMMA 3T3OA 3BVZA 4P16A 5G55A 1L5PA 3DBLB 2CHWA 3ZNZB 2BS4B 1VDVA 3KWVA 2ZJDA 2N9KA 2VH2A 3KUZA 1T3QA 1R4NB 4NNJB 3V60A 1HEZE 1IBXB 3QC8B 1T0RC 2J7QB 2JXXA 2L0TA 3NOBA 3PHXB 4LNOA 2J0JA 2DZMA 2JZPA 3NVVA 2MEKA 2Y5CA 2LUMA 3QARA 4YWGG 2I1JA 2PW9A 3URYA 1UGJA 2OJWA 4TV3A 4OZBA 1DOIA 4WWMA 1KFYB 2LGIA 1KF6B 2BYFA 3WALA 1P3QU 1IBXA 1EU3A 2NPTB 3DBSA 4K7WA 3SD5A 2INCC 3Q8BA 5J18A 2KO3A 2E3TA 2WXNA 4KDLB 3GE3C 1BT0A 2NBVB 1R4MB 4X57B 2PKOA 3HVZA 3UI3A 3B2GA 3KVFB 4GMVA 3EUB2 1P7EA 3TJPA 2LWPA 2NTTA 2EKEC 3NJTA 3B9JA 4KVGB 4PK1A 1ET6A 3A4RA 1QOGA 3LYYA 4YTMB 1IYFA 5FR6A 1KTKA 3UQBA 2MBHA 1OGWA 5FR3A 1OFFA 1K8RB 2EMTA 2XK5B 3Q8EA 2BGFA 1PUTA 4N9F4 1EF1A 4TKNA 2H88B 2WP9B 4ZRQA 5HKHA 1AARA 1WR1A 3L08A 4IOIE 2KJ6A 2XN9C 1NBFC 3PPAA 4ZRPA 5L83A 2KNBA 2MRPA 1EU4A 2FCNA 2FCMA 3X0WA 2YVCA 4RCOA 3UINB 1GC7A 4ANVA 2RDBC 1OEYJ 3O65B 3U4EG 4N58A 3V61A 1JQ4A 1L0VB 3NVZA 1KLUD 1Q1OA 1SXTA 2KDIA 1UZXB 2WXKA 1S1QB 4W9EA 1C4CA 2CJOA 2WX0A 1UWXA 1VZ7A 1PGXA 4YSYB 1UBIA 1QKZA 1WGGA 4DDGD 1JCKB 3AEBB 2WHIA 3BYTB 4GIVA 4MSQB 2VRRB 3NS8A 2W3SA 4K3CA 1Q10A 4RH6A 3ZDMC 4YTNB 5AEKB 1J8CA 3Q6BA 3BIID 2J0MA 2PE9A 1YN4A 2DX5B 2L0FA 2CU3A 2WXHA 4USAA 1J0GA 4N59A 4BZAA 1A70A 2FE8A 2LJ5A 2GBNA 2KWDA 2JYTA 4M8NA 2JRHA 4O1NA 5BYSA 2Z0DB 1TGZB 3MHSD 2IDYA 3ZQ4A 4MM3B 2LVOA 2LJIA 2WXIA 1B1ZA 4HPMB 3PZ8A 1WR6E 4DHJD 3I63C 4W9LA 2PTLA 4ACFA 5E6JA 3Q3OC 4LJOB 2L7RA 4FA6A 3V6CB 3BWUD 4LDTD 4TUUA 4OVVA 2BYTA 1V5TA 4JLCA 2DHZA 2KK8A 3DBHI 3DHIC 1N61A 2ZCBA 3SR6A 2YLMA 2WNMA 1P7FA 3AE4B 1MVKA 4ZRKA 4C7ZA 2ON8A 4A55A 1XD3B 2LHEA 2M19A 2DZIA 1WGYA 4TSSA 1E0ZA 3R7QA 1XLNA 4PYZA 2SEBD 3TEWA 2JUOA 2L32A 5HG2A 2M8SA 2LGXA 1JRPA 4GN1A 2Z59B 1WXQA 5IOIA 3ZJVA 4NQKE 1T5XD 2QC8A 5GMVA 2Z0EB 3KLSX 2M0XA 1MI0A 4JL9A 2M17A 4FHKA 3ZNGC 2Y5PA 3CMMB 3N1ZC 1D3ZA 3BYYB 5IP4D 3V05A 4ZHOA 1KH0A 2JF5A 1YJ1A 2NBUA 2IY0B 5BMGA 3RULA 2QHOA 2FCQA 1JRUA 2C9WB 1Q5WB 5J17A 4J3OD 1K51A 1QT9A 1XLOA 3A1QB 5D94A 3DDCB 4AP4C 4UDUC 1QOAA 2L83A 3NS1A 1VRAB 5CTRC 2KOXA 2AL3A 2WDVB 4MGYE 3DWMA 3AH7A 1E7UA 3L10B 3LB8C 3DHHC 1XO3A 4WQMA 1ENFA 4B0EA 3P42A 3TEXA 1KLGD 4H2AA 1SJED 1RAXA 1F2RI 1WH3A 4MGKE 2KD0A 2SAKA 3P4QB 4KSLC 4OZAA 2FIFA 4NJ7A 3M3JA 3RNAC 3VUXA 1S3SG 5HHDG 3I3TB 3VRAB 2CKHB 1H8CA 3ZNHB 2KFKB 1ZKHA 1SB3C 3RUIB 3C8YA 2JQRB 3R8BA 3PV1A 4IM0A 2DBYA 5KHOA 3LDZE 1ROEA 2EMSA 4YTPB 3ZKJC 1B9RA 2GBMA 4KDIC 2ZCCA 4HKQA 4II2B 3N32A 4RM8A 2JWZA 3LJ3A 1EM7A 1YJIA 4ANWA 1XF5L 2KFKA 3R66C 4C56C 1RWSA 1Z2MA 2GBRA 3SFDB 1T6BX 1XXGA 1RFKA 4DXAB 2MJEA 4XWWA 3FILB 5TR5A 1IUEA 3ECIA 2NMQA 4RF1A 2VZKB 4DK5A 4CHKA 2CS4A 3DHGC 1N62A 1MFWA 1WE6A 4GDKB 2WU5B 1PDXA 2D3BA 1IPGA 1FNVA 2CU1A 2WWZA 5JH5C 4CO7A 3RZFA 3UGBB 5AZHA 1YNTE 1C3TA 1K50A 2MBBB 3C0RB 3AI5A 4G11A 2HD5B 1CZPA 4KIKB 2WU2B 2KVRA 1I42A 4HDOA 1Y8RC 2LXAA 4WQOB 1WE7A 1UBQA 2WLBA 2KWUB 2B76B 2DZJA 2OEDA 3AU4A 2NBWB 2O6VB 3HUIA 3B08A 4IWQA 4KGTA 2WXJA 1FNUA 5JZEB 2L76A 3AXCA 4ZDVA 2R61A 3A4SC 1D5ZC 1F1HA 1VZ6A 4F7ZA 3ML9A 1V9JA 2AWTA 2BB5A 1C77A 2KX0A 4MH8A 1L0XB 2PJHA 2LI5A 3OAWA 3L16A 2N9PC 5EDSA 2MJDA 3AEFB 5BO4B 2MSED 4GB9A 4AQ7A 2DYOA 4B6WA 1WJ4A 3DVNV 5I4DA 2BB6A 3AE3B 2UYZB 4L23A 1D6EC 1DOYA 3ABVB 4DWFA 3TL5A 1FPYA 4JWUC 4DHZB 2EELA 2MA9B 2WYQA 1YMHE 3VRBB 1SE9A 1UD7A 4KGRA 3VVWB 1F9JA 1WGRA 2PPHA 1EF5A 2I1KA 2WXLA 1TKEA 3VTWA 3E56A 3MJWA 1PYWD 2CHXA 2GRIA 3FKYA 5C3JB 2RDGA 2L00B 3ZIMA 3AB5A 3NY5A 3R2IA 3VXWA 2RPVA 3KYDD 2N9EB 4HRSA 1WIAA 2R2QA 3B2FA 1QQRA 4MGZE 1GB4A 3GP7A 2EKIA 1V2YA 4NZLB 4NAWA 1L6VA 1V5OA 1SSNA 3W5UB 3OWEB 4FLHA 2IGGA 1YOVB 1IP9A 4ARCA 2J4XA 1XQQA 4YSXB 4MACA 3H8HA 1P0RA 3BVMA 1CJEA 3ZTDA 4HPPA 5CX3A 3EC8A 5E6OA 1LGRA 3H9DA 4ASWC 1WGKA 2V4IB 4EZJA 1D4BA 2DENB 1FXTB 2LD9A 2BWES 2PMVA 3CIRB 3A9JA 1SF0A 4E74A 4OZCA 3RMKC 1Q0WB 2KC2A 2MP2B 3DCGA 1HE8A 2KMMA 2K8BA 1J7AA 4WWNA 4ANXA 2GMIC 1SBBB 2MBOA 4HCPB 3AE7B 1AN8A 4LTUA 2YEPB 3A9KB 1G6JA 3E9SA 2L8JA 2L52A 4LK0M 1ZDXA 4RM9A 3QA8A 3H7PB 4II3B 1F52A 2NS5A 2D2QA 2G1EA 3RNBC 4NJCA 1A5RA 4A8XC 1JW9D 2JYEA 1VR9A 4G0NB 5DPRA 2IO0B 1H4RA 2KXJA 2RD0A 2G9HD 4HEA1 3UIPB 2MJ3A 4FJYA 1OQRA 4I6PA 2JX5A 4M00A 2O2VB 4WAFA 3Q3JA 2ASQA 1WXAA 4C00A 2BWFA 1P9DU 3HRDD 3TEYA 3OJ4B 2KDFB 2WXPA 2NPTA 2WXMA 4KKJA 1GPXA 2KDMA 2QIEB 4PT5A 1WX7A 2IO2B 2ZPNA 1ZE3D 1JROA 2CJNA 2QSDA 2REXA 1HTQA 2IPKD 1D5XC 1PGBA 4RF0A 2KYWA 3VUWA 1QZEA 4ZYSA 2IO1B 2K1FA 3BVGA 1STEA 3IAM1 5AZFA 4W9HA 4FN2A 2BYVE 1TS2A 1ISNA 1VJKA 5H8YE 2OHFA 2H89B 3RNFC 2CR5A 3RI7C 1I4PA 3NVYA 3DBRI 4BBNC 2L1AA 2V4LA 3JYUA 1N63A 5LXIB 3HM3A 1FCCC 2MBEA 5GXGB 1TKGA 2KDEB 1ZW7A 4TQ0A 1SGHA 2XK5A 3RZWC 1SEBD 4LNNA 2KX3A 1TTNA 3AE6B 4CQNA 1E9MA 4KZCA 4ZOHC 1C9FA 4NPNA 3N9YC 2X38A 5J2RA 2KTFA 3P2BA 1RFAA 1L6UA 1JWBD 3P1MA 2BBCA 3N1XC 2OJRA 1OTRB 2BKFA 3I5JC 3KQ4A 1V97A 4DXGA 1WI0A 5BYRA 3ZTCA 2FNJB 4JE3B 2LVPA 4TQ1A 2NR2A 2DYMA 1WXSA 3QAQA 4W9KA 4AJYB 1WM2A 2BTEA 3GZNI 3CF6E 1FFUA 1K52A 1TZOA 3W5VB 4LNKA 1C79A 1RRBA 3AE1B 2G45B 2AEHA 4HJKA 2LVQA 3KUDB 3V62A 1LXDA 2IGDA 1N5XA 1JWAD 2LMCA 1ZGUB 5G5HA 4I6LB 1NVID 2WQYB 2BT6A 1YQBA 4FJZA 1GOZA 4HPLB 1L4DB 3EGRA 2FIDA 4L2YA 4ZRJA 3V3XA 4F8CB 2RR9A 2IYDB 1V1OA 2TSSA 4EOYA 3QWZB 1ZP0B 3N20C 4XYCA 2KJRA 2WXFA 1KJTA 2GBJA 4G3XB 5E6PA 1P98A 5LLIA 3VAWA 2BQQA 1E8ZA 2LZ6A 4DBGA 1N5WA 2LFIA 3AULA 5AZGA 1I4XA 4GDLB 2D10A 2QILA 1FEHA 4IUMB 3DBLI 1ESFA 5IA7A 2D3GA 4IDIA 4P6VF 4LCDE 5HI1A 3SU8X 4HVBA 4EZLA 2KWCA 3L54A 3AEGB 3H7SA 1WJNA 1UF0A 4W9CA 2LHDA 4OW0A 4MM3A 4WH4A 2LGYA 3ZVVA 3VFKA 2AYOB 1T0SC 1NDDA 1DGJA 1JWMD 4M0WB 2N1WA 3ZYYX 2LRUA 2KN4A 2KVZA 2LUEA 2A5UA 5FKAC 3A33B 3RN9C 5C23A 3PS6A 4RGOS 3N3KB 1TJEA 1QLBB 2INPE 3PLVA 2QMTA 4HDQA 3NRZA 2IBIB 2I38A 1N60A 4MH0E 3UF8A 4ZHPA 1YD8U 3HHMA 2BW2A 4EKUA 3P4RB 3EFUA 2M56B 3L13A 4K81A 2GBKA 1I4HA 2WXRA 1CQVA 3AEAB 2IJ0A 1WMHB 1E6EB 1QOFA 4QAYA 2DAJA 4XWTA 3QCAA 2ONQA 2CHZA 3EECA 3QIJA 4DHZE 4REZA 1MG8A 1UGMA 4M01A 5D3IB 3NUHB 2WDRB 4TMAB 3EHVA 3H6NA 4EUTA 2JZ3B 3J9CA 4FADA 1WJ6A 1BXTA 5G5GA 2HJ8A 4A3PA 1FFVA 3PREA 1LFDA 3ZGZA 3VDZA 3U7ZA 2DYBA 5IN7A 3I9V1 1JMLA 5DPSA 2LXCA 1SE2A
