1WJNA

Solution structure of the c-terminal ubiquitin-like domain of mouse tubulin-specific chaperone e
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
97
structure length
97
Chain Sequence
b'GSSGSSGQLLTLKIKCSNQPERQILEKQLPDSMTVQKVKGLLSRLLKVPVSELLLSYESSKMPGREIELENDLQPLQFYSVENGDCLLVRWSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tubulin-folding protein TBCE
molecule tags Chaperone
source organism Mus musculus
publication title Solution structure of the C-terminal ubiquitin-like domain of mouse tubulin-specific chaperone e
rcsb
total genus 15
structure length 97
sequence length 97
ec nomenclature
pdb deposition date 2004-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14560 Ubiquitin_2 Ubiquitin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1wjnA00
2KANA 3P2BA 3ZNZB 3VDZA 2DZJA 4EEWA 4LDTB 5C23A 4FULA 5LLIA 3ZVVA 2HJ8A 2JRIB 4MSQB 2N1WA 3QC8B 4MGKE 1YD8U 3Q3JA 4LCDE 5HKHA 4GXBA 2UWQA 2CU1A 2FCQA 2KKCA 3V60A 2BWES 4ANVA 3WA0A 2YLMA 1WXSA 5IA7A 2O2VA 1V9JA 1KOTA 2HTHA 3X23A 2KTRB 2Y5BB 1YIWA 1LFDA 3ONSA 3QJZA 1Z5SB 1Q5WB 4NQKE 1IPGA 5TR5A 4BOZB 3H7PA 4LJPB 2LI5A 1I35A 4TQ1A 2O6VB 3TJPA 5G2NA 1YQBA 4MJSA 2RPQA 2L8JA 3JVZX 1RAXA 1GC6A 3ZNGC 1EF5A 1TZ1A 4IUMB 4FA6A 1TGZB 1UBQA 5CHFA 2LVOA 2L0FA 1V5TA 4WWNA 2DYMA 1E90A 2IYDB 2KTFA 2IO3B 2MRPA 2M0XA 1WFYA 4HDQA 4EZJA 1J0GA 4MGYE 2G45B 5J17A 3RZFA 2ZEQA 4DBGA 3MHSD 2L7RA 3M95A 4HJKA 3A1QA 1WMHB 4FHJA 1VCBA 2LD9A 2RR9A 4WWPA 2LGXA 1WYWB 3A1QB 2CR5A 1E7UA 2C7HA 2J0KA 1BT0A 2FCMA 3ZTDA 1P9DU 2LJ5A 3V61A 2AYOB 3EC8A 3NS8A 4K1RB 3H9DA 4XX5A 5DPTA 5GMVA 3U30A 2KDFB 4NAWB 3KUZA 4ZYNA 2GOWA 2ZZPB 4W9IA 5CHVC 4NNJB 4PS8A 1XD3B 2BKFA 3DCGA 4GN1A 3QAQA 2ZJDA 4G0NB 1WZ3A 4ICUA 1X1MA 2WX1A 3OJ3A 4IW0A 5E6PA 3QQ8B 3CMMB 1LQBA 4I6NB 3A9KA 1LM8B 1H4RA 2N1VA 2AEHA 4CYEA 3U7DA 5AEKB 1WJ4A 2JVCA 4E3CA 2K8CA 2LGDA 2WX0A 4JL9A 2ZPYA 2BF8B 2N9XA 3WAOA 4OVUA 1R4MI 2MP2B 2GBKA 3APFA 2MA9B 4JQWC 3ZNID 4BKSD 1WE6A 3L13A 2O6VD 2HD5B 2ZNVB 3PPAA 3A4SC 2N9EB 3ML9A 5C1ZA 2NPTB 3NZSA 2LASA 1XT9B 2FUHB 4ZRIA 2K39A 3VQIA 2N7EA 1V49A 3H7PB 2D3GA 4AOFA 1UBIA 1E7VA 3DQVA 2NBUA 3APCA 3HK0A 3QK0A 4KSLC 5DCNA 4BOSC 4EUTA 1L2NA 3PRMB 4IM0A 3PREA 3S2AA 2FCSA 3ML8A 4J6IA 3VTUA 4B9KA 4MEMA 2JZZA 2LRUA 1V6EA 5CTRC 2J7QB 2BPSA 5IAAC 3IBEA 3RCZA 2W9NA 3L0WB 4CO7A 2CHZA 2N9PC 3QHTA 3IHPC 4KZCA 4GOCA 4M8NA 1V80A 4MJSB 4BKSA 4IG7B 3H7SA 3ZRFA 1WXMA 3SHQA 2JWZA 4FBJB 1YX5B 3JSVB 2LVQA 4NQLB 3VH3B 2K6DB 4B6WA 4F7ZA 2GBMA 4P7IA 2KK8A 4G11A 4AUQC 4EFOA 3OLMD 3AULA 1WIAA 1LXDA 3R7RA 3PSEB 4IM3A 4E74A 4MSMB 2RSUA 2MBEA 4WJPA 5E6NA 3PT2B 3NY5A 2NS5A 3H6NA 2IZVB 3W1SA 3BINA 3TMPB 4ASWC 4GU2A 4K7WA 4MGIE 3JYUA 2I1KA 2DAFA 2ZPNA 5DPWA 3KH0A 4MDKE 4EZLA 3AXCA 5L83A 5D2MB 3W1SC 3ZDMC 3ZW3A 4BBNC 2MQJA 3HIZA 2A4ZA 3PRPB 3DVNU 5G55A 1UD7A 3PZDA 3V62A 1H8CA 5AZGA 1ZW7A 3VUXA 4FJYA 2KLCA 2PE6B 2XK5B 3V6EB 5FR6A 2KZRA 3T9LA 1M94A 2R2QA 2KC1A 3AU4A 3V6CB 3IFWB 4FADA 4KVGB 4A20A 3CSTA 2KXJA 2L0TA 4RM8A 5DPRA 1WGDA 1YJ1A 3DDCB 1Q1OA 2AL3A 1V81A 3HM6X 2GMIC 2PE9A 3PGEA 1Q0WB 3ZTCA 2AWTA 2C60A 1WX8A 2O6VA 3Q3FA 4II3B 2BYEA 2G3QB 2KWVB 3NHEB 1IP9A 4DHZB 2KDIA 3VAWA 1WXVA 2WWZA 2KJHB 4URKA 1Y8RC 3A9KB 2FNJB 4W9FA 1WM3A 4AWJA 4DDGD 2Z59B 3NOBA 3IG3A 2UYZB 3M63B 2D11A 1EUVB 4IWQA 3TIXA 2MX2A 2MLBA 4JLCA 2KX0A 2L3ZA 4GDKA 4NJ7A 1JRUA 1OTRB 2EMTA 2M8SA 4HDOA 3NZUA 4HWIB 1OGWA 3VH4B 2JRHA 1K8RB 1RLFA 2KDEB 2KWCA 2BKRB 2ZVOA 3SU8X 3UQAA 5J18A 3TBLD 2EKEC 2KD0A 1WJNA 4WQOB 2FAZA 4BBNF 5EDSA 2MBHA 1GJZA 3B1LX 2YVCA 2L00B 3CF6E 3JSVA 2V3SA 3VVWB 2WDTB 1E8XA 3QCAA 4I6PA 4RM9A 1WR6E 1E8YA 3UIPB 2C5LC 2XEWA 2DZIA 3SDLC 1EO6A 2M4NA 1C1YB 4HK2A 4ANWA 1E8WA 4PS7A 3VTWA 1GUAB 2A5UA 2MSED 4GSWA 3K9PB 2J0MA 3C0RB 1WGRA 2FIDA 2KOXA 2KJRA 2LZ6A 2DYBA 3PV1A 2LXAA 4K7SA 1R4NI 2ZCCA 3UQBA 4W9CA 2BYVE 5JHBA 1ZKHA 2PEAA 3ZNHB 1UZXB 2KHWB 3D32A 5D6JB 3N32A 4OVVA 1WGGA 4PS3A 2JXXA 4JIOU 3VHTC 4BVUC 1A5RA 2JPHA 3ZUNA 1WI0A 5D94A 2IY1B 2R2OA 4GB9A 3ZLZA 2OOBB 2KMAA 2LRWA 2ZVNA 3WIMA 2D2QA 1WE7A 4M8MA 2MWSB 2CS4A 4ZRKA 2XBBC 4DHJB 3PHWB 1HE8A 1RRBA 4HXDA 3DBSA 3QA8A 1WZ0A 2LUEA 3X0WA 4PYUA 3RT3B 3WANA 2DENB 3PTFC 2ASQA 1RFAA 4HPLB 4W9DA 3GOEA 1F9JA 2C7MB 3PVLA 2NBWB 2C9WB 1I42A 4GMVA 4W9KA 4HCNB 2CKHB 3O65B 4DHZE 5KHQA 4HCPB 3WAMA 3N30A 3A33B 2Z0EB 1KM7A 3R3MA 1WF9A 3RULA 4WJOA 2NPTA 2IBIB 3KW5B 3EECA 3TCAA 3QWZB 1V2YA 3KUDB 5J2RA 3U8ZA 3R66C 4W9HA 3QX1A 4E71A 4ANUA 2D10A 4MELA 4IWPA 4EKUA 1WGHA 4DDID 1E8ZA 2WYQA 2DZMA 4II2B 4PYZA 2RGFA 3HHMA 4X57B 3PRZA 4GGQA 3DVNV 3KYCD 4GDKB 4K7UA 3OAWA 2JT4B 4W9EA 4W9GA 2HE7A 4GDLB 5CX3A 1UGMA 3K9OB 3PLVA 2KQSA 4FHKA 3L54A 4DXAB 4MM3A 2BGFA 2MBOA 3UIOB 5JHAA 2LWPA 1MG8A 4XZ4A 3W1YA 4KZ0A 3VFKA 3KYDD 2MCNB 2LGYA 5JH5C 5JZEB 2MBBB 3DBRI 4NAWA 4TUUA 2D07B 2XK5A 4IM2A 5E6OA 3DBHI 5AZHA 1WJUA 3BY4B 2M17A 1WJ6A 3ZIMA 1AARA 3WALA 2KJ6A 2K1FA 5CHWA 2G4SA 5AZFA 3ALBA 1ISNA 1WRDB 1FXTB 2KDBA 3ECIA 3JW0X 2JY6A 4KIKB 3VUWA 1ZGUB 3MJWA 1V5OA 1J8CA 2JF5A 1V86A 1WX9A 5BO4B 4ZRJA 1KLVA 1GG3A 3H1UA 3M3JA 2Z0DB 1S3SG 1NDDA 4IC7B 4WWOA 5KHOA 3T8MA 3RD2A 4AJYB 2EMSA 3EFUA 1QZEA 1Z2MA 1SGHA 2C7NB 2KN5A 2BYFA 3B08A 2KNBA 2QHOA 2V1YA 3OJ4B 1L7YA 1WY8A 1OEYA 1WMHA 2K6QA 1D3ZA 3AI5A 3ZDTA 2KC2A 1E5WA 4TV3A 3ZO5B 5D7GA 2AL6A 2G4DB 1IYFA 4NJ6A 2JZ3B 2I1JA 4MGZE 4B95A 2DHZA 3ZRCA 1OQYA 3GZNI 3L10B 2O2VB 2MBQA 2IO1B 3PLUA 1P98A 1PQSA 4HVBA 4HPMB 4WJQA 2K8HA 2GBRA 3TL5A 2GBJA 4W9JA 2NR2A 1VD2A 3I3TB 4A3OA 1SIFA 2CHXA 4EZKA 1TTNA 2KX3A 4TKNA 2B3AA 1OEYJ 4W9LA 4NPNA 4NY0A 3L17A 4N9F4 4F1SA 5LXIB 1UELA 2PJHA 4IWOA 4KV2A 4YL8A 2REXA 1NI2A 4DK5A 4HLEA 5LXHA 2JUOA 3WAPA 3LJ3A 2DX5B 3LDZE 1WGYA 1G6JA 2KFKB 3AU5A 3RZWC 4KIKA 3IVFA 2DYOA 3L16A 3APDA 2KQ7A 2KFJA 4XC2A 4TQ0A 2DZKA 5L95C 4FJVB 2MW5A 2KWUB 3VXWA 2KFKA 1UH6A 1WR1A 2IO2B 4ICVA 3QARA 3MTNB 4DWFA 4F8CB 3DBLI 1T0YA 4KDLB 1TBEA 3DPDA 1C3TA 4K81A 3DVGY 4KSKC 2VRRB 2LXCA 2M1MA 3UGBB 2IY0B 1GC7A 1YX6B 2NBVB 4M0WB 3UINB 1WM2A 1WH3A 3PHXB 4LJOB 2FCNA 4FN2A 2N4FA 4FJZA 2CHWA 4JGHB 4WAAA 3PS6A 4WJNA 1CMXB 2L05A 3QIJA 3A9JA 2KO3A 2K25A 3DVGX 2K8BA 1P1AA 3CSFA 3VUYA 4CHKA 1S1QB 4G3XB 4BKGA 3B0AA 3A9JB 2L76A 2DAJA 1XQQA 2KTRA 2KLGA 4ZDVA 2FIFA 3KUCB 5DPSA 4A3PA 1GNUA 4I6LB 4BKTA 4FLHA 2ZCBA 2MP2A 2N7DA 4ANXA 4GDLA 4AJWA 2BWFA 3ENEA 2J0JA 3RUIB 2KVRA 2IO0B 2RD0A 2LVPA 3EHVA 2KMCA 2NCNA 2ZNVC 4LDTD 1NBFC 2PPHA 2GBNA 1P3QU 1KJTA 3SD5A 3R7QA 4KDIC 1EF1A 1WX7A 3L08A 3RYTA 4MH0E 1WXAA 1SE9A 2NVUI 4DHJD 4RMAA 3N3KB 1J19A 3ZKJC 3KVFB 3HM3A 3VTVA 2V4LA 4AP4C 2OJRA 1P0RA 4G50A 3UF8A 1U4AA 4GIVA 3A4RA 4BFRA 4EOYA 3M62B 3DOWA
chains in the Genus database with same CATH superfamily
