1WJSA

Solution structure of the first mbt domain from human kiaa1798 protein
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
127
structure length
127
Chain Sequence
GSSGSSGPYNKNGFKVGMKLEGVDPEHQSVYCVLTVAEVCGYRIKLHFDGYSDCYDFWVNADALDIHPVGWCEKTGHKLHPPKGYKEEEFNWQTYLKTCKAQAAPKSLFENQNITVIPSGFSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords KIAA1798 protein
publication title Solution structure of the first mbt domain from human KIAA1798 protein
rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 11
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2004-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02820 MBT mbt repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1wjsA00
3OYGA 4C5IA 3PMTA 2RJCA 1OI1A 3L2UA 4E7JA 4BE1A 3C4SA 4C5EA 3P8HA 1KHCA 1WJQA 3MEUA 5FRNA 1SSFA 3FEOA 5J39A 2GFUA 4ZTFA 2O4XB 1RI0A 4A4EA 2JZ2A 2XDPA 5KCHA 4PL6A 5FRMA 2VYTA 2PQWA 3NTHA 3L2QA 4E7HA 2RHZA 1WJRA 3H8ZA 2WACA 2R58A 3QJ6A 3DB3A 3MP6A 3ME9A 4IUUA 2RI2A 4BDZA 4GY5A 2RHXA 3OYDA 3L42A 3ZEHA 2E6NA 3DB4A 2R5AA 2BKDN 4A4FA 3OYAA 3S3MA 3ASKA 3OYJA 2EFIA 3PMIA 2LVMA 3QBYA 2QQSA 3OYIA 4BE2A 2X4YA 3OYEA 4FU6A 2L8DA 3L2VA 3FC3A 3OQ5A 5M9OA 5C6SA 2E5QA 2M16A 5D6YA 4A4GA 4BD3A 5IAYA 5KE2A 3OY9A 4BDYA 4HCZA 1MHNA 2RHUA 3OS2A 1N27A 2X4WA 2XK0A 3LGFA 2RHIA 2EQUA 2IG0A 3Q1JA 1OYXA 5C0MA 3OMCA 3OS1A 2DAQA 4N4GA 2M0OA 3OYKA 3E9GA 1WJSA 3FLGA 3NTKA 4EDUA 2NLUA 5D6XA 4B9WA 2MWPA 2RJDA 4QVZA 4E7KA 3PFSA 3O8VA 2QQRA 4E7LA 4ZTJA 2K3XA 3MP1A 3LX7A 2FHDA 3OMGA 3LYIA 4LD6A 4C5HA 3BDLA 3QKJA 4CRIA 3L2RA 2YRVA 3MEWA 4N4IA 4FL6A 4PLLA 4QQGA 4BACA 3S3NA 3OA6A 3OYLA 4Q5WA 2GFAA 5FROA 4C5GA 3OS0A 4IKFA 2JTFA 2O4XA 3H6ZA 2HQXA 3L2WA 3FDRA 2X4XA 5CIUA 5KH6A 3MP8A 5J26A 3META 4N4HA 1G5VA 2R5MA 1OZ2A 2F5KA 4IUPA 3LLRA 3SD4A 1H3ZA 3MEAA 2L3RA 3F70A 4BE0A 2EQKA 2X35A 2RI5A 4L59A 2R57A 3EAEA 3OYCA 4IUQA 4IURA 2LTOA 2EQMA 4NS5A 3E9FA 3OYFA 5D6WA 3QIIA 5KE3A 3KUFA 2BIVA 3PNWC 1OZ3A 3OYNA 3GOXA 3MEVA 2RI3A 2RJEA 4RG2A 4A4HA 4B9XA 3P8DA 3OYHA 3S3OA 3NTIA 2K3YA 4Z02A 2M1HA 4QW2A 2D9TA 2B8AA 3UT1A 3MO8A 4QQ6A 2MWOA 2RHYA 2P0KA 2BUDA 1WGSA 2LDMA 3LGLA 2EQJA 2GF7A 2G3RA 3OYBA 2EKOA 3OYMA 2DIGA 4PLIA 3UWNA 5IN1A 2CKKA 4UC4A 4OVAA 4IUTA 4E7IA 2RJFA 3LH0A 5KCOA 4QQDA 2LCCA 1XNIA 2LRQA 3CEYA 4IUVA 3OB9A 3S6WA 4II1A 2DIQA 2HQEA 2L89A 3DLMA 3M9QA 4X34A 2RO0A