chains in the Genus database with same CATH topology
1BT0A 2K8HA 2NBVB 3TMPB 5BO4B 2MSED 4GB9A 4X57B 1GJZA 5JHAA 3APFA 2DYOA 4B6WA 1WJ4A 5KHQA 3A1QA 3KVFB 4GMVA 3NHEB 1CMXB 3TJPA 2LWPA 4HXDA 3QJZA 3RYTA 2MQJA 2EKEC 2BKRB 3DVNV 4KVGB 3SHQA 4EZKA 2UYZB 4HCNB 4HWIB 2KHWB 2ZNVB 5L95C 2KMAA 3A4RA 3TL5A 4DHZB 4DWFA 2MCNB 3T8MA 2WYQA 2MA9B 1IYFA 3PZDA 5FR6A 1SE9A 1UD7A 1R4NI 3VVWB 3JVZX 3UQBA 2MBHA 1OGWA 4MJSB 3L0WB 2XBBC 5CHVC 1WJUA 1F9JA 1WGRA 4B9KA 2PPHA 1YIWA 3T9LA 1K8RB 1EF5A 2I1KA 3VH4B 4GDLA 3VTWA 4MGIE 2G3QB 3MJWA 2EMTA 3HM6X 2CHXA 5LXHA 3DVGX 1E5WA 2JY6A 4MELA 3ZRCA 2N9XA 4W9FA 1WZ0A 2L00B 2XK5B 1E90A 3ZIMA 2BGFA 3ONSA 3NY5A 4N9F4 2LASA 3VXWA 1E8YA 3KYDD 2N9EB 1EF1A 3PLUA 1WIAA 3CSFA 1WM3A 1EUVB 2R2QA 3OLMD 3QHTA 4TKNA 4E71A 3K9PB 4MGZE 3S2AA 3HK0A 2W9NA 1V2YA 4RMAA 4MJSA 5HKHA 1AARA 1WR1A 3DVNU 4NAWA 2D11A 3L08A 4PS7A 2KJ6A 3ZO5B 3BY4B 4YL8A 1V5OA 1NBFC 2KTRB 3IVFA 3PPAA 3ML8A 4FLHA 4W9JA 4ZYNA 4BOZB 5L83A 2KNBA 1IP9A 5JHBA 2MRPA 2K25A 1XQQA 2FCNA 2FCMA 3X0WA 1P0RA 2YVCA 3UINB 2K39A 1GC7A 3ZTDA 5CX3A 3EC8A 3WIMA 3ENEA 5E6OA 3H9DA 4ANVA 4ASWC 1R4MI 3DQVA 1OEYJ 3APCA 4EZJA 3O65B 4FULA 3V61A 2C7NB 4F1SA 2DENB 1FXTB 2LD9A 2J0KA 2BWES 1VCBA 3A9JA 3UQAA 2Y5BB 1Q1OA 1V80A 2BPSA 1X1MA 3WAOA 2G4SA 4E74A 2KDIA 3RT3B 1UZXB 2IY1B 1GC6A 4IC7B 1E8XA 1Q0WB 1S1QB 4W9EA 1TZ1A 2KMCA 2KC2A 2MP2B 3DCGA 2KC1A 1HE8A 5IAAC 4BKSA 2MW5A 2K8BA 5G2NA 4WWNA 2A4ZA 4ANXA 1UH6A 2WX0A 3D32A 2GMIC 2JZZA 2MBOA 4HCPB 4W9IA 4GDKA 1UBIA 3QQ8B 3A9KB 1G6JA 2JVCA 1WGGA 4DDGD 2L8JA 4GU2A 2FCSA 4GIVA 1WGDA 4BOSC 4RM9A 1WMHA 3QA8A 1GUAB 3K9OB 4J6IA 4NQLB 3H7PB 1PQSA 3QK0A 3W1SA 4MSQB 3M62B 2VRRB 2RGFA 3NS8A 3OJ3A 4II3B 1E7VA 4K1RB 2RSUA 2NS5A 3IFWB 2V1YA 2D2QA 4KIKA 4GSWA 4WJOA 3ZDMC 5AEKB 4HK2A 1A5RA 1J8CA 3VH3B 4G0NB 5DPRA 2IO0B 1H4RA 2KXJA 2RD0A 4KSKC 3UIPB 4FJYA 3WANA 4I6PA 1WX9A 2NVUI 2J0MA 2PE9A 1LM8B 2O2VB 5E6NA 3Q3JA 2ASQA 2O6VA 5C1ZA 2DX5B 2L0FA 1WXAA 2BWFA 2M1MA 1P9DU 2L3ZA 1J0GA 2MWSB 3OJ4B 2KDFB 2NPTA 2LJ5A 2GBNA 3PTFC 3R3MA 1WX7A 3N30A 2IO2B 2ZPNA 4M8NA 4DHJB 2JRHA 2REXA 1TBEA 2Z0DB 1TGZB 3MHSD 3PSEB 4K7SA 3B0AA 3VUWA 1QZEA 2HE7A 2LVOA 3TIXA 2IO1B 2K1FA 4HPMB 4MSMB 1WR6E 4DHJD 4W9LA 5AZFA 1LQBA 2BF8B 1UELA 3AU5A 4W9HA 2C7MB 4FN2A 2BYVE 4LJOB 3B1LX 3H1UA 2L7RA 1ISNA 3W1SC 1EO6A 4XZ4A 3V6CB 4CYEA 4FA6A 3PT2B 4K7UA 2CR5A 4LDTD 4TUUA 4OVVA 2KQSA 4GGQA 3DVGY 3DBRI 2XEWA 4BBNC 1V5TA 4BBNF 4JIOU 4JLCA 2V4LA 2DHZA 3JSVB 3JYUA 3IHPC 3PRZA 1L2NA 2KK8A 5DPTA 3PRMB 3DBHI 4W9GA 4IWOA 1VD2A 2ZCBA 5LXIB 3HM3A 1Z5SB 2YLMA 2MBEA 2KWVB 2KDEB 3ALBA 1ZW7A 4ZRKA 4PS3A 4TQ0A 1SGHA 2KQ7A 2XK5A 3JW0X 3RZWC 2LGDA 1XD3B 1V81A 2N7DA 4ANUA 2KX3A 1TTNA 2DZIA 1WGYA 1OQYA 2N4FA 3NZUA 2IO3B 4KZCA 4BVUC 3R7QA 3VQIA 4IWPA 4PYZA 3HIZA 3JSVA 4NPNA 1P1AA 4EFOA 1WGHA 3U30A 5J2RA 3ZDTA 2B3AA 2KTFA 1RFAA 3P2BA 3Q3FA 4HLEA 4GXBA 2K6DB 4JGHB 2KANA 2OJRA 2IZVB 2JUOA 2KTRA 1V49A 1OTRB 2BKFA 2M8SA 2LGXA 4ZRIA 4GN1A 2Z59B 1WI0A 4FJVB 3ZTCA 2FNJB 4NQKE 1I35A 2LVPA 4TQ1A 2NR2A 2Z0EB 5GMVA 2DYMA 4XC2A 1GG3A 2M0XA 1WXSA 2ZNVC 1WRDB 2M17A 3QAQA 4FHKA 4JL9A 4W9DA 4W9KA 5DPWA 4AJYB 3ZNGC 4ICVA 4E3CA 2D07B 1WM2A 3GZNI 3CF6E 3APDA 4IM3A 3UIOB 4FBJB 2L05A 3CMMB 1RRBA 2G45B 2AEHA 2KZRA 2ZPYA 2FAZA 5D6JB 3ZUNA 1D3ZA 3IG3A 4HJKA 2LVQA 3KUDB 2JF5A 1XT9B 1YJ1A 4WJNA 2HTHA 2MLBA 1NI2A 2NBUA 3V62A 1WZ3A 1U4AA 1SIFA 1LXDA 2MP2A 2N1VA 4B95A 2IY0B 3RULA 3VUYA 2QHOA 1WFYA 3PVLA 5D7GA 2FCQA 2WX1A 3VTVA 1JRUA 2C9WB 2KJHB 1ZGUB 1Q5WB 2KLGA 2RPQA 4I6LB 5J17A 4IG7B 1OEYA 1YQBA 4FJZA 4GOCA 4HPLB 5D94A 3A1QB 4ZRJA 2FIDA 3DDCB 3PHWB 4AOFA 4F8CB 2RR9A 4AP4C 3RD2A 2IYDB 3A9KA 1WX8A 3KW5B 2K6QA 4PS8A 5CTRC 4EOYA 2JRIB 2M4NA 3QWZB 2FUHB 2WDTB 4EEWA 2KOXA 2UWQA 2AL3A 4FHJA 1T0YA 4MGYE 4DDID 3H7PA 5CHFA 2KJRA 1E7UA 1KJTA 3L10B 2GBJA 4G3XB 1WF9A 5E6PA 1P98A 5LLIA 1M94A 3VAWA 2NCNA 1WY8A 2MX2A 2OOBB 1KM7A 3V6EB 1C1YB 1E8ZA 2LZ6A 4DBGA 3AULA 3ZNID 1RAXA 3PGEA 4BFRA 5AZGA 3BINA 1WH3A 4GDLB 4I6NB 2D10A 4MGKE 5DCNA 2JT4B 2KD0A 4IW0A 4KSLC 2KFJA 4AWJA 2O2VA 2FIFA 4IUMB 3DBLI 3U7DA 5IA7A 3ZW3A 3M95A 4NJ7A 2D3GA 2C5LC 3M3JA 3IBEA 4BKTA 4LDTB 2G4DB 3VUXA 3VTUA 4OVUA 1S3SG 3I3TB 4LCDE 3X23A 3SU8X 3ZLZA 2ZZPB 4HVBA 1WYWB 4EZLA 4NY0A 4MEMA 4A3OA 1KLVA 2CKHB 2PEAA 2KWCA 4JQWC 3ZNHB 1H8CA 2KFKB 3L54A 1ZKHA 4WWPA 3RUIB 3H7SA 1WJNA 3KH0A 4W9CA 4NAWB 4XX5A 2V3SA 3PV1A 3NZSA 2KN5A 4IM0A 4A20A 4BKGA 4MM3A 5KHOA 3LDZE 2EMSA 3W1YA 4WAAA 3ZKJC 3WA0A 2ZEQA 2LGYA 3GOEA 3ZVVA 4MDKE 1RLFA 4RM8A 2GBMA 3U8ZA 3VFKA 3KUCB 5D2MB 2C60A 2AYOB 2ZCCA 3CSTA 4KDIC 1NDDA 4M8MA 4II2B 3N32A 1L7YA 1WXVA 2JWZA 3M63B 4LJPB 2R2OA 3LJ3A 4M0WB 2N1WA 1GNUA 2DZKA 3TBLD 4WJPA 1V86A 1E8WA 2LRUA 4ICUA 3WAPA 4KV2A 4AUQC 4ANWA 3KYCD 4AJWA 3R66C 2KFKA 2C7HA 3VHTC 1YX6B 1Z2MA 2GBRA 4P7IA 2LUEA 4WJQA 2A5UA 3A33B 3A9JB 5C23A 3PS6A 3N3KB 2BYEA 2JPHA 5CHWA 4DXAB 3PLVA 5TR5A 4HDQA 3ECIA 4DK5A 2IBIB 4CHKA 2CS4A 3R7RA 3QX1A 5G55A 3SDLC 2CHWA 2AL6A 4MH0E 3UF8A 3ZNZB 1YD8U 1WE6A 2KKCA 3HHMA 4GDKB 4EKUA 4WWOA 2ZJDA 1V6EA 3EFUA 4BKSD 1IPGA 3L13A 2CU1A 4K81A 2GBKA 2WWZA 5JH5C 4CO7A 3RZFA 3ZRFA 1WXMA 3UGBB 5AZHA 3KUZA 1WMHB 4NNJB 1C3TA 3V60A 2GOWA 3QC8B 2J7QB 2MBBB 3C0RB 3AI5A 4G11A 2DAJA 2DAFA 2JXXA 2LRWA 2HD5B 2L0TA 3QCAA 4KIKB 3NOBA 3PHXB 3WAMA 2MBQA 1YX5B 2J0JA 2DZMA 2KLCA 4NJ6A 2CHZA 2KVRA 1I42A 4HDOA 1Y8RC 3EECA 2LXAA 3QIJA 4DHZE 4IM2A 4WQOB 1WE7A 1MG8A 2ZVOA 1UGMA 3QARA 1UBQA 2KDBA 2I1JA 3RCZA 3DOWA 4TV3A 2KWUB 3MTNB 2DZJA 3EHVA 3AU4A 