3ZNZB 1D5XC 2DZJA 3IXSA 2INDC 1SB3C 5C23A 5LLIA 2N1WA 4MGKE 2CU1A 2MJ3A 2RDHA 3WA0A 1V9JA 2L32A 2HTHA 5JXVA 1YIWA 1LFDA 3ONSA 3TUOA 1Z5SB 3H7PA 2LMCA 2WDRB 2K5PA 3ZNGC 4FA6A 4WWNA 2DYMA 1ZOYB 4D2KA 2IYDB 2KDMA 1JWAD 2AQ2B 2M0XA 4HDQA 4EZJA 1J0GA 3RNFC 3Q6BA 2ZEQA 3MHSD 2HDEA 4CQNA 2LD9A 2RR9A 4WWPA 3NVYA 1WYWB 2J0KA 1BT0A 4M02A 2LJ5A 3V61A 5GMVA 3NS8A 5DPTA 2K3UA 3U30A 2ZZPB 4W9IA 1LGRA 2BKFA 3QAQA 2WP9B 4L23A 3AE2B 4G0NB 4ICUA 2JSVX 4RGTA 5E6PA 1FFVA 3RNBC 4XWWA 1LQBA 5BMIA 2IJ0A 2N1VA 3AECB 4CYEA 2JVCA 4JWUC 4E3CA 2WX0A 2W82A 2ZPYA 4H2AA 1YN5A 5I4DA 4OVUA 1R4MI 5HG2A 1XCQL 1FNUA 1UUPA 2HD5B 2O6VD 3ZGZA 2ZNVB 1MHHE 3A4SC 3AEFB 3ML9A 4YSZB 2LASA 2N7EA 3DQVA 1RFKA 4EUTA 4KSLC 1L2NA 3EA6A 4KGRA 3ML8A 4B9KA 1QOGA 1MVKA 1UWMA 5CTRC 1XCTL 3KQ4A 3NJTA 2WLBA 1GOZA 1PYWD 3IHPC 3ZYYX 4BKSA 3B2GA 3AEDB 1D5ZC 4WURA 2K6DB 3VH3B 4F7ZA 3TSSA 4G11A 3C19A 2JYTA 2N0SB 3RN9C 2RSUA 1HTOA 2WXFA 4WJPA 1XLPA 3H6NA 2IZVB 1TKGA 2PVOD 1JWBD 1K53A 5H8YE 1KLUD 2DAFA 2ZPNA 2IGGA 3KH0A 4YXDB 3AXCA 5L83A 5D2MB 3W1SC 3MFGA 2INPE 2JX5A 3PRPB 1UGJA 1H8CA 1FM0D 3VUXA 2PE6B 4RH6A 3BVMA 5FR6A 5FR3A 5BMGA 3T9LA 4A20A 2KXJA 2LGSA 2OJWA 1WGDA 3DDCB 1Q1OA 2AL3A 2WXJA 3ZTCA 2I2YA 2AWTA 2FBWB 2O6VA 3Q2AC 4O1NA 2G3QB 3VAWA 1VZ8A 2EKIA 3NOBA 2UYZB 3FKYA 2PLPA 2D11A 3AMZA 2JXTA 2D3AA 2BT6A 2MLBA 4JLCA 2KX0A 2SEBD 1OGWA 1TS2A 3VH4B 1K8RB 1RLFA 2ZVOA 3UQAA 3UI3A 2YEPF 3AEGB 1NI3A 2YVCA 3B1LX 3CF6E 2INCC 3UIPB 2QC8A 3SDLC 2M4NA 1FNVA 2BB6A 1GUAB 2A5UA 3AEAB 2J0MA 1I4QA 1PFDA 1WGRA 2FIDA 2AQ1B 2DYBA 4K7SA 2BYVE 3OG5A 5JHBA 3B9JA 1UZXB 5D6JB 1L5PA 4PS3A 3Q14C 4BVUC 2JPHA 1WI0A 2ACZB 2R2OA 1PGBA 2WS3B 3PHWB 1HE8A 4XE0A 1WZ0A 3X0WA 1P7EA 4PYUA 3RT3B 2ASQA 4KX6B 3GOEA 4OW0A 3PVLA 2N7JA 4GMVA 1VR9A 3O65B 4HCPB 4RF0A 2MEKA 4WJOA 2GB1A 3Q69A 3QWZB 2WXMA 3KUDB 3AE3B 5J2RA 3RI7C 4ARCA 4E71A 3T3NA 4EE2A 2WYQA 4II2B 3AE8B 4TMAB 5AUIA 3PO0A 1M4VA 3OAWA 3ZJTA 1TZOA 3PLVA 2WDQB 4MM3A 3RPFC 1MG8A 4XZ4A 3W1YA 1MJDA 3KYDD 1ZE3D 1WJ6A 3WALA 3N9YC 4K3BA 2KJ6A 5CHWA 2G4SA 5AZFA 3ALBA 3ECIA 4A90A 3TEXA 2JF5A 3EFCA 4HRSA 1V86A 2GI9A 1WX9A 4ZRJA 4K3CA 5IOIA 1S3SG 1NDDA 4IC7B 2EMSA 1SEBD 3AE6B 2C7NB 4OZCA 1L7YA 2K6QA 4C56C 1N5WA 2AL6A 1IYFA 4MGZE 4XDDA 1N60A 2NTTA 3ZRCA 2LJIA 1L0YB 5BMHA 3PLUA 1PQSA 4WJQA 2K8HA 3URYA 1VD2A 4A3OA 1SIFA 2WU5B 2NTSA 2B3AA 5HHDG 1F2RC 4F1SA 4MM3B 1UELA 2PJHA 1ZDVA 4YL8A 2G1EA 5C2TB 2J52A 2JUOA 5G5HA 1GB1A 3LDZE 3AU5A 4DXFA 3IVFA 1NYRA 1ET6A 3APDA 3RNEC 2IGDA 2NMQA 1ESFA 2DZKA 1TJEA 5L95C 2KWUB 2KFKA 1UH6A 2CU3A 4ICVA 4HPPA 1T0YA 1GC7A 1ZP0B 2FCNA 1EU3A 2CHWA 2L05A 3A9JA 1MFWA 1R7SA 4CHKA 2K8BA 3VUYA 3B0AA 4P6VF 2KLGA 4M00A 4ZDVA 3KUCB 2N7DA 4AJWA 3LYYA 3ENEA 5G5GA 1FMAD 3EHVA 2LVPA 4KGTA 1R4NB 2LHDA 1AYFA 3R7QA 1EF1A 1WX7A 3L08A 3ETRA 1TIFA 3ZKJC 3HM3A 2D5GA 3NVVA 2OJRA 4HEA1 4G50A 3UF8A 3M62B 3VR9B 1GB4A 4EEWA 2M0AA 2JRIB 2ZW1A 1DYQA 4NAMA 1FCLA 3Q3JA 5HKHA 4GXBA 3ZJVA 4MACA 4JPSA 5IA7A 2YLMA 1WXSA 2O2VA 1T0QC 1FXIA 5TR5A 4LJPB 2LI5A 5TSSA 2MH7A 3TJPA 1QOBA 2RPQA 3JVZX 3J9CA 1GC6A 1TGZB 2MJEA 3P4SB 2BBCA 1ZUD2 2IO3B 4WQMA 2MRPA 2QCZA 5GXGB 3RZFA 4DBGA 4N59A 1ET9A 2H89B 4C7ZA 3A1QB 3CWIA 3ZTDA 1Y56A 4LNNA 4XX5A 1EU4A 3W2DA 4NAWB 1EWCA 2BS2B 2WX1A 3OJ3A 3N1ZC 3QQ8B 2RDBC 3U7DA 5AEKB 1WJ4A 2QEJC 4OHJA 1C79A 2J4XA 2KN4A 4JE3B 2GBKA 1CQVA 3IAS1 5C1ZA 2NPTB 4YT0B 3NZSA 3NVWA 1FRDA 1FRRA 3VQIA 1V49A 2D3GA 3HK0A 5DCNA 3S2AA 1ZXHA 2WXKA 3VTUA 4MEMA 2LRUA 2K22A 2J7QB 2BPSA 2W9NA 4CO7A 2CHZA 1ZPSA 3P63A 3MHZA 4GOCA 3H7SA 3ZRFA 1WXMA 1I4PA 1T0SC 3RNGC 2IDYA 2LVQA 3Q8FA 4XYCA 2RMMA 4AUQC 3OLMD 1WIAA 1LXDA 3R7RA 5AUKA 2KYWA 4L1BA 4MSMB 2MBEA 1KLGD 3NUHB 1F52A 1FD6A 3BINA 4ASWC 2BVCA 4GU2A 1L6VA 3JYUA 5IKCM 2QMTA 3P1MA 4MDKE 3ZDMC 3ZW3A 3HIZA 1T5XD 5AZGA 1ZW7A 4FJYA 5BYQA 3V6EB 1TY0A 3V6CB 3CSTA 2L0TA 4RM8A 1YJ1A 4S17A 2C60A 2V4IB 1WX8A 3BYYB 1N6ZA 2PIAA 1IP9A 4DHZB 2KDIA 3BZDB 1WXVA 1Y8RC 2KQ4X 3A9KB 1RM6C 2FNJB 1I4RA 1A70A 1D6EC 3MP9A 3DBHB 4ACFA 5IN7A 1JRUA 2EMTA 4HDOA 4HWIB 2BYTA 2JRHA 3IT6B 3TBLD 3GS2A 3C8YA 2L00B 2V3SA 1E8XA 4I6PA 2XEWA 4HK2A 4ANWA 4PS7A 3VTWA 2QSDA 2SAKA 1J7CA 1VLBA 2LXAA 1R4NI 2ZCCA 1QF6A 3O13A 3HUIA 1ZKHA 2GLSA 3RFZB 2RPVA 1WGGA 2Z8LA 1XLQA 2R61A 4MH8A 2JXXA 3U2SC 1FFUA 5D94A 2IY1B 1FXAA 3ZLZA 1XLOA 3WIMA 2D2QA 3LB8C 1WE7A 2MWSB 1TY2A 3AE4B 4DHJB 2XBBC 3GE3C 1RRBA 3R2TA 2LUEA 1C9FA 3WANA 3P4QB 1L6UA 2DENB 1F9JA 2C7MB 3Q8AA 2C9WB 4HCNB 4DQOC 5KHQA 3A33B 3NVZA 2Z0EB 2WXNA 3RULA 2IBIB 2JU6X 3KW5B 3R66C 4J3OD 1YN4A 1FPYA 2D10A 2Y5PA 1WGHA 4WWMA 1WWTA 1E8ZA 2PTLA 4PYZA 3HHMA 4QAYA 3DVNV 3KYCD 4PT5A 4RNAA 4WIPA 2G9HD 2JT4B 4W9GA 5CX3A 2HE7A 4GDLB 1UGMA 2BGFA 3AEBB 1YMHE 3UIOB 5JHAA 3AM9A 4KZ0A 2MCNB 2JZPA 3DBRB 5JH5C 1VZ6A 4RF1A 4IM2A 1NEKB 3DBHI 1TT5B 2M17A 1ISNA 1WRDB 2KDBA 2KACA 4HKZE 3W5UB 4KIKB 1J8CA 4P16A 5BO4B 3N20C 3T8MA 2L83A 4AJYB 2N9KA 3EFUA 1QZEA 1SGHA 2WXRA 2KN5A 2J53A 2V1YA 1D3ZA 1L4DB 1E5WA 4NJ6A 2AX5A 2I1JA 2FE8A 5H92C 4B95A 2MBQA 1NVID 2IO1B 1P98A 2NR2A 4EZKA 4FXCA 2KX3A 1OEYJ 1UWXA 4W9LA 3DHGC 3L17A 4N9F4 2QDFA 4HLEA 5LXHA 3E9SA 4RFBA 2DYOA 3L16A 3CIRB 4XC2A 1ENFA 4FJVB 1WR1A 1VZ7A 2ZW0A 3W9CB 2IO2B 4M01A 3QARA 3MTNB 3KLSX 3DBLI 1CK1A 5FKAC 1TBEA 1C3TA 3DVGY 4KSKC 2QILA 3UGBB 2M1MA 2NBVB 1WM2A 3I63C 3PHXB 1STEA 4LJOB 1XEEA 4FN2A 2N4FA 4JGHB 3PS6A 4WJNA 1V8CA 2K25A 3DVGX 3CSFA 1JALA 1IBXB 2V9HA 1JWUD 1ZDXA 4BKGA 4NZLB 2OHFA 3IT4B 2L76A 1XQQA 2KTRA 2FIFA 4A3PA 1GNUA 3AE1B 4FLHA 3WCQA 2ZCBA 2VZKD 2WXLA 1UF0A 2BWFA 4XWTA 4C80A 3VRAB 3RNAC 2J0JA 4LDTD 2KMCA 2ZNVC 2GBNA 1SSNA 5EE3A 2PVGC 1IGCA 4MH0E 4RMAA 2WU2B 4AP4C 2V4LA 3VR8B 4HKQA 1F0ZA 2ONQA 2E6XA 1YNTE 1KF6B 3A4RA 2KANA 3RNCC 2WXQA 4KGSA 2M19A 1JCKB 3VDZA 1D4BA 4LDTB 4FULA 2WDVB 4MSQB 3Q3MC 4WAFA 2MJDA 1NENB 2FCQA 3V60A 1KOTA 4IOIE 3X23A 1EM7A 2KTRB 2Y5BB 2IPKD 2W54A 1Q5WB 1SBBB 4BOZB 1I35A 1IBXA 3OWEB 2O6VB 5G2NA 1FEHA 3MJ5A 1YQBA 1E9MA 2L8JA 3SR6A 1EF5A 1TZ1A 4IUMB 1UBQA 5CHFA 2L0FA 1V5TA 2KAJA 4A9AA 2V0GA 4MGYE 1HTQA 2G45B 5J17A 5HFYA 2L7RA 3A1QA 4FHJA 1SE2A 1TS4A 3BVGA 2H88B 1E7UA 2AYOB 4K1RB 3H9DA 2KDFB 3KUZA 2GOWA 5CHVC 3V3XA 4NNJB 4PS8A 3DCGA 4GN1A 1WZ3A 1X1MA 4IW0A 1DOIA 4I6NB 1H4RA 2AEHA 2K8CA 3I9V1 1EWYC 4JL9A 1E7PB 3WAOA 2MP2B 2L52A 1P7FA 3PPAA 1J7BA 4ZRIA 2K39A 2KT7A 3H7PB 3QK0A 3AV8A 5D3IB 1I4XA 3PREA 4S0RA 5IO9A 1DOXA 1GAQB 1F1HA 2BS4B 4J6IA 3U7ZA 1VRAB 1HXYD 4LTUA 3L0WB 1YQ3B 4Q2JA 3QHTA 4MJSB 1V80A 2JWZA 4FBJB 1YX5B 1OFFA 3JSVB 1YQ4B 4NQLB 4B6WA 1TS3A 1TKYA 2AQ3B 2GBMA 4P7IA 3GE8C 2KK8A 4EFOA 1I4GA 2Y5CA 4YWGG 5D3DA 3TEZA 3NY5A 2TSSA 2NS5A 4N58A 3W1SA 1XXGA 1QLBB 3TMPB 2WHIA 4K7WA 2I1KA 5DPWA 2K0PA 2A4ZA 4RGNA 1UD7A 3PZDA 3V62A 2KLCA 1GPXA 2KZRA 1M94A 2R2QA 2KC1A 3AU4A 4FADA 3IFWB 5DPRA 4RGMA 3HM6X 2GMIC 1Q0WB 2HTME 3Q3FA 4II3B 5IP4D 2BYEA 2LHEA 2KWVB 3NHEB 3H8HA 2WWZA 4URKA 1E0ZA 4W9FA 1N62A 1WM3A 4DDGD 3IG3A 4REZA 1OQQA 3DBLB 1EUVB 1L4ZB 2GRIA 3SFEB 3TIXA 3NZ3A 1E6EB 1SXTA 3TEWA 3HVDA 4NJ7A 3NZUA 4C4VA 2BTEA 1K50A 2KWCA 3FAHA 5J18A 1QOFA 2EKEC 4BBNF 1WJNA 4WQOB 2FAZA 3ZXVA 2CJNA 2MBHA 3JSVA 3AE5B 1TKEA 3QCAA 1V97A 4RM9A 1E8YA 2C5LC 2W3SA 3AEEB 1C1YB 4TSSA 3U4EG 2KJRA 1HZ6A 2LZ6A 2WXHA 3EGRA 1CZPA 1KH0A 4YSXB 3PZ7A 2M56B 2PEAA 3ZNHB 3D32A 3N32A 1SE4A 1PGAA 3ZUNA 5EE9A 2OOBB 2KMAA 4A6QA 3E56A 5BYSA 4LNIA 4ZRKA 3DHIC 3DBSA 3AE9B 4ITKA 1I7HA 1RFAA 4HPLB 4ARIA 3W5VB 2NBWB 1I42A 4DHZE 3WAMA 1KM7A 2NPTA 4HROA 4A8XC 4US8A 4ZHOA 4W9HA 3QX1A 4ANUA 1V1OA 2MHJA 4MELA 4EKUA 4HJGE 2Q5WD 3FILA 2DZMA 4X57B 1D5MC 1C78A 3R8BA 4GDKB 4KKJA 3FILB 4K7UA 4W9EA 1ROEA 1V1PA 3K9OB 1WYGA 1N61A 4DXAB 3ABVB 1DGJA 2K9XA 2LWPA 3VFKA 4LLGM 3BK1A 4USAA 2MBBB 3DBRI 4NAWA 2D07B 1WGKA 3MC9A 1WJUA 1AARA 3L4PA 1KTKA 3VUWA 1ZGUB 2KMMA 3MJWA 1V5OA 3DHHC 1KLVA 3Q8BA 3NS1A 1GG3A 3H1UA 3KWLA 2Z0DB 4XGAB 2DBYA 5KHOA 3RD2A 1Z2MA 2WNMA 