chains in the Genus database with same CATH superfamily
1QCNA 4ZGJB 2AKKA 2CH4A 3JB9D 1VQKT 2AKLA 4Y92A 2KXDA 1WDXA 4ZTFA 3CCUQ 5GMKj 4WF2A 1YFNA 3L2QA 3M0RA 2R58A 2RHXA 2JOYA 2ESWA 3CCET 2KT1A 4EIKA 1D3BB 1SF9A 2GTJA 1H8KA 3QDFA 4FW1A 4FU6A 1YJ9Q 1RABB 2KYMA 3TQ7P 2MOXA 2ZPBB 2M16A 3VKIA 5LJ3f 2ZCFB 3LGFA 2DNUA 5KYXB 1VUBA 5AT1B 2QQ9A 1MGQA 4B9WA 5GAMf 3PFSA 5FWBA 1ZSGA 3CXCS 1ZUYA 3L2RA 2MCNA 4DEYA 4M77C 1M90R 4V2SA 4IIOA 3EFOB 3OW2S 3PIOA 2V26A 4XTXA 4ESRA 3VRYA 3PIPA 3CCLQ 3X20B 2RI5A 4OMOA 4HCBA 3BE3A 4C92E 2D8HA 4L6V5 4QKUA 4Y28E 3JB9G 2ROLA 1Y07A 3QXEB 1IHVA 4PJOE 3UT1A 3NFCA 3LWIA 1K73C 1V29B 1AWWA 4KBMB 1WGSA 3FB9A 2GF7A 1YJWA 3UWNA 4AFSC 2LT1A 1NLOC 5GJVB 5CR2A 2NWMA 4WTOB 1VA7A 2CH4W 3S6WA 2L2PA 1T0JA 3CCSA 1KHIA 2GQVA 2HCKA 3CD6A 4AG2C 1AWXA 2J6OA 4IIMA 1RAGB 4JS4A 1LPLA 3NMZC 4KGVB 2RPNA 2HL5C 3MHXA 3JCMV 1WPYA 2B86A 3M4YA 1QVGA 4J83A 3VS2A 4AFZC 3DB3A 4J9EA 3ME9A 3GBQA 1F1BB 4LDXA 3EGDB 3ZEHA 3CCJA 1W2BA 4A4FA 4J7IA 1MNDA 2SRCA 2DXUA 1KQSA 2E1HA 2EFIA 2K2VA 4RUGA 3ULRB 1VQ7T 1NEBA 5GMKh 3M59A 2EBPA 2LT4A 2I0NA 1RLPC 4KT0E 4PFOA 2CSIA 4HT8A 2G6FX 1YI2A 1TTHB 4M7AD 3FLGA 1CKAA 1UFFA 2KRMA 5I21A 1PKSA 1TUCA 2MMPA 3LYIA 1GCQC 3GIBA 4EMHA 2YRVA 3CPFA 2MI6A 3WVDB 4OB0B 3EH2A 5KH6A 5GAN4 2KT8A 1DJ7B 5IHIA 2RF0A 2VV5A 2PVDB 1R0CB 2F2WA 2E3IA 3KUFA 3GOXA 1U06A 3S3OA 5FW9A 4D6WA 2K3YA 4PJLA 2A36A 4F17A 1K9AA 2MWOA 2DBMA 2ED0A 2VXEA 2LDMA 3LGLA 2E3HA 2EQJA 2O88A 3HRSA 1YN8A 2O01E 3REBB 2AHJB 3C0CA 3RIRA 1WHHA 2XICA 3CCRQ 3JCMf 2LCSA 2DERA 4JJBA 4M7AB 5EC7A 3O5ZA 3VUZA 3UA7A 5LJ5g 5FU7B 2EWNA 1VYUA 4E7HA 1KSWA 2EVRA 4NL3A 2DETA 2FZKB 3MP6A 3QDRB 1QW1A 4PJMA 4F14A 1G3YA 1JJ2S 1OU8A 3X25B 3PMIA 1VQLQ 4BE2A 1YHQA 4HVWA 3G7ZA 3OYEA 1VQ6T 1WQ7A 9ATCB 2FVUA 4MDWA 2QEXQ 1V1CA 4RMOA 2E64A 2YUOA 2DFUA 5KYWA 3OSSC 1H3HA 2I2LA 1VQKA 1J3TA 1PM3A 3CCUT 2CP6A 4LUDA 3FIFA 4XQ3A 2ENMA 4ELZC 4ZTJA 2K3XA 1BI0A 4M77D 3CXCP 2KRNA 3JB9H 3JV3A 3OW2P 2X51A 3V8LA 1CSKA 2LNHB 2LTOA 1PKTA 3E9FA 3M4GA 5KE3A 3G1JA 1M3AA 3QYHB 