2PE6B 2NBWB 3H6NA 4EUTA 2O6VB 2JZ3B 3B08A 4IWQA 4FADA 5EDSA 5JZEB 1WJ6A 2BYFA 2K8CA 2L76A 3WALA 4PYUA 1P3QU 2ZVNA 3AXCA 2HJ8A 3L17A 4A3PA 4ZDVA 4K7WA 2NPTB 3DBSA 3A4SC 3SD5A 4F7ZA 3PREA 3TCAA 2O6VD 1LFDA 3ML9A 1V9JA 2AWTA 3VDZA 5J18A 2KX0A 1J19A 2DYBA 2KO3A 3DPDA 2PJHA 2LI5A 3OAWA 5DPSA 2N7EA 4URKA 1KOTA 4KDLB 2LXCA 3L16A 2N9PC 4G50A 3PRPB 4KZ0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BT0 A;  2K8H A;  2NBV B;  3TMP B;  5BO4 B;  2MSE D;  4GB9 A;  4X57 B;  1GJZ A;  5JHA A;  3APF A;  2DYO A;  4B6W A;  1WJ4 A;  5KHQ A;  3A1Q A;  3KVF B;  4GMV A;  3NHE B;  1CMX B;  3TJP A;  2LWP A;  4HXD A;  3QJZ A;  3RYT A;  2MQJ A;  2EKE C;  2BKR B;  3DVN V;  4KVG B;  3SHQ A;  4EZK A;  2UYZ B;  4HCN B;  4HWI B;  2KHW B;  2ZNV B;  5L95 C;  2KMA A;  3A4R A;  3TL5 A;  4DHZ B;  4DWF A;  2MCN B;  3T8M A;  2WYQ A;  2MA9 B;  1IYF A;  3PZD A;  5FR6 A;  1SE9 A;  1UD7 A;  1R4N I;  3VVW B;  3JVZ X;  3UQB A;  2MBH A;  1OGW A;  4MJS B;  3L0W B;  2XBB C;  5CHV C;  1WJU A;  1F9J A;  1WGR A;  4B9K A;  2PPH A;  1YIW A;  3T9L A;  1K8R B;  1EF5 A;  2I1K A;  3VH4 B;  4GDL A;  3VTW A;  4MGI E;  2G3Q B;  3MJW A;  2EMT A;  3HM6 X;  2CHX A;  5LXH A;  3DVG X;  1E5W A;  2JY6 A;  4MEL A;  3ZRC A;  2N9X A;  4W9F A;  1WZ0 A;  2L00 B;  2XK5 B;  1E90 A;  3ZIM A;  2BGF A;  3ONS A;  3NY5 A;  4N9F 4;  2LAS A;  3VXW A;  1E8Y A;  3KYD D;  2N9E B;  1EF1 A;  3PLU A;  1WIA A;  3CSF A;  1WM3 A;  1EUV B;  2R2Q A;  3OLM D;  3QHT A;  4TKN A;  4E71 A;  3K9P B;  4MGZ E;  3S2A A;  3HK0 A;  2W9N A;  1V2Y A;  4RMA A;  4MJS A;  5HKH A;  1AAR A;  1WR1 A;  3DVN U;  4NAW A;  2D11 A;  3L08 A;  4PS7 A;  2KJ6 A;  3ZO5 B;  3BY4 B;  4YL8 A;  1V5O A;  1NBF C;  2KTR B;  3IVF A;  3PPA A;  3ML8 A;  4FLH A;  4W9J A;  4ZYN A;  4BOZ B;  5L83 A;  2KNB A;  1IP9 A;  5JHB A;  2MRP A;  2K25 A;  1XQQ A;  2FCN A;  2FCM A;  3X0W A;  1P0R A;  2YVC A;  3UIN B;  2K39 A;  1GC7 A;  3ZTD A;  5CX3 A;  3EC8 A;  3WIM A;  3ENE A;  5E6O A;  3H9D A;  4ANV A;  4ASW C;  1R4M I;  3DQV A;  1OEY J;  3APC A;  4EZJ A;  3O65 B;  4FUL A;  3V61 A;  2C7N B;  4F1S A;  2DEN B;  1FXT B;  2LD9 A;  2J0K A;  2BWE S;  1VCB A;  3A9J A;  3UQA A;  2Y5B B;  1Q1O A;  1V80 A;  2BPS A;  1X1M A;  3WAO A;  2G4S A;  4E74 A;  2KDI A;  3RT3 B;  1UZX B;  2IY1 B;  1GC6 A;  4IC7 B;  1E8X A;  1Q0W B;  1S1Q B;  4W9E A;  1TZ1 A;  2KMC A;  2KC2 A;  2MP2 B;  3DCG A;  2KC1 A;  1HE8 A;  5IAA C;  4BKS A;  2MW5 A;  2K8B A;  5G2N A;  4WWN A;  2A4Z A;  4ANX A;  1UH6 A;  2WX0 A;  3D32 A;  2GMI C;  2JZZ A;  2MBO A;  4HCP B;  4W9I A;  4GDK A;  1UBI A;  3QQ8 B;  3A9K B;  1G6J A;  2JVC A;  1WGG A;  4DDG D;  2L8J A;  4GU2 A;  2FCS A;  4GIV A;  1WGD A;  4BOS C;  4RM9 A;  1WMH A;  3QA8 A;  1GUA B;  3K9O B;  4J6I A;  4NQL B;  3H7P B;  1PQS A;  3QK0 A;  3W1S A;  4MSQ B;  3M62 B;  2VRR B;  2RGF A;  3NS8 A;  3OJ3 A;  4II3 B;  1E7V A;  4K1R B;  2RSU A;  2NS5 A;  3IFW B;  2V1Y A;  2D2Q A;  4KIK A;  4GSW A;  4WJO A;  3ZDM C;  5AEK B;  4HK2 A;  1A5R A;  1J8C A;  3VH3 B;  4G0N B;  5DPR A;  2IO0 B;  1H4R A;  2KXJ A;  2RD0 A;  4KSK C;  3UIP B;  4FJY A;  3WAN A;  4I6P A;  1WX9 A;  2NVU I;  2J0M A;  2PE9 A;  1LM8 B;  2O2V B;  5E6N A;  3Q3J A;  2ASQ A;  2O6V A;  5C1Z A;  2DX5 B;  2L0F A;  1WXA A;  2BWF A;  2M1M A;  1P9D U;  2L3Z A;  1J0G A;  2MWS B;  3OJ4 B;  2KDF B;  2NPT A;  2LJ5 A;  2GBN A;  3PTF C;  3R3M A;  1WX7 A;  3N30 A;  2IO2 B;  2ZPN A;  4M8N A;  4DHJ B;  2JRH A;  2REX A;  1TBE A;  2Z0D B;  1TGZ B;  3MHS D;  3PSE B;  4K7S A;  3B0A A;  3VUW A;  1QZE A;  2HE7 A;  2LVO A;  3TIX A;  2IO1 B;  2K1F A;  4HPM B;  4MSM B;  1WR6 E;  4DHJ D;  4W9L A;  5AZF A;  1LQB A;  2BF8 B;  1UEL A;  3AU5 A;  4W9H A;  2C7M B;  4FN2 A;  2BYV E;  4LJO B;  3B1L X;  3H1U A;  2L7R A;  1ISN A;  3W1S C;  1EO6 A;  4XZ4 A;  3V6C B;  4CYE A;  4FA6 A;  3PT2 B;  4K7U A;  2CR5 A;  4LDT D;  4TUU A;  4OVV A;  2KQS A;  4GGQ A;  3DVG Y;  3DBR I;  2XEW A;  4BBN C;  1V5T A;  4BBN F;  4JIO U;  4JLC A;  2V4L A;  2DHZ A;  3JSV B;  3JYU A;  3IHP C;  3PRZ A;  1L2N A;  2KK8 A;  5DPT A;  3PRM B;  3DBH I;  4W9G A;  4IWO A;  1VD2 A;  2ZCB A;  5LXI B;  3HM3 A;  1Z5S B;  2YLM A;  2MBE A;  2KWV B;  2KDE B;  3ALB A;  1ZW7 A;  4ZRK A;  4PS3 A;  4TQ0 A;  1SGH A;  2KQ7 A;  2XK5 A;  3JW0 X;  3RZW C;  2LGD A;  1XD3 B;  1V81 A;  2N7D A;  4ANU A;  2KX3 A;  1TTN A;  2DZI A;  1WGY A;  1OQY A;  2N4F A;  3NZU A;  2IO3 B;  4KZC A;  4BVU C;  3R7Q A;  3VQI A;  4IWP A;  4PYZ A;  3HIZ A;  3JSV A;  4NPN A;  1P1A A;  4EFO A;  1WGH A;  3U30 A;  5J2R A;  3ZDT A;  2B3A A;  2KTF A;  1RFA A;  3P2B A;  3Q3F A;  4HLE A;  4GXB A;  2K6D B;  4JGH B;  2KAN A;  2OJR A;  2IZV B;  2JUO A;  2KTR A;  1V49 A;  1OTR B;  2BKF A;  2M8S A;  2LGX A;  4ZRI A;  4GN1 A;  2Z59 B;  1WI0 A;  4FJV B;  3ZTC A;  2FNJ B;  4NQK E;  1I35 A;  2LVP A;  4TQ1 A;  2NR2 A;  2Z0E B;  5GMV A;  2DYM A;  4XC2 A;  1GG3 A;  2M0X A;  1WXS A;  2ZNV C;  1WRD B;  2M17 A;  3QAQ A;  4FHK A;  4JL9 A;  4W9D A;  4W9K A;  5DPW A;  4AJY B;  3ZNG C;  4ICV A;  4E3C A;  2D07 B;  1WM2 A;  3GZN I;  3CF6 E;  3APD A;  4IM3 A;  3UIO B;  4FBJ B;  2L05 A;  3CMM B;  1RRB A;  2G45 B;  2AEH A;  2KZR A;  2ZPY A;  2FAZ A;  5D6J B;  3ZUN A;  1D3Z A;  3IG3 A;  4HJK A;  2LVQ A;  3KUD B;  2JF5 A;  1XT9 B;  1YJ1 A;  4WJN A;  2HTH A;  2MLB A;  1NI2 A;  2NBU A;  3V62 A;  1WZ3 A;  1U4A A;  1SIF A;  1LXD A;  2MP2 A;  2N1V A;  4B95 A;  2IY0 B;  3RUL A;  3VUY A;  2QHO A;  1WFY A;  3PVL A;  5D7G A;  2FCQ A;  2WX1 A;  3VTV A;  1JRU A;  2C9W B;  2KJH B;  1ZGU B;  1Q5W B;  2KLG A;  2RPQ A;  4I6L B;  5J17 A;  4IG7 B;  1OEY A;  1YQB A;  4FJZ A;  4GOC A;  4HPL B;  5D94 A;  3A1Q B;  4ZRJ A;  2FID A;  3DDC B;  3PHW B;  4AOF A;  4F8C B;  2RR9 A;  4AP4 C;  3RD2 A;  