2BYFA 2KNBA 3OJ4B 4RCOA 4B0MA 3AI5A 2KC2A 3ZO5B 5D7GA 2WGSA 2JZ3B 3B2FA 2DHZA 3GZNI 2O2VB 1AW7A 4HPMB 3VRBB 2LUMA 4W9JA 4KKIA 3TL5A 3I3TB 1RYJA 3R2IA 2CHXA 3SEBA 3P4RB 4NY0A 4N6EB 4BAXA 5LXIB 1IUEA 1C77A 2REXA 4KV2A 1NI2A 1PDXA 4DK5A 1WGYA 1G6JA 4KIKA 1YJJA 2KQ7A 2BB5A 2KFJA 4YTMB 2MW5A 1C76A 4DWFA 1WXQA 4KDLB 1FO4A 1KRHA 4K81A 3RMKC 2VRRB 2LXCA 2IY0B 1HEZE 1ACCA 2PMVA 1CJEA 1F2RI 5C3JB 4FJZA 3GB1A 4NJCA 4WAAA 2KO3A 1P1AA 3A9JB 3Q3OC 2VZKB 5DPSA 3SFDB 2BS3B 1MG4A 4ANXA 3N1YC 1IGDA 4GDLA 3P4PB 3RUIB 2KVRA 3I5JC 1NBFC 4US9A 1P3QU 1KJTA 4KDIC 1JMLA 4AQ7A 3RYTA 1SE9A 2NVUI 3HRDD 1L0VB 3KVFB 1FCCC 1P0RA 4BFRA 4EOYA 3DOWA 3P2BA 2B76B 3ZVVA 2HJ8A 4P1CC 3AN1A 5BYRA 1JROA 3QC8B 5LNK1 1YD8U 4LCDE 2UWQA 2KKCA 2BWES 4ANVA 1SIJA 4C4VB 3QJZA 1XO3A 4NQKE 1IPGA 1J7AA 4TQ1A 2PKOA 4MJSA 1BXTA 1RAXA 1N63A 3BYTB 2LVOA 1E90A 3MC0B 1SJHD 2KTFA 4GLSC 1WFYA 1C4AA 1DOYA 2D3BA 1F77A 3M95A 1K51A 4HJKA 1WMHB 1VCBA 2LGXA 1JW9D 2CR5A 1HQRD 2C7HA 2FCMA 1P9DU 3EC8A 2PW9A 1JQ4A 4ZYNA 1XD3B 2ZJDA 1OQRA 3CMMB 3A9KA 1LM8B 1PGXA 5MPOA 4DXGA 2LGDA 2E3TA 3NG0A 2BF8B 2N9XA 2IGHA 2CJOA 3APFA 3P42A 4JQWC 2MA9B 3ZNID 4BKSD 1WE6A 3L13A 3ZJUA 3Q8CA 2LEKA 2N9EB 1AWDA 4A55A 1XT9B 2FUHB 4AOFA 1YN3A 4L2YA 1UBIA 1E7VA 4BOSC 2NBUA 3APCA 4JX1C 3PRMB 4IM0A 3BWUD 2FCSA 2JZZA 1V6EA 2LFIA 5IAAC 4ZHPA 3IBEA 3RCZA 2INNE 2N9PC 3GP7A 1VJKA 4KZCA 4M8NA 4IG7B 1KFYB 3SHQA 2OEDA 2I38A 2DNFA 3PZ8A 1MPEA 2X8XX 1VDVA 1AN8A 3HVZA 3AULA 1JWSD 3PSEB 4IM3A 4E74A 1R4MB 1WSPA 5EE1A 3EUB2 5E6NA 3BIID 3PT2B 1K52A 4OZAA 1QOAA 4MGIE 1WRIA 2FUG1 2ICIA 3IAM1 4EZLA 3AB5A 4BBNC 2MQJA 3DVNU 5G55A 2JWUA 2XK5B 2V3NA 1Q10A 4KVGB 4YSYB 4P1BC 1V81A 3DWMA 2PE9A 3PGEA 1HA5A 4IKGA 1C4CA 4C00A 2KJHB 4XDCA 2D3CA 4AWJA 2Z59B 5HI1A 1JWMD 3M63B 2WQYB 4IWQA 3GZNB 2MX2A 3FC4A 2L3ZA 2XN9C 1YOVB 4GDKA 1L0XB 2KVZA 4R3DA 1OTRB 2M8SA 3DWGC 3SU8X 2KDEB 2BKRB 2KWDA 5EDSA 2KD0A 2UU7A 3BK2A 1GJZA 4OVZA 1B9RA 3VVWB 2W3RA 2WDTB 1WR6E 2WXOA 2DZIA 1EO6A 2Y3AA 2DWQA 4PK1A 4YTPB 1E8WA 4UDUC 2MSED 4GSWA 3K9PB 3C0RB 2KOXA 5EE0A 2JQRB 3PV1A 2XNAC 1PUTA 3UQBA 2WXGA 4W9CA 2W55A 1T0RC 4MT5A 2KHWB 4OVVA 1E10A 4JIOU 3VHTC 2BW2A 1A5RA 4GB9A 2LRWA 2JYEA 2ZVNA 3BVZA 4M8MA 1XF5L 2QIEB 2CS4A 1QQRA 4HXDA 1B1ZA 3Q3NC 4ZYSA 4LNFA 3QA8A 1YJIA 1ZXIA 3PTFC 4W9DA 4RGOS 4W9KA 1T6BX 2CKHB 2BQQA 3N30A 2QJLA 3R3MA 1WF9A 2WXPA 3EECA 3TCAA 3KWVA 1V2YA 3ZXRA 3U8ZA 4BZAA 4IWPA 1I4HA 4DDID 1SJED 2RGFA 3PRZA 4GGQA 1MI0A 5T8IA 2DLBA 4LNOA 2VH2A 2YEPB 1RWSA 1NYQA 2KQSA 4FHKA 3L54A 3NRZA 1UNSA 2MBOA 3I57A 1T3QA 2LGYA 5JZEB 4TUUA 2XK5A 4OZBA 5E6OA 2LGIA 4IDIA 5AZHA 3BY4B 1QT9A 3ZIMA 1FIQA 2K1FA 4AS1A 1N5XA 4B0EA 1FXTB 3JW0X 2JY6A 4ZOHC 1JRPA 4LNKA 3M3JA 1MHXA 4ZRPA 4WWOA 3Q8EA 2L1AA 3B08A 2QHOA 1WY8A 4YTNB 1OEYA 1WMHA 3ZDTA 4TV3A 2G4DB 1TYGB 3LXFA 3AE7B 1V1PB 1OQYA 3L10B 1BUIC 3U52E 1QKZA 4HVBA 2GBRA 2GBJA 1SE3A 2V3PA 2WXIA 1TTNA 4TKNA 4NPNA 5FK9C 3T3OA 4IWOA 4JWSC 1SF0A 1FNWA 3WAPA 3LJ3A 2DX5B 4C7YA 2KFKB 3RZWC 5E6JA 2EELA 1LO5D 4TQ0A 3VXWA 2X38A 4F8CB 3AH7A 3DPDA 3N1XC 4M0WB 1YX6B 3UINB 2N9LA 1WH3A 2ON8A 1CMXB 3QIJA 1S1QB 4G3XB 1C4PA 4ZRQA 2DAJA 3TEYA 4I6LB 4BKTA 4M0WA 3ZQ4A 2MP2A 2RDGA 1HZ5A 2IO0B 2RD0A 2NCNA 1XLNA 2PPHA 2HJ1A 3SD5A 2J42A 2VH1A 1BMLC 1WXAA 4WH4A 1QILA 4DHJD 3V05A 3N3KB 4LK0M 1J19A 3VTVA 3MC8A 1U4AA 1TS5A 4GIVA
chains in the Genus database with same CATH topology
2KANA 3P2BA 3ZNZB 3VDZA 2DZJA 4EEWA 4LDTB 5C23A 4FULA 5LLIA 3ZVVA 2HJ8A 2JRIB 4MSQB 2N1WA 3QC8B 4MGKE 1YD8U 3Q3JA 4LCDE 5HKHA 4GXBA 2UWQA 2CU1A 2FCQA 2KKCA 3V60A 2BWES 4ANVA 3WA0A 2YLMA 1WXSA 5IA7A 2O2VA 1V9JA 1KOTA 2HTHA 3X23A 2KTRB 2Y5BB 1YIWA 1LFDA 3ONSA 3QJZA 1Z5SB 1Q5WB 4NQKE 1IPGA 5TR5A 4BOZB 3H7PA 4LJPB 2LI5A 1I35A 4TQ1A 2O6VB 3TJPA 5G2NA 1YQBA 4MJSA 2RPQA 2L8JA 3JVZX 1RAXA 1GC6A 3ZNGC 1EF5A 1TZ1A 4IUMB 4FA6A 1TGZB 1UBQA 5CHFA 2LVOA 2L0FA 1V5TA 4WWNA 2DYMA 1E90A 2IYDB 2KTFA 2IO3B 2MRPA 2M0XA 1WFYA 4HDQA 4EZJA 1J0GA 4MGYE 2G45B 5J17A 3RZFA 2ZEQA 4DBGA 3MHSD 2L7RA 3M95A 4HJKA 3A1QA 1WMHB 4FHJA 1VCBA 2LD9A 2RR9A 4WWPA 2LGXA 1WYWB 3A1QB 2CR5A 1E7UA 2C7HA 2J0KA 1BT0A 2FCMA 3ZTDA 1P9DU 2LJ5A 3V61A 2AYOB 3EC8A 3NS8A 4K1RB 3H9DA 4XX5A 5DPTA 5GMVA 3U30A 2KDFB 4NAWB 3KUZA 4ZYNA 2GOWA 2ZZPB 4W9IA 5CHVC 4NNJB 4PS8A 1XD3B 2BKFA 3DCGA 4GN1A 3QAQA 2ZJDA 4G0NB 1WZ3A 4ICUA 1X1MA 2WX1A 3OJ3A 4IW0A 5E6PA 3QQ8B 3CMMB 1LQBA 4I6NB 3A9KA 1LM8B 1H4RA 2N1VA 2AEHA 4CYEA 3U7DA 5AEKB 1WJ4A 2JVCA 4E3CA 2K8CA 2LGDA 2WX0A 4JL9A 2ZPYA 2BF8B 2N9XA 3WAOA 4OVUA 1R4MI 2MP2B 2GBKA 3APFA 2MA9B 4JQWC 3ZNID 4BKSD 1WE6A 3L13A 2O6VD 2HD5B 2ZNVB 3PPAA 3A4SC 2N9EB 3ML9A 5C1ZA 2NPTB 3NZSA 2LASA 1XT9B 2FUHB 4ZRIA 2K39A 3VQIA 2N7EA 1V49A 3H7PB 2D3GA 4AOFA 1UBIA 1E7VA 3DQVA 2NBUA 3APCA 3HK0A 3QK0A 4KSLC 5DCNA 4BOSC 4EUTA 1L2NA 3PRMB 4IM0A 3PREA 3S2AA 2FCSA 3ML8A 4J6IA 3VTUA 4B9KA 4MEMA 2JZZA 2LRUA 1V6EA 5CTRC 2J7QB 2BPSA 5IAAC 3IBEA 3RCZA 2W9NA 3L0WB 4CO7A 2CHZA 2N9PC 3QHTA 3IHPC 4KZCA 4GOCA 4M8NA 1V80A 4MJSB 4BKSA 4IG7B 3H7SA 3ZRFA 1WXMA 3SHQA 2JWZA 4FBJB 1YX5B 3JSVB 2LVQA 4NQLB 3VH3B 2K6DB 4B6WA 4F7ZA 2GBMA 4P7IA 2KK8A 4G11A 4AUQC 4EFOA 3OLMD 3AULA 1WIAA 1LXDA 3R7RA 3PSEB 4IM3A 4E74A 4MSMB 2RSUA 2MBEA 4WJPA 5E6NA 3PT2B 3NY5A 2NS5A 3H6NA 2IZVB 3W1SA 3BINA 3TMPB 4ASWC 4GU2A 4K7WA 4MGIE 3JYUA 2I1KA 2DAFA 2ZPNA 5DPWA 3KH0A 4MDKE 4EZLA 3AXCA 5L83A 5D2MB 3W1SC 3ZDMC 3ZW3A 4BBNC 2MQJA 3HIZA 2A4ZA 3PRPB 3DVNU 5G55A 1UD7A 3PZDA 3V62A 1H8CA 5AZGA 1ZW7A 3VUXA 4FJYA 2KLCA 2PE6B 2XK5B 3V6EB 5FR6A 2KZRA 3T9LA 1M94A 2R2QA 2KC1A 3AU4A 3V6CB 3IFWB 4FADA 4KVGB 4A20A 3CSTA 2KXJA 2L0TA 4RM8A 5DPRA 1WGDA 1YJ1A 3DDCB 1Q1OA 2AL3A 1V81A 3HM6X 2GMIC 2PE9A 3PGEA 1Q0WB 3ZTCA 2AWTA 2C60A 1WX8A 2O6VA 3Q3FA 4II3B 2BYEA 2G3QB 2KWVB 3NHEB 1IP9A 4DHZB 2KDIA 3VAWA 1WXVA 2WWZA 2KJHB 4URKA 1Y8RC 3A9KB 2FNJB 4W9FA 1WM3A 4AWJA 4DDGD 2Z59B 3NOBA 3IG3A 2UYZB 3M63B 2D11A 1EUVB 4IWQA 3TIXA 2MX2A 2MLBA 4JLCA 2KX0A 2L3ZA 4GDKA 4NJ7A 1JRUA 1OTRB 2EMTA 2M8SA 4HDOA 3NZUA 4HWIB 1OGWA 3VH4B 2JRHA 1K8RB 1RLFA 2KDEB 2KWCA 2BKRB 2ZVOA 3SU8X 3UQAA 5J18A 3TBLD 2EKEC 2KD0A 1WJNA 4WQOB 2FAZA 4BBNF 5EDSA 2MBHA 1GJZA 3B1LX 2YVCA 2L00B 3CF6E 3JSVA 2V3SA 3VVWB 2WDTB 1E8XA 3QCAA 4I6PA 4RM9A 1WR6E 1E8YA 3UIPB 2C5LC 2XEWA 2DZIA 3SDLC 1EO6A 2M4NA 1C1YB 4HK2A 4ANWA 1E8WA 4PS7A 3VTWA 1GUAB 2A5UA 2MSED 4GSWA 3K9PB 2J0MA 3C0RB 1WGRA 2FIDA 2KOXA 2KJRA 2LZ6A 2DYBA 3PV1A 2LXAA 4K7SA 1R4NI 2ZCCA 3UQBA 4W9CA 2BYVE 5JHBA 1ZKHA 2PEAA 3ZNHB 1UZXB 2KHWB 3D32A 5D6JB 3N32A 4OVVA 1WGGA 4PS3A 2JXXA 4JIOU 3VHTC 4BVUC 1A5RA 2JPHA 3ZUNA 1WI0A 5D94A 2IY1B 2R2OA 4GB9A 3ZLZA 2OOBB 2KMAA 2LRWA 2ZVNA 3WIMA 2D2QA 1WE7A 4M8MA 2MWSB 2CS4A 4ZRKA 2XBBC 4DHJB 3PHWB 1HE8A 1RRBA 4HXDA 3DBSA 3QA8A 1WZ0A 2LUEA 3X0WA 4PYUA 3RT3B 3WANA 2DENB 3PTFC 2ASQA 1RFAA 4HPLB 4W9DA 3GOEA 1F9JA 2C7MB 3PVLA 2NBWB 2C9WB 1I42A 4GMVA 4W9KA 4HCNB 2CKHB 3O65B 4DHZE 5KHQA 4HCPB 3WAMA 3N30A 3A33B 2Z0EB 1KM7A 3R3MA 1WF9A 3RULA 4WJOA 2NPTA 2IBIB 3KW5B 3EECA 3TCAA 3QWZB 1V2YA 3KUDB 5J2RA 3U8ZA 3R66C 4W9HA 3QX1A 4E71A 4ANUA 2D10A 4MELA 4IWPA 4EKUA 1WGHA 4DDID 1E8ZA 2WYQA 2DZMA 4II2B 4PYZA 2RGFA 3HHMA 4X57B 3PRZA 4GGQA 3DVNV 3KYCD 4GDKB 4K7UA 3OAWA 2JT4B 4W9EA 4W9GA 2HE7A 4GDLB 5CX3A 1UGMA 3K9OB 3PLVA 2KQSA 4FHKA 3L54A 4DXAB 4MM3A 2BGFA 