1E6HA 4A4HA 1BYMA 3A1PA 1NE8A 5CK9A 1IHWA 3H0FA 5L23A 1TUDA 2M02A 3VYHB 1RI9A 2CSQA 2GGRA 4J8OA 2DD5A 4IUTA 2MPXC 4J5YA 3M0PA 1OQKA 3VS1A 4A63B 3I5RA 1QCFA 3M9QA 4E7JA 2JM9A 4HCCA 1HSQA 1KFZA 4M77B 1SPKA 4YTLA 3OYDA 4MZMA 4JJCA 2J6KA 1IREB 4AFQC 4BI8B 3M56A 3OYAA 3S3MA 2FZGB 1K73U 1AHJB 2LQ8A 3OYIA 1R77A 3VS7A 5LJ5j 1BKBA 1BI3A 3TCJA 3EG2A 1NBEB 1D1CA 3V7CA 1K8AC 2GTOA 3I56T 1WJSA 2JS2A 2RK2A 2V1QA 3EFSA 2RM4A 2NLUA 4FT2A 2QDLA 2DPPB 1ABQA 3HL8A 5HKCA 3SB2A 1ZX6A 2V1RA 2EYYA 1UDLA 4BUGA 1K0SA 5GANf 4IKFA 1LVKA 1VQ9T 3EG1A 1VQ7A 2AK5A 4B6MA 2X3WD 3CPWS 4F7UF 1H3ZA 2DBKA 4ZN3A 3JB9I 3QPHA 2RMOA 3OYCA 1RAFB 1E7OA 2C0IA 2KROA 2RI3A 2WSFE 4RG2A 4AMCA 5HK0A 3OBYA 3CCVQ 3JCMX 1C1AA 1HYOA 1YJWT 3A8OB 4E7ZA 4ATOA 2OTJA 3M0UA 1JXOA 3X28B 3L1AA 4OB1B 1UGPB 2RD1A 1PD1A 2XG8D 3JAME 4M7AE 4X34A 4F16A 1BCMA 2RJCA 1KD1C 3C4SA 4NOYA 1S72A 1EFNA 1NM7A 1SSFA 1UGRB 3CCJT 1Y7XA 1TUGB 3UF4A 1WXUA 2F2VA 1YIJQ 1NZ9A 1RUWA 2V8KA 1UTIA 1Q81R 1JJ2P 1BCOA 2KDSA 1ZUKA 4J9GA 3FC3A 3OQ5A 1VQ5Q 4X9DA 3IQLA 1XQHA 3TEEA 2IVWA 5KYNA 3I55Q 1YITQ 4XU3A 1QQJA 3CMAT 4KUIA 1WZOA 3I5SA 2COWA 1FYNA 5IXFA 3R6OA 1UJYA 2BTTA 4F7UA 4OMLA 2QQBA 4KRTA 5LJ5h 3O8VA 1Y71A 5GAN6 2JNGA 1M2VB 4CRIA 2CREA 3QSUA 4QQGA 3G71Q 1HD3A 4M78F 4N0AA 3JCMP 5GAMe 4RCBA 1VQ6A 4CC3A 2BZYA 3G6EQ 3JRZA 3CC7Q 2JT4A 2ZZDA 2ZPIB 2CUDA 3WVEB 2ECZA 3F70A 2CZ7B 5LJ3g 1VIFA 1Q7YU 4FT4A 4J9CA 4XTYA 2NUZA 2EYZA 4M7DC 1Y57A 2FEIA 3CCUA 4M7DA 1M5Q1 1B07A 2ABLA 2KY9A 2RB6A 4BY6C 2DM1A 4M75E 4LUEA 2NUPA 4OMNA 1JQQA 1PHTA 2QTXA 2DZCA 2BZXA 4O5VA 1KK7A 2DTOA 4Z8AA 4UC4A 2YT6A 3UDCA 4JRPA 1YP5A 1ZQ1A 5KCOA 4FYYB 2IIMA 1M3CA 3RBBB 5CKDA 3DLMA 2P4TA 2RO0A 5CKFA 2PU9B 2LQNA 1Q82C 1OI1A 3U23A 1G3TA 4M77E 5FRMA 2RN8A 1YCYA 2WACA 2OAWA 4IUUA 5DY9A 4C0ZA 2BKDN 1YHQT 3PT9A 4C8QE 1XOVA 2DJZA 3ASKA 3R6NA 1UG1A 2DE0X 3CCMT 1K73R 1GXIE 2F2XA 3CC4Q 2E70A 1GL5A 3RMQA 3CXCA 4ZNXA 2VC8A 1U8RA 3E2UA 1FMVA 2RQUA 4M78A 1VQ8Q 5GJWB 1M1KC 3OS2A 4DOVA 1I5OB 3OW2A 5GMKl 1OYXA 2DMOA 1SHFA 4EDUA 4PNOA 5D6XA 1MV0B 4E7KA 1LOJA 2QA4T 4JZ3A 2DX1A 3M0QA 2CP0A 2PUKB 4C5GA 1M2OA 4KH1B 3OBWA 1WHJA 3UA6A 1UE9A 3EGUA 2XD0A 5CIUA 3MP8A 5IHKA 4KH0B 3LLRA 2HL3A 1ABOA 3M0TA 3CPWP 