2IYD B;  3A9K A;  1WX8 A;  3KW5 B;  2K6Q A;  4PS8 A;  5CTR C;  4EOY A;  2JRI B;  2M4N A;  3QWZ B;  2FUH B;  2WDT B;  4EEW A;  2KOX A;  2UWQ A;  2AL3 A;  4FHJ A;  1T0Y A;  4MGY E;  4DDI D;  3H7P A;  5CHF A;  2KJR A;  1E7U A;  1KJT A;  3L10 B;  2GBJ A;  4G3X B;  1WF9 A;  5E6P A;  1P98 A;  5LLI A;  1M94 A;  3VAW A;  2NCN A;  1WY8 A;  2MX2 A;  2OOB B;  1KM7 A;  3V6E B;  1C1Y B;  1E8Z A;  2LZ6 A;  4DBG A;  3AUL A;  3ZNI D;  1RAX A;  3PGE A;  4BFR A;  5AZG A;  3BIN A;  1WH3 A;  4GDL B;  4I6N B;  2D10 A;  4MGK E;  5DCN A;  2JT4 B;  2KD0 A;  4IW0 A;  4KSL C;  2KFJ A;  4AWJ A;  2O2V A;  2FIF A;  4IUM B;  3DBL I;  3U7D A;  5IA7 A;  3ZW3 A;  3M95 A;  4NJ7 A;  2D3G A;  2C5L C;  3M3J A;  3IBE A;  4BKT A;  4LDT B;  2G4D B;  3VUX A;  3VTU A;  4OVU A;  1S3S G;  3I3T B;  4LCD E;  3X23 A;  3SU8 X;  3ZLZ A;  2ZZP B;  4HVB A;  1WYW B;  4EZL A;  4NY0 A;  4MEM A;  4A3O A;  1KLV A;  2CKH B;  2PEA A;  2KWC A;  4JQW C;  3ZNH B;  1H8C A;  2KFK B;  3L54 A;  1ZKH A;  4WWP A;  3RUI B;  3H7S A;  1WJN A;  3KH0 A;  4W9C A;  4NAW B;  4XX5 A;  2V3S A;  3PV1 A;  3NZS A;  2KN5 A;  4IM0 A;  4A20 A;  4BKG A;  4MM3 A;  5KHO A;  3LDZ E;  2EMS A;  3W1Y A;  4WAA A;  3ZKJ C;  3WA0 A;  2ZEQ A;  2LGY A;  3GOE A;  3ZVV A;  4MDK E;  1RLF A;  4RM8 A;  2GBM A;  3U8Z A;  3VFK A;  3KUC B;  5D2M B;  2C60 A;  2AYO B;  2ZCC A;  3CST A;  4KDI C;  1NDD A;  4M8M A;  4II2 B;  3N32 A;  1L7Y A;  1WXV A;  2JWZ A;  3M63 B;  4LJP B;  2R2O A;  3LJ3 A;  4M0W B;  2N1W A;  1GNU A;  2DZK A;  3TBL D;  4WJP A;  1V86 A;  1E8W A;  2LRU A;  4ICU A;  3WAP A;  4KV2 A;  4AUQ C;  4ANW A;  3KYC D;  4AJW A;  3R66 C;  2KFK A;  2C7H A;  3VHT C;  1YX6 B;  1Z2M A;  2GBR A;  4P7I A;  2LUE A;  4WJQ A;  2A5U A;  3A33 B;  3A9J B;  5C23 A;  3PS6 A;  3N3K B;  2BYE A;  2JPH A;  5CHW A;  4DXA B;  3PLV A;  5TR5 A;  4HDQ A;  3ECI A;  4DK5 A;  2IBI B;  4CHK A;  2CS4 A;  3R7R A;  3QX1 A;  5G55 A;  3SDL C;  2CHW A;  2AL6 A;  4MH0 E;  3UF8 A;  3ZNZ B;  1YD8 U;  1WE6 A;  2KKC A;  3HHM A;  4GDK B;  4EKU A;  4WWO A;  2ZJD A;  1V6E A;  3EFU A;  4BKS D;  1IPG A;  3L13 A;  2CU1 A;  4K81 A;  2GBK A;  2WWZ A;  5JH5 C;  4CO7 A;  3RZF A;  3ZRF A;  1WXM A;  3UGB B;  5AZH A;  3KUZ A;  1WMH B;  4NNJ B;  1C3T A;  3V60 A;  2GOW A;  3QC8 B;  2J7Q B;  2MBB B;  3C0R B;  3AI5 A;  4G11 A;  2DAJ A;  2DAF A;  2JXX A;  2LRW A;  2HD5 B;  2L0T A;  3QCA A;  4KIK B;  3NOB A;  3PHX B;  3WAM A;  2MBQ A;  1YX5 B;  2J0J A;  2DZM A;  2KLC A;  4NJ6 A;  2CHZ A;  2KVR A;  1I42 A;  4HDO A;  1Y8R C;  3EEC A;  2LXA A;  3QIJ A;  4DHZ E;  4IM2 A;  4WQO B;  1WE7 A;  1MG8 A;  2ZVO A;  1UGM A;  3QAR A;  1UBQ A;  2KDB A;  2I1J A;  3RCZ A;  3DOW A;  4TV3 A;  2KWU B;  3MTN B;  2DZJ A;  3EHV A;  3AU4 A;  2PE6 B;  2NBW B;  3H6N A;  4EUT A;  2O6V B;  2JZ3 B;  3B08 A;  4IWQ A;  4FAD A;  5EDS A;  5JZE B;  1WJ6 A;  2BYF A;  2K8C A;  2L76 A;  3WAL A;  4PYU A;  1P3Q U;  2ZVN A;  3AXC A;  2HJ8 A;  3L17 A;  4A3P A;  4ZDV A;  4K7W A;  2NPT B;  3DBS A;  3A4S C;  3SD5 A;  4F7Z A;  3PRE A;  3TCA A;  2O6V D;  1LFD A;  3ML9 A;  1V9J A;  2AWT A;  3VDZ A;  5J18 A;  2KX0 A;  1J19 A;  2DYB A;  2KO3 A;  3DPD A;  2PJH A;  2LI5 A;  3OAW A;  5DPS A;  2N7E A;  4URK A;  1KOT A;  4KDL B;  2LXC A;  3L16 A;  2N9P C;  4G50 A;  3PRP B;  4KZ0 A; 
#chains in the Genus database with same CATH topology
 3BK2 A;  2K8H A;  1PFD A;  5JHA A;  5KHQ A;  3A1Q A;  3NHE B;  1C4A A;  3RYT A;  2MQJ A;  1V1P B;  3SHQ A;  1C76 A;  3RFZ B;  4HWI B;  2KHW B;  2ZNV B;  4US8 A;  4HRO A;  2JSV X;  3T8M A;  1N6Z A;  3L0W B;  2V3P A;  5H92 C;  4C7Y A;  5CHV C;  1WJU A;  1YIW A;  3T9L A;  3U2S C;  3GB1 A;  1E10 A;  3MC9 A;  2JY6 A;  3ZRC A;  3ZJT A;  1E90 A;  4A90 A;  2PVO D;  1E8Y A;  3AMZ A;  1WM3 A;  1J7C A;  1EUV B;  3S2A A;  1RM6 C;  2N9L A;  2Q5W D;  1NEN B;  1DYQ A;  1TY2 A;  4PS7 A;  3ZO5 B;  3BY4 B;  1YQ3 B;  4YL8 A;  2KTR B;  3IVF A;  4BOZ B;  1ACC A;  5JHB A;  3Q8C A;  2AQ1 B;  2ICI A;  4S0R A;  1DOX A;  1TT5 B;  2INN E;  3BZD B;  3WIM A;  3DQV A;  2DWQ A;  4FUL A;  2C7N B;  4F1S A;  3MHZ A;  3WCQ A;  1TY0 A;  2HDE A;  1VCB A;  1V80 A;  1X1M A;  3WAO A;  1FRR A;  3Q14 C;  3FIL A;  1GC6 A;  1ZDV A;  4IC7 B;  1I4Q A;  2HTM E;  1QF6 A;  2KC1 A;  2JWU A;  5IAA C;  4BKS A;  2MW5 A;  2A4Z A;  1HXY D;  1UH6 A;  2MH7 A;  2ZW0 A;  5D3D A;  4BAX A;  4W9I A;  2W55 A;  4GDK A;  4US9 A;  4C80 A;  3QQ8 B;  4GU2 A;  4BOS C;  1WGD A;  2JU6 X;  1ZXH A;  4J6I A;  4JWS C;  3QK0 A;  3M62 B;  2RGF A;  1F0Z A;  3OJ3 A;  1AWD A;  2WGS A;  4KIK A;  4XDC A;  1SJH D;  3P63 A;  1R7S A;  2D5G A;  3VH3 B;  2DLB A;  1NEK B;  4KSK C;  3WAN A;  1WX9 A;  1LM8 B;  4K3B A;  5E6N A;  2O6V A;  1XLP A;  3MJ5 A;  1TKY A;  1NYR A;  2MWS B;  1E7P B;  2GI9 A;  3R3M A;  3N30 A;  1HZ5 A;  5FK9 C;  4DHJ B;  1D5M C;  4K7S A;  1PGA A;  4XE0 A;  3AE2 B;  3RNE C;  1K53 A;  2HE7 A;  4M02 A;  3TIX A;  1AW7 A;  4MSM B;  1ZUD 2;  4A6Q A;  3FAH A;  3GZN B;  2BF8 B;  1FCL A;  4KGS A;  3B1L X;  4CYE A;  1EO6 A;  3PT2 B;  4P1C C;  1WWT A;  2KQS A;  2XEW A;  4BBN F;  3IHP C;  4L1B A;  5DPT A;  3PRM B;  4W9G A;  2ZW1 A;  2K5P A;  1VD2 A;  2YEP F;  4DQO C;  4JPS A;  3IT4 B;  4HKZ E;  2KWV B;  3ALB A;  2J53 A;  2AX5 A;  4PS3 A;  2KQ7 A;  2LGD A;  1V81 A;  2N7D A;  1V8C A;  1FD6 A;  2KQ4 X;  1MHX A;  2N4F A;  1JAL A;  3NZU A;  2IO3 B;  4BVU C;  2PIA A;  3VQI A;  4IWP A;  4AS1 A;  1M4V A;  3HIZ A;  1P1A A;  4Q2J A;  4EFO A;  1WGH A;  3U30 A;  2B3A A;  2W82 A;  3Q3F A;  4HLE A;  4GXB A;  2K6D B;  2GB1 A;  1XCT L;  1MPE A;  1V49 A;  1FNW A;  3EA6 A;  1OQQ A;  2HJ1 A;  1HTO A;  4XC2 A;  1GG3 A;  4OVZ A;  4W9D A;  5DPW A;  4ICV A;  2D07 B;  1UWM A;  3APD A;  4FBJ B;  2L05 A;  1IGD A;  2KZR A;  2XNA C;  