2MBOA 3UIOB 5JHAA 2LWPA 1MG8A 4XZ4A 3W1YA 4KZ0A 3VFKA 3KYDD 2MCNB 2LGYA 5JH5C 5JZEB 2MBBB 3DBRI 4NAWA 4TUUA 2D07B 2XK5A 4IM2A 5E6OA 3DBHI 5AZHA 1WJUA 3BY4B 2M17A 1WJ6A 3ZIMA 1AARA 3WALA 2KJ6A 2K1FA 5CHWA 2G4SA 5AZFA 3ALBA 1ISNA 1WRDB 1FXTB 2KDBA 3ECIA 3JW0X 2JY6A 4KIKB 3VUWA 1ZGUB 3MJWA 1V5OA 1J8CA 2JF5A 1V86A 1WX9A 5BO4B 4ZRJA 1KLVA 1GG3A 3H1UA 3M3JA 2Z0DB 1S3SG 1NDDA 4IC7B 4WWOA 5KHOA 3T8MA 3RD2A 4AJYB 2EMSA 3EFUA 1QZEA 1Z2MA 1SGHA 2C7NB 2KN5A 2BYFA 3B08A 2KNBA 2QHOA 2V1YA 3OJ4B 1L7YA 1WY8A 1OEYA 1WMHA 2K6QA 1D3ZA 3AI5A 3ZDTA 2KC2A 1E5WA 4TV3A 3ZO5B 5D7GA 2AL6A 2G4DB 1IYFA 4NJ6A 2JZ3B 2I1JA 4MGZE 4B95A 2DHZA 3ZRCA 1OQYA 3GZNI 3L10B 2O2VB 2MBQA 2IO1B 3PLUA 1P98A 1PQSA 4HVBA 4HPMB 4WJQA 2K8HA 2GBRA 3TL5A 2GBJA 4W9JA 2NR2A 1VD2A 3I3TB 4A3OA 1SIFA 2CHXA 4EZKA 1TTNA 2KX3A 4TKNA 2B3AA 1OEYJ 4W9LA 4NPNA 4NY0A 3L17A 4N9F4 4F1SA 5LXIB 1UELA 2PJHA 4IWOA 4KV2A 4YL8A 2REXA 1NI2A 4DK5A 4HLEA 5LXHA 2JUOA 3WAPA 3LJ3A 2DX5B 3LDZE 1WGYA 1G6JA 2KFKB 3AU5A 3RZWC 4KIKA 3IVFA 2DYOA 3L16A 3APDA 2KQ7A 2KFJA 4XC2A 4TQ0A 2DZKA 5L95C 4FJVB 2MW5A 2KWUB 3VXWA 2KFKA 1UH6A 1WR1A 2IO2B 4ICVA 3QARA 3MTNB 4DWFA 4F8CB 3DBLI 1T0YA 4KDLB 1TBEA 3DPDA 1C3TA 4K81A 3DVGY 4KSKC 2VRRB 2LXCA 2M1MA 3UGBB 2IY0B 1GC7A 1YX6B 2NBVB 4M0WB 3UINB 1WM2A 1WH3A 3PHXB 4LJOB 2FCNA 4FN2A 2N4FA 4FJZA 2CHWA 4JGHB 4WAAA 3PS6A 4WJNA 1CMXB 2L05A 3QIJA 3A9JA 2KO3A 2K25A 3DVGX 2K8BA 1P1AA 3CSFA 3VUYA 4CHKA 1S1QB 4G3XB 4BKGA 3B0AA 3A9JB 2L76A 2DAJA 1XQQA 2KTRA 2KLGA 4ZDVA 2FIFA 3KUCB 5DPSA 4A3PA 1GNUA 4I6LB 4BKTA 4FLHA 2ZCBA 2MP2A 2N7DA 4ANXA 4GDLA 4AJWA 2BWFA 3ENEA 2J0JA 3RUIB 2KVRA 2IO0B 2RD0A 2LVPA 3EHVA 2KMCA 2NCNA 2ZNVC 4LDTD 1NBFC 2PPHA 2GBNA 1P3QU 1KJTA 3SD5A 3R7QA 4KDIC 1EF1A 1WX7A 3L08A 3RYTA 4MH0E 1WXAA 1SE9A 2NVUI 4DHJD 4RMAA 3N3KB 1J19A 3ZKJC 3KVFB 3HM3A 3VTVA 2V4LA 4AP4C 2OJRA 1P0RA 4G50A 3UF8A 1U4AA 4GIVA 3A4RA 4BFRA 4EOYA 3M62B 3DOWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KAN A;  3P2B A;  3ZNZ B;  3VDZ A;  2DZJ A;  4EEW A;  4LDT B;  5C23 A;  4FUL A;  5LLI A;  3ZVV A;  2HJ8 A;  2JRI B;  4MSQ B;  2N1W A;  3QC8 B;  4MGK E;  1YD8 U;  3Q3J A;  4LCD E;  5HKH A;  4GXB A;  2UWQ A;  2CU1 A;  2FCQ A;  2KKC A;  3V60 A;  2BWE S;  4ANV A;  3WA0 A;  2YLM A;  1WXS A;  5IA7 A;  2O2V A;  1V9J A;  1KOT A;  2HTH A;  3X23 A;  2KTR B;  2Y5B B;  1YIW A;  1LFD A;  3ONS A;  3QJZ A;  1Z5S B;  1Q5W B;  4NQK E;  1IPG A;  5TR5 A;  4BOZ B;  3H7P A;  4LJP B;  2LI5 A;  1I35 A;  4TQ1 A;  2O6V B;  3TJP A;  5G2N A;  1YQB A;  4MJS A;  2RPQ A;  2L8J A;  3JVZ X;  1RAX A;  1GC6 A;  3ZNG C;  1EF5 A;  1TZ1 A;  4IUM B;  4FA6 A;  1TGZ B;  1UBQ A;  5CHF A;  2LVO A;  2L0F A;  1V5T A;  4WWN A;  2DYM A;  1E90 A;  2IYD B;  2KTF A;  2IO3 B;  2MRP A;  2M0X A;  1WFY A;  4HDQ A;  4EZJ A;  1J0G A;  4MGY E;  2G45 B;  5J17 A;  3RZF A;  2ZEQ A;  4DBG A;  3MHS D;  2L7R A;  3M95 A;  4HJK A;  3A1Q A;  1WMH B;  4FHJ A;  1VCB A;  2LD9 A;  2RR9 A;  4WWP A;  2LGX A;  1WYW B;  3A1Q B;  2CR5 A;  1E7U A;  2C7H A;  2J0K A;  1BT0 A;  2FCM A;  3ZTD A;  1P9D U;  2LJ5 A;  3V61 A;  2AYO B;  3EC8 A;  3NS8 A;  4K1R B;  3H9D A;  4XX5 A;  5DPT A;  5GMV A;  3U30 A;  2KDF B;  4NAW B;  3KUZ A;  4ZYN A;  2GOW A;  2ZZP B;  4W9I A;  5CHV C;  4NNJ B;  4PS8 A;  1XD3 B;  2BKF A;  3DCG A;  4GN1 A;  3QAQ A;  2ZJD A;  4G0N B;  1WZ3 A;  4ICU A;  1X1M A;  2WX1 A;  3OJ3 A;  4IW0 A;  5E6P A;  3QQ8 B;  3CMM B;  1LQB A;  4I6N B;  3A9K A;  1LM8 B;  1H4R A;  2N1V A;  2AEH A;  4CYE A;  3U7D A;  5AEK B;  1WJ4 A;  2JVC A;  4E3C A;  2K8C A;  2LGD A;  2WX0 A;  4JL9 A;  2ZPY A;  2BF8 B;  2N9X A;  3WAO A;  4OVU A;  1R4M I;  2MP2 B;  2GBK A;  3APF A;  2MA9 B;  4JQW C;  3ZNI D;  4BKS D;  1WE6 A;  3L13 A;  2O6V D;  2HD5 B;  2ZNV B;  3PPA A;  3A4S C;  2N9E B;  3ML9 A;  5C1Z A;  2NPT B;  3NZS A;  2LAS A;  1XT9 B;  2FUH B;  4ZRI A;  2K39 A;  3VQI A;  2N7E A;  1V49 A;  3H7P B;  2D3G A;  4AOF A;  1UBI A;  1E7V A;  3DQV A;  2NBU A;  3APC A;  3HK0 A;  3QK0 A;  4KSL C;  5DCN A;  4BOS C;  4EUT A;  1L2N A;  3PRM B;  4IM0 A;  3PRE A;  3S2A A;  2FCS A;  3ML8 A;  4J6I A;  3VTU A;  4B9K A;  4MEM A;  2JZZ A;  2LRU A;  1V6E A;  5CTR C;  2J7Q B;  2BPS A;  5IAA C;  3IBE A;  3RCZ A;  2W9N A;  3L0W B;  4CO7 A;  2CHZ A;  2N9P C;  3QHT A;  3IHP C;  4KZC A;  4GOC A;  4M8N A;  1V80 A;  4MJS B;  4BKS A;  4IG7 B;  3H7S A;  3ZRF A;  1WXM A;  3SHQ A;  2JWZ A;  4FBJ B;  1YX5 B;  3JSV B;  2LVQ A;  4NQL B;  3VH3 B;  2K6D B;  4B6W A;  4F7Z A;  2GBM A;  4P7I A;  2KK8 A;  4G11 A;  4AUQ C;  4EFO A;  3OLM D;  3AUL A;  1WIA A;  1LXD A;  3R7R A;  3PSE B;  4IM3 A;  4E74 A;  4MSM B;  2RSU A;  2MBE A;  4WJP A;  5E6N A;  3PT2 B;  3NY5 A;  2NS5 A;  3H6N A;  2IZV B;  3W1S A;  3BIN A;  3TMP B;  4ASW C;  4GU2 A;  4K7W A;  4MGI E;  3JYU A;  2I1K A;  2DAF A;  2ZPN A;  5DPW A;  3KH0 A;  4MDK E;  4EZL A;  3AXC A;  5L83 A;  5D2M B;  3W1S C;  3ZDM C;  3ZW3 A;  4BBN C;  2MQJ A;  3HIZ A;  2A4Z A;  3PRP B;  3DVN U;  5G55 A;  1UD7 A;  3PZD A;  3V62 A;  1H8C A;  5AZG A;  1ZW7 A;  3VUX A;  4FJY A;  2KLC A;  2PE6 B;  2XK5 B;  3V6E B;  5FR6 A;  2KZR A;  3T9L A;  1M94 A;  2R2Q A;  2KC1 A;  3AU4 A;  3V6C B;  3IFW B;  4FAD A;  4KVG B;  4A20 A;  3CST A;  2KXJ A;  2L0T A;  4RM8 A;  5DPR A;  1WGD A;  1YJ1 A;  3DDC B;  1Q1O A;  2AL3 A;  1V81 A;  3HM6 X;  2GMI C;  2PE9 A;  3PGE A;  1Q0W B;  3ZTC A;  2AWT A;  2C60 A;  1WX8 A;  2O6V A;  3Q3F A;  4II3 B;  2BYE A;  2G3Q B;  2KWV B;  3NHE B;  1IP9 A;  4DHZ B;  2KDI A;  3VAW A;  1WXV A;  2WWZ A;  2KJH B;  4URK A;  1Y8R C;  3A9K B;  2FNJ B;  4W9F A;  1WM3 A;  4AWJ A;  4DDG D;  2Z59 B;  3NOB A;  3IG3 A;  2UYZ B;  3M63 B;  2D11 A;  1EUV B;  4IWQ A;  3TIX A;  2MX2 A;  2MLB A;  4JLC A;  2KX0 A;  2L3Z A;  4GDK A;  4NJ7 A;  1JRU A;  1OTR B;  2EMT A;  2M8S A;  4HDO A;  3NZU A;  4HWI B;  1OGW A;  3VH4 B;  2JRH A;  1K8R B;  1RLF A;  2KDE B;  2KWC A;  2BKR B;  2ZVO A;  3SU8 X;  3UQA A;  5J18 A;  3TBL D;  2EKE C;  2KD0 A;  1WJN A;  4WQO B;  2FAZ A;  4BBN F;  5EDS A;  2MBH A;  1GJZ A;  3B1L X;  2YVC A;  2L00 B;  3CF6 E;  3JSV A;  2V3S A;  3VVW B;  2WDT B;  1E8X A;  3QCA A;  4I6P A;  4RM9 A;  1WR6 E;  1E8Y A;  3UIP B;  2C5L C;  2XEW A;  2DZI A;  3SDL C;  1EO6 A;  2M4N A;  1C1Y B;  4HK2 A;  4ANW A;  1E8W A;  4PS7 A;  3VTW A;  1GUA B;  2A5U A;  2MSE D;  4GSW A;  3K9P B;  2J0M A;  3C0R B;  1WGR A;  2FID A;  2KOX A;  2KJR A;  2LZ6 A;  2DYB A;  3PV1 A;  2LXA A;  4K7S A;  1R4N I;  2ZCC A;  3UQB A;  4W9C A;  2BYV E;  5JHB A;  1ZKH A;  2PEA A;  3ZNH B;  1UZX B;  2KHW B;  3D32 A;  5D6J B;  3N32 A;  4OVV A;  1WGG A;  4PS3 A;  2JXX A;  4JIO U;  3VHT C;  4BVU C;  1A5R A;  2JPH A;  3ZUN A;  1WI0 A;  5D94 A;  2IY1 B;  2R2O A;  4GB9 A;  3ZLZ A;  2OOB B;  2KMA A;  2LRW A;  2ZVN A;  3WIM A;  2D2Q A;  1WE7 A;  4M8M A;  2MWS B;  2CS4 A;  4ZRK A;  2XBB C;  4DHJ B;  3PHW B;  1HE8 A;  1RRB A;  4HXD A;  3DBS A;  3QA8 A;  1WZ0 A;  2LUE A;  3X0W A;  4PYU A;  3RT3 B;  3WAN A;  2DEN B;  3PTF C;  2ASQ A;  1RFA A;  4HPL B;  4W9D A;  3GOE A;  1F9J A;  2C7M B;  3PVL A;  2NBW B;  2C9W B;  1I42 A;  4GMV A;  4W9K A;  4HCN B;  2CKH B;  3O65 B;  4DHZ E;  5KHQ A;  4HCP B;  3WAM A;  3N30 A;  3A33 B;  2Z0E B;  1KM7 A;  3R3M