4HXJA 2R57A 5DLOA 1VQOQ 2X9HA 2KAFA 2K79A 5KYYB 1ZBJA 2K5IA 5AYFA 3I56A 2RJEA 4ZGEB 3SWNC 4QW2A 1K8AU 2D9TA 2B8AA 3SWNA 1IXDA 2JVVA 2RHYA 2RQRA 3J7AF 1M4ZA 2YDLA 5LJ3j 3H41A 1X75C 1QKWA 1VQ9A 4FYVB 1UEBA 4KUDK 2KI7A 2V8JA 2QGGA 5GAOm 2EYWA 3KBGA 4C5IA 1KQ2A 3BY7A 2DRKA 2H3EB 1OU9A 3CCQT 1RI0A 2K5LA 2JZ2A 5CO7A 2K9GA 2VYTA 3JCMe 1D0YA 5FWCA 2LX7A 4OMMA 2C0TA 1ACMB 1JU5C 4RTZA 2O31A 3RESA 4C92F 3QHSA 1W4SA 3MPUB 2CT4A 4PJOF 1ZSZA 1PNJA 2F69A 8AT1B 3SFMA 1PD0A 4JUVA 2ZPEB 2EKHA 3OY9A 2HNIA 1LCKA 1BU1A 1TWBA 2DRMA 3VS0A 2H8HA 1I81A 2DAQA 1TXQA 1R8OB 1KD1U 1H641 1OPLA 3I9QA 3EHQA 3EG9A 2K6DA 2VUBA 4PFPA 4C5HA 2DK3A 4JDSA 3TU4K 1YIJT 2PVOB 4Q5WA 1G83A 1MMGA 3M55A 2NUTB 2JTFA 2DXCA 1TSFA 3L2WA 3FDRA 3SD4A 3I55T 4M7DD 3V8JA 2DL4A 2DZ9A 2EAYA 3X26B 3CMAA 3RDVA 1Q7YR 4EMGA 3TSWA 2ED1A 2EJ9A 4JJNK 3MEVA 5J3BA 1YJNQ 2ZPGB 2GQIA 2OTJT 2COZA 2JXBA 4PJJA 1X27A 3SEMA 1VIEA 4R55A 3RUXA 4HA8A 2VXFA 4C0DC 2EKOA 3VUBA 1K1ZA 4DBFA 4PLIA 2CKKA 1VQLA 1VQNQ 2CS7A 3OS5A 3G4ST 4PFZA 5KYUB 2VGMA 1Y96B 3CEYA 4RTYA 5GAN2 2YUNA 2LJ1A 4EMKA 4HKEA 4C92A 1S72T 1JJ2A 1WLPB 1WHLA 3H0IA 3VS6A 1CKBA 3HTRA 4F7UG 1T3SA 2EJFA 3CCSQ 4PJOA 5LJ3h 2L3PA 3CC2T 3CD6Q 1U1SA 5LJ5d 1M27C 2A28A 4JRIA 1FMWA 2J06A 2MYSA 1VQ4Q 3QBYA 4M4ZA 1QVFA 2DVEA 2DILA 4M7DB 2HEQA 2JW4A 2QGFB 2D0NA 2DEQA 3CMET 5A0LA 2K5FA 5IAYA 2COYA 5FLXE 2A7YA 2LX9A 4BY6B 4M7DG 1GFCA 2IG0A 1HXDA 1O9SA 3OMCA 3GP8A 2YUPA 4LDWA 4BI4A 2L3SA 1Q82U 4FW2A 1RLQC 3RMSA 4JLIA 1YI2Q 4RTTA 5FROA 3CCMA 2GBQA 2E65A 1BI2A 2FPEA 3UATA 1QVPA 2E12A 4J9DA 4N4HA 5HCKA 5GAOq 5GANe 3UPUA 2EYXA 4DOWA 2DTHA 2QQAA 1PRLC 2QYZA 4RKUE 2MAMA 3HSBA 2JS0A 1M1KU 1N9SA 1TH7A 3NTIA 1LJOA 5D7UA 2QA4A 1K8AR 2E41A 5IT9E 2P0KA 4ME7A 2D1XA 1WHMA 2XU8A 2Y90A 4NL2A 5EG2A 2LQKA 1YBYA 1YJ9T 1VQPQ 4XTWA 5A2QE 4XAXB 4M78G 5IH2A 3EGXA 5GAOr 3PMTA 4CC2A 1JO8A 2L0AA 1WJQA 3MEUA 2RQTA 1M3BA 1PC0A 1N5ZA 2PQWA 3NTHA 4Z88A 4EPCA 1FX7A 3JCMW 4DBHA 3CBOA 1PSFA 2KBTA 1Q95G 2XIDA 3URGA 5I22A 3CCLT 2EGEA 1IGUA 1TS9A 1QWEA 4CI0C 1C0MA 4FYWB 2QG9B 4FM4B 2A3LA 2KQWA 5D6YA 3SWNB 4A4GA 1JBMA 1MHNA 4OF1A 2A08A 4Y91A 2HZYA 3CCQA 3OS1A 3CPWA 5ECAA 3NTKA 5LL6S 2VKNA 2MWPA 2RJDA 1NPRA 4LD6A 2P84A 