2ZPY A;  3IG3 A;  1XT9 B;  4WJN A;  3DBH B;  1NI2 A;  1WZ3 A;  1SIF A;  2MP2 A;  4B95 A;  3PVL A;  5D7G A;  2WX1 A;  2KJH B;  1FM0 D;  1YQ4 B;  2KLG A;  2RPQ A;  3ZJU A;  4N6E B;  4GOC A;  4AOF A;  5EE9 A;  1VZ8 A;  1MG4 A;  3A9K A;  3KW5 B;  4ARI A;  2M4N A;  3AE5 B;  2UU7 A;  3MFG A;  2NTS A;  2UWQ A;  4DDI D;  3H7P A;  2WS3 B;  1WF9 A;  1M94 A;  3CWI A;  2KAC A;  2NCN A;  2MX2 A;  1KM7 A;  1C1Y B;  1CK1 A;  1TYG B;  3PGE A;  3IXS A;  2FBW B;  3ZXV A;  2KFJ A;  4AWJ A;  2O2V A;  3ZW3 A;  2C5L C;  3IBE A;  3W9C B;  1QIL A;  2G4D B;  1TS5 A;  2Y3A A;  2FUG 1;  3ZLZ A;  3MC0 B;  1WYW B;  4NY0 A;  1KLV A;  2RDH A;  2PEA A;  4JQW C;  3Q3M C;  4WWP A;  4HJG E;  2I2Y A;  3KH0 A;  2V3S A;  4LNF A;  2KN5 A;  4RFB A;  4A20 A;  4BKG A;  4KX6 B;  3P4P B;  4WAA A;  3WA0 A;  2ZEQ A;  1LO5 D;  2BVC A;  1RLF A;  1SIJ A;  5D2M B;  3RPF C;  3CST A;  4D2K A;  2PLP A;  4MT5 A;  1WXV A;  4LJP B;  2R2O A;  5AUK A;  2DZK A;  2V3N A;  4KV2 A;  3Q8A A;  3VHT C;  1Y56 A;  3NZ3 A;  2BYE A;  2JPH A;  3O13 A;  4EE2 A;  1EWY C;  1TS4 A;  3DWG C;  1SE4 A;  1YN5 A;  2QCZ A;  1GB1 A;  3R7R A;  2V9H A;  1T0Q C;  3QX1 A;  5BYQ A;  3SDL C;  5EE3 A;  2AL6 A;  3R2T A;  2KKC A;  2N0S B;  4WWO A;  1V6E A;  4BKS D;  2VZK D;  1ZOY B;  3TSS A;  2QJL A;  2LGS A;  3ZRF A;  1WXM A;  3KWL A;  1XLQ A;  2GOW A;  5C2T B;  2DAF A;  3P4S B;  2LRW A;  1I4G A;  3WAM A;  2MBQ A;  1YX5 B;  3ETR A;  2KLC A;  4NJ6 A;  4IM2 A;  1QOB A;  2ZVO A;  2KDB A;  1NI3 A;  3DOW A;  3RCZ A;  2V0G A;  4RNA A;  4RGT A;  3MTN B;  2Z8L A;  2PE6 B;  1GAQ B;  2K8C A;  2DNF A;  4PYU A;  2ZVN A;  1L0Y B;  3L17 A;  3TCA A;  2O6V D;  3MP9 A;  1J19 A;  3DPD A;  2N7E A;  4URK A;  2BS3 B;  1KOT A;  4HXD A;  4G50 A;  3PRP B;  2W3R A;  4KZ0 A;  3TMP B;  1GJZ A;  3APF A;  1KRH A;  1CMX B;  3QJZ A;  1WRI A;  2BKR B;  1FO4 A;  2WXO A;  4EZK A;  4HCN B;  1C78 A;  5L95 C;  2KMA A;  2MCN B;  1F2R C;  3W2D A;  1HQR D;  4C4V B;  5BMH A;  3PZD A;  1R4N I;  3JVZ X;  1YJJ A;  3Q8F A;  4MJS B;  2XBB C;  1JWS D;  4B9K A;  4RGN A;  3AE8 B;  3VH4 B;  4GDL A;  4MGI E;  2G3Q B;  4ITK A;  3BK1 A;  3HM6 X;  5LXH A;  3DVG X;  1E5W A;  2LEK A;  4MEL A;  2N9X A;  2D3C A;  1WZ0 A;  2K0P A;  4W9F A;  3ONS A;  1SE3 A;  2LAS A;  1WYG A;  3PLU A;  3TEZ A;  4C4V A;  3CSF A;  3OLM D;  3QHT A;  4E71 A;  3K9P B;  3HK0 A;  2W9N A;  5EE0 A;  4LNI A;  4RMA A;  4MJS A;  3DVN U;  2D11 A;  2IND C;  3GE8 C;  2WDQ B;  3AE9 B;  3IT6 B;  4ZYN A;  1TIF A;  3ML8 A;  4W9J A;  1ET9 A;  2K25 A;  3IAS 1;  1AYF A;  3RNC C;  5BMI A;  2K39 A;  4M0W A;  3AV8 A;  3ENE A;  2N7J A;  1R4M I;  3U52 E;  3APC A;  2MHJ A;  4P1B C;  1I4R A;  2J0K A;  5MPO A;  3UQA A;  2Y5B B;  3LXF A;  2BPS A;  2G4S A;  3RT3 B;  3VR8 B;  2IY1 B;  1E8X A;  1TZ1 A;  2KMC A;  5G2N A;  4WIP A;  3D32 A;  1FMA D;  2JZZ A;  5EE1 A;  4XDD A;  2AQ3 B;  1JWU D;  2JVC A;  4YXD B;  3MC8 A;  3AEE B;  2FCS A;  1L4Z B;  3SFE B;  1WMH A;  1GUA B;  3K9O B;  2BS2 B;  4NQL B;  1PQS A;  3TUO A;  3W1S A;  2WXQ A;  5HFY A;  1E7V A;  4K1R B;  2RSU A;  3IFW B;  1XEE A;  3NG0 A;  2V1Y A;  4GSW A;  3GS2 A;  4WJO A;  4HK2 A;  4IKG A;  1UNS A;  2WXG A;  4GLS C;  2NVU I;  3RNG C;  5C1Z A;  2M1M A;  2L3Z A;  5IO9 A;  2K3U A;  2ACZ B;  2KT7 A;  3PTF C;  1TBE A;  4JX1 C;  3PSE B;  3L4P A;  2VH1 A;  3FC4 A;  3B0A A;  5T8I A;  2J42 A;  3HVD A;  1LQB A;  1UEL A;  3AU5 A;  5LNK 1;  2C7M B;  3SEB A;  4OHJ A;  3VR9 B;  3H1U A;  1V1P A;  3W1S C;  4XZ4 A;  1FXA A;  5IKC M;  4FXC A;  4K7U A;  3ZXR A;  4GGQ A;  3DVG Y;  1ZXI A;  4JIO U;  1WSP A;  3JSV B;  3PRZ A;  2K22 A;  1L2N A;  1C4P A;  4IWO A;  1MHH E;  1I7H A;  3OG5 A;  1Z5S B;  1F77 A;  1EWC A;  3EFC A;  3JW0 X;  1MJD A;  4ANU A;  3C19 A;  4DXF A;  1OQY A;  4RGM A;  4WUR A;  3Q3N C;  5AUI A;  3JSV A;  3ZDT A;  2IGH A;  4JGH B;  2KAN A;  2IZV B;  3I57 A;  1HA5 A;  2JXT A;  2KTR A;  2M0A A;  4ZRI A;  4FJV B;  4YT0 B;  1TS3 A;  1I35 A;  2ZNV C;  1WRD B;  4E3C A;  1RYJ A;  4IM3 A;  3UIO B;  3DBR B;  2AQ2 B;  3ZUN A;  2FAZ A;  5D6J B;  2HTH A;  2MLB A;  2QEJ C;  1U4A A;  2N1V A;  1BUI C;  3VUY A;  1WFY A;  3NVW A;  2W54 A;  3VTV A;  1BML C;  4IG7 B;  1OEY A;  2PVG C;  3PHW B;  3RD2 A;  1FXI A;  1WX8 A;  1VLB A;  2K6Q A;  4PS8 A;  2JRI B;  2FUH B;  1YN3 A;  2WDT B;  4EEW A;  4FHJ A;  1T0Y A;  2X8X X;  3Q2A C;  5CHF A;  4B0M A;  2D3A A;  2GLS A;  1WY8 A;  2J52 A;  4A9A A;  5JXV A;  1HZ6 A;  2OOB B;  3PZ7 A;  3V6E B;  4S17 A;  4NAM A;  3ZNI D;  4BFR A;  3BIN A;  1FRD A;  4I6N B;  5DCN A;  3Q69 A;  2JT4 B;  3N1Y C;  4XGA B;  4IW0 A;  1J7B A;  3U7D A;  3M95 A;  4BKT A;  4KKI A;  4LDT B;  3VTU A;  4OVU A;  3X23 A;  2ZZP B;  4LLG M;  1NYQ A;  2K9X A;  4MEM A;  4A3O A;  1UUP A;  3PO0 A;  1IGC A;  4NAW B;  4XX5 A;  5TSS A;  1ZPS A;  3NZS A;  3AED B;  3W1Y A;  3GOE A;  2KAJ A;  4MDK E;  3U8Z A;  3KUC B;  2C60 A;  4M8M A;  3AN1 A;  1L7Y A;  4R3D A;  3M63 B;  3TBL D;  1GNU A;  4WJP A;  1V86 A;  1E8W A;  4ICU A;  3WAP A;  4AUQ C;  3KYC D;  4AJW A;  3AEC B;  2C7H A;  1YX6 B;  4P7I A;  2QDF A;  4WJQ A;  3T3N A;  3A9J B;  5CHW A;  3AM9 A;  4YSZ B;  2E6X A;  1XCQ L;  1FIQ A;  2RMM A;  3T3O A;  3BVZ A;  4P16 A;  5G55 A;  1L5P A;  3DBL B;  2CHW A;  3ZNZ B;  2BS4 B;  1VDV A;  3KWV A;  2ZJD A;  2N9K A;  2VH2 A;  3KUZ A;  1T3Q A;  1R4N B;  4NNJ B;  3V60 A;  1HEZ E;  1IBX B;  3QC8 B;  1T0R C;  2J7Q B;  2JXX A;  2L0T A;  3NOB A;  3PHX B;  4LNO A;  2J0J A;  2DZM A;  2JZP A;  3NVV A;  2MEK A;  2Y5C A;  2LUM A;  3QAR A;  4YWG G;  2I1J A;  2PW9 A;  3URY A;  1UGJ A;  2OJW A;  4TV3 A;  4OZB A;  1DOI A;  4WWM A;  1KFY B;  2LGI A;  1KF6 B;  2BYF A;  3WAL A;  1P3Q U;  1IBX A;  1EU3 A;  2NPT B;  3DBS A;  4K7W A;  3SD5 A;  2INC C;  