A;  1WF9 A;  3RUL A;  4WJO A;  2NPT A;  2IBI B;  3KW5 B;  3EEC A;  3TCA A;  3QWZ B;  1V2Y A;  3KUD B;  5J2R A;  3U8Z A;  3R66 C;  4W9H A;  3QX1 A;  4E71 A;  4ANU A;  2D10 A;  4MEL A;  4IWP A;  4EKU A;  1WGH A;  4DDI D;  1E8Z A;  2WYQ A;  2DZM A;  4II2 B;  4PYZ A;  2RGF A;  3HHM A;  4X57 B;  3PRZ A;  4GGQ A;  3DVN V;  3KYC D;  4GDK B;  4K7U A;  3OAW A;  2JT4 B;  4W9E A;  4W9G A;  2HE7 A;  4GDL B;  5CX3 A;  1UGM A;  3K9O B;  3PLV A;  2KQS A;  4FHK A;  3L54 A;  4DXA B;  4MM3 A;  2BGF A;  2MBO A;  3UIO B;  5JHA A;  2LWP A;  1MG8 A;  4XZ4 A;  3W1Y A;  4KZ0 A;  3VFK A;  3KYD D;  2MCN B;  2LGY A;  5JH5 C;  5JZE B;  2MBB B;  3DBR I;  4NAW A;  4TUU A;  2D07 B;  2XK5 A;  4IM2 A;  5E6O A;  3DBH I;  5AZH A;  1WJU A;  3BY4 B;  2M17 A;  1WJ6 A;  3ZIM A;  1AAR A;  3WAL A;  2KJ6 A;  2K1F A;  5CHW A;  2G4S A;  5AZF A;  3ALB A;  1ISN A;  1WRD B;  1FXT B;  2KDB A;  3ECI A;  3JW0 X;  2JY6 A;  4KIK B;  3VUW A;  1ZGU B;  3MJW A;  1V5O A;  1J8C A;  2JF5 A;  1V86 A;  1WX9 A;  5BO4 B;  4ZRJ A;  1KLV A;  1GG3 A;  3H1U A;  3M3J A;  2Z0D B;  1S3S G;  1NDD A;  4IC7 B;  4WWO A;  5KHO A;  3T8M A;  3RD2 A;  4AJY B;  2EMS A;  3EFU A;  1QZE A;  1Z2M A;  1SGH A;  2C7N B;  2KN5 A;  2BYF A;  3B08 A;  2KNB A;  2QHO A;  2V1Y A;  3OJ4 B;  1L7Y A;  1WY8 A;  1OEY A;  1WMH A;  2K6Q A;  1D3Z A;  3AI5 A;  3ZDT A;  2KC2 A;  1E5W A;  4TV3 A;  3ZO5 B;  5D7G A;  2AL6 A;  2G4D B;  1IYF A;  4NJ6 A;  2JZ3 B;  2I1J A;  4MGZ E;  4B95 A;  2DHZ A;  3ZRC A;  1OQY A;  3GZN I;  3L10 B;  2O2V B;  2MBQ A;  2IO1 B;  3PLU A;  1P98 A;  1PQS A;  4HVB A;  4HPM B;  4WJQ A;  2K8H A;  2GBR A;  3TL5 A;  2GBJ A;  4W9J A;  2NR2 A;  1VD2 A;  3I3T B;  4A3O A;  1SIF A;  2CHX A;  4EZK A;  1TTN A;  2KX3 A;  4TKN A;  2B3A A;  1OEY J;  4W9L A;  4NPN A;  4NY0 A;  3L17 A;  4N9F 4;  4F1S A;  5LXI B;  1UEL A;  2PJH A;  4IWO A;  4KV2 A;  4YL8 A;  2REX A;  1NI2 A;  4DK5 A;  4HLE A;  5LXH A;  2JUO A;  3WAP A;  3LJ3 A;  2DX5 B;  3LDZ E;  1WGY A;  1G6J A;  2KFK B;  3AU5 A;  3RZW C;  4KIK A;  3IVF A;  2DYO A;  3L16 A;  3APD A;  2KQ7 A;  2KFJ A;  4XC2 A;  4TQ0 A;  2DZK A;  5L95 C;  4FJV B;  2MW5 A;  2KWU B;  3VXW A;  2KFK A;  1UH6 A;  1WR1 A;  2IO2 B;  4ICV A;  3QAR A;  3MTN B;  4DWF A;  4F8C B;  3DBL I;  1T0Y A;  4KDL B;  1TBE A;  3DPD A;  1C3T A;  4K81 A;  3DVG Y;  4KSK C;  2VRR B;  2LXC A;  2M1M A;  3UGB B;  2IY0 B;  1GC7 A;  1YX6 B;  2NBV B;  4M0W B;  3UIN B;  1WM2 A;  1WH3 A;  3PHX B;  4LJO B;  2FCN A;  4FN2 A;  2N4F A;  4FJZ A;  2CHW A;  4JGH B;  4WAA A;  3PS6 A;  4WJN A;  1CMX B;  2L05 A;  3QIJ A;  3A9J A;  2KO3 A;  2K25 A;  3DVG X;  2K8B A;  1P1A A;  3CSF A;  3VUY A;  4CHK A;  1S1Q B;  4G3X B;  4BKG A;  3B0A A;  3A9J B;  2L76 A;  2DAJ A;  1XQQ A;  2KTR A;  2KLG A;  4ZDV A;  2FIF A;  3KUC B;  5DPS A;  4A3P A;  1GNU A;  4I6L B;  4BKT A;  4FLH A;  2ZCB A;  2MP2 A;  2N7D A;  4ANX A;  4GDL A;  4AJW A;  2BWF A;  3ENE A;  2J0J A;  3RUI B;  2KVR A;  2IO0 B;  2RD0 A;  2LVP A;  3EHV A;  2KMC A;  2NCN A;  2ZNV C;  4LDT D;  1NBF C;  2PPH A;  2GBN A;  1P3Q U;  1KJT A;  3SD5 A;  3R7Q A;  4KDI C;  1EF1 A;  1WX7 A;  3L08 A;  3RYT A;  4MH0 E;  1WXA A;  1SE9 A;  2NVU I;  4DHJ D;  4RMA A;  3N3K B;  1J19 A;  3ZKJ C;  3KVF B;  3HM3 A;  3VTV A;  2V4L A;  4AP4 C;  2OJR A;  1P0R A;  4G50 A;  3UF8 A;  1U4A A;  4GIV A;  3A4R A;  4BFR A;  4EOY A;  3M62 B;  3DOW A; 
#chains in the Genus database with same CATH topology
 3ZNZ B;  1D5X C;  2DZJ A;  3IXS A;  2IND C;  1SB3 C;  5C23 A;  5LLI A;  2N1W A;  4MGK E;  2CU1 A;  2MJ3 A;  2RDH A;  3WA0 A;  1V9J A;  2L32 A;  2HTH A;  5JXV A;  1YIW A;  1LFD A;  3ONS A;  3TUO A;  1Z5S B;  3H7P A;  2LMC A;  2WDR B;  2K5P A;  3ZNG C;  4FA6 A;  4WWN A;  2DYM A;  1ZOY B;  4D2K A;  2IYD B;  2KDM A;  1JWA D;  2AQ2 B;  2M0X A;  4HDQ A;  4EZJ A;  1J0G A;  3RNF C;  3Q6B A;  2ZEQ A;  3MHS D;  2HDE A;  4CQN A;  2LD9 A;  2RR9 A;  4WWP A;  3NVY A;  1WYW B;  2J0K A;  1BT0 A;  4M02 A;  2LJ5 A;  3V61 A;  5GMV A;  3NS8 A;  5DPT A;  2K3U A;  3U30 A;  2ZZP B;  4W9I A;  1LGR A;  2BKF A;  3QAQ A;  2WP9 B;  4L23 A;  3AE2 B;  4G0N B;  4ICU A;  2JSV X;  4RGT A;  5E6P A;  1FFV A;  3RNB C;  4XWW A;  1LQB A;  5BMI A;  2IJ0 A;  2N1V A;  3AEC B;  4CYE A;  2JVC A;  4JWU C;  4E3C A;  2WX0 A;  2W82 A;  2ZPY A;  4H2A A;  1YN5 A;  5I4D A;  4OVU A;  1R4M I;  5HG2 A;  1XCQ L;  1FNU A;  1UUP A;  2HD5 B;  2O6V D;  3ZGZ A;  2ZNV B;  1MHH E;  3A4S C;  3AEF B;  3ML9 A;  4YSZ B;  2LAS A;  2N7E A;  3DQV A;  1RFK A;  4EUT A;  4KSL C;  1L2N A;  3EA6 A;  4KGR A;  3ML8 A;  4B9K A;  1QOG A;  1MVK A;  1UWM A;  5CTR C;  1XCT L;  3KQ4 A;  3NJT A;  2WLB A;  1GOZ A;  1PYW D;  3IHP C;  3ZYY X;  4BKS A;  3B2G A;  3AED B;  1D5Z C;  4WUR A;  2K6D B;  3VH3 B;  4F7Z A;  3TSS A;  4G11 A;  3C19 A;  2JYT A;  2N0S B;  3RN9 C;  2RSU A;  1HTO A;  2WXF A;  4WJP A;  1XLP A;  3H6N A;  2IZV B;  1TKG A;  2PVO D;  1JWB D;  1K53 A;  5H8Y E;  1KLU D;  2DAF A;  2ZPN A;  2IGG A;  3KH0 A;  4YXD B;  3AXC A;  5L83 A;  5D2M B;  3W1S C;  3MFG A;  2INP E;  2JX5 A;  3PRP B;  1UGJ A;  1H8C A;  1FM0 D;  3VUX A;  2PE6 B;  4RH6 A;  3BVM A;  5FR6 A;  5FR3 A;  5BMG A;  3T9L A;  4A20 A;  2KXJ A;  2LGS A;  2OJW A;  1WGD A;  3DDC B;  1Q1O A;  2AL3 A;  2WXJ A;  3ZTC A;  2I2Y A;  2AWT A;  2FBW B;  2O6V A;  3Q2A C;  4O1N A;  2G3Q B;  3VAW A;  1VZ8 A;  2EKI A;  3NOB A;  2UYZ B;  3FKY A;  2PLP A;  2D11 A;  3AMZ A;  2JXT A;  2D3A A;  2BT6 A;  2MLB A;  4JLC A;  2KX0 A;  2SEB D;  1OGW A;  1TS2 A;  3VH4 B;  1K8R B;  1RLF A;  2ZVO A;  3UQA A;  3UI3 A;  2YEP F;  3AEG B;  1NI3 A;  2YVC A;  3B1L X;  3CF6 E;  2INC C;  3UIP B;  2QC8 A;  3SDL C;  2M4N A;  1FNV A;  2BB6 A;  1GUA B;  2A5U A;  3AEA B;  2J0M A;  1I4Q A;  1PFD A;  1WGR A;  2FID A;  2AQ1 B;  2DYB A;  4K7S A;  2BYV E;  3OG5 A;  5JHB A;  3B9J A;  1UZX B;  5D6J B;  1L5P A;  4PS3 A;  3Q14 C;  4BVU C;  2JPH A;  1WI0 A;  2ACZ B;  2R2O A;  1PGB A;  2WS3 B;  3PHW B;  1HE8 A;  4XE0 A;  1WZ0 A;  3X0W A;  1P7E A;  4PYU A;  3RT3 B;  2ASQ A;  4KX6 B;  3GOE A;  4OW0 A;  3PVL A;  2N7J A;  4GMV A;  1VR9 A;  3O65 B;  4HCP B;  4RF0 A;  2MEK A;  4WJO A;  2GB1 A;  3Q69 A;  3QWZ B;  2WXM A;  3KUD B;  3AE3 B;  5J2R A;  3RI7 C;  4ARC A;  4E71 A;  3T3N A;  4EE2 A;  2WYQ A;  4II2 B;  3AE8 B;  4TMA B;  5AUI A;  3PO0 A;  1M4V A;  3OAW A;  3ZJT A;  1TZO A;  3PLV A;  2WDQ B;  4MM3 A;  3RPF C;  1MG8 A;  4XZ4 A;  3W1Y A;  1MJD A;  3KYD D;  1ZE3 D;  1WJ6 A;  3WAL A;  3N9Y C;  4K3B A;  2KJ6 A;  5CHW A;  2G4S A;  5AZF A;  3ALB A;  3ECI A;  4A90 A;  3TEX A;  2JF5 A;  3EFC A;  4HRS A;  1V86 A;  2GI9 A;  1WX9 A;  4ZRJ A;  4K3C A;  5IOI A;  1S3S G;  1NDD A;  4IC7 B;  2EMS A;  1SEB D;  3AE6 B;  2C7N B;  4OZC A;  1L7Y A;  2K6Q A;  4C56 C;  1N5W A;  2AL6 A;  1IYF A;  4MGZ E;  4XDD A;  1N60 A;  2NTT A;  3ZRC A;  2LJI A;  1L0Y B;  5BMH A;  3PLU A;  1PQS A;  4WJQ A;  2K8H A;  3URY A;  1VD2 A;  4A3O A;  1SIF A;  2WU5 B;  2NTS A;  2B3A A;  5HHD G;  1F2R C;  4F1S A;  4MM3 B;  1UEL A;  2PJH A;  1ZDV A;  4YL8 A;  2G1E A;  5C2T B;  2J52 A;  2JUO A;  5G5H A;  1GB1 A;  3LDZ E;  3AU5 A;  4DXF A;  3IVF A;  1NYR A;  1ET6 A;  3APD A;  3RNE C;  2IGD A;  2NMQ A;  1ESF A;  2DZK A;  