3A8HB 3BDLA 1OULA 4FL6A 2HQXA 4MZTA 2DKGA 1ZBXA 4LNPA 3M58A 3J81E 4FSSA 3THKA 1XJWB 2LMJA 3CCEQ 5IXBA 2FYKA 2DA9A 1NYGA 3X24B 4QVCA 4RTXA 4MMKA 1Z9ZA 3EAEA 4CC4B 4C0GA 3M5AA 1QWFA 5HK3A 3RERA 2JJ9A 2FG0A 3GLXA 1SRMA 4JS5A 3EFOA 1SG5A 2KNBB 1MMNA 4KGZB 2D8JA 3V8KA 2EW3A 4JPBW 1YIJA 2K3BA 1R0BG 1BIAA 4E6RA 1FMKA 1VQ5A 4J6WA 3I55A 3OYGA 1M1FA 2A37A 1AZEA 3L2UA 1N8RC 1W6XA 4LN2A 2P0QA 3QZ5B 5GANj 1I1JA 2D0QB 2RQVA 1M9SA 3H0HA 3QUIA 3VYGA 3QJ6A 1YWOA 2FPDA 3G71A 2XDBA 3I35A 1BIBA 3V7RA 3OYJA 3G4SA 2LVMA 2KSSA 3KXTA 4J6YA 3P8BB 3VJPA 4AT1B 4GLKA 3EGDA 1P92A 3CC2A 4C0DB 3OYKA 2YRCA 5GMKe 4XTVA 1K0XA 5HY6A 2M51A 1U1TA 4RTVA 1MMAA 2QQRA 4M7AF 5CKEA 1VQMQ 1UGVA 2XMFA 3MP1A 2KXCA 4LDUA 3MEWA 3OYLA 4OB3B 2ROTA 1VQ4T 3CCRT 1X6GA 4GLMA 4C92G 2AIRB 1RAAB 3CMEA 2R5MA 2P4RA 2CUBA 4PJOG 1VQ7Q 5LJ3d 4CC7A 3OYFA 1MUZA 1KIKA 2LNVA 1OZ3A 2DL7A 3PE0A 4RTUA 4N0AC 1X2KA 2BZ8A 1LNXA 5GAMd 1OPKA 1K76A 2CP7A 2K2MA 4R56A 3MO8A 1VQLT 4P5NA 3EG0A 1IB8A 3T9NA 3MKDA 1SRLA 4J9BA 2QEXT 2OTLQ 2NYSA 1GBQA 2J6FA 5L8RE 1NJIC 3VS4A 3OB9A 2DIQA 4LD9K 2ZPFB 1K9MC 2VGNA 1AT1B 1M30A 1M1GA 4BE1A 5GAMg 1RL2A 1JEGA 2WSCE 3QZ9B 4K11A 2DXBA 1XTDA 2XDPA 1ZUUA 5KYWB 3H8ZA 2HAXA 3ER0A 2E6NA 2EJGA 1YJ9A 4QVDA 1D0ZA 3ZL7C 4HT9A 1N9RA 4M7AA 4M75F 1GCPA 4FYXB 3NGPA 1D1BA 2E5QA 1WHKA 3A98A 4O6JA 2KYBA 2XK0A 4PKCC 2FB7A 4D8KA 2XHCA 1U3OA 3EG3A 3QWXX 2DYBA 2L5QA 2FHDA 3EGXB 3E19A 2GFAA 4M78C 4M77F 3RKYA 1Q81C 3BFMA 2VASA 3CCLA 1MMDA 4C0FA 2CP5A 3META 4RTWA 4IUPA 3GNGA 1VQ6Q 4C8QF 2DYIA 2YSQA 4TVRA 1ZHIA 5GAN3 4BB7A 1SSHA 2K4YA 3OYHA 2M9UA 2D6FA 2HBWA 2EYQA 1JXMA 2OI3A 1WNLA 2HKNA 4JRKA 1KG1A 1UGSB 3C12A 2HSEB 4AG1C 1H92A 2DIGA 1QP3A 2W0ZA 1AZGB 4OVAA 4E7IA 2RJFA 2QK0A 2AZVA 4OGCA 1TOVA 1VYVA 4IUVA 3RNJA 4DEXA 2GNCA 4XTZA 4LDYA 1IRXA 1BBZA 3A5ZB 4M75C 3P8HA 1KHCA 3CQTA 1T0HA 4M75A 1AD5A 1QMCA 5CAIA 2RK1A 2Y4YA 1UHCA 3V7SA 2FZCB 1HJDA 2MK5A 4GY5A 2KVQG 4LXCA 1W70A 2MF2A 6AT1B 5GAMj 3RR6A 3L2ZA 4DBQA 1BK2A 2ZGWA 5GAN8 1GRIA 2L8DA 4OMQA 2E5KA 2CZ1B 3FJ5A 4M77A 3A8GB 4MZPA 4BDYA 1Q86C 3JCMd 2RHUA 4XU2A 3CCVT 2GCXA 1NYFA 3CBMA 3QWYA 5DLQE 1YJNA 2M0OA 3E9GA 3LH5A 4C8QC 2HD0A 3VS5A 1KC8C 1N8RU 4QVZA 1AVZC 3PVQA 4C8QA 3VRZA 