1WJNA

Solution structure of the c-terminal ubiquitin-like domain of mouse tubulin-specific chaperone e
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
97
structure length
97
Chain Sequence
GSSGSSGQLLTLKIKCSNQPERQILEKQLPDSMTVQKVKGLLSRLLKVPVSELLLSYESSKMPGREIELENDLQPLQFYSVENGDCLLVRWSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tubulin-folding protein TBCE
publication title Solution structure of the C-terminal ubiquitin-like domain of mouse tubulin-specific chaperone e
rcsb
source organism Mus musculus
molecule tags Chaperone
total genus 15
structure length 97
sequence length 97
ec nomenclature
pdb deposition date 2004-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14560 Ubiquitin_2 Ubiquitin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1wjnA00
3VQIA 3DCGA 4ASWC 4PS7A 4WAAA 5CX3A 1UH6A 1Z2MA 4MELA 4ZRKA 2NS5A 2NCNA 3NY5A 2AEHA 3R66C 4PYUA 3DPDA 2L7RA 1UELA 3PLUA 1J19A 2GBJA 3PS6A 2MCNB 4FJYA 4WJQA 4W9CA 4NY0A 2MBEA 4WWPA 4IG7B 1RLFA 4GOCA 1WR6E 3RZFA 2C60A 1WXMA 2C7HA 2NVUI 2LGYA 4HDQA 4DHZE 2W9NA 2FCMA 2IO3B 2KZRA 4W9DA 2NR2A 3ZKJC 3EECA 3RCZA 3WIMA 1IYFA 4ANWA 4TV3A 2GBRA 2G3QB 2KTFA 2MA9B 3ZDMC 3H7SA 1V81A 2IBIB 3ZNZB 4CHKA 4K7WA 3VH4B 1WE7A 2KO3A 3DOWA 3VH3B 5JHBA 2KTRA 1UD7A 3DVNU 1XT9B 5D6JB 2MW5A 2BWES 3DBLI 4AJWA 3HHMA 2L0TA 3ALBA 3EFUA 4WJOA 1WGYA 3S2AA 2WWZA 1WE6A 4HCPB 2KFKA 2KFKB 2A4ZA 4KSLC 2GBMA 3PRPB 3VTVA 3QARA 3R7RA 2WX0A 5CTRC 2KJRA 3PZDA 2LJ5A 2FAZA 3KYDD 1V2YA 4BKGA 5IAAC 2OOBB 2DZJA 4HXDA 3TL5A 3MJWA 2LI5A 1KM7A 1XQQA 2G4DB 3VDZA 4BKSA 5J2RA 3N30A 4BKTA 3WAOA 4PS3A 1WI0A 4MSQB 2DZKA 3DVGX 4HPMB 1TTNA 1WM2A 1XD3B 3TCAA 3QHTA 2DHZA 1CMXB 4IM2A 4BKSD 5J17A 3PLVA 4HJKA 4HK2A 4IWPA 4MGZE 4EFOA 3SU8X 4BVUC 5E6NA 3JSVB 2KOXA 5JH5C 2CR5A 4PYZA 2ZNVB 2WX1A 1HE8A 2K25A 4I6NB 4FN2A 3U7DA 2KNBA 1WXVA 1R4MI 2JRIB 2MBOA 2XK5A 2XK5B 3M95A 1UGMA 1P1AA 1V5TA 1WXSA 2KXJA 3UQBA 4G50A 1WX9A 2ZVNA 1OEYA 1P3QU 4FBJB 4IM3A 3A4SC 5KHQA 2YLMA 2MP2A 4GDLA 4GDLB 4I6PA 4X57B 1GC7A 4EZKA 1E7UA 3UIOB 2J0JA 5LXIB 4HWIB 4ICUA 2AL3A 2PJHA 3ZLZA 3IHPC 2L00B 2XEWA 4MEMA 4BOZB 1EF1A 1J8CA 2FIFA 2DZMA 3ZTCA 1SGHA 1V80A 1S1QB 2IY1B 3H7PA 3H7PB 2DX5B 3RD2A 3D32A 2BPSA 1ISNA 2LVOA 2RSUA 1GC6A 1C1YB 3UQAA 1I35A 1S3SG 1L7YA 5L83A 1KJTA 4JLCA 4AP4C 1IPGA 1VD2A 3PTFC 4FJVB 4FJZA 3VHTC 4BFRA 1E8WA 2JY6A 4W9EA 1IP9A 2DAFA 1D3ZA 1RAXA 2V3SA 3DVNV 4GGQA 2NBWB 2CU1A 2ZCBA 5J18A 2XBBC 3NZSA 3PHXB 1MG8A 3K9PB 3PRZA 2K1FA 2LZ6A 4NPNA 3APFA 3ZUNA 2Z0EB 2C7NB 3BINA 4F8CB 4KIKB 1RFAA 4TUUA 1Q5WB 2KHWB 3B08A 2JVCA 3DBRI 4GIVA 4NQLB 3ZRFA 4HVBA 1KOTA 2LGXA 2ZNVC 3KVFB 4MGIE 1WGRA 2IO2B 3JVZX 1FXTB 3AU4A 4AOFA 2RPQA 3QWZB 2IYDB 3CF6E 3ONSA 4M8MA 4W9LA 3M3JA 3QJZA 4IC7B 2BGFA 1WGDA 4TQ1A 3RULA 1WR1A 5IA7A 1WGHA 1ZGUB 3IBEA 4IWOA 2LRUA 1E8XA 2B3AA 2MSED 3TJPA 4G3XB 3ZRCA 1LXDA 2NBVB 2Z59B 1EO6A 1GJZA 3IFWB 1RRBA 4LJOB 1TZ1A 5DPRA 3QA8A 2JXXA 1WJUA 3JW0X 3V60A 2PE6B 2ASQA 2LASA 3WALA 2C7MB 3PV1A 2K6QA 3VAWA 3VTUA 4EOYA 4EUTA 2HTHA 5HKHA 2KDBA 2JF5A 3C0RB 3PRMB 1E8YA 3ZNGC 4FULA 2MWSB 3HK0A 3RT3B 2LGDA 2FUHB 2R2QA 4FA6A 5KHOA 1E90A 4NQKE 4FADA 4YL8A 3ZTDA 3CSTA 3KUCB 2M4NA 3I3TB 3OJ3A 1P98A 2K8BA 2N9EB 1NI2A 3PVLA 1WFYA 3PT2B 1NBFC 2OJRA 3QK0A 4G11A 5DPTA 4A3OA 2GBNA 4WQOB 5LXHA 2O6VA 2O6VB 3NS8A 2IY0B 2KMCA 1OGWA 1WJ6A 4GDKA 4GDKB 2C9WB 1WYWB 4HCNB 3L17A 2MBHA 2O6VD 3VUXA 1YJ1A 4MGKE 1X1MA 1F9JA 3APDA 2L05A 1R4NI 2N1WA 3OAWA 5D2MB 3RYTA 4AUQC 3ZW3A 2EMTA 1GG3A 2BYEA 1V9JA 2DENB 4NJ6A 3K9OB 3Q3FA 3VUYA 3L0WB 2J0KA 3R3MA 3V6EB 3IG3A 2M17A 3L08A 2RGFA 3GZNI 2KVRA 1TBEA 5G55A 3HM3A 4NJ7A 1WGGA 1OTRB 1OEYJ 2JWZA 4RM8A 4WJPA 1H4RA 2KD0A 2L0FA 2KJ6A 2LUEA 3JSVA 1AARA 3M63B 3EC8A 3QQ8B 4GSWA 2BWFA 4HDOA 3AULA 4A20A 1WMHA 1WMHB 5D94A 1P9DU 3IVFA 4JGHB 1YQBA 2K39A 3RUIB 1WX7A 2KLGA 3H1UA 4K7UA 1V5OA 3UGBB 2N4FA 1E8ZA 1E7VA 4TKNA 4E3CA 3Q3JA 5AEKB 1WY8A 2N9PC 4IWQA 1WJNA 2LXCA 2BF8B 2O2VB 4XX5A 2BKRB 2KKCA 4PS8A 3ZNHB 2KDEB 2ZJDA 3NZUA 5L95C 2HJ8A 3ECIA 4DXAB 4DHJB 4KDLB 5CHWA 2C5LC 3CMMB 4W9JA 4IW0A 4CO7A 2JT4B 4DHJD 2EMSA 4MJSB 4BBNF 3A4RA 2JPHA 2JUOA 1TGZB 4KZ0A 5CHVC 1A5RA 1E5WA 3A9KA 3A9KB 3PREA 3ENEA 2GMIC 3TMPB 2KMAA 3L54A 2VRRB 3SD5A 4MM3A 1EF5A 2KX0A 4ZRJA 2V4LA 4URKA 3V61A 3UIPB 4BBNC 4KIKA 2CHXA 2MQJA 1SE9A 3JYUA 2N7EA 1U4AA 2KX3A 1WM3A 2G4SA 2PPHA 2KQ7A 2KDFB 3MHSD 4KV2A 3WAMA 3WANA 4ANUA 1T0YA 2YVCA 1VCBA 5C23A 2K6DB 2K8HA 1ZKHA 4ICVA 4LJPB 1JRUA 2Y5BB 1LFDA 2BYFA 4F7ZA 4MH0E 2FIDA 1WH3A 2WDTB 3AI5A 4DK5A 3PGEA 1KLVA 5DPWA 4FHKA 1WX8A 3ZO5B 4DDID 1YD8U 5EDSA 4LDTB 2JRHA 2I1KA 4B9KA 4J6IA 3ML8A 4K1RB 2AL6A 4K7SA 3A9JB 4LDTD 2KK8A 2N7DA 5TR5A 2DYBA 2LD9A 5AZFA 2FCSA 3CSFA 4M0WB 1Y8RC 4ZYNA 2ZCCA 4GMVA 2D3GA 3T8MA 2Z0DB 2MX2A 5FR6A 1OQYA 3B1LX 2D10A 1WIAA 3N3KB 4HPLB 3U30A 4A3PA 4E74A 3AU5A 3QIJA 4RM9A 4KDIC 1EUVB 5E6OA 2G45B 3WA0A 5JZEB 4RMAA 3V6CB 1WXAA 3DDCB 3PPAA 2KWCA 4GB9A 3TBLD 3X23A 2ZVOA 5JHAA 3PSEB 3QC8B 3ZIMA 3HIZA 4JL9A 4MGYE 5E6PA 2DZIA 1K8RB 4MDKE 3X0WA 1BT0A 3N32A 2D07B 3HM6X 1Z5SB 3NOBA 4ANXA 2L76A 4DDGD 1L2NA 3LJ3A 3VUWA 4KSKC 3T9LA 3DVGY 2KWVB 2CHWA 4OVUA 3OLMD 2M0XA 4CYEA 4IUMB 3GOEA 3ZDTA 4N9F4 4DWFA 1ZW7A 2JZZA 3AXCA 4TQ0A 2MLBA 5D7GA 2EKEC 3DQVA 3KUDB 4G0NB 4WWNA 5DPSA 2ZPYA 1Q0WB 2KTRB 4KZCA 3RZWC 2A5UA 3KYCD 1QZEA 3VXWA 3M62B 4JIOU 3UF8A 1UBIA 1LQBA 4W9IA 5LLIA 3VTWA 3VVWB 3MTNB 2M1MA 3P2BA 1GUAB 3W1SA 2K8CA 2ZEQA 4DBGA 5BO4B 2AYOB 2HD5B 2N1VA 2AWTA 2CHZA 4II3B 1G6JA 2J7QB 2NPTA 2NPTB 3ZNID 3R7QA 4EZJA 1H8CA 1M94A 2FCNA 4AWJA 2KWUB 5CHFA 1YIWA 3ML9A 2R2OA 2MBBB 2M8SA 4OVVA 4B6WA 2FNJB 2PE9A 2V1YA 2LWPA 2KFJA 2LVPA 4JQWC 2KQSA 3V62A 2QHOA 2GBKA 1YX5B 2J0MA 3NHEB 3L10B 2DYOA 4II2B 4W9KA 2LVQA 2WYQA 2BYVE 2IO0B 3DBHI 2MBQA 3KW5B 3LDZE 4WWOA 1WZ3A 2O2VA 2L3ZA 1V86A 4ZRIA 3QAQA 3ZVVA 4BOSC 5AZHA 4FHJA 4ZDVA 2REXA 4E71A 1UZXB 2KANA 2MRPA 1UBQA 1V6EA 1I42A 1WF9A 2JZ3B 1SIFA 4XC2A 4ANVA 3H9DA 1NDDA 4HLEA 4AJYB 4MJSA 4EKUA 4B95A 2IZVB 2RR9A 2FCQA 2LXAA 2MP2B 2KDIA 3L13A 2L8JA 3QX1A 1J0GA 4K81A 3A33B 3B0AA 3W1SC 4LCDE 3TIXA 2KLCA 5DCNA 4NAWA 4NAWB 1V49A 3H6NA 4W9GA 2IO1B 3QCAA 2CS4A 3U8ZA 1WRDB 2UYZB 4P7IA 4MSMB 2DAJA 2KC1A 2N9XA 3WAPA 1WZ0A 2D2QA 3DBSA 4GN1A 2BKFA 3W1YA 4DHZB 3L16A 1C3TA 5AZGA 5C1ZA 4W9HA 3VFKA 3O65B 2ZZPB 4W9FA 3SHQA 4FLHA 1Q1OA 2DYMA 2PEAA 2KJHB 3A1QA 3A1QB 4M8NA 4NNJB 3SDLC 4IM0A 4F1SA 3EHVA 3OJ4B 5G2NA 3A9JA 3UINB 2NBUA 2UWQA 2ZPNA 4EZLA 3KUZA 1P0RA 2KN5A 4WJNA 2I1JA 3PHWB 1PQSA 2LRWA 4I6LB 2CKHB 2D11A 3APCA 4KVGB 4GU2A 4EEWA 4XZ4A 1WJ4A 1YX6B 2KC2A 3KH0A 2GOWA 2HE7A 3BY4B 4GXBA 1LM8B 2RD0A 1GNUA 5GMVA
chains in the Genus database with same CATH superfamily