1TJE A;  5L95 C;  2KWU B;  2KFK A;  1UH6 A;  2CU3 A;  4ICV A;  4HPP A;  1T0Y A;  1GC7 A;  1ZP0 B;  2FCN A;  1EU3 A;  2CHW A;  2L05 A;  3A9J A;  1MFW A;  1R7S A;  4CHK A;  2K8B A;  3VUY A;  3B0A A;  4P6V F;  2KLG A;  4M00 A;  4ZDV A;  3KUC B;  2N7D A;  4AJW A;  3LYY A;  3ENE A;  5G5G A;  1FMA D;  3EHV A;  2LVP A;  4KGT A;  1R4N B;  2LHD A;  1AYF A;  3R7Q A;  1EF1 A;  1WX7 A;  3L08 A;  3ETR A;  1TIF A;  3ZKJ C;  3HM3 A;  2D5G A;  3NVV A;  2OJR A;  4HEA 1;  4G50 A;  3UF8 A;  3M62 B;  3VR9 B;  1GB4 A;  4EEW A;  2M0A A;  2JRI B;  2ZW1 A;  1DYQ A;  4NAM A;  1FCL A;  3Q3J A;  5HKH A;  4GXB A;  3ZJV A;  4MAC A;  4JPS A;  5IA7 A;  2YLM A;  1WXS A;  2O2V A;  1T0Q C;  1FXI A;  5TR5 A;  4LJP B;  2LI5 A;  5TSS A;  2MH7 A;  3TJP A;  1QOB A;  2RPQ A;  3JVZ X;  3J9C A;  1GC6 A;  1TGZ B;  2MJE A;  3P4S B;  2BBC A;  1ZUD 2;  2IO3 B;  4WQM A;  2MRP A;  2QCZ A;  5GXG B;  3RZF A;  4DBG A;  4N59 A;  1ET9 A;  2H89 B;  4C7Z A;  3A1Q B;  3CWI A;  3ZTD A;  1Y56 A;  4LNN A;  4XX5 A;  1EU4 A;  3W2D A;  4NAW B;  1EWC A;  2BS2 B;  2WX1 A;  3OJ3 A;  3N1Z C;  3QQ8 B;  2RDB C;  3U7D A;  5AEK B;  1WJ4 A;  2QEJ C;  4OHJ A;  1C79 A;  2J4X A;  2KN4 A;  4JE3 B;  2GBK A;  1CQV A;  3IAS 1;  5C1Z A;  2NPT B;  4YT0 B;  3NZS A;  3NVW A;  1FRD A;  1FRR A;  3VQI A;  1V49 A;  2D3G A;  3HK0 A;  5DCN A;  3S2A A;  1ZXH A;  2WXK A;  3VTU A;  4MEM A;  2LRU A;  2K22 A;  2J7Q B;  2BPS A;  2W9N A;  4CO7 A;  2CHZ A;  1ZPS A;  3P63 A;  3MHZ A;  4GOC A;  3H7S A;  3ZRF A;  1WXM A;  1I4P A;  1T0S C;  3RNG C;  2IDY A;  2LVQ A;  3Q8F A;  4XYC A;  2RMM A;  4AUQ C;  3OLM D;  1WIA A;  1LXD A;  3R7R A;  5AUK A;  2KYW A;  4L1B A;  4MSM B;  2MBE A;  1KLG D;  3NUH B;  1F52 A;  1FD6 A;  3BIN A;  4ASW C;  2BVC A;  4GU2 A;  1L6V A;  3JYU A;  5IKC M;  2QMT A;  3P1M A;  4MDK E;  3ZDM C;  3ZW3 A;  3HIZ A;  1T5X D;  5AZG A;  1ZW7 A;  4FJY A;  5BYQ A;  3V6E B;  1TY0 A;  3V6C B;  3CST A;  2L0T A;  4RM8 A;  1YJ1 A;  4S17 A;  2C60 A;  2V4I B;  1WX8 A;  3BYY B;  1N6Z A;  2PIA A;  1IP9 A;  4DHZ B;  2KDI A;  3BZD B;  1WXV A;  1Y8R C;  2KQ4 X;  3A9K B;  1RM6 C;  2FNJ B;  1I4R A;  1A70 A;  1D6E C;  3MP9 A;  3DBH B;  4ACF A;  5IN7 A;  1JRU A;  2EMT A;  4HDO A;  4HWI B;  2BYT A;  2JRH A;  3IT6 B;  3TBL D;  3GS2 A;  3C8Y A;  2L00 B;  2V3S A;  1E8X A;  4I6P A;  2XEW A;  4HK2 A;  4ANW A;  4PS7 A;  3VTW A;  2QSD A;  2SAK A;  1J7C A;  1VLB A;  2LXA A;  1R4N I;  2ZCC A;  1QF6 A;  3O13 A;  3HUI A;  1ZKH A;  2GLS A;  3RFZ B;  2RPV A;  1WGG A;  2Z8L A;  1XLQ A;  2R61 A;  4MH8 A;  2JXX A;  3U2S C;  1FFU A;  5D94 A;  2IY1 B;  1FXA A;  3ZLZ A;  1XLO A;  3WIM A;  2D2Q A;  3LB8 C;  1WE7 A;  2MWS B;  1TY2 A;  3AE4 B;  4DHJ B;  2XBB C;  3GE3 C;  1RRB A;  3R2T A;  2LUE A;  1C9F A;  3WAN A;  3P4Q B;  1L6U A;  2DEN B;  1F9J A;  2C7M B;  3Q8A A;  2C9W B;  4HCN B;  4DQO C;  5KHQ A;  3A33 B;  3NVZ A;  2Z0E B;  2WXN A;  3RUL A;  2IBI B;  2JU6 X;  3KW5 B;  3R66 C;  4J3O D;  1YN4 A;  1FPY A;  2D10 A;  2Y5P A;  1WGH A;  4WWM A;  1WWT A;  1E8Z A;  2PTL A;  4PYZ A;  3HHM A;  4QAY A;  3DVN V;  3KYC D;  4PT5 A;  4RNA A;  4WIP A;  2G9H D;  2JT4 B;  4W9G A;  5CX3 A;  2HE7 A;  4GDL B;  1UGM A;  2BGF A;  3AEB B;  1YMH E;  3UIO B;  5JHA A;  3AM9 A;  4KZ0 A;  2MCN B;  2JZP A;  3DBR B;  5JH5 C;  1VZ6 A;  4RF1 A;  4IM2 A;  1NEK B;  3DBH I;  1TT5 B;  2M17 A;  1ISN A;  1WRD B;  2KDB A;  2KAC A;  4HKZ E;  3W5U B;  4KIK B;  1J8C A;  4P16 A;  5BO4 B;  3N20 C;  3T8M A;  2L83 A;  4AJY B;  2N9K A;  3EFU A;  1QZE A;  1SGH A;  2WXR A;  2KN5 A;  2J53 A;  2V1Y A;  1D3Z A;  1L4D B;  1E5W A;  4NJ6 A;  2AX5 A;  2I1J A;  2FE8 A;  5H92 C;  4B95 A;  2MBQ A;  1NVI D;  2IO1 B;  1P98 A;  2NR2 A;  4EZK A;  4FXC A;  2KX3 A;  1OEY J;  1UWX A;  4W9L A;  3DHG C;  3L17 A;  4N9F 4;  2QDF A;  4HLE A;  5LXH A;  3E9S A;  4RFB A;  2DYO A;  3L16 A;  3CIR B;  4XC2 A;  1ENF A;  4FJV B;  1WR1 A;  1VZ7 A;  2ZW0 A;  3W9C B;  2IO2 B;  4M01 A;  3QAR A;  3MTN B;  3KLS X;  3DBL I;  1CK1 A;  5FKA C;  1TBE A;  1C3T A;  3DVG Y;  4KSK C;  2QIL A;  3UGB B;  2M1M A;  2NBV B;  1WM2 A;  3I63 C;  3PHX B;  1STE A;  4LJO B;  1XEE A;  4FN2 A;  2N4F A;  4JGH B;  3PS6 A;  4WJN A;  1V8C A;  2K25 A;  3DVG X;  3CSF A;  1JAL A;  1IBX B;  2V9H A;  1JWU D;  1ZDX A;  4BKG A;  4NZL B;  2OHF A;  3IT4 B;  2L76 A;  1XQQ A;  2KTR A;  2FIF A;  4A3P A;  1GNU A;  3AE1 B;  4FLH A;  3WCQ A;  2ZCB A;  2VZK D;  2WXL A;  1UF0 A;  2BWF A;  4XWT A;  4C80 A;  3VRA B;  3RNA C;  2J0J A;  4LDT D;  2KMC A;  2ZNV C;  2GBN A;  1SSN A;  5EE3 A;  2PVG C;  1IGC A;  4MH0 E;  4RMA A;  2WU2 B;  4AP4 C;  2V4L A;  3VR8 B;  4HKQ A;  1F0Z A;  2ONQ A;  2E6X A;  1YNT E;  1KF6 B;  3A4R A;  2KAN A;  3RNC C;  2WXQ A;  4KGS A;  2M19 A;  1JCK B;  3VDZ A;  1D4B A;  4LDT B;  4FUL A;  2WDV B;  4MSQ B;  3Q3M C;  4WAF A;  2MJD A;  1NEN B;  2FCQ A;  3V60 A;  1KOT A;  4IOI E;  3X23 A;  1EM7 A;  2KTR B;  2Y5B B;  2IPK D;  2W54 A;  1Q5W B;  1SBB B;  4BOZ B;  1I35 A;  1IBX A;  3OWE B;  2O6V B;  5G2N A;  1FEH A;  3MJ5 A;  1YQB A;  1E9M A;  2L8J A;  3SR6 A;  1EF5 A;  1TZ1 A;  4IUM B;  1UBQ A;  5CHF A;  2L0F A;  1V5T A;  2KAJ A;  4A9A A;  2V0G A;  4MGY E;  1HTQ A;  2G45 B;  5J17 A;  5HFY A;  2L7R A;  3A1Q A;  4FHJ A;  1SE2 A;  1TS4 A;  3BVG A;  2H88 B;  1E7U A;  2AYO B;  4K1R B;  3H9D A;  2KDF B;  3KUZ A;  2GOW A;  5CHV C;  3V3X A;  4NNJ B;  4PS8 A;  3DCG A;  4GN1 A;  1WZ3 A;  1X1M A;  4IW0 A;  1DOI A;  4I6N B;  1H4R A;  2AEH A;  2K8C A;  3I9V 1;  1EWY C;  4JL9 A;  1E7P B;  3WAO A;  2MP2 B;  2L52 A;  1P7F A;  3PPA A;  1J7B A;  4ZRI A;  2K39 A;  2KT7 A;  3H7P B;  3QK0 A;  3AV8 A;  5D3I B;  1I4X A;  3PRE A;  4S0R A;  5IO9 A;  1DOX A;  1GAQ B;  1F1H A;  2BS4 B;  4J6I A;  3U7Z A;  1VRA B;  1HXY D;  4LTU A;  3L0W B;  1YQ3 B;  4Q2J A;  3QHT A;  4MJS B;  1V80 A;  2JWZ A;  4FBJ B;  1YX5 B;  1OFF A;  3JSV B;  1YQ4 B;  4NQL B;  4B6W A;  1TS3 A;  1TKY A;  2AQ3 B;  2GBM A;  4P7I A;  3GE8 C;  2KK8 A;  4EFO A;  1I4G A;  2Y5C A;  4YWG G;  5D3D A;  3TEZ A;  3NY5 A;  2TSS A;  2NS5 A;  4N58 A;  3W1S A;  1XXG A;  1QLB B;  3TMP B;  2WHI A;  4K7W A;  2I1K A;  5DPW A;  2K0P A;  2A4Z A;  4RGN A;  1UD7 A;  3PZD A;  3V62 A;  2KLC A;  1GPX A;  2KZR A;  1M94 A;  2R2Q A;  2KC1 A;  3AU4 A;  4FAD A;  3IFW B;  5DPR A;  4RGM A;  3HM6 X;  2GMI C;  1Q0W B;  2HTM E;  3Q3F A;  4II3 B;  5IP4 D;  2BYE A;  2LHE A;  2KWV B;  3NHE B;  3H8H A;  2WWZ A;  4URK A;  1E0Z A;  4W9F A;  1N62 A;  1WM3 A;  4DDG D;  3IG3 A;  4REZ A;  1OQQ A;  3DBL B;  1EUV B;  1L4Z B;  2GRI A;  3SFE B;  3TIX A;  3NZ3 A;  1E6E B;  1SXT A;  3TEW A;  3HVD A;  4NJ7 A;  3NZU A;  4C4V A;  2BTE A;  1K50 A;  2KWC A;  3FAH A;  5J18 A;  1QOF A;  2EKE C;  4BBN F;  1WJN A;  4WQO B;  2FAZ A;  3ZXV A;  2CJN A;  2MBH A;  3JSV A;  3AE5 B;  1TKE A;  3QCA A;  1V97 A;  4RM9 A;  1E8Y A;  2C5L C;  2W3S A;  3AEE B;  1C1Y B;  4TSS A;  3U4E G;  2KJR A;  1HZ6 A;  2LZ6 A;  2WXH A;  3EGR A;  1CZP A;  1KH0 A;  4YSX B;  3PZ7 A;  2M56 B;  2PEA A;  3ZNH B;  3D32 A;  3N32 A;  1SE4 A;  1PGA A;  3ZUN A;  5EE9 A;  2OOB B;  2KMA A;  4A6Q A;  3E56 A;  5BYS A;  4LNI A;  4ZRK A;  3DHI C;  3DBS A;  3AE9 B;  4ITK A;  1I7H A;  1RFA A;  4HPL B;  4ARI A;  