3LX7A 2CT3A 1ZSZC 3OA6A 1Z9QA 4L5GA 2KRSA 4BI3A 2HDAA 2VB6A 3TSZA 2FPFA 2J7IA 1VQNA 2DL3A 2O4XA 3JCMg 3RKXA 4JZ4A 3HRTA 2L3RA 4BE0A 2MIOA 4IUQA 4IURA 3OSVA 3P8DA 1ZA2B 2C0OA 1B34A 1X6OA 2M1HA 5I11A 3I56Q 1VQMT 2JUFA 2DF6A 1OOTA 2G3RA 3OYMA 2FRYA 3M53A 1VQ4A 3CCRA 1VQ5T 2BE7D 1OEBA 2DXTA 1G3SA 2F5TX 1YITT 2O9VA 3M54A 4A54A 4II1A 1VQ9Q 2HQEA 4DQ2A 3HFNA 2VWFA 1X69A 4C5EA 5CKHA 2EGCA 3VU3C 5GAN7 2HKQB 5J39A 5KCHA 7AT1B 3G71T 4X9CA 1D1AA 1M90C 2L3QA 2RI2A 2VVKA 3JCMJ 3DB4A 1ARKA 4F7UB 1YJWQ 4EMKC 3G6ET 2QEXA 4C92C 2OTLT 3CC7T 2EGAA 1T3LA 4R0KA 3L2VA 1GCQA 4PJOC 1N6AA 1WA7A 1QVGS 5C6SA 2QAZA 4PK4A 5KE2A 5CQYA 1EX4A 4HCZA 3SDZA 1NJIU 1W2BS 4HVUA 1BI1A 3TREA 4JLGA 3HPWA 3Q1JA 1I8FA 1K9MU 5GAMh 1FXXA 2ATCB 2QI2A 1KQSS 2YLCA 2K57A 1B7TA 2C06A 4M78D 5FU6C 3CCJQ 4J6XA 5CQXA 1VQPA 4MMLA 4J9FA 3DLLA 2DL8A 1O75A 8ATCB 1HK9A 5LJ5e 2NUPB 3N5BB 1U5SA 5CCAA 3H9NA 4PJNA 4WCIA 1M2VA 2EQMA 1PWTA 1QLYA 5D6WA 1IO6A 2JMAA 1WQWA 3NHNA 2PZ1A 2AZSA 3CMAQ 1FWZA 3KFVA 4KGXB 4Z02A 1I07A 4J9HA 4OMFB 2DJQA 1VOMA 2CYZB 3OYBA 3CC4T 3BDUA 3REAB 2DLPA 3HKSA 1ZLMA 4M7AG 5IN1A 4X1VA 1YNZA 5GANd 1PRMC 5I2SA 1VQ8T 2A0FB 2HSPA 2LRQA 4XTUA 3MJXA 1Q81U 4M75D 2L89A 2ZAEA 1Q7YC 5DM7R 2YHTA 4KULA 3LW5E 2KE9A 1JB0E 2JM8A 4A4EA 1A0NB 4M78B 3FJPA 4AFUC 1X2QA 4JRQA 5A0GA 2RQWA 1UGQB 5GANg 4HCKA 2IPOB 1QVFS 4FIBA 3EFRA 1EZZB 2CP2A 2X4YA 3FRNA 3CCEA 1VQOT 4JJDA 5M9OA 2HQHA 4BD3A 3J80E 2YUQA 3DKMA 3JCMQ 1N27A 2O2OA 4C8QD 3JB9F 2M0YA 2X4WA 5CKBA 3C95A 1KQ1A 3D7SB 5C0MA 2JMCA 3A8MB 5A0DA 2LQWA 5GMKi 4RCCA 1N8RR 2DVJA 4J9IA 4E2FB 3AHUA 4A4KA 4PLLA 2CP3A 2PNIA 3EH1A 2E4HA 1WIEA 3LWHA 1E6GA 1KJWA 4DBRA 2LP5A 2P0PA 4M75B 1YHQQ 2JTMA 2X4XA 1RADB 5J26A 1OZ2A 5GMKm 3CCMQ 4Z89A 1RAIB 3ZFJA 3CCVA 4L59A 4M75G 2K7AA 2DD4A 1KD1R 1D3BA 1BB9A 1WI7A 1UJ0A 5GAOl 1VQKQ 2YLBA 4B9XA 5LJ5f 1Q86U 3JB9J 1AEYA 2YRDA 2E10A 2YXYA 1W1FA 1M8MA 4ZN1A 1KC8U 1PSEA 1GBRA 2OX7A 1QKXA 1V76A 2QA4Q 5KYXA 1NLPC 2OAUA 4ELYC 5KYYA 4XU1A 3BW1A 4M77G 3WXMB 2OJ2A 4C8QB 3JCMh 2FL7A 2LCLA 2EIFA 3A8LB 5FRNA 3FEOA 4MDXA 1M8VA 1ZSZB 4C8QG 2GFUA 2O4XB 3MCAB 2DEUA 1VQMA 2RH2A 3ZBDA 4C92D 4F7UE 4BDZA 2R5AA 3HP9A 1RAEB 4PJOD 2O9SA 3EG9B 2DO3A 2QQSA 1YITA 2PUOB 