4ASWC 1UH6A 4MELA 2AEHA 3R66C 3DPDA 1RYJA 3PLUA 3PS6A 1V8CA 2GBJA 4LNKA 4W9CA 5EE9A 4GOCA 1SIJA 2BW2A 2C60A 3J9CA 1FCCC 1WXMA 4LTUA 2MJEA 1KLGD 4W9DA 3RCZA 3WIMA 2V4IB 2WXOA 4TV3A 2GBRA 2G3QB 3ZDMC 3H7SA 1CZPA 2WXGA 2WS3B 4ZOHC 4AS1A 4K7WA 1KTKA 2KTRA 2KAJA 2JXTA 4FXCA 1MHHE 2IGGA 3ALBA 1WGYA 2INDC 1XCTL 2KFKB 2A4ZA 4KSLC 2GBMA 3VTVA 3R7RA 2WX0A 1ET9A 2KJRA 2FAZA 1SE4A 5AUIA 4HXDA 2FE8A 3MJWA 1T5XD 4BKTA 2WXRA 1WM2A 4A9AA 1XD3B 3QHTA 5J17A 3VRBB 3W5UB 5E6NA 3JSVB 2KOXA 5JH5C 2KDMA 2WX1A 2N9LA 2K25A 2MBOA 4HRSA 3M95A 1WGKA 1UGMA 1UUPA 2KXJA 1VDVA 4RFBA 1P3QU 4X57B 4N59A 3ZLZA 4MEMA 4UDUC 4BOZB 2LEKA 1V1PA 2PVGC 3ZTCA 1SGHA 2YEPF 4WURA 2DX5B 3D32A 2BPSA 2BQQA 4JE3B 2LVOA 2RSUA 3FAHA 1C1YB 1MVKA 1L7YA 2XN9C 1IPGA 3ZJTA 1RAXA 2CU1A 3R8BA 1MG8A 3PRZA 2K1FA 2BTEA 2Z0EB 2C7NB 4F8CB 4KIKB 1RFAA 4TUUA 5I4DA 3B08A 4GIVA 4NQLB 4HVBA 4MGIE 1FXTB 2RPQA 4HJGE 4KGTA 2IYDB 3CF6E 2G9HD 1DGJA 4W9LA 2RDHA 4J3OD 1E8XA 1J7BA 2NBVB 1C79A 1EO6A 2Z59B 3V05A 3JW0X 1QILA 3PV1A 1YJJA 3VTUA 4EUTA 2KDBA 3N1ZC 3AE2B 3AMZA 4FULA 1MPEA 4RGMA 2LHEA 1F77A 4US8A 2CJNA 2R2QA 1AWDA 4NQKE 4YL8A 3ZXRA 3Q8EA 3CSTA 2BS4B 4G11A 3IAS1 5LXHA 3CIRB 3NS8A 1OGWA 3IAM1 3L17A 3N20C 4MGKE 1R4MB 4AUQC 4ARIA 3LYYA 1V9JA 3PZ7A 3VUYA 1TJEA 4XYCA 5HFYA 3AE3B 3V6EB 3AE9B 3IG3A 3ZJUA 2M17A 3Q2AC 3GZNI 2W3SA 1T0SC 2WXLA 4NJ7A 1E9MA 3GE8C 1OTRB 4RM8A 1L0XB 2KJ6A 3KWVA 3KLSX 2BWFA 2X38A 2WXMA 2Q5WD 2BBCA 2VZKD 1YQBA 1ESFA 1E7VA 3Q3JA 1IBXA 1WY8A 2N9PC 4XE0A 4PS8A 2V9HA 4LLGM 1TKYA 2ZJDA 5L95C 1VJKA 2C5LC 4XGAB 4CO7A 1EU3A 1K50A 2MH7A 1BXTA 3NVYA 4K3CA 3A4RA 1TGZB 1FCLA 5H92C 3P63A 1PUTA 1LGRA 1PGAA 1JWSD 4BBNC 5BMIA 2RDBC 1XLOA 2PPHA 3E9SA 2KQ7A 2QILA 1T0YA 4WIPA 2K8HA 1JRUA 4F7ZA 4C4VB 4MH0E 2WDTB 4JWSC 5EDSA 2JRHA 2I1KA 3ML8A 4K1RB 2W54A 2KK8A 2N7DA 5C2TB 4YT0B 4ZYNA 2ZCCA 1PYWD 2PTLA 2D3GA 5H8YE 3T8MA 4ITKA 3U30A 3AU5A 4P1CC 1EUVB 3WA0A 4NZLB 3V6CB 3Q3NC 4ARCA 5JHAA 3QC8B 3PZ8A 4JL9A 4MDKE 3BK2A 2V0GA 4N58A 4YTNB 3VUWA 3T9LA 3DVGY 2CHWA 2IPKD 4CYEA 4IUMB 3RNGC 2PKOA 4M00A 2INNE 2EKIA 3B2GA 3GOEA 4N9F4 1ZW7A 3AXCA 2MLBA 2EKEC 5DPSA 1YN5A 4G0NB 1EWYC 2ZPYA 2KTRB 4L2YA 1C76A 1QZEA 3AE5B 3VXWA 4W9IA 1LQBA 3VVWB 1I4RA 3CWIA 5JXVA 3FILA 4KKIA 2UU7A 5IN7A 5BO4B 1QF6A 2N1VA 1WYGA 2LJIA 3R7QA 3RN9C 1M94A 1YIWA 4B6WA 2MBBB 2BS2B 2G1EA 2KFJA 1JRPA 4JQWC 2WXKA 1NYRA 1YX5B 3ZXVA 4II2B 2WYQA 2IGDA 1XLQA 2BYVE 2JYTA 3LDZE 4YSZB 3BYTB 2CJOA 1FPYA 1NVID 3AEAB 3ZVVA 5AUKA 1UWXA 2JZPA 2JU6X 1UBQA 2LGSA 1SIFA 4XC2A 4ANVA 3H9DA 2B76B 1FMAD 1XO3A 4HLEA 1FFUA 2KN4A 4EKUA 3ZGZA 1OQRA 3AE8B 1JWAD 3QX1A 1SEBD 1L4ZB 2L8JA 3L13A 2I2YA 4HROA 4LCDE 3TIXA 2KLCA 4W9GA 1V1PB 3RNFC 2IO1B 3U8ZA 2W82A 4MSMB 2D2QA 4GN1A 2BS3B 3L16A 1KRHA 3MC9A 4C7YA 1V1OA 3IXSA 4FLHA 4YSXB 1ZXHA 1YQ3B 4JPSA 3MHZA 2PEAA 3SFDB 3A1QB 3SDLC 4K3BA 1VR9A 5G2NA 3A9JA 3UINB 2NBUA 1DYQA 4EZLA 4OVZA 4M0WA 3Q3OC 3KWLA 1PQSA 4I6LB 4NJCA 2TSSA 2D11A 3APCA 4GU2A 3NUHB 1WXQA 4EEWA 3KH0A 2GOWA 1R4NB 3I5JC 4RGTA 3DCGA 1N5XA 1Z2MA 4ZRKA 1FNVA 1UWMA 2NCNA 1SSNA 3B9JA 4DQOC 2L7RA 3P1MA 1J19A 1IGCA 1VZ7A 4NY0A 2WXJA 1WR6E 3O13A 4IKGA 1A70A 2QMTA 4HDQA 4DHZE 1PDXA 3ZKJC 2IO3B 3EECA 4ANWA 2D3BA 2MA9B 1V81A 2IBIB 4CHKA 1B1ZA 3VH3B 4YWGG 1XT9B 3DBLI 4AJWA 4WJOA 2WWZA 4ZRQA 2FUG1 3Q69A 3TUOA 1CJEA 3KYDD 1P7FA 2KQ4X 1TS2A 1KM7A 4OZBA 4BKSA 5J2RA 1ZPSA 1WI0A 4MSQB 3DVGX 1I4QA 5G5HA 2GB1A 1RM6C 2DHZA 3PLVA 4HK2A 4MGZE 3NRZA 4RF0A 2INCC 1FRRA 2CU3A 4I6NB 2XK5A 2JRIB 4YTMB 1V5TA 1WXSA 3UQBA 3MC8A 3AN1A 1WX9A 2ZVNA 3RNEC 3A4SC 2YLMA 4GDLA 4EZKA 1E7UA 2MHJA 1C4CA 2L00B 1J8CA 2FIFA 2DZMA 1V80A 1SF0A 3H7PB 1MJDA 3RD2A 3DHHC 1JWMD 5D3DA 1I35A 1KJTA 4P1BC 4AP4C 4FJVB 3VHTC 4W9EA 1D3ZA 3DVNV 3RNCC 3ABVB 3NZSA 5EE1A 4NPNA 3TEYA 3BINA 1CQVA 2J53A 2RDGA 2JVCA 3DBRI 2DBYA 2WU2B 4REZA 3ZRFA 1AW7A 5T8IA 2LGXA 3AU4A 3QJZA 2BGFA 1WGDA 4IWOA 3SR6A 5MPOA 1J7AA 2MSED 4G3XB 3ZRCA 3IFWB 2WHIA 4LJOB 4B0MA 2PE6B 1ACCA 1E7PB 1WSPA 3WALA 2C7MB 5HKHA 4OZAA 2I38A 2MWSB 3ZJVA 3RT3B 3E56A 1GOZA 1E90A 1FXAA 1N6ZA 2QC8A 1P98A 2N9EB 5FK9C 1NBFC 1B9RA 2OJRA 5DPTA 4USAA 4WQOB 2O6VA 4D2KA 1HTOA 4GDKA 2J52A 4HCNB 4KGSA 4RCOA 1X1MA 3U7ZA 2L05A 3ZW3A 2EMTA 1ZP0B 1GG3A 2BYEA 3P4QB 1QKZA 3K9OB 4DXFA 3L0WB 2J0KA 1T3QA 3L08A 3FKYA 5HI1A 1WGGA 3VRAB 1HZ5A 2JWZA 2WXIA 4TSSA 1KH0A 1NENB 1QOGA 4WJPA 2KD0A 4S17A 2NTSA 1AARA 3EC8A 4HDOA 2VZKB 3AULA 4A20A 1WMHA 4OW0A 1GAQB 3H1UA 3N9YC 3UGBB 2N4FA 1E8ZA 4TKNA 2BF8B 1R7SA 1ZDXA 4XX5A 3AEGB 3N1YC 3ZNHB 2KDEB 3NZUA 4DXAB 3NS1A 4XDDA 1T0QC 2L1AA 2EMSA 2JUOA 1E5WA 2K9XA 3A9KA 3ENEA 2GMIC 3TMPB 2KMAA 3SD5A 4MM3A 3ZQ4A 1EF5A 2KX0A 4ZRJA 2V4LA 1V97A 3V61A 3UIPB 1SE9A 3WAMA 2KX3A 1WM3A 2KDFB 4ANUA 1VCBA 1ZKHA 1ET6A 2BYFA 3H8HA 3I9V1 3I57A 1WX8A 4DDID 1YD8U 5HHDG 2AL6A 1N62A 3A9JB 2DYBA 5AZFA 3TEZA 2FCSA 3CSFA 4M0WB 4NAMA 1I7HA 3W2DA 1K53A 4S0RA 1OQYA 1VZ8A 2D10A 1WIAA 4E74A 4TMAB 3QIJA 4RM9A 3NVVA 5E6OA 2JQRB 1XLPA 3GZNB 3HIZA 5E6PA 4MGYE 4WH4A 3X0WA 1K8RB 1JW9D 1ZDVA 3V3XA 4GLSC 3P4PB 1L2NA 2OJWA 3OLMD 2M0XA 4N6EB 1YJIA 3ZDTA 1MHXA 4DWFA 1UGJA 4BZAA 1JROA 4KZCA 1Q0WB 3KYCD 1L0VB 4JIOU 5LLIA 2SEBD 3VTWA 1FNUA 1XXGA 2M1MA 1D4BA 3W1SA 5TSSA 2HTME 3AE7B 2CHZA 2NPTB 1SBBB 1T0RC 4AWJA 1SJHD 2FNJB 1NI3A 2Y5PA 2GBKA 3NHEB 2IO0B 3DBHI 2MBQA 2GRIA 4WWOA 1WZ3A 1E10A 1V86A 4OZCA 3T3NA 4ZDVA 4E71A 1TKEA 2KANA 2K0PA 1I42A 3Q8FA 1TIFA 4OHJA 1J7CA 2H89B 4B95A 2E3TA 2RR9A 1KFYB 2K22A 2AQ3B 1QOFA 3EFCA 4NAWB 3H6NA 2X8XX 2WXHA 2UYZB 3ZYYX 4P7IA 2DAJA 2KC1A 3W1YA 1T6BX 5AZGA 4W9HA 1GPXA 2ZZPB 3SHQA 4ZHOA 1Q1OA 2KJHB 2WP9B 4NNJB 2Y3AA 3RNBC 4IM0A 2XNAC 1L0YB 2UWQA 1EM7A 3PHWB 4RGNA 4XZ4A 1WJ4A 1K51A 2HE7A 2N0SB 1HA5A 3EGRA 3IT6B 4PS7A 5CX3A 1EU4A 3BYYB 4PYUA 1SXTA 1UELA 4FJYA 1RLFA 4A8XC 5D3IB 2C7HA 3L4PA 2NVUI 3Q8BA 2LGYA 2W9NA 2Z8LA 2FCMA 2KZRA 4A55A 2SAKA 2N9KA 3DHIC 1NEKB 4US9A 3ZNZB 4BAXA 1WE7A 5JHBA 3DVNU 5D6JB 2BWES 4Q2JA 2ICIA 3HHMA 2L0TA 1WE6A 2QEJC 2KFKA 1JALA 1TS4A 2HDEA 2OHFA 5CTRC 3P42A 2OOBB 2LI5A 2YEPB 2WNMA 3N30A 3WAOA 4PS3A 2DZKA 4HPMB 4B0EA 4KX6B 2K3UA 4L23A 3TCAA 4BKSD 2IDYA 1L6VA 3ETRA 5EE3A 2W55A 4HJKA 1BUIC 2DWQA 2IJ0A 3N1XC 3SU8X 1C4PA 5E6JA 4L1BA 1PFDA 4HKZE 4WWMA 3U7DA 1WWTA 1WXVA 2KNBA 3Q8CA 1P1AA 1D5MC 1STEA 3BK1A 3NVWA 1OEYA 4FBJB 4IM3A 2INPE 1SE3A 2MP2A 4I6PA 1GC7A 3UIOB 2ZW0A 4HWIB 4ICUA 2PJHA 1JWUD 2XEWA 1EF1A 2IY1B 2JWUA 5L83A 2EELA 3AE6B 4JWUC 2LGIA 1VD2A 4FJZA 2JY6A 1IP9A 2DAFA 2V3SA 1N5WA 2XBBC 3K9PB 2WGSA 3HVDA 2LZ6A 1QQRA 1JMLA 1Q5WB 2KHWB 4KGRA 2IO2B 1FEHA 3ONSA 4TQ1A 4IC7B 1ZGUB 4C80A 2LRUA 3TJPA 1BMLC 3U4EG 1ZOYB 5DPRA 1WJUA 3P4SB 1MFWA 1UF0A 4EOYA 1Q10A 2LUMA 1YNTE 4HEA1 3C0RB 3ZNGC 5EE0A 3HVZA 3HK0A 2LGDA 2MJDA 4A90A 3HUIA 2FUHB 1YN4A 5KHOA 2LMCA 4FADA 1JWBD 2M4NA 1I4GA 2K8BA 1F0ZA 1I4XA 3BWUD 1C77A 4IDIA 2GBNA 2AQ2B 2ACZB 2IY0B 1MI0A 2O6VD 1VLBA 3VUXA 2NMQA 2BB5A 3SEBA 1F9JA 1P7EA 3APDA 1R4NI 3BZDB 3OAWA 5D2MB 1SJED 2DENB 4KKJA 1D5XC 2RGFA 1TBEA 3HM3A 5FR3A 2ONQA 2LUEA 4GSWA 2M56B 4M02A 1N63A 5D94A 2KACA 4MH8A 2MJ3A 4ZRPA 3IVFA 4JGHB 3NVZA 2K39A 4LNNA 1F2RI 5IP4D 1V5OA 2BVCA 5AEKB 1IBXB 3AE4B 2L83A 2BKRB 3DBRB 3AH7A 4MACA 2ON8A 4RGOS 3ECIA 1KF6B 2WQYB 4KDLB 5CHWA 4YXDB 3CMMB 4W9JA 1E6EB 2WDVB 5IO9A 1OFFA 4DHJD 4BBNF 3MFGA 2H88B 4KZ0A 1M4VA 5CHVC 1A5RA 3PREA 3L54A 2L32A 1L6UA 2VRRB 1FIQA 2AX5A 2CHXA 1RWSA 3W9CB 1C78A 3MHSD 3WANA 5C23A 2K6DB 4LJPB 2Y5BB 4MT5A 4JX1C 1N60A 2FIDA 4DK5A 3PGEA 1TS3A 1KLVA 5DPWA 4FHKA 3PO0A 5HG2A 4P6VF 1F1HA 4K7SA 4LDTD 5TR5A 2LD9A 2LFIA 2FBWB 3GE3C 1GB1A 1FFVA 1XLNA 2Z0DB 2MX2A 3R2TA 5FR6A 3AV8A 3B1LX 4HPLB 1FNWA 4LNFA 4KDIC 1FXIA 5JZEB 2G45B 2QCZA 4RMAA 1WXAA 3AB5A 3DDCB 1MG4A 5G5GA 2ZVOA 3PSEB 3ZIMA 2AQ1B 2DZIA 1BT0A 3N32A 2D07B 3HM6X 4ANXA 2L76A 4DDGD 4RNAA 2KWVB 1LO5D 4OVUA 4HKQA 3DWGC 2J42A 2DLBA 4R3DA 1N61A 3DHGC 3OWEB 2BYTA 3M62B 