3W5V B;  2NBW B;  1I42 A;  4DHZ E;  3WAM A;  1KM7 A;  2NPT A;  4HRO A;  4A8X C;  4US8 A;  4ZHO A;  4W9H A;  3QX1 A;  4ANU A;  1V1O A;  2MHJ A;  4MEL A;  4EKU A;  4HJG E;  2Q5W D;  3FIL A;  2DZM A;  4X57 B;  1D5M C;  1C78 A;  3R8B A;  4GDK B;  4KKJ A;  3FIL B;  4K7U A;  4W9E A;  1ROE A;  1V1P A;  3K9O B;  1WYG A;  1N61 A;  4DXA B;  3ABV B;  1DGJ A;  2K9X A;  2LWP A;  3VFK A;  4LLG M;  3BK1 A;  4USA A;  2MBB B;  3DBR I;  4NAW A;  2D07 B;  1WGK A;  3MC9 A;  1WJU A;  1AAR A;  3L4P A;  1KTK A;  3VUW A;  1ZGU B;  2KMM A;  3MJW A;  1V5O A;  3DHH C;  1KLV A;  3Q8B A;  3NS1 A;  1GG3 A;  3H1U A;  3KWL A;  2Z0D B;  4XGA B;  2DBY A;  5KHO A;  3RD2 A;  1Z2M A;  2WNM A;  2BYF A;  2KNB A;  3OJ4 B;  4RCO A;  4B0M A;  3AI5 A;  2KC2 A;  3ZO5 B;  5D7G A;  2WGS A;  2JZ3 B;  3B2F A;  2DHZ A;  3GZN I;  2O2V B;  1AW7 A;  4HPM B;  3VRB B;  2LUM A;  4W9J A;  4KKI A;  3TL5 A;  3I3T B;  1RYJ A;  3R2I A;  2CHX A;  3SEB A;  3P4R B;  4NY0 A;  4N6E B;  4BAX A;  5LXI B;  1IUE A;  1C77 A;  2REX A;  4KV2 A;  1NI2 A;  1PDX A;  4DK5 A;  1WGY A;  1G6J A;  4KIK A;  1YJJ A;  2KQ7 A;  2BB5 A;  2KFJ A;  4YTM B;  2MW5 A;  1C76 A;  4DWF A;  1WXQ A;  4KDL B;  1FO4 A;  1KRH A;  4K81 A;  3RMK C;  2VRR B;  2LXC A;  2IY0 B;  1HEZ E;  1ACC A;  2PMV A;  1CJE A;  1F2R I;  5C3J B;  4FJZ A;  3GB1 A;  4NJC A;  4WAA A;  2KO3 A;  1P1A A;  3A9J B;  3Q3O C;  2VZK B;  5DPS A;  3SFD B;  2BS3 B;  1MG4 A;  4ANX A;  3N1Y C;  1IGD A;  4GDL A;  3P4P B;  3RUI B;  2KVR A;  3I5J C;  1NBF C;  4US9 A;  1P3Q U;  1KJT A;  4KDI C;  1JML A;  4AQ7 A;  3RYT A;  1SE9 A;  2NVU I;  3HRD D;  1L0V B;  3KVF B;  1FCC C;  1P0R A;  4BFR A;  4EOY A;  3DOW A;  3P2B A;  2B76 B;  3ZVV A;  2HJ8 A;  4P1C C;  3AN1 A;  5BYR A;  1JRO A;  3QC8 B;  5LNK 1;  1YD8 U;  4LCD E;  2UWQ A;  2KKC A;  2BWE S;  4ANV A;  1SIJ A;  4C4V B;  3QJZ A;  1XO3 A;  4NQK E;  1IPG A;  1J7A A;  4TQ1 A;  2PKO A;  4MJS A;  1BXT A;  1RAX A;  1N63 A;  3BYT B;  2LVO A;  1E90 A;  3MC0 B;  1SJH D;  2KTF A;  4GLS C;  1WFY A;  1C4A A;  1DOY A;  2D3B A;  1F77 A;  3M95 A;  1K51 A;  4HJK A;  1WMH B;  1VCB A;  2LGX A;  1JW9 D;  2CR5 A;  1HQR D;  2C7H A;  2FCM A;  1P9D U;  3EC8 A;  2PW9 A;  1JQ4 A;  4ZYN A;  1XD3 B;  2ZJD A;  1OQR A;  3CMM B;  3A9K A;  1LM8 B;  1PGX A;  5MPO A;  4DXG A;  2LGD A;  2E3T A;  3NG0 A;  2BF8 B;  2N9X A;  2IGH A;  2CJO A;  3APF A;  3P42 A;  4JQW C;  2MA9 B;  3ZNI D;  4BKS D;  1WE6 A;  3L13 A;  3ZJU A;  3Q8C A;  2LEK A;  2N9E B;  1AWD A;  4A55 A;  1XT9 B;  2FUH B;  4AOF A;  1YN3 A;  4L2Y A;  1UBI A;  1E7V A;  4BOS C;  2NBU A;  3APC A;  4JX1 C;  3PRM B;  4IM0 A;  3BWU D;  2FCS A;  2JZZ A;  1V6E A;  2LFI A;  5IAA C;  4ZHP A;  3IBE A;  3RCZ A;  2INN E;  2N9P C;  3GP7 A;  1VJK A;  4KZC A;  4M8N A;  4IG7 B;  1KFY B;  3SHQ A;  2OED A;  2I38 A;  2DNF A;  3PZ8 A;  1MPE A;  2X8X X;  1VDV A;  1AN8 A;  3HVZ A;  3AUL A;  1JWS D;  3PSE B;  4IM3 A;  4E74 A;  1R4M B;  1WSP A;  5EE1 A;  3EUB 2;  5E6N A;  3BII D;  3PT2 B;  1K52 A;  4OZA A;  1QOA A;  4MGI E;  1WRI A;  2FUG 1;  2ICI A;  3IAM 1;  4EZL A;  3AB5 A;  4BBN C;  2MQJ A;  3DVN U;  5G55 A;  2JWU A;  2XK5 B;  2V3N A;  1Q10 A;  4KVG B;  4YSY B;  4P1B C;  1V81 A;  3DWM A;  2PE9 A;  3PGE A;  1HA5 A;  4IKG A;  1C4C A;  4C00 A;  2KJH B;  4XDC A;  2D3C A;  4AWJ A;  2Z59 B;  5HI1 A;  1JWM D;  3M63 B;  2WQY B;  4IWQ A;  3GZN B;  2MX2 A;  3FC4 A;  2L3Z A;  2XN9 C;  1YOV B;  4GDK A;  1L0X B;  2KVZ A;  4R3D A;  1OTR B;  2M8S A;  3DWG C;  3SU8 X;  2KDE B;  2BKR B;  2KWD A;  5EDS A;  2KD0 A;  2UU7 A;  3BK2 A;  1GJZ A;  4OVZ A;  1B9R A;  3VVW B;  2W3R A;  2WDT B;  1WR6 E;  2WXO A;  2DZI A;  1EO6 A;  2Y3A A;  2DWQ A;  4PK1 A;  4YTP B;  1E8W A;  4UDU C;  2MSE D;  4GSW A;  3K9P B;  3C0R B;  2KOX A;  5EE0 A;  2JQR B;  3PV1 A;  2XNA C;  1PUT A;  3UQB A;  2WXG A;  4W9C A;  2W55 A;  1T0R C;  4MT5 A;  2KHW B;  4OVV A;  1E10 A;  4JIO U;  3VHT C;  2BW2 A;  1A5R A;  4GB9 A;  2LRW A;  2JYE A;  2ZVN A;  3BVZ A;  4M8M A;  1XF5 L;  2QIE B;  2CS4 A;  1QQR A;  4HXD A;  1B1Z A;  3Q3N C;  4ZYS A;  4LNF A;  3QA8 A;  1YJI A;  1ZXI A;  3PTF C;  4W9D A;  4RGO S;  4W9K A;  1T6B X;  2CKH B;  2BQQ A;  3N30 A;  2QJL A;  3R3M A;  1WF9 A;  2WXP A;  3EEC A;  3TCA A;  3KWV A;  1V2Y A;  3ZXR A;  3U8Z A;  4BZA A;  4IWP A;  1I4H A;  4DDI D;  1SJE D;  2RGF A;  3PRZ A;  4GGQ A;  1MI0 A;  5T8I A;  2DLB A;  4LNO A;  2VH2 A;  2YEP B;  1RWS A;  1NYQ A;  2KQS A;  4FHK A;  3L54 A;  3NRZ A;  1UNS A;  2MBO A;  3I57 A;  1T3Q A;  2LGY A;  5JZE B;  4TUU A;  2XK5 A;  4OZB A;  5E6O A;  2LGI A;  4IDI A;  5AZH A;  3BY4 B;  1QT9 A;  3ZIM A;  1FIQ A;  2K1F A;  4AS1 A;  1N5X A;  4B0E A;  1FXT B;  3JW0 X;  2JY6 A;  4ZOH C;  1JRP A;  4LNK A;  3M3J A;  1MHX A;  4ZRP A;  4WWO A;  3Q8E A;  2L1A A;  3B08 A;  2QHO A;  1WY8 A;  4YTN B;  1OEY A;  1WMH A;  3ZDT A;  4TV3 A;  2G4D B;  1TYG B;  3LXF A;  3AE7 B;  1V1P B;  1OQY A;  3L10 B;  1BUI C;  3U52 E;  1QKZ A;  4HVB A;  2GBR A;  2GBJ A;  1SE3 A;  2V3P A;  2WXI A;  1TTN A;  4TKN A;  4NPN A;  5FK9 C;  3T3O A;  4IWO A;  4JWS C;  1SF0 A;  1FNW A;  3WAP A;  3LJ3 A;  2DX5 B;  4C7Y A;  2KFK B;  3RZW C;  5E6J A;  2EEL A;  1LO5 D;  4TQ0 A;  3VXW A;  2X38 A;  4F8C B;  3AH7 A;  3DPD A;  3N1X C;  4M0W B;  1YX6 B;  3UIN B;  2N9L A;  1WH3 A;  2ON8 A;  1CMX B;  3QIJ A;  1S1Q B;  4G3X B;  1C4P A;  4ZRQ A;  2DAJ A;  3TEY A;  4I6L B;  4BKT A;  4M0W A;  3ZQ4 A;  2MP2 A;  2RDG A;  1HZ5 A;  2IO0 B;  2RD0 A;  2NCN A;  1XLN A;  2PPH A;  2HJ1 A;  3SD5 A;  2J42 A;  2VH1 A;  1BML C;  1WXA A;  4WH4 A;  1QIL A;  4DHJ D;  3V05 A;  3N3K B;  4LK0 M;  1J19 A;  3VTV A;  3MC8 A;  1U4A A;  1TS5 A;  4GIV A; 
#chains in the Genus database with same CATH homology
 2KAN A;  3P2B A;  3ZNZ B;  3VDZ A;  2DZJ A;  4EEW A;  4LDT B;  5C23 A;  4FUL A;  5LLI A;  3ZVV A;  2HJ8 A;  2JRI B;  4MSQ B;  2N1W A;  3QC8 B;  4MGK E;  1YD8 U;  3Q3J A;  4LCD E;  5HKH A;  4GXB A;  2UWQ A;  2CU1 A;  2FCQ A;  2KKC A;  3V60 A;  2BWE S;  4ANV A;  3WA0 A;  2YLM A;  1WXS A;  5IA7 A;  2O2V A;  1V9J A;  1KOT A;  2HTH A;  3X23 A;  2KTR B;  2Y5B B;  1YIW A;  1LFD A;  3ONS A;  3QJZ A;  1Z5S B;  1Q5W B;  4NQK E;  1IPG A;  5TR5 A;  4BOZ B;  3H7P A;  4LJP B;  2LI5 A;  1I35 A;  4TQ1 A;  2O6V B;  3TJP A;  5G2N A;  1YQB A;  4MJS A;  2RPQ A;  2L8J A;  3JVZ X;  1RAX A;  1GC6 A;  3ZNG C;  1EF5 A;  1TZ1 A;  4IUM B;  4FA6 A;  1TGZ B;  1UBQ A;  5CHF A;  2LVO A;  2L0F A;  1V5T A;  4WWN A;  2DYM A;  1E90 A;  2IYD B;  2KTF A;  2IO3 B;  2MRP A;  2M0X A;  1WFY A;  4HDQ A;  4EZJ A;  1J0G A;  4MGY E;  2G45 B;  5J17 A;  3RZF A;  2ZEQ A;  4DBG A;  3MHS D;  2L7R A;  3M95 A;  4HJK A;  3A1Q A;  1WMH B;  4FHJ A;  1VCB A;  2LD9 A;  2RR9 A;  4WWP A;  2LGX A;  1WYW B;  3A1Q B;  2CR5 A;  1E7U A;  2C7H A;  2J0K A;  1BT0 A;  2FCM A;  3ZTD A;  1P9D U;  2LJ5 A;  3V61 A;  2AYO B;  3EC8 A;  3NS8 A;  4K1R B;  3H9D A;  4XX5 A;  5DPT A;  5GMV A;  3U30 A;  2KDF B;  4NAW B;  3KUZ A;  4ZYN A;  2GOW A;  2ZZP B;  4W9I A;  5CHV C;  4NNJ B;  4PS8 A;  1XD3 B;  2BKF A;  3DCG A;  4GN1 A;  3QAQ A;  2ZJD A;  4G0N B;  1WZ3 A;  4ICU A;  1X1M A;  2WX1 A;  3OJ3 A;  4IW0 A;  5E6P A;  3QQ8 B;  3CMM B;  1LQB A;  4I6N B;  3A9K A;  