2EQIA 1I4K1 1K4US 1B34B 2Z0WA 1NEGA 5I2MA 2LJ3A 4XU0A 1YJNT 4GBQA 1QVGP 3M57A 1ZA1B 1NJIR 4N4GA 1W2BP 2BE9B 1K9MR 2QASA 2X4JA 4HVVA 3HFOA 3JCMb 1KQSP 3CCQQ 3OMGA 3TVTA 1VQNT 4M7DE 4OMPA 2DL5A 2QXFA 3PGGA 3QKJA 4N4IA 4OP0A 4QT7A 4BACA 4OB2B 1PCXA 3G6EA 3EHRA 3OS0A 1M90U 2OTLA 3CC7A 2Y4XA 2CZ0B 2XKOC 3H6ZA 1SKUB 3C94A 3E1SA 1YCSB 1G5VA 2F5KA 3CCST 3JSCA 2EQKA 3CD6T 2JTEA 1YWPA 2KGTA 4M7DF 4E7LA 1Q82R 1IGQA 3QIIA 2BIVA 3OYNA 1QCOA 2DTIA 2PVGB 2W10A 4EMKB 1NPPA 2QTVA 4C92B 2NUTA 1Y0MA 2WSEE 3HRUA 3SHWA 1D0XA 1AOJA 2CGHA 4DA4A 4F04B 1SEMA 2BUDA 4PJOB 4ZGDB 1MNEA 1B3QA 1UUEA 1TG0A 1EIFA 2KR3A 3VS3A 2QDYB 4QQDA 5GAOp 2LCCA 1XNIA 3JCMc 4ANJA 3OYYA 2E6ZA 3PVLA 1SHGA 1UB4A 1WHGA 2KEAA 1M1KR 5FU6B 1WXBA 4M78E 2EPDA 1G8XA 1YI2T 4PL6A 2HBPA 2XDDA 2RHZA 1WJRA 3CBPA 1OV3A 5KYUA 1Y96A 3M0SA 3CC4A 3L42A 1UECA 2RNAA 2OTJQ 1WYXA 1S1NA 5LJ3e 2SEMA 1VQ8A 1QVFP 2KMTA 2ZPHB 2F1LA 3AT1B 4A53A 5GAOn 3GNFB 3G4SQ 1RACB 1RAHB 5GAN5 1PG5B 2CDTA 3QO3A 1AWOA 2JN0A 3GPLA 2CZ6B 2LZ6B 4RG8A 1G3WA 4FSXA 2J05A 2EQUA 2RHIA 3QG1A 1S72Q 3VV0A 1TU0B 2XI9A 4OGEA 1D09B 4XK8E 4D8DA 1OX9A 3QYGB 1I0CA 3PTAA 1I5LA 3RKWA 1VQPT 3CC2Q 5IHNA 4M7AC 2FO0A 1WX6A 3S3NA 3QJYA 5GANh 3GF5A 5FU7C 2LJ0A 4VUBA 4LE9A 2H3JA 1OX8A 2FRWA 1AWJA 1WXTA 1VQOA 2LC4A 1IZ6A 4FCYA 3MEAA 1NG2A 3NPFA 2X35A 1JRIA 1MV3A 2RA2A 3CMEQ 1X43A 1X01A 4NS5A 2X3XD 4E47A 3PNWC 1VYTA 1X6BA 2AT1B 4E7SA 1UHFA 1Q86R 2HMAA 4QQ6A 1WFWA 2PTKA 3HHTB 2V8IA 1KC8R 1C6VX 4ORZA 1GFDA 3LH0A 5CVIA 1G2BA 4J7FA 2YWWA 1QP2A 2KK4A 4LDVA 3INZA
chains in the Genus database with same CATH topology
3PMTA 2RJCA 4ZGJB 1KD1C 3C4SA 4C5EA 4NOYA 1WJQA 3JB9D 3MEUA 5CKHA 1S72A 1VQKT 1SSFA 3VU3C 5GAN7 5J39A 4ZTFA 5KCHA 1UGRB 2PQWA 5GMKj 3CCJT 4WF2A 3NTHA 3L2QA 3G71T 1Y7XA 4X9CA 2R58A 1M90C 4EPCA 2RI2A 2RHXA 1FX7A 3JCMJ 2JOYA 3DB4A 3JCMW 4F7UB 1NZ9A 3CBOA 4EMKC 3G6ET 2QEXA 1PSFA 4C92C 5GAOr 2V8KA 3CCET 1D3BB 2OTLT 3CC7T 2XIDA 3URGA 3CCLT 4FU6A 2KDSA 3L2VA 3FC3A 4CI0C 3OQ5A 4PJOC 4X9DA 1N6AA 1XQHA 3TEEA 2IVWA 4FM4B 2A3LA 1QVGS 2ZPBB 5C6SA 2M16A 2KQWA 5D6YA 3SWNB 4A4GA 5KE2A 1JBMA 5CQYA 4XU3A 3VKIA 4HCZA 5LJ3f 1MHNA 3SDZA 3CMAT 4OF1A 4KUIA 2ZCFB 1NJIU 1W2BS 3LGFA 1BI1A 