3UF8A 3MTNB 3P2BA 1GUAB 3FILB 2QDFA 2K8CA 2ZEQA 4DBGA 2AYOB 1G6JA 2J7QB 4RF1A 5CHFA 2M8SA 2PE9A 3VR9B 2LWPA 1GB4A 2LVPA 2LHDA 3V62A 2QHOA 2W3RA 1HEZE 2NTTA 3RFZB 2DYOA 4W9KA 4C7ZA 2LVQA 3P4RB 2O2VA 1I4PA 5AZHA 2QSDA 4FHJA 1V6EA 2QJLA 3C19A 2DNFA 5BMGA 4AQ7A 1NDDA 4MJSA 3T3OA 2IZVB 2FCQA 2MP2B 1YQ4B 3MP9A 2KDIA 3U2SC 1PGXA 1HXYD 3A33B 1ZXIA 3GP7A 1V49A 2VH1A 2CS4A 3W5VB 5IKCM 3WCQA 3B2FA 1TKGA 1WRIA 2N9XA 3WAPA 4XDCA 2BKFA 1KLUD 1C3TA 5C1ZA 4M01A 3VFKA 3RI7C 2DYMA 3C8YA 4M8NA 3A1QA 1D5ZC 3TSSA 3EA6A 3OJ4B 5C3JB 2ZPNA 3KUZA 1P0RA 3IT4B 2KN5A 3NG0A 1YN3A 3AEEB 3URYA 2D3AA 3BY4B 4LK0M 1LM8B 2RD0A 5GMVA 3VQIA 1FO4A 4WAAA 2NS5A 3NY5A 3AECB 3EUB2 3AEFB 2MCNB 4WJQA 2MBEA 3VR8B 4WWPA 5BYSA 4IG7B 2PIAA 3RZFA 1IYFA 2NR2A 2N7JA 2D3CA 2KTFA 1E0ZA 4LNOA 2V3NA 3VH4B 2KO3A 3DOWA 1UD7A 1OQQA 2WLBA 2MW5A 2M0AA 3DBHB 3EFUA 4WAFA 3S2AA 4HCPB 3PRPB 3QARA 3PZDA 2LJ5A 1V2YA 4BKGA 4H2AA 5IAAC 3FC4A 4O1NA 1DOYA 2DZJA 3TL5A 2JX5A 1XQQA 2G4DB 4A6QA 1SB3C 4HPPA 3VDZA 3OG5A 2HJ1A 1TTNA 1C4AA 1CMXB 4IM2A 4EFOA 1ZE3D 4IWPA 2WU5B 4BVUC 4XWWA 4WQMA 2CR5A 4PYZA 2ZNVB 3MJ5A 1HE8A 4FN2A 2XK5B 1PGBA 1R4MI 4G50A 1Y56A 3NZ3A 3DWMA 5KHQA 1QOBA 4GDLB 1YMHE 3LB8C 2J0JA 5LXIB 3GB1A 2AL3A 5BYQA 3IHPC 2GI9A 1S1QB 3H7PA 1ISNA 1JCKB 2K5PA 1D6EC 1GC6A 3UQAA 3LXFA 1S3SG 3RNAC 2OEDA 1XF5L 4JLCA 4BFRA 3PTFC 1E8WA 2WXPA 2VH2A 4GGQA 2NBWB 2ZCBA 5J18A 4ZHPA 1VRAB 3PHXB 4XWTA 3ZUNA 3APFA 1KOTA 2ZNVC 3KVFB 1WGRA 3JVZX 4AOFA 3QWZB 2WXNA 4M8MA 3M3JA 3RULA 5IA7A 1WR1A 4CQNA 1WGHA 3IBEA 1HZ6A 2B3AA 1AYFA 1LXDA 1DOIA 1GJZA 1TYGB 1RRBA 1TZ1A 3QA8A 2JXXA 3V60A 2ASQA 2LASA 2RMMA 5BYRA 2K6QA 3VAWA 2HTHA 2JF5A 3PRMB 1E8YA 1TT5B 1F52A 3U52E 4FA6A 3ZTDA 3KUCB 3NJTA 3I3TB 3PVLA 3OJ3A 1NI2A 4C56C 1WFYA 3PT2B 3QK0A 4A3OA 2O6VB 2KMCA 2Y5CA 1WJ6A 1I4HA 1QOAA 1VZ6A 1WYWB 2C9WB 2GLSA 4GDKB 2ZW1A 1FD6A 2MBHA 1YJ1A 1K52A 2V3PA 2N1WA 3RYTA 5GXGB 4NJ6A 3Q3FA 4ZYSA 3R2IA 3R3MA 2KVRA 5G55A 1OEYJ 1IGDA 2WXFA 1H4RA 3I63C 2L0FA 4PT5A 3TEXA 3JSVA 3M63B 1NYQA 3QQ8B 3GS2A 3RPFC 1WMHB 3BVMA 1P9DU 1FRDA 1L5PA 3RUIB 1WX7A 2KLGA 3AE1B 4K7UA 4E3CA 5FKAC 3BVZA 4IWQA 1WJNA 2LXCA 3UI3A 2O2VB 2KKCA 3Q3MC 4PK1A 2HJ8A 2J4XA 4DHJB 2BT6A 4IW0A 2JT4B 2R61A 4MJSB 1SE2A 2JPHA 3A9KB 4MM3B 4URKA 4KIKA 2MQJA 4RH6A 3JYUA 2N7EA 3BVGA 1U4AA 2G4SA 4KV2A 3Q6BA 1ENFA 2YVCA 2IGHA 4ICVA 1LFDA 2KYWA 1ROEA 1WH3A 2L52A 3AI5A 5IOIA 3ZO5B 4LDTB 4B9KA 4J6IA 3DBLB 1TY0A 1Y8RC 3Q8AA 3HRDD 4GMVA 4QAYA 2M19A 1HTQA 4LNIA 3N3KB 4A3PA 4ACFA 2PLPA 3KQ4A 3PPAA 3SFEB 2KWCA 4GB9A 4IOIE 3TBLD 3X23A 1Z5SB 1C9FA 3NOBA 2D5GA 2BB6A 3LJ3A 1IUEA 4KSKC 2MEKA 2WDQB 1ZUD2 2JZZA 4TQ0A 5D7GA 3AEDB 3DQVA 3KUDB 4WWNA 4YTPB 3MC0B 3RMKC 3RZWC 2A5UA 2WXQA 1UBIA 4C00A 1YOVB 1QLBB 1EWCA 2JYEA 1JQ4A 2HD5B 4II3B 2AWTA 4EZJA 2NPTA 3ZNID 1H8CA 4DXGA 2FCNA 2KWUB 3ML9A 4OVVA 2R2OA 2E6XA 2V1YA 4EE2A 2KQSA 2KVZA 2J0MA 1UNSA 3L10B 3Q14C 3BIID 3KW5B 5BMHA 2L3ZA 4ZRIA 3QAQA 3AEBB 4BOSC 2REXA 1UZXB 2JSVX 1XEEA 2MRPA 1WF9A 2JZ3B 4AJYB 1F2RC 2WDRB 1XCQL 2LXAA 3AM9A 1J0GA 2KT7A 4K81A 1TS5A 3B0AA 3W1SC 5DCNA 4NAWA 3TEWA 3QCAA 1WRDB 1WZ0A 3DBSA 4DHZB 1RFKA 1HQRD 1FM0D 4C4VA 1CK1A 3O65B 2KMMA 2KWDA 4W9FA 2PMVA 2QIEB 1L4DB 2PW9A 1QT9A 4F1SA 3EHVA 1AN8A 5LNK1 4YSYB 1DOXA 4WJNA 2I1JA 1TZOA 2LRWA 2CKHB 4KVGB 2RPVA 4P16A 2KC2A 1YX6B 2PVOD 4GXBA 1TY2A 1GNUA
chains in the Genus database with same CATH topology
3VQIA 3DCGA 4ASWC 4PS7A 4WAAA 5CX3A 1UH6A 1Z2MA 4MELA 4ZRKA 2NS5A 2NCNA 3NY5A 2AEHA 3R66C 4PYUA 3DPDA 2L7RA 1UELA 3PLUA 1J19A 2GBJA 3PS6A 2MCNB 4FJYA 4WJQA 4W9CA 4NY0A 2MBEA 4WWPA 4IG7B 1RLFA 4GOCA 1WR6E 3RZFA 2C60A 1WXMA 2C7HA 2NVUI 2LGYA 4HDQA 4DHZE 2W9NA 2FCMA 2IO3B 2KZRA 4W9DA 2NR2A 3ZKJC 3EECA 3RCZA 3WIMA 1IYFA 4ANWA 4TV3A 2GBRA 2G3QB 2KTFA 2MA9B 3ZDMC 3H7SA 1V81A 2IBIB 3ZNZB 4CHKA 4K7WA 3VH4B 1WE7A 2KO3A 3DOWA 3VH3B 5JHBA 2KTRA 1UD7A 3DVNU 1XT9B 5D6JB 2MW5A 2BWES 3DBLI 4AJWA 3HHMA 2L0TA 3ALBA 3EFUA 4WJOA 1WGYA 3S2AA 2WWZA 1WE6A 4HCPB 2KFKA 2KFKB 2A4ZA 4KSLC 2GBMA 3PRPB 3VTVA 3QARA 3R7RA 2WX0A 5CTRC 2KJRA 3PZDA 2LJ5A 2FAZA 3KYDD 1V2YA 4BKGA 5IAAC 2OOBB 2DZJA 4HXDA 3TL5A 3MJWA 2LI5A 1KM7A 1XQQA 2G4DB 3VDZA 4BKSA 5J2RA 3N30A 4BKTA 3WAOA 4PS3A 1WI0A 4MSQB 2DZKA 3DVGX 4HPMB 1TTNA 1WM2A 1XD3B 3TCAA 3QHTA 2DHZA 1CMXB 4IM2A 4BKSD 5J17A 3PLVA 4HJKA 4HK2A 4IWPA 4MGZE 4EFOA 3SU8X 4BVUC 5E6NA 3JSVB 2KOXA 5JH5C 2CR5A 4PYZA 2ZNVB 2WX1A 1HE8A 2K25A 4I6NB 4FN2A 3U7DA 2KNBA 1WXVA 1R4MI 2JRIB 2MBOA 2XK5A 2XK5B 3M95A 1UGMA 1P1AA 1V5TA 1WXSA 2KXJA 3UQBA 4G50A 1WX9A 2ZVNA 1OEYA 1P3QU 4FBJB 4IM3A 3A4SC 5KHQA 2YLMA 2MP2A 4GDLA 4GDLB 4I6PA 4X57B 1GC7A 4EZKA 1E7UA 3UIOB 2J0JA 5LXIB 4HWIB 4ICUA 2AL3A 2PJHA 3ZLZA 3IHPC 2L00B 2XEWA 4MEMA 4BOZB 1EF1A 1J8CA 2FIFA 2DZMA 3ZTCA 1SGHA 1V80A 1S1QB 2IY1B 3H7PA 3H7PB 2DX5B 3RD2A 3D32A 2BPSA 1ISNA 2LVOA 2RSUA 1GC6A 1C1YB 3UQAA 1I35A 1S3SG 1L7YA 5L83A 1KJTA 4JLCA 4AP4C 1IPGA 1VD2A 3PTFC 4FJVB 4FJZA 3VHTC 4BFRA 1E8WA 2JY6A 4W9EA 1IP9A 2DAFA 1D3ZA 1RAXA 2V3SA 3DVNV 4GGQA 2NBWB 2CU1A 2ZCBA 5J18A 2XBBC 3NZSA 3PHXB 1MG8A 3K9PB 3PRZA 2K1FA 2LZ6A 4NPNA 3APFA 3ZUNA 2Z0EB 2C7NB 3BINA 4F8CB 4KIKB 1RFAA 4TUUA 1Q5WB 2KHWB 3B08A 2JVCA 3DBRI 4GIVA 4NQLB 3ZRFA 4HVBA 1KOTA 2LGXA 2ZNVC 3KVFB 4MGIE 1WGRA 2IO2B 3JVZX 1FXTB 3AU4A 4AOFA 2RPQA 3QWZB 2IYDB 3CF6E 3ONSA 4M8MA 4W9LA 3M3JA 3QJZA 4IC7B 2BGFA 1WGDA 4TQ1A 3RULA 1WR1A 5IA7A 1WGHA 1ZGUB 3IBEA 4IWOA 2LRUA 1E8XA 2B3AA 2MSED 3TJPA 4G3XB 3ZRCA 1LXDA 2NBVB 2Z59B 1EO6A 1GJZA 3IFWB 1RRBA 4LJOB 1TZ1A 5DPRA 3QA8A 2JXXA 1WJUA 3JW0X 3V60A 2PE6B 2ASQA 2LASA 3WALA 2C7MB 3PV1A 2K6QA 3VAWA 3VTUA 4EOYA 4EUTA 2HTHA 5HKHA 2KDBA 2JF5A 3C0RB 3PRMB 1E8YA 3ZNGC 4FULA 2MWSB 3HK0A 3RT3B 2LGDA 2FUHB 2R2QA 4FA6A 5KHOA 1E90A 4NQKE 4FADA 4YL8A 3ZTDA 3CSTA 3KUCB 2M4NA 3I3TB 3OJ3A 1P98A 2K8BA 2N9EB 1NI2A 3PVLA 1WFYA 3PT2B 1NBFC 2OJRA 3QK0A 4G11A 5DPTA 4A3OA 2GBNA 4WQOB 5LXHA 2O6VA 2O6VB 3NS8A 2IY0B 2KMCA 1OGWA 1WJ6A 4GDKA 4GDKB 2C9WB 1WYWB 4HCNB 3L17A 2MBHA 2O6VD 3VUXA 1YJ1A 4MGKE 1X1MA 1F9JA 3APDA 2L05A 1R4NI 2N1WA 3OAWA 5D2MB 3RYTA 4AUQC 3ZW3A 2EMTA 1GG3A 2BYEA 1V9JA 2DENB 4NJ6A 3K9OB 3Q3FA 3VUYA 3L0WB 2J0KA 3R3MA 3V6EB 3IG3A 2M17A 3L08A 2RGFA 3GZNI 2KVRA 1TBEA 5G55A 3HM3A 4NJ7A 1WGGA 1OTRB 1OEYJ 2JWZA 4RM8A 4WJPA 1H4RA 2KD0A 2L0FA 2KJ6A 2LUEA 3JSVA 1AARA 3M63B 3EC8A 3QQ8B 4GSWA 2BWFA 4HDOA 3AULA 4A20A 1WMHA 1WMHB 5D94A 1P9DU 3IVFA 4JGHB 1YQBA 2K39A 3RUIB 1WX7A 2KLGA 3H1UA 4K7UA 1V5OA 3UGBB 2N4FA 1E8ZA 1E7VA 4TKNA 4E3CA 3Q3JA 5AEKB 1WY8A 2N9PC 4IWQA 1WJNA 2LXCA 2BF8B 2O2VB 4XX5A 2BKRB 2KKCA 4PS8A 3ZNHB 2KDEB 2ZJDA 3NZUA 5L95C 2HJ8A 3ECIA 4DXAB 4DHJB 4KDLB 5CHWA 2C5LC 3CMMB 4W9JA 4IW0A 4CO7A 2JT4B 4DHJD 2EMSA 4MJSB 4BBNF 3A4RA 2JPHA 2JUOA 1TGZB 4KZ0A 5CHVC 1A5RA 1E5WA 3A9KA 3A9KB 3PREA 3ENEA 2GMIC 3TMPB 2KMAA 3L54A 2VRRB 3SD5A 4MM3A 1EF5A 2KX0A 4ZRJA 2V4LA 4URKA 3V61A 3UIPB 4BBNC 4KIKA 2CHXA 2MQJA 1SE9A 3JYUA 2N7EA 1U4AA 2KX3A 1WM3A 2G4SA 2PPHA 2KQ7A 2KDFB 3MHSD 4KV2A 3WAMA 3WANA 4ANUA 1T0YA 2YVCA 1VCBA 5C23A 2K6DB 2K8HA 1ZKHA 4ICVA 4LJPB 1JRUA 2Y5BB 1LFDA 2BYFA 4F7ZA 4MH0E 2FIDA 1WH3A 2WDTB 3AI5A 4DK5A 3PGEA 1KLVA 5DPWA 4FHKA 1WX8A 3ZO5B 4DDID 1YD8U 5EDSA 4LDTB 2JRHA 2I1KA 4B9KA 4J6IA 3ML8A 4K1RB 2AL6A 4K7SA 3A9JB 4LDTD 2KK8A 2N7DA 5TR5A 2DYBA 2LD9A 