3Q8B A;  5J18 A;  2KO3 A;  2E3T A;  2WXN A;  4KDL B;  3GE3 C;  1BT0 A;  2NBV B;  1R4M B;  4X57 B;  2PKO A;  3HVZ A;  3UI3 A;  3B2G A;  3KVF B;  4GMV A;  3EUB 2;  1P7E A;  3TJP A;  2LWP A;  2NTT A;  2EKE C;  3NJT A;  3B9J A;  4KVG B;  4PK1 A;  1ET6 A;  3A4R A;  1QOG A;  3LYY A;  4YTM B;  1IYF A;  5FR6 A;  1KTK A;  3UQB A;  2MBH A;  1OGW A;  5FR3 A;  1OFF A;  1K8R B;  2EMT A;  2XK5 B;  3Q8E A;  2BGF A;  1PUT A;  4N9F 4;  1EF1 A;  4TKN A;  2H88 B;  2WP9 B;  4ZRQ A;  5HKH A;  1AAR A;  1WR1 A;  3L08 A;  4IOI E;  2KJ6 A;  2XN9 C;  1NBF C;  3PPA A;  4ZRP A;  5L83 A;  2KNB A;  2MRP A;  1EU4 A;  2FCN A;  2FCM A;  3X0W A;  2YVC A;  4RCO A;  3UIN B;  1GC7 A;  4ANV A;  2RDB C;  1OEY J;  3O65 B;  3U4E G;  4N58 A;  3V61 A;  1JQ4 A;  1L0V B;  3NVZ A;  1KLU D;  1Q1O A;  1SXT A;  2KDI A;  1UZX B;  2WXK A;  1S1Q B;  4W9E A;  1C4C A;  2CJO A;  2WX0 A;  1UWX A;  1VZ7 A;  1PGX A;  4YSY B;  1UBI A;  1QKZ A;  1WGG A;  4DDG D;  1JCK B;  3AEB B;  2WHI A;  3BYT B;  4GIV A;  4MSQ B;  2VRR B;  3NS8 A;  2W3S A;  4K3C A;  1Q10 A;  4RH6 A;  3ZDM C;  4YTN B;  5AEK B;  1J8C A;  3Q6B A;  3BII D;  2J0M A;  2PE9 A;  1YN4 A;  2DX5 B;  2L0F A;  2CU3 A;  2WXH A;  4USA A;  1J0G A;  4N59 A;  4BZA A;  1A70 A;  2FE8 A;  2LJ5 A;  2GBN A;  2KWD A;  2JYT A;  4M8N A;  2JRH A;  4O1N A;  5BYS A;  2Z0D B;  1TGZ B;  3MHS D;  2IDY A;  3ZQ4 A;  4MM3 B;  2LVO A;  2LJI A;  2WXI A;  1B1Z A;  4HPM B;  3PZ8 A;  1WR6 E;  4DHJ D;  3I63 C;  4W9L A;  2PTL A;  4ACF A;  5E6J A;  3Q3O C;  4LJO B;  2L7R A;  4FA6 A;  3V6C B;  3BWU D;  4LDT D;  4TUU A;  4OVV A;  2BYT A;  1V5T A;  4JLC A;  2DHZ A;  2KK8 A;  3DBH I;  3DHI C;  1N61 A;  2ZCB A;  3SR6 A;  2YLM A;  2WNM A;  1P7F A;  3AE4 B;  1MVK A;  4ZRK A;  4C7Z A;  2ON8 A;  4A55 A;  1XD3 B;  2LHE A;  2M19 A;  2DZI A;  1WGY A;  4TSS A;  1E0Z A;  3R7Q A;  1XLN A;  4PYZ A;  2SEB D;  3TEW A;  2JUO A;  2L32 A;  5HG2 A;  2M8S A;  2LGX A;  1JRP A;  4GN1 A;  2Z59 B;  1WXQ A;  5IOI A;  3ZJV A;  4NQK E;  1T5X D;  2QC8 A;  5GMV A;  2Z0E B;  3KLS X;  2M0X A;  1MI0 A;  4JL9 A;  2M17 A;  4FHK A;  3ZNG C;  2Y5P A;  3CMM B;  3N1Z C;  1D3Z A;  3BYY B;  5IP4 D;  3V05 A;  4ZHO A;  1KH0 A;  2JF5 A;  1YJ1 A;  2NBU A;  2IY0 B;  5BMG A;  3RUL A;  2QHO A;  2FCQ A;  1JRU A;  2C9W B;  1Q5W B;  5J17 A;  4J3O D;  1K51 A;  1QT9 A;  1XLO A;  3A1Q B;  5D94 A;  3DDC B;  4AP4 C;  4UDU C;  1QOA A;  2L83 A;  3NS1 A;  1VRA B;  5CTR C;  2KOX A;  2AL3 A;  2WDV B;  4MGY E;  3DWM A;  3AH7 A;  1E7U A;  3L10 B;  3LB8 C;  3DHH C;  1XO3 A;  4WQM A;  1ENF A;  4B0E A;  3P42 A;  3TEX A;  1KLG D;  4H2A A;  1SJE D;  1RAX A;  1F2R I;  1WH3 A;  4MGK E;  2KD0 A;  2SAK A;  3P4Q B;  4KSL C;  4OZA A;  2FIF A;  4NJ7 A;  3M3J A;  3RNA C;  3VUX A;  1S3S G;  5HHD G;  3I3T B;  3VRA B;  2CKH B;  1H8C A;  3ZNH B;  2KFK B;  1ZKH A;  1SB3 C;  3RUI B;  3C8Y A;  2JQR B;  3R8B A;  3PV1 A;  4IM0 A;  2DBY A;  5KHO A;  3LDZ E;  1ROE A;  2EMS A;  4YTP B;  3ZKJ C;  1B9R A;  2GBM A;  4KDI C;  2ZCC A;  4HKQ A;  4II2 B;  3N32 A;  4RM8 A;  2JWZ A;  3LJ3 A;  1EM7 A;  1YJI A;  4ANW A;  1XF5 L;  2KFK A;  3R66 C;  4C56 C;  1RWS A;  1Z2M A;  2GBR A;  3SFD B;  1T6B X;  1XXG A;  1RFK A;  4DXA B;  2MJE A;  4XWW A;  3FIL B;  5TR5 A;  1IUE A;  3ECI A;  2NMQ A;  4RF1 A;  2VZK B;  4DK5 A;  4CHK A;  2CS4 A;  3DHG C;  1N62 A;  1MFW A;  1WE6 A;  4GDK B;  2WU5 B;  1PDX A;  2D3B A;  1IPG A;  1FNV A;  2CU1 A;  2WWZ A;  5JH5 C;  4CO7 A;  3RZF A;  3UGB B;  5AZH A;  1YNT E;  1C3T A;  1K50 A;  2MBB B;  3C0R B;  3AI5 A;  4G11 A;  2HD5 B;  1CZP A;  4KIK B;  2WU2 B;  2KVR A;  1I42 A;  4HDO A;  1Y8R C;  2LXA A;  4WQO B;  1WE7 A;  1UBQ A;  2WLB A;  2KWU B;  2B76 B;  2DZJ A;  2OED A;  3AU4 A;  2NBW B;  2O6V B;  3HUI A;  3B08 A;  4IWQ A;  4KGT A;  2WXJ A;  1FNU A;  5JZE B;  2L76 A;  3AXC A;  4ZDV A;  2R61 A;  3A4S C;  1D5Z C;  1F1H A;  1VZ6 A;  4F7Z A;  3ML9 A;  1V9J A;  2AWT A;  2BB5 A;  1C77 A;  2KX0 A;  4MH8 A;  1L0X B;  2PJH A;  2LI5 A;  3OAW A;  3L16 A;  2N9P C;  5EDS A;  2MJD A;  3AEF B;  5BO4 B;  2MSE D;  4GB9 A;  4AQ7 A;  2DYO A;  4B6W A;  1WJ4 A;  3DVN V;  5I4D A;  2BB6 A;  3AE3 B;  2UYZ B;  4L23 A;  1D6E C;  1DOY A;  3ABV B;  4DWF A;  3TL5 A;  1FPY A;  4JWU C;  4DHZ B;  2EEL A;  2MA9 B;  2WYQ A;  1YMH E;  3VRB B;  1SE9 A;  1UD7 A;  4KGR A;  3VVW B;  1F9J A;  1WGR A;  2PPH A;  1EF5 A;  2I1K A;  2WXL A;  1TKE A;  3VTW A;  3E56 A;  3MJW A;  1PYW D;  2CHX A;  2GRI A;  3FKY A;  5C3J B;  2RDG A;  2L00 B;  3ZIM A;  3AB5 A;  3NY5 A;  3R2I A;  3VXW A;  2RPV A;  3KYD D;  2N9E B;  4HRS A;  1WIA A;  2R2Q A;  3B2F A;  1QQR A;  4MGZ E;  1GB4 A;  3GP7 A;  2EKI A;  1V2Y A;  4NZL B;  4NAW A;  1L6V A;  1V5O A;  1SSN A;  3W5U B;  3OWE B;  4FLH A;  2IGG A;  1YOV B;  1IP9 A;  4ARC A;  2J4X A;  1XQQ A;  4YSX B;  4MAC A;  3H8H A;  1P0R A;  3BVM A;  1CJE A;  3ZTD A;  4HPP A;  5CX3 A;  3EC8 A;  5E6O A;  1LGR A;  3H9D A;  4ASW C;  1WGK A;  2V4I B;  4EZJ A;  1D4B A;  2DEN B;  1FXT B;  2LD9 A;  2BWE S;  2PMV A;  3CIR B;  3A9J A;  1SF0 A;  4E74 A;  4OZC A;  3RMK C;  1Q0W B;  2KC2 A;  2MP2 B;  3DCG A;  1HE8 A;  2KMM A;  2K8B A;  1J7A A;  4WWN A;  4ANX A;  2GMI C;  1SBB B;  2MBO A;  4HCP B;  3AE7 B;  1AN8 A;  4LTU A;  2YEP B;  3A9K B;  1G6J A;  3E9S A;  2L8J A;  2L52 A;  4LK0 M;  1ZDX A;  4RM9 A;  3QA8 A;  3H7P B;  4II3 B;  1F52 A;  2NS5 A;  2D2Q A;  2G1E A;  3RNB C;  4NJC A;  1A5R A;  4A8X C;  1JW9 D;  2JYE A;  1VR9 A;  4G0N B;  5DPR A;  2IO0 B;  1H4R A;  2KXJ A;  2RD0 A;  2G9H D;  4HEA 1;  3UIP B;  2MJ3 A;  4FJY A;  1OQR A;  4I6P A;  2JX5 A;  4M00 A;  2O2V B;  4WAF A;  3Q3J A;  2ASQ A;  1WXA A;  4C00 A;  2BWF A;  1P9D U;  3HRD D;  3TEY A;  3OJ4 B;  2KDF B;  2WXP A;  2NPT A;  2WXM A;  4KKJ A;  