1LM8 B;  1H4R A;  2N1V A;  2AEH A;  4CYE A;  3U7D A;  5AEK B;  1WJ4 A;  2JVC A;  4E3C A;  2K8C A;  2LGD A;  2WX0 A;  4JL9 A;  2ZPY A;  2BF8 B;  2N9X A;  3WAO A;  4OVU A;  1R4M I;  2MP2 B;  2GBK A;  3APF A;  2MA9 B;  4JQW C;  3ZNI D;  4BKS D;  1WE6 A;  3L13 A;  2O6V D;  2HD5 B;  2ZNV B;  3PPA A;  3A4S C;  2N9E B;  3ML9 A;  5C1Z A;  2NPT B;  3NZS A;  2LAS A;  1XT9 B;  2FUH B;  4ZRI A;  2K39 A;  3VQI A;  2N7E A;  1V49 A;  3H7P B;  2D3G A;  4AOF A;  1UBI A;  1E7V A;  3DQV A;  2NBU A;  3APC A;  3HK0 A;  3QK0 A;  4KSL C;  5DCN A;  4BOS C;  4EUT A;  1L2N A;  3PRM B;  4IM0 A;  3PRE A;  3S2A A;  2FCS A;  3ML8 A;  4J6I A;  3VTU A;  4B9K A;  4MEM A;  2JZZ A;  2LRU A;  1V6E A;  5CTR C;  2J7Q B;  2BPS A;  5IAA C;  3IBE A;  3RCZ A;  2W9N A;  3L0W B;  4CO7 A;  2CHZ A;  2N9P C;  3QHT A;  3IHP C;  4KZC A;  4GOC A;  4M8N A;  1V80 A;  4MJS B;  4BKS A;  4IG7 B;  3H7S A;  3ZRF A;  1WXM A;  3SHQ A;  2JWZ A;  4FBJ B;  1YX5 B;  3JSV B;  2LVQ A;  4NQL B;  3VH3 B;  2K6D B;  4B6W A;  4F7Z A;  2GBM A;  4P7I A;  2KK8 A;  4G11 A;  4AUQ C;  4EFO A;  3OLM D;  3AUL A;  1WIA A;  1LXD A;  3R7R A;  3PSE B;  4IM3 A;  4E74 A;  4MSM B;  2RSU A;  2MBE A;  4WJP A;  5E6N A;  3PT2 B;  3NY5 A;  2NS5 A;  3H6N A;  2IZV B;  3W1S A;  3BIN A;  3TMP B;  4ASW C;  4GU2 A;  4K7W A;  4MGI E;  3JYU A;  2I1K A;  2DAF A;  2ZPN A;  5DPW A;  3KH0 A;  4MDK E;  4EZL A;  3AXC A;  5L83 A;  5D2M B;  3W1S C;  3ZDM C;  3ZW3 A;  4BBN C;  2MQJ A;  3HIZ A;  2A4Z A;  3PRP B;  3DVN U;  5G55 A;  1UD7 A;  3PZD A;  3V62 A;  1H8C A;  5AZG A;  1ZW7 A;  3VUX A;  4FJY A;  2KLC A;  2PE6 B;  2XK5 B;  3V6E B;  5FR6 A;  2KZR A;  3T9L A;  1M94 A;  2R2Q A;  2KC1 A;  3AU4 A;  3V6C B;  3IFW B;  4FAD A;  4KVG B;  4A20 A;  3CST A;  2KXJ A;  2L0T A;  4RM8 A;  5DPR A;  1WGD A;  1YJ1 A;  3DDC B;  1Q1O A;  2AL3 A;  1V81 A;  3HM6 X;  2GMI C;  2PE9 A;  3PGE A;  1Q0W B;  3ZTC A;  2AWT A;  2C60 A;  1WX8 A;  2O6V A;  3Q3F A;  4II3 B;  2BYE A;  2G3Q B;  2KWV B;  3NHE B;  1IP9 A;  4DHZ B;  2KDI A;  3VAW A;  1WXV A;  2WWZ A;  2KJH B;  4URK A;  1Y8R C;  3A9K B;  2FNJ B;  4W9F A;  1WM3 A;  4AWJ A;  4DDG D;  2Z59 B;  3NOB A;  3IG3 A;  2UYZ B;  3M63 B;  2D11 A;  1EUV B;  4IWQ A;  3TIX A;  2MX2 A;  2MLB A;  4JLC A;  2KX0 A;  2L3Z A;  4GDK A;  4NJ7 A;  1JRU A;  1OTR B;  2EMT A;  2M8S A;  4HDO A;  3NZU A;  4HWI B;  1OGW A;  3VH4 B;  2JRH A;  1K8R B;  1RLF A;  2KDE B;  2KWC A;  2BKR B;  2ZVO A;  3SU8 X;  3UQA A;  5J18 A;  3TBL D;  2EKE C;  2KD0 A;  1WJN A;  4WQO B;  2FAZ A;  4BBN F;  5EDS A;  2MBH A;  1GJZ A;  3B1L X;  2YVC A;  2L00 B;  3CF6 E;  3JSV A;  2V3S A;  3VVW B;  2WDT B;  1E8X A;  3QCA A;  4I6P A;  4RM9 A;  1WR6 E;  1E8Y A;  3UIP B;  2C5L C;  2XEW A;  2DZI A;  3SDL C;  1EO6 A;  2M4N A;  1C1Y B;  4HK2 A;  4ANW A;  1E8W A;  4PS7 A;  3VTW A;  1GUA B;  2A5U A;  2MSE D;  4GSW A;  3K9P B;  2J0M A;  3C0R B;  1WGR A;  2FID A;  2KOX A;  2KJR A;  2LZ6 A;  2DYB A;  3PV1 A;  2LXA A;  4K7S A;  1R4N I;  2ZCC A;  3UQB A;  4W9C A;  2BYV E;  5JHB A;  1ZKH A;  2PEA A;  3ZNH B;  1UZX B;  2KHW B;  3D32 A;  5D6J B;  3N32 A;  4OVV A;  1WGG A;  4PS3 A;  2JXX A;  4JIO U;  3VHT C;  4BVU C;  1A5R A;  2JPH A;  3ZUN A;  1WI0 A;  5D94 A;  2IY1 B;  2R2O A;  4GB9 A;  3ZLZ A;  2OOB B;  2KMA A;  2LRW A;  2ZVN A;  3WIM A;  2D2Q A;  1WE7 A;  4M8M A;  2MWS B;  2CS4 A;  4ZRK A;  2XBB C;  4DHJ B;  3PHW B;  1HE8 A;  1RRB A;  4HXD A;  3DBS A;  3QA8 A;  1WZ0 A;  2LUE A;  3X0W A;  4PYU A;  3RT3 B;  3WAN A;  2DEN B;  3PTF C;  2ASQ A;  1RFA A;  4HPL B;  4W9D A;  3GOE A;  1F9J A;  2C7M B;  3PVL A;  2NBW B;  2C9W B;  1I42 A;  4GMV A;  4W9K A;  4HCN B;  2CKH B;  3O65 B;  4DHZ E;  5KHQ A;  4HCP B;  3WAM A;  3N30 A;  3A33 B;  2Z0E B;  1KM7 A;  3R3M A;  1WF9 A;  3RUL A;  4WJO A;  2NPT A;  2IBI B;  3KW5 B;  3EEC A;  3TCA A;  3QWZ B;  1V2Y A;  3KUD B;  5J2R A;  3U8Z A;  3R66 C;  4W9H A;  3QX1 A;  4E71 A;  4ANU A;  2D10 A;  4MEL A;  4IWP A;  4EKU A;  1WGH A;  4DDI D;  1E8Z A;  2WYQ A;  2DZM A;  4II2 B;  4PYZ A;  2RGF A;  3HHM A;  4X57 B;  3PRZ A;  4GGQ A;  3DVN V;  3KYC D;  4GDK B;  4K7U A;  3OAW A;  2JT4 B;  4W9E A;  4W9G A;  2HE7 A;  4GDL B;  5CX3 A;  1UGM A;  3K9O B;  3PLV A;  2KQS A;  4FHK A;  3L54 A;  4DXA B;  4MM3 A;  2BGF A;  2MBO A;  3UIO B;  5JHA A;  2LWP A;  1MG8 A;  4XZ4 A;  3W1Y A;  4KZ0 A;  3VFK A;  3KYD D;  2MCN B;  2LGY A;  5JH5 C;  5JZE B;  2MBB B;  3DBR I;  4NAW A;  4TUU A;  2D07 B;  2XK5 A;  4IM2 A;  5E6O A;  3DBH I;  5AZH A;  1WJU A;  3BY4 B;  2M17 A;  1WJ6 A;  3ZIM A;  1AAR A;  3WAL A;  2KJ6 A;  2K1F A;  5CHW A;  2G4S A;  5AZF A;  3ALB A;  1ISN A;  1WRD B;  1FXT B;  2KDB A;  3ECI A;  3JW0 X;  2JY6 A;  4KIK B;  3VUW A;  1ZGU B;  3MJW A;  1V5O A;  1J8C A;  2JF5 A;  1V86 A;  1WX9 A;  5BO4 B;  4ZRJ A;  1KLV A;  1GG3 A;  3H1U A;  3M3J A;  2Z0D B;  1S3S G;  1NDD A;  4IC7 B;  4WWO A;  5KHO A;  3T8M A;  3RD2 A;  4AJY B;  2EMS A;  3EFU A;  1QZE A;  1Z2M A;  1SGH A;  2C7N B;  2KN5 A;  2BYF A;  3B08 A;  2KNB A;  2QHO A;  2V1Y A;  3OJ4 B;  1L7Y A;  1WY8 A;  1OEY A;  1WMH A;  2K6Q A;  1D3Z A;  3AI5 A;  3ZDT A;  2KC2 A;  1E5W A;  4TV3 A;  3ZO5 B;  5D7G A;  2AL6 A;  2G4D B;  1IYF A;  4NJ6 A;  2JZ3 B;  2I1J A;  4MGZ E;  4B95 A;  2DHZ A;  3ZRC A;  1OQY A;  3GZN I;  3L10 B;  2O2V B;  2MBQ A;  2IO1 B;  3PLU A;  1P98 A;  1PQS A;  4HVB A;  4HPM B;  4WJQ A;  2K8H A;  2GBR A;  3TL5 A;  2GBJ A;  4W9J A;  2NR2 A;  1VD2 A;  3I3T B;  4A3O A;  1SIF A;  2CHX A;  4EZK A;  1TTN A;  2KX3 A;  4TKN A;  2B3A A;  1OEY J;  4W9L A;  4NPN A;  4NY0 A;  3L17 A;  4N9F 4;  4F1S A;  5LXI B;  1UEL A;  2PJH A;  4IWO A;  4KV2 A;  4YL8 A;  2REX A;  1NI2 A;  4DK5 A;  4HLE A;  5LXH A;  2JUO A;  3WAP A;  3LJ3 A;  2DX5 B;  3LDZ E;  1WGY A;  1G6J A;  2KFK B;  3AU5 A;  3RZW C;  4KIK A;  3IVF A;  2DYO A;  3L16 A;  3APD A;  2KQ7 A;  2KFJ A;  4XC2 A;  4TQ0 A;  2DZK A;  5L95 C;  4FJV B;  2MW5 A;  2KWU B;  3VXW A;  2KFK A;  1UH6 A;  1WR1 A;  2IO2 B;  4ICV A;  3QAR A;  3MTN B;  4DWF A;  4F8C B;  3DBL I;  1T0Y A;  4KDL B;  1TBE A;  3DPD A;  1C3T A;  4K81 A;  3DVG Y;  4KSK C;  2VRR B;  2LXC A;  2M1M A;  3UGB B;  2IY0 B;  1GC7 A;  1YX6 B;  2NBV B;  4M0W B;  3UIN B;  1WM2 A;  1WH3 A;  3PHX B;  4LJO B;  2FCN A;  4FN2 A;  2N4F A;  4FJZ A;  2CHW A;  4JGH B;  4WAA A;  3PS6 A;  4WJN A;  1CMX B;  2L05 A;  3QIJ A;  3A9J A;  2KO3 A;  2K25 A;  3DVG X;  2K8B A;  1P1A A;  3CSF A;  3VUY A;  4CHK A;  1S1Q B;  4G3X B;  4BKG A;  3B0A A;  3A9J B;  2L76 A;  2DAJ A;  1XQQ A;  2KTR A;  2KLG A;  4ZDV A;  2FIF A;  3KUC B;  5DPS A;  4A3P A;  1GNU A;  4I6L B;  4BKT A;  4FLH A;  2ZCB A;  2MP2 A;  2N7D A;  4ANX A;  4GDL A;  4AJW A;  2BWF A;  3ENE A;  2J0J A;  3RUI B;  2KVR A;  2IO0 B;  2RD0 A;  2LVP A;  3EHV A;  2KMC A;  2NCN A;  2ZNV C;  4LDT D;  1NBF C;  2PPH A;  2GBN A;  1P3Q U;  1KJT A;  3SD5 A;  3R7Q A;  4KDI C;  1EF1 A;  1WX7 A;  3L08 A;  3RYT A;  4MH0 E;  1WXA A;  1SE9 A;  2NVU I;  4DHJ D;  4RMA A;  3N3K B;  1J19 A;  3ZKJ C;  3KVF B;  3HM3 A;  3VTV A;  2V4L A;  4AP4 C;  2OJR A;  1P0R A;  4G50 A;  3UF8 A;  1U4A A;  4GIV A;  3A4R A;  4BFR A;  4EOY A;  3M62 B;  3DOW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...