5AZFA 2FCSA 3CSFA 4M0WB 1Y8RC 4ZYNA 2ZCCA 4GMVA 2D3GA 3T8MA 2Z0DB 2MX2A 5FR6A 1OQYA 3B1LX 2D10A 1WIAA 3N3KB 4HPLB 3U30A 4A3PA 4E74A 3AU5A 3QIJA 4RM9A 4KDIC 1EUVB 5E6OA 2G45B 3WA0A 5JZEB 4RMAA 3V6CB 1WXAA 3DDCB 3PPAA 2KWCA 4GB9A 3TBLD 3X23A 2ZVOA 5JHAA 3PSEB 3QC8B 3ZIMA 3HIZA 4JL9A 4MGYE 5E6PA 2DZIA 1K8RB 4MDKE 3X0WA 1BT0A 3N32A 2D07B 3HM6X 1Z5SB 3NOBA 4ANXA 2L76A 4DDGD 1L2NA 3LJ3A 3VUWA 4KSKC 3T9LA 3DVGY 2KWVB 2CHWA 4OVUA 3OLMD 2M0XA 4CYEA 4IUMB 3GOEA 3ZDTA 4N9F4 4DWFA 1ZW7A 2JZZA 3AXCA 4TQ0A 2MLBA 5D7GA 2EKEC 3DQVA 3KUDB 4G0NB 4WWNA 5DPSA 2ZPYA 1Q0WB 2KTRB 4KZCA 3RZWC 2A5UA 3KYCD 1QZEA 3VXWA 3M62B 4JIOU 3UF8A 1UBIA 1LQBA 4W9IA 5LLIA 3VTWA 3VVWB 3MTNB 2M1MA 3P2BA 1GUAB 3W1SA 2K8CA 2ZEQA 4DBGA 5BO4B 2AYOB 2HD5B 2N1VA 2AWTA 2CHZA 4II3B 1G6JA 2J7QB 2NPTA 2NPTB 3ZNID 3R7QA 4EZJA 1H8CA 1M94A 2FCNA 4AWJA 2KWUB 5CHFA 1YIWA 3ML9A 2R2OA 2MBBB 2M8SA 4OVVA 4B6WA 2FNJB 2PE9A 2V1YA 2LWPA 2KFJA 2LVPA 4JQWC 2KQSA 3V62A 2QHOA 2GBKA 1YX5B 2J0MA 3NHEB 3L10B 2DYOA 4II2B 4W9KA 2LVQA 2WYQA 2BYVE 2IO0B 3DBHI 2MBQA 3KW5B 3LDZE 4WWOA 1WZ3A 2O2VA 2L3ZA 1V86A 4ZRIA 3QAQA 3ZVVA 4BOSC 5AZHA 4FHJA 4ZDVA 2REXA 4E71A 1UZXB 2KANA 2MRPA 1UBQA 1V6EA 1I42A 1WF9A 2JZ3B 1SIFA 4XC2A 4ANVA 3H9DA 1NDDA 4HLEA 4AJYB 4MJSA 4EKUA 4B95A 2IZVB 2RR9A 2FCQA 2LXAA 2MP2B 2KDIA 3L13A 2L8JA 3QX1A 1J0GA 4K81A 3A33B 3B0AA 3W1SC 4LCDE 3TIXA 2KLCA 5DCNA 4NAWA 4NAWB 1V49A 3H6NA 4W9GA 2IO1B 3QCAA 2CS4A 3U8ZA 1WRDB 2UYZB 4P7IA 4MSMB 2DAJA 2KC1A 2N9XA 3WAPA 1WZ0A 2D2QA 3DBSA 4GN1A 2BKFA 3W1YA 4DHZB 3L16A 1C3TA 5AZGA 5C1ZA 4W9HA 3VFKA 3O65B 2ZZPB 4W9FA 3SHQA 4FLHA 1Q1OA 2DYMA 2PEAA 2KJHB 3A1QA 3A1QB 4M8NA 4NNJB 3SDLC 4IM0A 4F1SA 3EHVA 3OJ4B 5G2NA 3A9JA 3UINB 2NBUA 2UWQA 2ZPNA 4EZLA 3KUZA 1P0RA 2KN5A 4WJNA 2I1JA 3PHWB 1PQSA 2LRWA 4I6LB 2CKHB 2D11A 3APCA 4KVGB 4GU2A 4EEWA 4XZ4A 1WJ4A 1YX6B 2KC2A 3KH0A 2GOWA 2HE7A 3BY4B 4GXBA 1LM8B 2RD0A 1GNUA 5GMVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VQI A;  3DCG A;  4ASW C;  4PS7 A;  4WAA A;  5CX3 A;  1UH6 A;  1Z2M A;  4MEL A;  4ZRK A;  2NS5 A;  2NCN A;  3NY5 A;  2AEH A;  3R66 C;  4PYU A;  3DPD A;  2L7R A;  1UEL A;  3PLU A;  1J19 A;  2GBJ A;  3PS6 A;  2MCN B;  4FJY A;  4WJQ A;  4W9C A;  4NY0 A;  2MBE A;  4WWP A;  4IG7 B;  1RLF A;  4GOC A;  1WR6 E;  3RZF A;  2C60 A;  1WXM A;  2C7H A;  2NVU I;  2LGY A;  4HDQ A;  4DHZ E;  2W9N A;  2FCM A;  2IO3 B;  2KZR A;  4W9D A;  2NR2 A;  3ZKJ C;  3EEC A;  3RCZ A;  3WIM A;  1IYF A;  4ANW A;  4TV3 A;  2GBR A;  2G3Q B;  2KTF A;  2MA9 B;  3ZDM C;  3H7S A;  1V81 A;  2IBI B;  3ZNZ B;  4CHK A;  4K7W A;  3VH4 B;  1WE7 A;  2KO3 A;  3DOW A;  3VH3 B;  5JHB A;  2KTR A;  1UD7 A;  3DVN U;  1XT9 B;  5D6J B;  2MW5 A;  2BWE S;  3DBL I;  4AJW A;  3HHM A;  2L0T A;  3ALB A;  3EFU A;  4WJO A;  1WGY A;  3S2A A;  2WWZ A;  1WE6 A;  4HCP B;  2KFK A;  2KFK B;  2A4Z A;  4KSL C;  2GBM A;  3PRP B;  3VTV A;  3QAR A;  3R7R A;  2WX0 A;  5CTR C;  2KJR A;  3PZD A;  2LJ5 A;  2FAZ A;  3KYD D;  1V2Y A;  4BKG A;  5IAA C;  2OOB B;  2DZJ A;  4HXD A;  3TL5 A;  3MJW A;  2LI5 A;  1KM7 A;  1XQQ A;  2G4D B;  3VDZ A;  4BKS A;  5J2R A;  3N30 A;  4BKT A;  3WAO A;  4PS3 A;  1WI0 A;  4MSQ B;  2DZK A;  3DVG X;  4HPM B;  1TTN A;  1WM2 A;  1XD3 B;  3TCA A;  3QHT A;  2DHZ A;  1CMX B;  4IM2 A;  4BKS D;  5J17 A;  3PLV A;  4HJK A;  4HK2 A;  4IWP A;  4MGZ E;  4EFO A;  3SU8 X;  4BVU C;  5E6N A;  3JSV B;  2KOX A;  5JH5 C;  2CR5 A;  4PYZ A;  2ZNV B;  2WX1 A;  1HE8 A;  2K25 A;  4I6N B;  4FN2 A;  3U7D A;  2KNB A;  1WXV A;  1R4M I;  2JRI B;  2MBO A;  2XK5 A;  2XK5 B;  3M95 A;  1UGM A;  1P1A A;  1V5T A;  1WXS A;  2KXJ A;  3UQB A;  4G50 A;  1WX9 A;  2ZVN A;  1OEY A;  1P3Q U;  4FBJ B;  4IM3 A;  3A4S C;  5KHQ A;  2YLM A;  2MP2 A;  4GDL A;  4GDL B;  4I6P A;  4X57 B;  1GC7 A;  4EZK A;  1E7U A;  3UIO B;  2J0J A;  5LXI B;  4HWI B;  4ICU A;  2AL3 A;  2PJH A;  3ZLZ A;  3IHP C;  2L00 B;  2XEW A;  4MEM A;  4BOZ B;  1EF1 A;  1J8C A;  2FIF A;  2DZM A;  3ZTC A;  1SGH A;  1V80 A;  1S1Q B;  2IY1 B;  3H7P A;  3H7P B;  2DX5 B;  3RD2 A;  3D32 A;  2BPS A;  1ISN A;  2LVO A;  2RSU A;  1GC6 A;  1C1Y B;  3UQA A;  1I35 A;  1S3S G;  1L7Y A;  5L83 A;  1KJT A;  4JLC A;  4AP4 C;  1IPG A;  1VD2 A;  3PTF C;  4FJV B;  4FJZ A;  3VHT C;  4BFR A;  1E8W A;  2JY6 A;  4W9E A;  1IP9 A;  2DAF A;  1D3Z A;  1RAX A;  2V3S A;  3DVN V;  4GGQ A;  2NBW B;  2CU1 A;  2ZCB A;  5J18 A;  2XBB C;  3NZS A;  3PHX B;  1MG8 A;  3K9P B;  3PRZ A;  2K1F A;  2LZ6 A;  4NPN A;  3APF A;  3ZUN A;  2Z0E B;  2C7N B;  3BIN A;  4F8C B;  4KIK B;  1RFA A;  4TUU A;  1Q5W B;  2KHW B;  3B08 A;  2JVC A;  3DBR I;  4GIV A;  4NQL B;  3ZRF A;  4HVB A;  1KOT A;  2LGX A;  2ZNV C;  3KVF B;  4MGI E;  1WGR A;  2IO2 B;  3JVZ X;  1FXT B;  3AU4 A;  4AOF A;  2RPQ A;  3QWZ B;  2IYD B;  3CF6 E;  3ONS A;  4M8M A;  4W9L A;  3M3J A;  3QJZ A;  4IC7 B;  2BGF A;  1WGD A;  4TQ1 A;  3RUL A;  1WR1 A;  5IA7 A;  1WGH A;  1ZGU B;  3IBE A;  4IWO A;  2LRU A;  1E8X A;  2B3A A;  2MSE D;  3TJP A;  4G3X B;  3ZRC A;  1LXD A;  2NBV B;  2Z59 B;  1EO6 A;  1GJZ A;  3IFW B;  1RRB A;  4LJO B;  1TZ1 A;  5DPR A;  3QA8 A;  2JXX A;  1WJU A;  3JW0 X;  3V60 A;  2PE6 B;  2ASQ A;  2LAS A;  3WAL A;  2C7M B;  3PV1 A;  2K6Q A;  3VAW A;  3VTU A;  4EOY A;  4EUT A;  2HTH A;  5HKH A;  2KDB A;  2JF5 A;  3C0R B;  3PRM B;  1E8Y A;  3ZNG C;  4FUL A;  2MWS B;  3HK0 A;  3RT3 B;  2LGD A;  2FUH B;  2R2Q A;  4FA6 A;  5KHO A;  1E90 A;  4NQK E;  4FAD A;  4YL8 A;  3ZTD A;  3CST A;  3KUC B;  2M4N A;  3I3T B;  3OJ3 A;  1P98 A;  2K8B A;  2N9E B;  1NI2 A;  3PVL A;  1WFY A;  3PT2 B;  1NBF C;  2OJR A;  3QK0 A;  4G11 A;  5DPT A;  4A3O A;  2GBN A;  4WQO B;  5LXH A;  2O6V A;  2O6V B;  3NS8 A;  2IY0 B;  2KMC A;  1OGW A;  1WJ6 A;  4GDK A;  4GDK B;  2C9W B;  1WYW B;  4HCN B;  3L17 A;  2MBH A;  2O6V D;  3VUX A;  1YJ1 A;  4MGK E;  1X1M A;  1F9J A;  3APD A;  2L05 A;  1R4N I;  2N1W A;  3OAW A;  5D2M B;  3RYT A;  4AUQ C;  3ZW3 A;  2EMT A;  1GG3 A;  2BYE A;  1V9J A;  2DEN B;  4NJ6 A;  3K9O B;  3Q3F A;  3VUY A;  3L0W B;  2J0K A;  3R3M A;  3V6E B;  3IG3 A;  2M17 A;  3L08 A;  2RGF A;  3GZN I;  2KVR A;  1TBE A;  5G55 A;  3HM3 A;  4NJ7 A;  1WGG A;  1OTR B;  1OEY J;  2JWZ A;  4RM8 A;  4WJP A;  1H4R A;  2KD0 A;  2L0F A;  2KJ6 A;  2LUE A;  3JSV A;  1AAR A;  3M63 B;  3EC8 A;  3QQ8 B;  4GSW A;  2BWF A;  4HDO A;  3AUL A;  4A20 A;  1WMH A;  1WMH B;  5D94 A;  1P9D U;  3IVF A;  4JGH B;  1YQB A;  2K39 A;  3RUI B;  1WX7 A;  2KLG A;  3H1U A;  4K7U A;  1V5O A;  3UGB B;  2N4F A;  1E8Z A;  1E7V A;  4TKN A;  4E3C A;  3Q3J A;  5AEK B;  1WY8 A;  2N9P C;  4IWQ A;  1WJN A;  2LXC A;  2BF8 B;  2O2V B;  4XX5 A;  2BKR B;  2KKC A;  4PS8 A;  3ZNH B;  2KDE B;  2ZJD A;  3NZU A;  5L95 C;  2HJ8 A;  3ECI A;  4DXA B;  4DHJ B;  4KDL B;  5CHW A;  2C5L C;  3CMM B;  4W9J A;  4IW0 A;  4CO7 A;  2JT4 B;  4DHJ D;  2EMS A;  4MJS B;  4BBN F;  3A4R A;  2JPH A;  2JUO A;  1TGZ B;  4KZ0 A;  5CHV C;  1A5R A;  1E5W A;  3A9K A;  3A9K B;  3PRE A;  3ENE A;  2GMI C;  3TMP B;  2KMA A;  3L54 A;  2VRR B;  3SD5 A;  4MM3 A;  1EF5 A;  2KX0 A;  4ZRJ A;  2V4L A;  4URK A;  3V61 A;  3UIP B;  4BBN C;  4KIK A;  2CHX A;  2MQJ A;  1SE9 A;  3JYU A;  2N7E A;  1U4A A;  2KX3 A;  1WM3 