1GPX A;  2KDM A;  2QIE B;  4PT5 A;  1WX7 A;  2IO2 B;  2ZPN A;  1ZE3 D;  1JRO A;  2CJN A;  2QSD A;  2REX A;  1HTQ A;  2IPK D;  1D5X C;  1PGB A;  4RF0 A;  2KYW A;  3VUW A;  1QZE A;  4ZYS A;  2IO1 B;  2K1F A;  3BVG A;  1STE A;  3IAM 1;  5AZF A;  4W9H A;  4FN2 A;  2BYV E;  1TS2 A;  1ISN A;  1VJK A;  5H8Y E;  2OHF A;  2H89 B;  3RNF C;  2CR5 A;  3RI7 C;  1I4P A;  3NVY A;  3DBR I;  4BBN C;  2L1A A;  2V4L A;  3JYU A;  1N63 A;  5LXI B;  3HM3 A;  1FCC C;  2MBE A;  5GXG B;  1TKG A;  2KDE B;  1ZW7 A;  4TQ0 A;  1SGH A;  2XK5 A;  3RZW C;  1SEB D;  4LNN A;  2KX3 A;  1TTN A;  3AE6 B;  4CQN A;  1E9M A;  4KZC A;  4ZOH C;  1C9F A;  4NPN A;  3N9Y C;  2X38 A;  5J2R A;  2KTF A;  3P2B A;  1RFA A;  1L6U A;  1JWB D;  3P1M A;  2BBC A;  3N1X C;  2OJR A;  1OTR B;  2BKF A;  3I5J C;  3KQ4 A;  1V97 A;  4DXG A;  1WI0 A;  5BYR A;  3ZTC A;  2FNJ B;  4JE3 B;  2LVP A;  4TQ1 A;  2NR2 A;  2DYM A;  1WXS A;  3QAQ A;  4W9K A;  4AJY B;  1WM2 A;  2BTE A;  3GZN I;  3CF6 E;  1FFU A;  1K52 A;  1TZO A;  3W5V B;  4LNK A;  1C79 A;  1RRB A;  3AE1 B;  2G45 B;  2AEH A;  4HJK A;  2LVQ A;  3KUD B;  3V62 A;  1LXD A;  2IGD A;  1N5X A;  1JWA D;  2LMC A;  1ZGU B;  5G5H A;  4I6L B;  1NVI D;  2WQY B;  2BT6 A;  1YQB A;  4FJZ A;  1GOZ A;  4HPL B;  1L4D B;  3EGR A;  2FID A;  4L2Y A;  4ZRJ A;  3V3X A;  4F8C B;  2RR9 A;  2IYD B;  1V1O A;  2TSS A;  4EOY A;  3QWZ B;  1ZP0 B;  3N20 C;  4XYC A;  2KJR A;  2WXF A;  1KJT A;  2GBJ A;  4G3X B;  5E6P A;  1P98 A;  5LLI A;  3VAW A;  2BQQ A;  1E8Z A;  2LZ6 A;  4DBG A;  1N5W A;  2LFI A;  3AUL A;  5AZG A;  1I4X A;  4GDL B;  2D10 A;  2QIL A;  1FEH A;  4IUM B;  3DBL I;  1ESF A;  5IA7 A;  2D3G A;  4IDI A;  4P6V F;  4LCD E;  5HI1 A;  3SU8 X;  4HVB A;  4EZL A;  2KWC A;  3L54 A;  3AEG B;  3H7S A;  1WJN A;  1UF0 A;  4W9C A;  2LHD A;  4OW0 A;  4MM3 A;  4WH4 A;  2LGY A;  3ZVV A;  3VFK A;  2AYO B;  1T0S C;  1NDD A;  1DGJ A;  1JWM D;  4M0W B;  2N1W A;  3ZYY X;  2LRU A;  2KN4 A;  2KVZ A;  2LUE A;  2A5U A;  5FKA C;  3A33 B;  3RN9 C;  5C23 A;  3PS6 A;  4RGO S;  3N3K B;  1TJE A;  1QLB B;  2INP E;  3PLV A;  2QMT A;  4HDQ A;  3NRZ A;  2IBI B;  2I38 A;  1N60 A;  4MH0 E;  3UF8 A;  4ZHP A;  1YD8 U;  3HHM A;  2BW2 A;  4EKU A;  3P4R B;  3EFU A;  2M56 B;  3L13 A;  4K81 A;  2GBK A;  1I4H A;  2WXR A;  1CQV A;  3AEA B;  2IJ0 A;  1WMH B;  1E6E B;  1QOF A;  4QAY A;  2DAJ A;  4XWT A;  3QCA A;  2ONQ A;  2CHZ A;  3EEC A;  3QIJ A;  4DHZ E;  4REZ A;  1MG8 A;  1UGM A;  4M01 A;  5D3I B;  3NUH B;  2WDR B;  4TMA B;  3EHV A;  3H6N A;  4EUT A;  2JZ3 B;  3J9C A;  4FAD A;  1WJ6 A;  1BXT A;  5G5G A;  2HJ8 A;  4A3P A;  1FFV A;  3PRE A;  1LFD A;  3ZGZ A;  3VDZ A;  3U7Z A;  2DYB A;  5IN7 A;  3I9V 1;  1JML A;  5DPS A;  2LXC A;  1SE2 A; 
#chains in the Genus database with same CATH homology
 1BT0 A;  2K8H A;  2NBV B;  3TMP B;  5BO4 B;  2MSE D;  4GB9 A;  4X57 B;  1GJZ A;  5JHA A;  3APF A;  2DYO A;  4B6W A;  1WJ4 A;  5KHQ A;  3A1Q A;  3KVF B;  4GMV A;  3NHE B;  1CMX B;  3TJP A;  2LWP A;  4HXD A;  3QJZ A;  3RYT A;  2MQJ A;  2EKE C;  2BKR B;  3DVN V;  4KVG B;  3SHQ A;  4EZK A;  2UYZ B;  4HCN B;  4HWI B;  2KHW B;  2ZNV B;  5L95 C;  2KMA A;  3A4R A;  3TL5 A;  4DHZ B;  4DWF A;  2MCN B;  3T8M A;  2WYQ A;  2MA9 B;  1IYF A;  3PZD A;  5FR6 A;  1SE9 A;  1UD7 A;  1R4N I;  3VVW B;  3JVZ X;  3UQB A;  2MBH A;  1OGW A;  4MJS B;  3L0W B;  2XBB C;  5CHV C;  1WJU A;  1F9J A;  1WGR A;  4B9K A;  2PPH A;  1YIW A;  3T9L A;  1K8R B;  1EF5 A;  2I1K A;  3VH4 B;  4GDL A;  3VTW A;  4MGI E;  2G3Q B;  3MJW A;  2EMT A;  3HM6 X;  2CHX A;  5LXH A;  3DVG X;  1E5W A;  2JY6 A;  4MEL A;  3ZRC A;  2N9X A;  4W9F A;  1WZ0 A;  2L00 B;  2XK5 B;  1E90 A;  3ZIM A;  2BGF A;  3ONS A;  3NY5 A;  4N9F 4;  2LAS A;  3VXW A;  1E8Y A;  3KYD D;  2N9E B;  1EF1 A;  3PLU A;  1WIA A;  3CSF A;  1WM3 A;  1EUV B;  2R2Q A;  3OLM D;  3QHT A;  4TKN A;  4E71 A;  3K9P B;  4MGZ E;  3S2A A;  3HK0 A;  2W9N A;  1V2Y A;  4RMA A;  4MJS A;  5HKH A;  1AAR A;  1WR1 A;  3DVN U;  4NAW A;  2D11 A;  3L08 A;  4PS7 A;  2KJ6 A;  3ZO5 B;  3BY4 B;  4YL8 A;  1V5O A;  1NBF C;  2KTR B;  3IVF A;  3PPA A;  3ML8 A;  4FLH A;  4W9J A;  4ZYN A;  4BOZ B;  5L83 A;  2KNB A;  1IP9 A;  5JHB A;  2MRP A;  2K25 A;  1XQQ A;  2FCN A;  2FCM A;  3X0W A;  1P0R A;  2YVC A;  3UIN B;  2K39 A;  1GC7 A;  3ZTD A;  5CX3 A;  3EC8 A;  3WIM A;  3ENE A;  5E6O A;  3H9D A;  4ANV A;  4ASW C;  1R4M I;  3DQV A;  1OEY J;  3APC A;  4EZJ A;  3O65 B;  4FUL A;  3V61 A;  2C7N B;  4F1S A;  2DEN B;  1FXT B;  2LD9 A;  2J0K A;  2BWE S;  1VCB A;  3A9J A;  3UQA A;  2Y5B B;  1Q1O A;  1V80 A;  2BPS A;  1X1M A;  3WAO A;  2G4S A;  4E74 A;  2KDI A;  3RT3 B;  1UZX B;  2IY1 B;  1GC6 A;  4IC7 B;  1E8X A;  1Q0W B;  1S1Q B;  4W9E A;  1TZ1 A;  2KMC A;  2KC2 A;  2MP2 B;  3DCG A;  2KC1 A;  1HE8 A;  5IAA C;  4BKS A;  2MW5 A;  2K8B A;  5G2N A;  4WWN A;  2A4Z A;  4ANX A;  1UH6 A;  2WX0 A;  3D32 A;  2GMI C;  2JZZ A;  2MBO A;  4HCP B;  4W9I A;  4GDK A;  1UBI A;  3QQ8 B;  3A9K B;  1G6J A;  2JVC A;  1WGG A;  4DDG D;  2L8J A;  4GU2 A;  2FCS A;  4GIV A;  1WGD A;  4BOS C;  4RM9 A;  1WMH A;  3QA8 A;  1GUA B;  3K9O B;  4J6I A;  4NQL B;  3H7P B;  1PQS A;  3QK0 A;  3W1S A;  4MSQ B;  3M62 B;  2VRR B;  2RGF A;  3NS8 A;  3OJ3 A;  4II3 B;  1E7V A;  4K1R B;  2RSU A;  2NS5 A;  3IFW B;  2V1Y A;  2D2Q A;  4KIK A;  4GSW A;  4WJO A;  3ZDM C;  5AEK B;  4HK2 A;  1A5R A;  1J8C A;  3VH3 B;  4G0N B;  5DPR A;  2IO0 B;  1H4R A;  2KXJ A;  2RD0 A;  4KSK C;  3UIP B;  4FJY A;  3WAN A;  4I6P A;  1WX9 A;  2NVU I;  2J0M A;  2PE9 A;  1LM8 B;  2O2V B;  5E6N A;  3Q3J A;  2ASQ A;  2O6V A;  5C1Z A;  2DX5 B;  2L0F A;  1WXA A;  2BWF A;  2M1M A;  1P9D U;  2L3Z A;  1J0G A;  2MWS B;  3OJ4 B;  2KDF B;  2NPT A;  2LJ5 