A;  2G4S A;  2PPH A;  2KQ7 A;  2KDF B;  3MHS D;  4KV2 A;  3WAM A;  3WAN A;  4ANU A;  1T0Y A;  2YVC A;  1VCB A;  5C23 A;  2K6D B;  2K8H A;  1ZKH A;  4ICV A;  4LJP B;  1JRU A;  2Y5B B;  1LFD A;  2BYF A;  4F7Z A;  4MH0 E;  2FID A;  1WH3 A;  2WDT B;  3AI5 A;  4DK5 A;  3PGE A;  1KLV A;  5DPW A;  4FHK A;  1WX8 A;  3ZO5 B;  4DDI D;  1YD8 U;  5EDS A;  4LDT B;  2JRH A;  2I1K A;  4B9K A;  4J6I A;  3ML8 A;  4K1R B;  2AL6 A;  4K7S A;  3A9J B;  4LDT D;  2KK8 A;  2N7D A;  5TR5 A;  2DYB A;  2LD9 A;  5AZF A;  2FCS A;  3CSF A;  4M0W B;  1Y8R C;  4ZYN A;  2ZCC A;  4GMV A;  2D3G A;  3T8M A;  2Z0D B;  2MX2 A;  5FR6 A;  1OQY A;  3B1L X;  2D10 A;  1WIA A;  3N3K B;  4HPL B;  3U30 A;  4A3P A;  4E74 A;  3AU5 A;  3QIJ A;  4RM9 A;  4KDI C;  1EUV B;  5E6O A;  2G45 B;  3WA0 A;  5JZE B;  4RMA A;  3V6C B;  1WXA A;  3DDC B;  3PPA A;  2KWC A;  4GB9 A;  3TBL D;  3X23 A;  2ZVO A;  5JHA A;  3PSE B;  3QC8 B;  3ZIM A;  3HIZ A;  4JL9 A;  4MGY E;  5E6P A;  2DZI A;  1K8R B;  4MDK E;  3X0W A;  1BT0 A;  3N32 A;  2D07 B;  3HM6 X;  1Z5S B;  3NOB A;  4ANX A;  2L76 A;  4DDG D;  1L2N A;  3LJ3 A;  3VUW A;  4KSK C;  3T9L A;  3DVG Y;  2KWV B;  2CHW A;  4OVU A;  3OLM D;  2M0X A;  4CYE A;  4IUM B;  3GOE A;  3ZDT A;  4N9F 4;  4DWF A;  1ZW7 A;  2JZZ A;  3AXC A;  4TQ0 A;  2MLB A;  5D7G A;  2EKE C;  3DQV A;  3KUD B;  4G0N B;  4WWN A;  5DPS A;  2ZPY A;  1Q0W B;  2KTR B;  4KZC A;  3RZW C;  2A5U A;  3KYC D;  1QZE A;  3VXW A;  3M62 B;  4JIO U;  3UF8 A;  1UBI A;  1LQB A;  4W9I A;  5LLI A;  3VTW A;  3VVW B;  3MTN B;  2M1M A;  3P2B A;  1GUA B;  3W1S A;  2K8C A;  2ZEQ A;  4DBG A;  5BO4 B;  2AYO B;  2HD5 B;  2N1V A;  2AWT A;  2CHZ A;  4II3 B;  1G6J A;  2J7Q B;  2NPT A;  2NPT B;  3ZNI D;  3R7Q A;  4EZJ A;  1H8C A;  1M94 A;  2FCN A;  4AWJ A;  2KWU B;  5CHF A;  1YIW A;  3ML9 A;  2R2O A;  2MBB B;  2M8S A;  4OVV A;  4B6W A;  2FNJ B;  2PE9 A;  2V1Y A;  2LWP A;  2KFJ A;  2LVP A;  4JQW C;  2KQS A;  3V62 A;  2QHO A;  2GBK A;  1YX5 B;  2J0M A;  3NHE B;  3L10 B;  2DYO A;  4II2 B;  4W9K A;  2LVQ A;  2WYQ A;  2BYV E;  2IO0 B;  3DBH I;  2MBQ A;  3KW5 B;  3LDZ E;  4WWO A;  1WZ3 A;  2O2V A;  2L3Z A;  1V86 A;  4ZRI A;  3QAQ A;  3ZVV A;  4BOS C;  5AZH A;  4FHJ A;  4ZDV A;  2REX A;  4E71 A;  1UZX B;  2KAN A;  2MRP A;  1UBQ A;  1V6E A;  1I42 A;  1WF9 A;  2JZ3 B;  1SIF A;  4XC2 A;  4ANV A;  3H9D A;  1NDD A;  4HLE A;  4AJY B;  4MJS A;  4EKU A;  4B95 A;  2IZV B;  2RR9 A;  2FCQ A;  2LXA A;  2MP2 B;  2KDI A;  3L13 A;  2L8J A;  3QX1 A;  1J0G A;  4K81 A;  3A33 B;  3B0A A;  3W1S C;  4LCD E;  3TIX A;  2KLC A;  5DCN A;  4NAW A;  4NAW B;  1V49 A;  3H6N A;  4W9G A;  2IO1 B;  3QCA A;  2CS4 A;  3U8Z A;  1WRD B;  2UYZ B;  4P7I A;  4MSM B;  2DAJ A;  2KC1 A;  2N9X A;  3WAP A;  1WZ0 A;  2D2Q A;  3DBS A;  4GN1 A;  2BKF A;  3W1Y A;  4DHZ B;  3L16 A;  1C3T A;  5AZG A;  5C1Z A;  4W9H A;  3VFK A;  3O65 B;  2ZZP B;  4W9F A;  3SHQ A;  4FLH A;  1Q1O A;  2DYM A;  2PEA A;  2KJH B;  3A1Q A;  3A1Q B;  4M8N A;  4NNJ B;  3SDL C;  4IM0 A;  4F1S A;  3EHV A;  3OJ4 B;  5G2N A;  3A9J A;  3UIN B;  2NBU A;  2UWQ A;  2ZPN A;  4EZL A;  3KUZ A;  1P0R A;  2KN5 A;  4WJN A;  2I1J A;  3PHW B;  1PQS A;  2LRW A;  4I6L B;  2CKH B;  2D11 A;  3APC A;  4KVG B;  4GU2 A;  4EEW A;  4XZ4 A;  1WJ4 A;  1YX6 B;  2KC2 A;  3KH0 A;  2GOW A;  2HE7 A;  3BY4 B;  4GXB A;  1LM8 B;  2RD0 A;  1GNU A;  5GMV A; 
#chains in the Genus database with same CATH topology
 4ASW C;  1UH6 A;  4MEL A;  2AEH A;  3R66 C;  3DPD A;  1RYJ A;  3PLU A;  3PS6 A;  1V8C A;  2GBJ A;  4LNK A;  4W9C A;  5EE9 A;  4GOC A;  1SIJ A;  2BW2 A;  2C60 A;  3J9C A;  1FCC C;  1WXM A;  4LTU A;  2MJE A;  1KLG D;  4W9D A;  3RCZ A;  3WIM A;  2V4I B;  2WXO A;  4TV3 A;  2GBR A;  2G3Q B;  3ZDM C;  3H7S A;  1CZP A;  2WXG A;  2WS3 B;  4ZOH C;  4AS1 A;  4K7W A;  1KTK A;  2KTR A;  2KAJ A;  2JXT A;  4FXC A;  1MHH E;  2IGG A;  3ALB A;  1WGY A;  2IND C;  1XCT L;  2KFK B;  2A4Z A;  4KSL C;  2GBM A;  3VTV A;  3R7R A;  2WX0 A;  1ET9 A;  2KJR A;  2FAZ A;  1SE4 A;  5AUI A;  4HXD A;  2FE8 A;  3MJW A;  1T5X D;  4BKT A;  2WXR A;  1WM2 A;  4A9A A;  1XD3 B;  3QHT A;  5J17 A;  3VRB B;  3W5U B;  5E6N A;  3JSV B;  2KOX A;  5JH5 C;  2KDM A;  2WX1 A;  2N9L A;  2K25 A;  2MBO A;  4HRS A;  3M95 A;  1WGK A;  1UGM A;  1UUP A;  2KXJ A;  1VDV A;  4RFB A;  1P3Q U;  4X57 B;  4N59 A;  3ZLZ A;  4MEM A;  4UDU C;  4BOZ B;  2LEK A;  1V1P A;  2PVG C;  3ZTC A;  1SGH A;  2YEP F;  4WUR A;  2DX5 B;  3D32 A;  2BPS A;  2BQQ A;  4JE3 B;  2LVO A;  2RSU A;  3FAH A;  1C1Y B;  1MVK A;  1L7Y A;  2XN9 C;  1IPG A;  3ZJT A;  1RAX A;  2CU1 A;  3R8B A;  1MG8 A;  3PRZ A;  2K1F A;  2BTE A;  2Z0E B;  2C7N B;  4F8C B;  4KIK B;  1RFA A;  4TUU A;  5I4D A;  3B08 A;  4GIV A;  4NQL B;  4HVB A;  4MGI E;  1FXT B;  2RPQ A;  4HJG E;  4KGT A;  2IYD B;  3CF6 E;  2G9H D;  1DGJ A;  4W9L A;  2RDH A;  4J3O D;  1E8X A;  1J7B A;  2NBV B;  1C79 A;  1EO6 A;  2Z59 B;  3V05 A;  3JW0 X;  1QIL A;  3PV1 A;  1YJJ A;  3VTU A;  4EUT A;  2KDB A;  3N1Z C;  3AE2 B;  3AMZ A;  4FUL A;  1MPE A;  4RGM A;  2LHE A;  1F77 A;  4US8 A;  2CJN A;  2R2Q A;  1AWD A;  4NQK E;  4YL8 A;  3ZXR A;  3Q8E A;  3CST A;  2BS4 B;  4G11 A;  3IAS 1;  5LXH A;  3CIR B;  3NS8 A;  1OGW A;  3IAM 1;  3L17 A;  3N20 C;  4MGK E;  1R4M B;  4AUQ C;  4ARI A;  3LYY A;  1V9J A;  3PZ7 A;  3VUY A;  1TJE A;  4XYC A;  5HFY A;  3AE3 B;  3V6E B;  3AE9 B;  3IG3 A;  3ZJU A;  2M17 A;  3Q2A C;  3GZN I;  2W3S A;  1T0S C;  2WXL A;  4NJ7 A;  1E9M A;  3GE8 C;  1OTR B;  4RM8 A;  1L0X B;  2KJ6 A;  3KWV A;  3KLS X;  2BWF A;  2X38 A;  2WXM A;  2Q5W D;  2BBC A;  2VZK D;  1YQB A;  1ESF A;  1E7V A;  3Q3J A;  1IBX A;  1WY8 A;  2N9P C;  4XE0 A;  4PS8 A;  2V9H A;  4LLG M;  1TKY A;  2ZJD A;  5L95 C;  1VJK A;  2C5L C;  4XGA B;  4CO7 A;  1EU3 A;  1K50 A;  2MH7 A;  1BXT A;  3NVY A;  4K3C A;  3A4R A;  1TGZ B;  1FCL A;  5H92 C;  3P63 A;  1PUT A;  1LGR A;  1PGA A;  1JWS D;  4BBN C;  5BMI A;  2RDB C;  1XLO A;  2PPH A;  3E9S A;  2KQ7 A;  2QIL A;  1T0Y A;  4WIP A;  2K8H A;  1JRU A;  4F7Z A;  4C4V B;  4MH0 E;  2WDT B;  4JWS C;  5EDS A;  2JRH A;  2I1K A;  3ML8 A;  4K1R B;  2W54 A;  2KK8 A;  2N7D A;  5C2T B;  4YT0 B;  4ZYN A;  2ZCC A;  1PYW D;  2PTL A;  2D3G A;  5H8Y E;  3T8M A;  4ITK A;  3U30 A;  3AU5 A;  4P1C C;  1EUV B;  3WA0 A;  4NZL B;  3V6C B;  3Q3N C;  4ARC A;  5JHA A;  3QC8 B;  3PZ8 A;  4JL9 A;  4MDK E;  3BK2 A;  2V0G A;  4N58 A;  4YTN B;  3VUW A;  3T9L A;  3DVG Y;  2CHW A;  2IPK D;  4CYE A;  4IUM B;  3RNG C;  2PKO A;  4M00 A;  2INN E;  2EKI A;  3B2G A;  3GOE A;  4N9F 4;  1ZW7 A;  3AXC A;  2MLB A;  2EKE C;  5DPS A;  1YN5 A;  4G0N B;  1EWY C;  2ZPY A;  2KTR B;  4L2Y A;  1C76 A;  1QZE A;  3AE5 B;  3VXW A;  4W9I A;  1LQB A;  3VVW B;  1I4R A;  3CWI A;  5JXV A;  3FIL A;  4KKI A;  2UU7 A;  5IN7 A;  5BO4 B;  1QF6 A;  2N1V A;  1WYG A;  2LJI A;  3R7Q A;  3RN9 C;  1M94 A;  1YIW A;  4B6W A;  2MBB B;  2BS2 B;  2G1E A;  2KFJ A;  1JRP A;  4JQW C;  2WXK A;  1NYR A;  1YX5 B;  3ZXV A;  4II2 B;  2WYQ A;  2IGD A;  1XLQ A;  2BYV E;  2JYT A;  3LDZ E;  4YSZ B;  3BYT B;  2CJO A;  1FPY A;  1NVI D;  3AEA B;  3ZVV A;  5AUK A;  1UWX A;  2JZP A;  2JU6 X;  1UBQ A;  2LGS A;  1SIF A;  4XC2 A;  4ANV A;  3H9D A;  2B76 B;  1FMA D;  1XO3 A;  4HLE A;  1FFU A;  2KN4 A;  4EKU A;  3ZGZ A;  1OQR A;  3AE8 B;  1JWA D;  3QX1 A;  1SEB D;  1L4Z B;  2L8J A;  3L13 A;  2I2Y A;  4HRO A;  4LCD E;  3TIX A;  2KLC A;  4W9G A;  1V1P B;  3RNF C;  2IO1 B;  3U8Z A;  2W82 A;  4MSM B;  2D2Q A;  4GN1 A;  2BS3 B;  3L16 A;  1KRH A;  3MC9 A;  4C7Y A;  1V1O A;  3IXS A;  4FLH A;  4YSX B;  1ZXH A;  1YQ3 B;  4JPS A;  3MHZ A;  2PEA A;  3SFD B;  3A1Q B;  3SDL C;  4K3B A;  1VR9 A;  5G2N A;  3A9J A;  3UIN B;  2NBU A;  1DYQ A;  4EZL A;  4OVZ A;  4M0W A;  3Q3O C;  3KWL A;  1PQS A;  4I6L B;  4NJC A;  2TSS A;  2D11 A;  3APC A;  4GU2 A;  3NUH B;  1WXQ A;  4EEW A;  3KH0 A;  2GOW A;  1R4N B;  3I5J C;  4RGT A;  3DCG A;  1N5X A;  1Z2M A;  4ZRK A;  1FNV A;  1UWM A;  2NCN A;  1SSN A;  3B9J A;  4DQO C;  2L7R A;  3P1M A;  1J19 A;  1IGC A;  1VZ7 A;  4NY0 A;  2WXJ A;  1WR6 E;  3O13 A;  4IKG A;  1A70 A;  2QMT A;  4HDQ A;  4DHZ E;  1PDX A;  3ZKJ C;  2IO3 B;  3EEC A;  4ANW A;  2D3B A;  2MA9 B;  1V81 A;  2IBI B;  4CHK A;  1B1Z A;  3VH3 B;  4YWG G;  1XT9 B;  3DBL I;  4AJW A;  4WJO A;  2WWZ A;  4ZRQ A;  2FUG 1;  3Q69 A;  3TUO A;  1CJE A;  3KYD D;  1P7F A;  2KQ4 X;  1TS2 A;  1KM7 A;  4OZB A;  4BKS A;  5J2R A;  1ZPS A;  1WI0 A;  4MSQ B;  3DVG X;  1I4Q A;  5G5H A;  2GB1 A;  1RM6 C;  2DHZ A;  3PLV A;  4HK2 A;  4MGZ E;  3NRZ A;  4RF0 A;  2INC C;  1FRR A;  2CU3 A;  4I6N B;  2XK5 A;  2JRI B;  4YTM B;  1V5T A;  1WXS A;  3UQB A;  3MC8 A;  3AN1 A;  1WX9 A;  2ZVN A;  3RNE C;  3A4S C;  2YLM A;  4GDL A;  4EZK A;  1E7U A;  2MHJ A;  1C4C A;  2L00 B;  1J8C A;  2FIF A;  2DZM A;  1V80 A;  1SF0 A;  3H7P B;  1MJD A;  3RD2 A;  3DHH C;  1JWM D;  5D3D A;  1I35 A;  1KJT A;  4P1B C;  4AP4 C;  4FJV B;  3VHT C;  4W9E A;  1D3Z A;  3DVN V;  3RNC C;  3ABV B;  3NZS A;  5EE1 A;  4NPN A;  3TEY A;  3BIN A;  1CQV A;  2J53 A;  2RDG A;  2JVC A;  3DBR I;  2DBY A;  2WU2 B;  4REZ A;  3ZRF A;  1AW7 A;  5T8I A;  2LGX A;  3AU4 A;  3QJZ A;  2BGF A;  1WGD A;  4IWO A;  3SR6 A;  5MPO A;  1J7A A;  2MSE D;  4G3X B;  3ZRC A;  3IFW B;  2WHI A;  4LJO B;  4B0M A;  2PE6 B;  1ACC A;  1E7P B;  1WSP A;  3WAL A;  2C7M B;  5HKH A;  4OZA A;  2I38 A;  2MWS B;  3ZJV A;  3RT3 B;  3E56 A;  1GOZ A;  1E90 A;  1FXA A;  1N6Z A;  2QC8 A;  1P98 A;  2N9E B;  5FK9 C;  1NBF C;  1B9R A;  2OJR A;  5DPT A;  4USA A;  4WQO B;  2O6V A;  4D2K A;  1HTO A;  4GDK A;  2J52 A;  4HCN B;  4KGS A;  4RCO A;  1X1M A;  3U7Z A;  2L05 A;  3ZW3 A;  2EMT A;  1ZP0 B;  1GG3 A;  2BYE A;  3P4Q B;  1QKZ A;  3K9O B;  4DXF A;  3L0W B;  2J0K A;  1T3Q A;  3L08 A;  3FKY A;  5HI1 A;  1WGG A;  3VRA B;  1HZ5 A;  2JWZ A;  2WXI A;  4TSS A;  1KH0 A;  1NEN B;  1QOG A;  4WJP A;  2KD0 A;  4S17 A;  2NTS A;  1AAR A;  3EC8 A;  4HDO A;  2VZK B;  3AUL A;  4A20 A;  1WMH A;  4OW0 A;  1GAQ B;  3H1U A;  3N9Y C;  3UGB B;  2N4F A;  1E8Z A;  4TKN A;  2BF8 B;  1R7S A;  1ZDX A;  4XX5 A;  3AEG B;  3N1Y C;  3ZNH B;  2KDE B;  3NZU A;  4DXA B;  3NS1 A;  4XDD A;  1T0Q C;  2L1A A;  2EMS A;  2JUO A;  1E5W A;  2K9X A;  3A9K A;  3ENE A;  2GMI C;  3TMP B;  2KMA A;  3SD5 A;  4MM3 A;  3ZQ4 A;  1EF5 A;  2KX0 A;  4ZRJ A;  2V4L A;  1V97 A;  3V61 A;  3UIP B;  1SE9 A;  3WAM A;  2KX3 A;  1WM3 A;  2KDF B;  4ANU A;  1VCB A;  1ZKH A;  1ET6 A;  2BYF A;  3H8H A;  3I9V 1;  3I57 A;  1WX8 A;  4DDI D;  1YD8 U;  5HHD G;  2AL6 A;  1N62 A;  3A9J B;  2DYB A;  5AZF A;  3TEZ A;  2FCS A;  3CSF A;  4M0W B;  4NAM A;  1I7H A;  3W2D A;  1K53 A;  4S0R A;  1OQY A;  1VZ8 A;  2D10 A;  1WIA A;  4E74 A;  4TMA B;  3QIJ A;  4RM9 A;  3NVV A;  5E6O A;  2JQR B;  1XLP A;  3GZN B;  3HIZ A;  5E6P A;  4MGY E;  4WH4 A;  3X0W A;  1K8R B;  1JW9 D;  1ZDV A;  3V3X A;  4GLS C;  3P4P B;  1L2N A;  2OJW A;  3OLM D;  2M0X A;  4N6E B;  1YJI A;  3ZDT A;  1MHX A;  4DWF A;  1UGJ A;  4BZA A;  1JRO A;  4KZC A;  1Q0W B;  3KYC D;  1L0V B;  4JIO U;  5LLI A;  2SEB D;  3VTW A;  1FNU A;  1XXG A;  2M1M A;  1D4B A;  3W1S A;  5TSS A;  2HTM E;  3AE7 B;  2CHZ A;  2NPT B;  1SBB B;  1T0R C;  4AWJ A;  1SJH D;  2FNJ B;  1NI3 A;  2Y5P A;  2GBK A;  3NHE B;  2IO0 B;  3DBH I;  2MBQ A;  2GRI A;  4WWO A;  1WZ3 A;  1E10 A;  1V86 A;  4OZC A;  3T3N A;  4ZDV A;  4E71 A;  1TKE A;  2KAN A;  2K0P A;  1I42 A;  3Q8F A;  1TIF A;  4OHJ A;  1J7C A;  2H89 B;  4B95 A;  2E3T A;  2RR9 A;  1KFY B;  2K22 A;  2AQ3 B;  1QOF A;  3EFC A;  4NAW B;  3H6N A;  2X8X X;  2WXH A;  2UYZ B;  3ZYY X;  4P7I A;  2DAJ A;  2KC1 A;  3W1Y A;  1T6B X;  5AZG A;  4W9H A;  1GPX A;  2ZZP B;  3SHQ A;  4ZHO A;  1Q1O A;  2KJH B;  2WP9 B;  4NNJ B;  2Y3A A;  3RNB C;  4IM0 A;  2XNA C;  1L0Y B;  2UWQ A;  1EM7 A;  3PHW B;  4RGN A;  4XZ4 A;  1WJ4 A;  1K51 A;  2HE7 A;  2N0S B;  1HA5 A;  3EGR A;  3IT6 B;  4PS7 A;  5CX3 A;  1EU4 A;  3BYY B;  4PYU A;  1SXT A;  1UEL A;  4FJY A;  1RLF A;  4A8X C;  5D3I B;  2C7H A;  3L4P A;  2NVU I;  3Q8B A;  2LGY A;  2W9N A;  2Z8L A;  2FCM A;  2KZR A;  4A55 A;  2SAK A;  2N9K A;  3DHI C;  1NEK B;  4US9 A;  3ZNZ B;  4BAX A;  1WE7 A;  5JHB A;  3DVN U;  5D6J B;  2BWE S;  4Q2J A;  2ICI A;  3HHM A;  2L0T A;  1WE6 A;  2QEJ C;  2KFK A;  1JAL A;  1TS4 A;  2HDE A;  2OHF A;  5CTR C;  3P42 A;  2OOB B;  2LI5 A;  2YEP B;  2WNM A;  3N30 A;  3WAO A;  4PS3 A;  2DZK A;  4HPM B;  4B0E A;  4KX6 B;  2K3U A;  4L23 A;  3TCA A;  4BKS D;  2IDY A;  1L6V A;  3ETR A;  5EE3 A;  2W55 A;  4HJK A;  1BUI C;  2DWQ A;  2IJ0 A;  3N1X C;  3SU8 X;  1C4P A;  5E6J A;  4L1B A;  1PFD A;  4HKZ E;  4WWM A;  3U7D A;  1WWT A;  1WXV A;  2KNB A;  3Q8C A;  1P1A A;  1D5M C;  1STE A;  3BK1 A;  3NVW A;  1OEY A;  4FBJ B;  4IM3 A;  2INP E;  1SE3 A;  2MP2 A;  4I6P A;  1GC7 A;  3UIO B;  2ZW0 A;  4HWI B;  4ICU A;  2PJH A;  1JWU D;  2XEW A;  1EF1 A;  2IY1 B;  2JWU A;  5L83 A;  2EEL A;  3AE6 B;  4JWU C;  2LGI A;  1VD2 A;  4FJZ A;  2JY6 A;  1IP9 A;  2DAF A;  2V3S A;  1N5W A;  2XBB C;  3K9P B;  2WGS A;  3HVD A;  2LZ6 A;  1QQR A;  1JML A;  1Q5W B;  2KHW B;  4KGR A;  2IO2 B;  1FEH A;  3ONS A;  4TQ1 A;  4IC7 B;  1ZGU B;  4C80 A;  2LRU A;  3TJP A;  1BML C;  3U4E G;  1ZOY B;  5DPR A;  1WJU A;  3P4S B;  1MFW A;  1UF0 A;  4EOY A;  1Q10 A;  2LUM A;  1YNT E;  4HEA 1;  3C0R B;  3ZNG C;  5EE0 A;  3HVZ A;  3HK0 A;  2LGD A;  2MJD A;  4A90 A;  3HUI A;  2FUH B;  1YN4 A;  5KHO A;  2LMC A;  4FAD A;  1JWB D;  2M4N A;  1I4G A;  2K8B A;  1F0Z A;  1I4X A;  3BWU D;  1C77 A;  4IDI A;  2GBN A;  2AQ2 B;  2ACZ B;  2IY0 B;  1MI0 A;  2O6V D;  1VLB A;  3VUX A;  2NMQ A;  2BB5 A;  3SEB A;  1F9J A;  1P7E A;  3APD A;  1R4N I;  3BZD B;  3OAW A;  5D2M B;  1SJE D;  2DEN B;  4KKJ A;  1D5X C;  2RGF A;  1TBE A;  3HM3 A;  5FR3 A;  2ONQ A;  2LUE A;  4GSW A;  2M56 B;  4M02 A;  1N63 A;  5D94 A;  2KAC A;  4MH8 A;  2MJ3 A;  4ZRP A;  3IVF A;  4JGH B;  3NVZ A;  2K39 A;  4LNN A;  1F2R I;  5IP4 D;  1V5O A;  2BVC A;  5AEK B;  1IBX B;  3AE4 B;  2L83 A;  2BKR B;  3DBR B;  3AH7 A;  4MAC A;  2ON8 A;  4RGO S;  3ECI A;  1KF6 B;  2WQY B;  4KDL B;  5CHW A;  4YXD B;  3CMM B;  4W9J A;  1E6E B;  2WDV B;  5IO9 A;  1OFF A;  4DHJ D;  4BBN F;  3MFG A;  2H88 B;  4KZ0 A;  1M4V A;  5CHV C;  1A5R A;  3PRE A;  3L54 A;  2L32 A;  1L6U A;  2VRR B;  1FIQ A;  2AX5 A;  2CHX A;  1RWS A;  3W9C B;  1C78 A;  3MHS D;  3WAN A;  