A;  2GBN A;  3PTF C;  3R3M A;  1WX7 A;  3N30 A;  2IO2 B;  2ZPN A;  4M8N A;  4DHJ B;  2JRH A;  2REX A;  1TBE A;  2Z0D B;  1TGZ B;  3MHS D;  3PSE B;  4K7S A;  3B0A A;  3VUW A;  1QZE A;  2HE7 A;  2LVO A;  3TIX A;  2IO1 B;  2K1F A;  4HPM B;  4MSM B;  1WR6 E;  4DHJ D;  4W9L A;  5AZF A;  1LQB A;  2BF8 B;  1UEL A;  3AU5 A;  4W9H A;  2C7M B;  4FN2 A;  2BYV E;  4LJO B;  3B1L X;  3H1U A;  2L7R A;  1ISN A;  3W1S C;  1EO6 A;  4XZ4 A;  3V6C B;  4CYE A;  4FA6 A;  3PT2 B;  4K7U A;  2CR5 A;  4LDT D;  4TUU A;  4OVV A;  2KQS A;  4GGQ A;  3DVG Y;  3DBR I;  2XEW A;  4BBN C;  1V5T A;  4BBN F;  4JIO U;  4JLC A;  2V4L A;  2DHZ A;  3JSV B;  3JYU A;  3IHP C;  3PRZ A;  1L2N A;  2KK8 A;  5DPT A;  3PRM B;  3DBH I;  4W9G A;  4IWO A;  1VD2 A;  2ZCB A;  5LXI B;  3HM3 A;  1Z5S B;  2YLM A;  2MBE A;  2KWV B;  2KDE B;  3ALB A;  1ZW7 A;  4ZRK A;  4PS3 A;  4TQ0 A;  1SGH A;  2KQ7 A;  2XK5 A;  3JW0 X;  3RZW C;  2LGD A;  1XD3 B;  1V81 A;  2N7D A;  4ANU A;  2KX3 A;  1TTN A;  2DZI A;  1WGY A;  1OQY A;  2N4F A;  3NZU A;  2IO3 B;  4KZC A;  4BVU C;  3R7Q A;  3VQI A;  4IWP A;  4PYZ A;  3HIZ A;  3JSV A;  4NPN A;  1P1A A;  4EFO A;  1WGH A;  3U30 A;  5J2R A;  3ZDT A;  2B3A A;  2KTF A;  1RFA A;  3P2B A;  3Q3F A;  4HLE A;  4GXB A;  2K6D B;  4JGH B;  2KAN A;  2OJR A;  2IZV B;  2JUO A;  2KTR A;  1V49 A;  1OTR B;  2BKF A;  2M8S A;  2LGX A;  4ZRI A;  4GN1 A;  2Z59 B;  1WI0 A;  4FJV B;  3ZTC A;  2FNJ B;  4NQK E;  1I35 A;  2LVP A;  4TQ1 A;  2NR2 A;  2Z0E B;  5GMV A;  2DYM A;  4XC2 A;  1GG3 A;  2M0X A;  1WXS A;  2ZNV C;  1WRD B;  2M17 A;  3QAQ A;  4FHK A;  4JL9 A;  4W9D A;  4W9K A;  5DPW A;  4AJY B;  3ZNG C;  4ICV A;  4E3C A;  2D07 B;  1WM2 A;  3GZN I;  3CF6 E;  3APD A;  4IM3 A;  3UIO B;  4FBJ B;  2L05 A;  3CMM B;  1RRB A;  2G45 B;  2AEH A;  2KZR A;  2ZPY A;  2FAZ A;  5D6J B;  3ZUN A;  1D3Z A;  3IG3 A;  4HJK A;  2LVQ A;  3KUD B;  2JF5 A;  1XT9 B;  1YJ1 A;  4WJN A;  2HTH A;  2MLB A;  1NI2 A;  2NBU A;  3V62 A;  1WZ3 A;  1U4A A;  1SIF A;  1LXD A;  2MP2 A;  2N1V A;  4B95 A;  2IY0 B;  3RUL A;  3VUY A;  2QHO A;  1WFY A;  3PVL A;  5D7G A;  2FCQ A;  2WX1 A;  3VTV A;  1JRU A;  2C9W B;  2KJH B;  1ZGU B;  1Q5W B;  2KLG A;  2RPQ A;  4I6L B;  5J17 A;  4IG7 B;  1OEY A;  1YQB A;  4FJZ A;  4GOC A;  4HPL B;  5D94 A;  3A1Q B;  4ZRJ A;  2FID A;  3DDC B;  3PHW B;  4AOF A;  4F8C B;  2RR9 A;  4AP4 C;  3RD2 A;  2IYD B;  3A9K A;  1WX8 A;  3KW5 B;  2K6Q A;  4PS8 A;  5CTR C;  4EOY A;  2JRI B;  2M4N A;  3QWZ B;  2FUH B;  2WDT B;  4EEW A;  2KOX A;  2UWQ A;  2AL3 A;  4FHJ A;  1T0Y A;  4MGY E;  4DDI D;  3H7P A;  5CHF A;  2KJR A;  1E7U A;  1KJT A;  3L10 B;  2GBJ A;  4G3X B;  1WF9 A;  5E6P A;  1P98 A;  5LLI A;  1M94 A;  3VAW A;  2NCN A;  1WY8 A;  2MX2 A;  2OOB B;  1KM7 A;  3V6E B;  1C1Y B;  1E8Z A;  2LZ6 A;  4DBG A;  3AUL A;  3ZNI D;  1RAX A;  3PGE A;  4BFR A;  5AZG A;  3BIN A;  1WH3 A;  4GDL B;  4I6N B;  2D10 A;  4MGK E;  5DCN A;  2JT4 B;  2KD0 A;  4IW0 A;  4KSL C;  2KFJ A;  4AWJ A;  2O2V A;  2FIF A;  4IUM B;  3DBL I;  3U7D A;  5IA7 A;  3ZW3 A;  3M95 A;  4NJ7 A;  2D3G A;  2C5L C;  3M3J A;  3IBE A;  4BKT A;  4LDT B;  2G4D B;  3VUX A;  3VTU A;  4OVU A;  1S3S G;  3I3T B;  4LCD E;  3X23 A;  3SU8 X;  3ZLZ A;  2ZZP B;  4HVB A;  1WYW B;  4EZL A;  4NY0 A;  4MEM A;  4A3O A;  1KLV A;  2CKH B;  2PEA A;  2KWC A;  4JQW C;  3ZNH B;  1H8C A;  2KFK B;  3L54 A;  1ZKH A;  4WWP A;  3RUI B;  3H7S A;  1WJN A;  3KH0 A;  4W9C A;  4NAW B;  4XX5 A;  2V3S A;  3PV1 A;  3NZS A;  2KN5 A;  4IM0 A;  4A20 A;  4BKG A;  4MM3 A;  5KHO A;  3LDZ E;  2EMS A;  3W1Y A;  4WAA A;  3ZKJ C;  3WA0 A;  2ZEQ A;  2LGY A;  3GOE A;  3ZVV A;  4MDK E;  1RLF A;  4RM8 A;  2GBM A;  3U8Z A;  3VFK A;  3KUC B;  5D2M B;  2C60 A;  2AYO B;  2ZCC A;  3CST A;  4KDI C;  1NDD A;  4M8M A;  4II2 B;  3N32 A;  1L7Y A;  1WXV A;  2JWZ A;  3M63 B;  4LJP B;  2R2O A;  3LJ3 A;  4M0W B;  2N1W A;  1GNU A;  2DZK A;  3TBL D;  4WJP A;  1V86 A;  1E8W A;  2LRU A;  4ICU A;  3WAP A;  4KV2 A;  4AUQ C;  4ANW A;  3KYC D;  4AJW A;  3R66 C;  2KFK A;  2C7H A;  3VHT C;  1YX6 B;  1Z2M A;  2GBR A;  4P7I A;  2LUE A;  4WJQ A;  2A5U A;  3A33 B;  3A9J B;  5C23 A;  3PS6 A;  3N3K B;  2BYE A;  2JPH A;  5CHW A;  4DXA B;  3PLV A;  5TR5 A;  4HDQ A;  3ECI A;  4DK5 A;  2IBI B;  4CHK A;  2CS4 A;  3R7R A;  3QX1 A;  5G55 A;  3SDL C;  2CHW A;  2AL6 A;  4MH0 E;  3UF8 A;  3ZNZ B;  1YD8 U;  1WE6 A;  2KKC A;  3HHM A;  4GDK B;  4EKU A;  4WWO A;  2ZJD A;  1V6E A;  3EFU A;  4BKS D;  1IPG A;  3L13 A;  2CU1 A;  4K81 A;  2GBK A;  2WWZ A;  5JH5 C;  4CO7 A;  3RZF A;  3ZRF A;  1WXM A;  3UGB B;  5AZH A;  3KUZ A;  1WMH B;  4NNJ B;  1C3T A;  3V60 A;  2GOW A;  3QC8 B;  2J7Q B;  2MBB B;  3C0R B;  3AI5 A;  4G11 A;  2DAJ A;  2DAF A;  2JXX A;  2LRW A;  2HD5 B;  2L0T A;  3QCA A;  4KIK B;  3NOB A;  3PHX B;  3WAM A;  2MBQ A;  1YX5 B;  2J0J A;  2DZM A;  2KLC A;  4NJ6 A;  2CHZ A;  2KVR A;  1I42 A;  4HDO A;  1Y8R C;  3EEC A;  2LXA A;  3QIJ A;  4DHZ E;  4IM2 A;  4WQO B;  1WE7 A;  1MG8 A;  2ZVO A;  1UGM A;  3QAR A;  1UBQ A;  2KDB A;  2I1J A;  3RCZ A;  3DOW A;  4TV3 A;  2KWU B;  3MTN B;  2DZJ A;  3EHV A;  3AU4 A;  2PE6 B;  2NBW B;  3H6N A;  4EUT A;  2O6V B;  2JZ3 B;  3B08 A;  4IWQ A;  4FAD A;  5EDS A;  5JZE B;  1WJ6 A;  2BYF A;  2K8C A;  2L76 A;  3WAL A;  4PYU A;  1P3Q U;  2ZVN A;  3AXC A;  2HJ8 A;  3L17 A;  4A3P A;  4ZDV A;  4K7W A;  2NPT B;  3DBS A;  3A4S C;  3SD5 A;  4F7Z A;  3PRE A;  3TCA A;  2O6V D;  1LFD A;  3ML9 A;  1V9J A;  2AWT A;  3VDZ A;  5J18 A;  2KX0 A;  1J19 A;  2DYB A;  2KO3 A;  3DPD A;  2PJH A;  2LI5 A;  3OAW A;  5DPS A;  2N7E A;  4URK A;  1KOT A;  4KDL B;  2LXC A;  3L16 A;  2N9P C;  4G50 A;  3PRP B;  4KZ0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...