5C23 A;  2K6D B;  4LJP B;  2Y5B B;  4MT5 A;  4JX1 C;  1N60 A;  2FID A;  4DK5 A;  3PGE A;  1TS3 A;  1KLV A;  5DPW A;  4FHK A;  3PO0 A;  5HG2 A;  4P6V F;  1F1H A;  4K7S A;  4LDT D;  5TR5 A;  2LD9 A;  2LFI A;  2FBW B;  3GE3 C;  1GB1 A;  1FFV A;  1XLN A;  2Z0D B;  2MX2 A;  3R2T A;  5FR6 A;  3AV8 A;  3B1L X;  4HPL B;  1FNW A;  4LNF A;  4KDI C;  1FXI A;  5JZE B;  2G45 B;  2QCZ A;  4RMA A;  1WXA A;  3AB5 A;  3DDC B;  1MG4 A;  5G5G A;  2ZVO A;  3PSE B;  3ZIM A;  2AQ1 B;  2DZI A;  1BT0 A;  3N32 A;  2D07 B;  3HM6 X;  4ANX A;  2L76 A;  4DDG D;  4RNA A;  2KWV B;  1LO5 D;  4OVU A;  4HKQ A;  3DWG C;  2J42 A;  2DLB A;  4R3D A;  1N61 A;  3DHG C;  3OWE B;  2BYT A;  3M62 B;  3UF8 A;  3MTN B;  3P2B A;  1GUA B;  3FIL B;  2QDF A;  2K8C A;  2ZEQ A;  4DBG A;  2AYO B;  1G6J A;  2J7Q B;  4RF1 A;  5CHF A;  2M8S A;  2PE9 A;  3VR9 B;  2LWP A;  1GB4 A;  2LVP A;  2LHD A;  3V62 A;  2QHO A;  2W3R A;  1HEZ E;  2NTT A;  3RFZ B;  2DYO A;  4W9K A;  4C7Z A;  2LVQ A;  3P4R B;  2O2V A;  1I4P A;  5AZH A;  2QSD A;  4FHJ A;  1V6E A;  2QJL A;  3C19 A;  2DNF A;  5BMG A;  4AQ7 A;  1NDD A;  4MJS A;  3T3O A;  2IZV B;  2FCQ A;  2MP2 B;  1YQ4 B;  3MP9 A;  2KDI A;  3U2S C;  1PGX A;  1HXY D;  3A33 B;  1ZXI A;  3GP7 A;  1V49 A;  2VH1 A;  2CS4 A;  3W5V B;  5IKC M;  3WCQ A;  3B2F A;  1TKG A;  1WRI A;  2N9X A;  3WAP A;  4XDC A;  2BKF A;  1KLU D;  1C3T A;  5C1Z A;  4M01 A;  3VFK A;  3RI7 C;  2DYM A;  3C8Y A;  4M8N A;  3A1Q A;  1D5Z C;  3TSS A;  3EA6 A;  3OJ4 B;  5C3J B;  2ZPN A;  3KUZ A;  1P0R A;  3IT4 B;  2KN5 A;  3NG0 A;  1YN3 A;  3AEE B;  3URY A;  2D3A A;  3BY4 B;  4LK0 M;  1LM8 B;  2RD0 A;  5GMV A;  3VQI A;  1FO4 A;  4WAA A;  2NS5 A;  3NY5 A;  3AEC B;  3EUB 2;  3AEF B;  2MCN B;  4WJQ A;  2MBE A;  3VR8 B;  4WWP A;  5BYS A;  4IG7 B;  2PIA A;  3RZF A;  1IYF A;  2NR2 A;  2N7J A;  2D3C A;  2KTF A;  1E0Z A;  4LNO A;  2V3N A;  3VH4 B;  2KO3 A;  3DOW A;  1UD7 A;  1OQQ A;  2WLB A;  2MW5 A;  2M0A A;  3DBH B;  3EFU A;  4WAF A;  3S2A A;  4HCP B;  3PRP B;  3QAR A;  3PZD A;  2LJ5 A;  1V2Y A;  4BKG A;  4H2A A;  5IAA C;  3FC4 A;  4O1N A;  1DOY A;  2DZJ A;  3TL5 A;  2JX5 A;  1XQQ A;  2G4D B;  4A6Q A;  1SB3 C;  4HPP A;  3VDZ A;  3OG5 A;  2HJ1 A;  1TTN A;  1C4A A;  1CMX B;  4IM2 A;  4EFO A;  1ZE3 D;  4IWP A;  2WU5 B;  4BVU C;  4XWW A;  4WQM A;  2CR5 A;  4PYZ A;  2ZNV B;  3MJ5 A;  1HE8 A;  4FN2 A;  2XK5 B;  1PGB A;  1R4M I;  4G50 A;  1Y56 A;  3NZ3 A;  3DWM A;  5KHQ A;  1QOB A;  4GDL B;  1YMH E;  3LB8 C;  2J0J A;  5LXI B;  3GB1 A;  2AL3 A;  5BYQ A;  3IHP C;  2GI9 A;  1S1Q B;  3H7P A;  1ISN A;  1JCK B;  2K5P A;  1D6E C;  1GC6 A;  3UQA A;  3LXF A;  1S3S G;  3RNA C;  2OED A;  1XF5 L;  4JLC A;  4BFR A;  3PTF C;  1E8W A;  2WXP A;  2VH2 A;  4GGQ A;  2NBW B;  2ZCB A;  5J18 A;  4ZHP A;  1VRA B;  3PHX B;  4XWT A;  3ZUN A;  3APF A;  1KOT A;  2ZNV C;  3KVF B;  1WGR A;  3JVZ X;  4AOF A;  3QWZ B;  2WXN A;  4M8M A;  3M3J A;  3RUL A;  5IA7 A;  1WR1 A;  4CQN A;  1WGH A;  3IBE A;  1HZ6 A;  2B3A A;  1AYF A;  1LXD A;  1DOI A;  1GJZ A;  1TYG B;  1RRB A;  1TZ1 A;  3QA8 A;  2JXX A;  3V60 A;  2ASQ A;  2LAS A;  2RMM A;  5BYR A;  2K6Q A;  3VAW A;  2HTH A;  2JF5 A;  3PRM B;  1E8Y A;  1TT5 B;  1F52 A;  3U52 E;  4FA6 A;  3ZTD A;  3KUC B;  3NJT A;  3I3T B;  3PVL A;  3OJ3 A;  1NI2 A;  4C56 C;  1WFY A;  3PT2 B;  3QK0 A;  4A3O A;  2O6V B;  2KMC A;  2Y5C A;  1WJ6 A;  1I4H A;  1QOA A;  1VZ6 A;  1WYW B;  2C9W B;  2GLS A;  4GDK B;  2ZW1 A;  1FD6 A;  2MBH A;  1YJ1 A;  1K52 A;  2V3P A;  2N1W A;  3RYT A;  5GXG B;  4NJ6 A;  3Q3F A;  4ZYS A;  3R2I A;  3R3M A;  2KVR A;  5G55 A;  1OEY J;  1IGD A;  2WXF A;  1H4R A;  3I63 C;  2L0F A;  4PT5 A;  3TEX A;  3JSV A;  3M63 B;  1NYQ A;  3QQ8 B;  3GS2 A;  3RPF C;  1WMH B;  3BVM A;  1P9D U;  1FRD A;  1L5P A;  3RUI B;  1WX7 A;  2KLG A;  3AE1 B;  4K7U A;  4E3C A;  5FKA C;  3BVZ A;  4IWQ A;  1WJN A;  2LXC A;  3UI3 A;  2O2V B;  2KKC A;  3Q3M C;  4PK1 A;  2HJ8 A;  2J4X A;  4DHJ B;  2BT6 A;  4IW0 A;  2JT4 B;  2R61 A;  4MJS B;  1SE2 A;  2JPH A;  3A9K B;  4MM3 B;  4URK A;  4KIK A;  2MQJ A;  4RH6 A;  3JYU A;  2N7E A;  3BVG A;  1U4A A;  2G4S A;  4KV2 A;  3Q6B A;  1ENF A;  2YVC A;  2IGH A;  4ICV A;  1LFD A;  2KYW A;  1ROE A;  1WH3 A;  2L52 A;  3AI5 A;  5IOI A;  3ZO5 B;  4LDT B;  4B9K A;  4J6I A;  3DBL B;  1TY0 A;  1Y8R C;  3Q8A A;  3HRD D;  4GMV A;  4QAY A;  2M19 A;  1HTQ A;  4LNI A;  3N3K B;  4A3P A;  4ACF A;  2PLP A;  3KQ4 A;  3PPA A;  3SFE B;  2KWC A;  4GB9 A;  4IOI E;  3TBL D;  3X23 A;  1Z5S B;  1C9F A;  3NOB A;  2D5G A;  2BB6 A;  3LJ3 A;  1IUE A;  4KSK C;  2MEK A;  2WDQ B;  1ZUD 2;  2JZZ A;  4TQ0 A;  5D7G A;  3AED B;  3DQV A;  3KUD B;  4WWN A;  4YTP B;  3MC0 B;  3RMK C;  3RZW C;  2A5U A;  2WXQ A;  1UBI A;  4C00 A;  1YOV B;  1QLB B;  1EWC A;  2JYE A;  1JQ4 A;  2HD5 B;  4II3 B;  2AWT A;  4EZJ A;  2NPT A;  3ZNI D;  1H8C A;  4DXG A;  2FCN A;  2KWU B;  3ML9 A;  4OVV A;  2R2O A;  2E6X A;  2V1Y A;  4EE2 A;  2KQS A;  2KVZ A;  2J0M A;  1UNS A;  3L10 B;  3Q14 C;  3BII D;  3KW5 B;  5BMH A;  2L3Z A;  4ZRI A;  3QAQ A;  3AEB B;  4BOS C;  2REX A;  1UZX B;  2JSV X;  1XEE A;  2MRP A;  1WF9 A;  2JZ3 B;  4AJY B;  1F2R C;  2WDR B;  1XCQ L;  2LXA A;  3AM9 A;  1J0G A;  2KT7 A;  4K81 A;  1TS5 A;  3B0A A;  3W1S C;  5DCN A;  4NAW A;  3TEW A;  3QCA A;  1WRD B;  1WZ0 A;  3DBS A;  4DHZ B;  1RFK A;  1HQR D;  1FM0 D;  4C4V A;  1CK1 A;  3O65 B;  2KMM A;  2KWD A;  4W9F A;  2PMV A;  2QIE B;  1L4D B;  2PW9 A;  1QT9 A;  4F1S A;  3EHV A;  1AN8 A;  5LNK 1;  4YSY B;  1DOX A;  4WJN A;  2I1J A;  1TZO A;  2LRW A;  2CKH B;  4KVG B;  2RPV A;  4P16 A;  2KC2 A;  1YX6 B;  2PVO D;  4GXB A;  1TY2 A;  1GNU A; 
#chains in the Genus database with same CATH homology
 3VQI A;  3DCG A;  4ASW C;  4PS7 A;  4WAA A;  5CX3 A;  1UH6 A;  1Z2M A;  4MEL A;  4ZRK A;  2NS5 A;  2NCN A;  3NY5 A;  2AEH A;  3R66 C;  4PYU A;  3DPD A;  2L7R A;  1UEL A;  3PLU A;  1J19 A;  2GBJ A;  3PS6 A;  2MCN B;  4FJY A;  4WJQ A;  4W9C A;  4NY0 A;  2MBE A;  4WWP A;  4IG7 B;  1RLF A;  4GOC A;  1WR6 E;  3RZF A;  2C60 A;  1WXM A;  2C7H A;  2NVU I;  2LGY A;  4HDQ A;  4DHZ E;  2W9N A;  2FCM A;  2IO3 B;  2KZR A;  4W9D A;  2NR2 A;  3ZKJ C;  3EEC A;  3RCZ A;  3WIM A;  1IYF A;  4ANW A;  4TV3 A;  2GBR A;  2G3Q B;  2KTF A;  2MA9 B;  3ZDM C;  3H7S A;  1V81 A;  2IBI B;  3ZNZ B;  4CHK A;  4K7W A;  3VH4 B;  1WE7 A;  2KO3 A;  3DOW A;  3VH3 B;  5JHB A;  2KTR A;  1UD7 A;  3DVN U;  1XT9 B;  5D6J B;  2MW5 A;  2BWE S;  3DBL I;  4AJW A;  3HHM A;  2L0T A;  3ALB A;  3EFU A;  4WJO A;  1WGY A;  3S2A A;  2WWZ A;  1WE6 A;  4HCP B;  2KFK A;  2KFK B;  2A4Z A;  4KSL C;  2GBM A;  3PRP B;  3VTV A;  3QAR A;  3R7R A;  2WX0 A;  5CTR C;  2KJR A;  3PZD A;  2LJ5 A;  2FAZ A;  3KYD D;  1V2Y A;  4BKG A;  5IAA C;  2OOB B;  2DZJ A;  4HXD A;  3TL5 A;  3MJW A;  2LI5 A;  1KM7 A;  1XQQ A;  2G4D B;  3VDZ A;  4BKS A;  5J2R A;  3N30 A;  4BKT A;  3WAO A;  4PS3 A;  1WI0 A;  4MSQ B;  2DZK A;  3DVG X;  4HPM B;  1TTN A;  1WM2 A;  1XD3 B;  3TCA A;  3QHT A;  2DHZ A;  1CMX B;  4IM2 A;  4BKS D;  5J17 A;  3PLV A;  4HJK A;  4HK2 A;  4IWP A;  4MGZ E;  4EFO A;  3SU8 X;  4BVU C;  5E6N A;  3JSV B;  2KOX A;  5JH5 C;  2CR5 A;  4PYZ A;  2ZNV B;  2WX1 A;  1HE8 A;  2K25 A;  4I6N B;  4FN2 A;  3U7D A;  2KNB A;  1WXV A;  1R4M I;  2JRI B;  2MBO A;  2XK5 A;  2XK5 B;  3M95 A;  1UGM A;  1P1A A;  1V5T A;  1WXS A;  2KXJ A;  3UQB A;  4G50 A;  1WX9 A;  2ZVN A;  1OEY A;  1P3Q U;  4FBJ B;  4IM3 A;  3A4S C;  5KHQ A;  2YLM A;  2MP2 A;  4GDL A;  4GDL B;  4I6P A;  4X57 B;  1GC7 A;  4EZK A;  1E7U A;  3UIO B;  2J0J A;  5LXI B;  4HWI B;  4ICU A;  2AL3 A;  2PJH A;  3ZLZ A;  3IHP C;  2L00 B;  2XEW A;  4MEM A;  4BOZ B;  1EF1 A;  1J8C A;  2FIF A;  2DZM A;  3ZTC A;  1SGH A;  1V80 A;  1S1Q B;  2IY1 B;  3H7P A;  3H7P B;  2DX5 B;  3RD2 A;  3D32 A;  2BPS A;  1ISN A;  2LVO A;  2RSU A;  1GC6 A;  1C1Y B;  3UQA A;  1I35 A;  1S3S G;  1L7Y A;  5L83 A;  1KJT A;  4JLC A;  4AP4 C;  1IPG A;  1VD2 A;  3PTF C;  4FJV B;  4FJZ A;  3VHT C;  4BFR A;  1E8W A;  2JY6 A;  4W9E A;  1IP9 A;  2DAF A;  1D3Z A;  1RAX A;  2V3S A;  3DVN V;  4GGQ A;  2NBW B;  2CU1 A;  2ZCB A;  5J18 A;  2XBB C;  3NZS A;  3PHX B;  1MG8 A;  3K9P B;  3PRZ A;  2K1F A;  2LZ6 A;  4NPN A;  3APF A;  3ZUN A;  2Z0E B;  2C7N B;  3BIN A;  4F8C B;  4KIK B;  1RFA A;  4TUU A;  1Q5W B;  2KHW B;  3B08 A;  2JVC A;  3DBR I;  4GIV A;  4NQL B;  3ZRF A;  4HVB A;  1KOT A;  2LGX A;  2ZNV C;  3KVF B;  4MGI E;  1WGR A;  2IO2 B;  3JVZ X;  1FXT B;  3AU4 A;  4AOF A;  2RPQ A;  3QWZ B;  2IYD B;  3CF6 E;  3ONS A;  4M8M A;  4W9L A;  3M3J A;  3QJZ A;  4IC7 B;  2BGF A;  1WGD A;  4TQ1 A;  3RUL A;  1WR1 A;  5IA7 A;  1WGH A;  1ZGU B;  3IBE A;  4IWO A;  2LRU A;  1E8X A;  2B3A A;  2MSE D;  3TJP A;  4G3X B;  3ZRC A;  1LXD A;  2NBV B;  2Z59 B;  1EO6 A;  1GJZ A;  3IFW B;  1RRB A;  4LJO B;  1TZ1 A;  5DPR A;  3QA8 A;  2JXX A;  1WJU A;  3JW0 X;  3V60 A;  2PE6 B;  2ASQ A;  2LAS A;  3WAL A;  2C7M B;  3PV1 A;  2K6Q A;  3VAW A;  3VTU A;  4EOY A;  4EUT A;  2HTH A;  5HKH A;  2KDB A;  2JF5 A;  3C0R B;  3PRM B;  1E8Y A;  3ZNG C;  4FUL A;  2MWS B;  3HK0 A;  3RT3 B;  2LGD A;  2FUH B;  2R2Q A;  4FA6 A;  5KHO A;  1E90 A;  4NQK E;  4FAD A;  4YL8 A;  3ZTD A;  3CST A;  3KUC B;  2M4N A;  3I3T B;  3OJ3 A;  1P98 A;  2K8B A;  2N9E B;  1NI2 A;  3PVL A;  1WFY A;  3PT2 B;  1NBF C;  2OJR A;  3QK0 A;  4G11 A;  5DPT A;  4A3O A;  2GBN A;  4WQO B;  5LXH A;  2O6V A;  2O6V B;  3NS8 A;  2IY0 B;  2KMC A;  1OGW A;  1WJ6 A;  4GDK A;  4GDK B;  2C9W B;  1WYW B;  4HCN B;  3L17 A;  2MBH A;  2O6V D;  3VUX A;  1YJ1 A;  4MGK E;  1X1M A;  1F9J A;  3APD A;  2L05 A;  1R4N I;  2N1W A;  3OAW A;  5D2M B;  3RYT A;  4AUQ C;  3ZW3 A;  2EMT A;  1GG3 A;  2BYE A;  1V9J A;  2DEN B;  4NJ6 A;  3K9O B;  3Q3F A;  3VUY A;  3L0W B;  2J0K A;  3R3M A;  3V6E B;  3IG3 A;  2M17 A;  3L08 A;  2RGF A;  3GZN I;  2KVR A;  1TBE A;  5G55 A;  3HM3 A;  4NJ7 A;  1WGG A;  1OTR B;  1OEY J;  2JWZ A;  4RM8 A;  4WJP A;  1H4R A;  2KD0 A;  2L0F A;  2KJ6 A;  2LUE A;  3JSV A;  1AAR A;  3M63 B;  3EC8 A;  3QQ8 B;  4GSW A;  2BWF A;  4HDO A;  3AUL A;  4A20 A;  1WMH A;  1WMH B;  5D94 A;  1P9D U;  3IVF A;  4JGH B;  1YQB A;  2K39 A;  3RUI B;  1WX7 A;  2KLG A;  3H1U A;  4K7U A;  1V5O A;  3UGB B;  2N4F A;  1E8Z A;  1E7V A;  4TKN A;  4E3C A;  3Q3J A;  5AEK B;  1WY8 A;  2N9P C;  4IWQ A;  1WJN A;  2LXC A;  2BF8 B;  2O2V B;  4XX5 A;  2BKR B;  2KKC A;  4PS8 A;  3ZNH B;  2KDE B;  2ZJD A;  3NZU A;  5L95 C;  2HJ8 A;  3ECI A;  4DXA B;  4DHJ B;  4KDL B;  5CHW A;  2C5L C;  3CMM B;  4W9J A;  4IW0 A;  4CO7 A;  2JT4 B;  4DHJ D;  2EMS A;  4MJS B;  4BBN F;  3A4R A;  2JPH A;  2JUO A;  1TGZ B;  4KZ0 A;  5CHV C;  1A5R A;  1E5W A;  3A9K A;  3A9K B;  3PRE A;  3ENE A;  2GMI C;  3TMP B;  2KMA A;  3L54 A;  2VRR B;  3SD5 A;  4MM3 A;  1EF5 A;  2KX0 A;  4ZRJ A;  2V4L A;  4URK A;  3V61 A;  3UIP B;  4BBN C;  4KIK A;  2CHX A;  2MQJ A;  1SE9 A;  3JYU A;  2N7E A;  1U4A A;  2KX3 A;  1WM3 A;  2G4S A;  2PPH A;  2KQ7 A;  2KDF B;  3MHS D;  4KV2 A;  3WAM A;  3WAN A;  4ANU A;  1T0Y A;  2YVC A;  1VCB A;  5C23 A;  2K6D B;  2K8H A;  1ZKH A;  4ICV A;  4LJP B;  1JRU A;  2Y5B B;  1LFD A;  2BYF A;  4F7Z A;  4MH0 E;  2FID A;  1WH3 A;  2WDT B;  3AI5 A;  4DK5 A;  3PGE A;  1KLV A;  5DPW A;  4FHK A;  1WX8 A;  3ZO5 B;  4DDI D;  1YD8 U;  5EDS A;  4LDT B;  2JRH A;  2I1K A;  4B9K A;  4J6I A;  3ML8 A;  4K1R B;  2AL6 A;  4K7S A;  3A9J B;  4LDT D;  2KK8 A;  2N7D A;  5TR5 A;  2DYB A;  2LD9 A;  5AZF A;  2FCS A;  3CSF A;  4M0W B;  1Y8R C;  4ZYN A;  2ZCC A;  4GMV A;  2D3G A;  3T8M A;  2Z0D B;  2MX2 A;  5FR6 A;  1OQY A;  3B1L X;  2D10 A;  1WIA A;  3N3K B;  4HPL B;  3U30 A;  4A3P A;  4E74 A;  3AU5 A;  3QIJ A;  4RM9 A;  4KDI C;  1EUV B;  5E6O A;  2G45 B;  3WA0 A;  5JZE B;  4RMA A;  3V6C B;  1WXA A;  3DDC B;  3PPA A;  2KWC A;  4GB9 A;  3TBL D;  3X23 A;  2ZVO A;  5JHA A;  3PSE B;  3QC8 B;  3ZIM A;  3HIZ A;  4JL9 A;  4MGY E;  5E6P A;  2DZI A;  1K8R B;  4MDK E;  3X0W A;  1BT0 A;  3N32 A;  2D07 B;  3HM6 X;  1Z5S B;  3NOB A;  4ANX A;  2L76 A;  4DDG D;  1L2N A;  3LJ3 A;  3VUW A;  4KSK C;  3T9L A;  3DVG Y;  2KWV B;  2CHW A;  4OVU A;  3OLM D;  2M0X A;  4CYE A;  4IUM B;  3GOE A;  3ZDT A;  4N9F 4;  4DWF A;  1ZW7 A;  2JZZ A;  3AXC A;  4TQ0 A;  2MLB A;  5D7G A;  2EKE C;  3DQV A;  3KUD B;  4G0N B;  4WWN A;  5DPS A;  2ZPY A;  1Q0W B;  2KTR B;  4KZC A;  3RZW C;  2A5U A;  3KYC D;  1QZE A;  3VXW A;  3M62 B;  4JIO U;  3UF8 A;  1UBI A;  1LQB A;  4W9I A;  5LLI A;  3VTW A;  3VVW B;  3MTN B;  2M1M A;  3P2B A;  1GUA B;  3W1S A;  2K8C A;  2ZEQ A;  4DBG A;  5BO4 B;  2AYO B;  2HD5 B;  2N1V A;  2AWT A;  2CHZ A;  4II3 B;  1G6J A;  2J7Q B;  2NPT A;  2NPT B;  3ZNI D;  3R7Q A;  4EZJ A;  1H8C A;  1M94 A;  2FCN A;  4AWJ A;  2KWU B;  5CHF A;  1YIW A;  3ML9 A;  2R2O A;  2MBB B;  2M8S A;  4OVV A;  4B6W A;  2FNJ B;  2PE9 A;  2V1Y A;  2LWP A;  2KFJ A;  2LVP A;  4JQW C;  2KQS A;  3V62 A;  2QHO A;  2GBK A;  1YX5 B;  2J0M A;  3NHE B;  3L10 B;  2DYO A;  4II2 B;  4W9K A;  2LVQ A;  2WYQ A;  2BYV E;  2IO0 B;  3DBH I;  2MBQ A;  3KW5 B;  3LDZ E;  4WWO A;  1WZ3 A;  2O2V A;  2L3Z A;  1V86 A;  4ZRI A;  3QAQ A;  3ZVV A;  4BOS C;  5AZH A;  4FHJ A;  4ZDV A;  2REX A;  4E71 A;  1UZX B;  2KAN A;  2MRP A;  1UBQ A;  1V6E A;  1I42 A;  1WF9 A;  2JZ3 B;  1SIF A;  4XC2 A;  4ANV A;  3H9D A;  1NDD A;  4HLE A;  4AJY B;  4MJS A;  4EKU A;  4B95 A;  2IZV B;  2RR9 A;  2FCQ A;  2LXA A;  2MP2 B;  2KDI A;  3L13 A;  2L8J A;  3QX1 A;  1J0G A;  4K81 A;  3A33 B;  3B0A A;  3W1S C;  4LCD E;  3TIX A;  2KLC A;  5DCN A;  4NAW A;  4NAW B;  1V49 A;  3H6N A;  4W9G A;  2IO1 B;  3QCA A;  2CS4 A;  3U8Z A;  1WRD B;  2UYZ B;  4P7I A;  4MSM B;  2DAJ A;  2KC1 A;  2N9X A;  3WAP A;  1WZ0 A;  2D2Q A;  3DBS A;  4GN1 A;  2BKF A;  3W1Y A;  4DHZ B;  3L16 A;  1C3T A;  5AZG A;  5C1Z A;  4W9H A;  3VFK A;  3O65 B;  2ZZP B;  4W9F A;  3SHQ A;  4FLH A;  1Q1O A;  2DYM A;  2PEA A;  2KJH B;  3A1Q A;  3A1Q B;  4M8N A;  4NNJ B;  3SDL C;  4IM0 A;  4F1S A;  3EHV A;  3OJ4 B;  5G2N A;  3A9J A;  3UIN B;  2NBU A;  2UWQ A;  2ZPN A;  4EZL A;  3KUZ A;  1P0R A;  2KN5 A;  4WJN A;  2I1J A;  3PHW B;  1PQS A;  2LRW A;  4I6L B;  2CKH B;  2D11 A;  3APC A;  4KVG B;  4GU2 A;  4EEW A;  4XZ4 A;  1WJ4 A;  1YX6 B;  2KC2 A;  3KH0 A;  2GOW A;  2HE7 A;  3BY4 B;  4GXB A;  1LM8 B;  2RD0 A;  1GNU A;  5GMV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...