3TREA 4JLGA 3R6OA 4Y91A 3HPWA 3Q1JA 3CCQA 3OS1A 1I8FA 1VUBA 4F7UA 1K9MU 5GAMh 3CPWA 1FXXA 3NTKA 5LL6S 2QI2A 2QQ9A 1KQSS 1MGQA 2K57A 2QQBA 2MWPA 2RJDA 2YLCA 4B9WA 5GAMf 3PFSA 5LJ5h 3O8VA 1Y71A 5GAN6 2C06A 1NPRA 4M78D 3CXCS 2JNGA 4CRIA 4LD6A 5FU6C 3A8HB 3BDLA 3L2RA 3QSUA 4J6XA 5CQXA 4FL6A 4QQGA 1VQPA 4MMLA 4M78F 4N0AA 3JCMP 5GAMe 3DLLA 4M77C 1O75A 4V2SA 4RCBA 1HK9A 2HQXA 4MZTA 2DKGA 1ZBXA 5LJ5e 3M58A 3J81E 3PIOA 3OW2S 1VQ6A 4XTXA 3N5BB 3PIPA 3JRZA 2FYKA 2ZZDA 2ZPIB 3WVEB 3X24B 5CCAA 3F70A 2CZ7B 4QVCA 3X20B 2RI5A 4MMKA 5LJ3g 1VIFA 3EAEA 1Q7YU 4HCBA 4FT4A 4XTYA 4C0GA 2EQMA 5D6WA 4M7DC 4C92E 3M5AA 4L6V5 1WQWA 5HK3A 3CCUA 3RERA 4M7DA 1M5Q1 4Y28E 3JB9G 1FWZA 1Y07A 3GLXA 3QXEB 4Z02A 2KY9A 4PJOE 4OMFB 2RB6A 3NFCA 3UT1A 1V29B 4M75E 4BY6C 3LWIA 4KBMB 4JS5A 1K73C 2CYZB 1WGSA 3FB9A 3V8KA 2GF7A 3BDUA 3OYBA 3CC4T 1YJWA 1YIJA 2QTXA 2DZCA 3HKSA 4O5VA 4M7AG 3UWNA 5IN1A 2DTOA 4UC4A 3UDCA 5GANd 2LT1A 4JRPA 1BIAA 5CR2A 1ZQ1A 5I2SA 5KCOA 1VQ8T 1VQ5A 2LRQA 4XTUA 5CKDA 3S6WA 4J6WA 4M75D 3I55A 1KHIA 3CCSA 1Q81U 2GQVA 2L89A 3DLMA 3CD6A 2P4TA 1Q7YC 2RO0A 3OYGA 5CKFA 1M1FA 2PU9B 5DM7R 1Q82C 1OI1A 3L2UA 4JS4A 1N8RC 2YHTA 1G3TA 3LW5E 4KULA 1JB0E 3MHXA 2P0QA 3QZ5B 3JCMV 4M77E 5GANj 2D0QB 1WPYA 4A4EA 5FRMA 4M78B 3M4YA 1QVGA 1M9SA 3FJPA 4J83A 3QUIA 3VYGA 1YCYA 2WACA 3QJ6A 5A0GA 3DB3A 4JRQA 1UGQB 3ME9A 4IUUA 5GANg 4LDXA 3ZEHA 3CCJA 1W2BA 5DY9A 4C0ZA 3G71A 2BKDN 1YHQT 2XDBA 4A4FA 3PT9A 1QVFS 1BIBA 4J7IA 3V7RA 1XOVA 4C8QE 2DJZA 3ASKA 3OYJA 4FIBA 2DXUA 3EFRA 2E1HA 2EFIA 2LVMA 2K2VA 3G4SA 3CCMT 1KQSA 1GXIE 2KSSA 2X4YA 3KXTA 2E70A 3FRNA 3RMQA 4J6YA 3CXCA 3CCEA 1VQ7T 2VC8A 3P8BB 1VQOT 1U8RA 5M9OA 3M59A 5GMKh 4M78A 2LT4A 3VJPA 4BD3A 3J80E 1M1KC 3DKMA 4GLKA 3OS2A 3JCMQ 1N27A 4KT0E 4C8QD 4DOVA 3JB9F 2X4WA 5CKBA 3C95A 1KQ1A 1P92A 3OW2A 4HT8A 3CC2A 5GMKl 1OYXA 5C0MA 4C0DB 1YI2A 3OYKA 4M7AD 3A8MB 3FLGA 5A0DA 4EDUA 5GMKe 5I21A 4PNOA 4XTVA 5D6XA 5HY6A 1U1TA 4E7KA 5GMKi 1LOJA 4RCCA 2QQRA 4M7AF 5CKEA 2QA4T 3AHUA 3MP1A 2MMPA 4LDUA 3LYIA 4A4KA 3GIBA 4EMHA 2YRVA 3MEWA 4PLLA 2PUKB 3OYLA 3CPFA 4C5GA 4OB3B 2MI6A 3LWHA 1VQ4T 3OBWA 3OYNA 3CCRT 2P0PA 4M75B 4OB0B 3WVDB 2JTMA 2XD0A 2X4XA 4C92G 5CIUA 5KH6A 5GAN4 3MP8A 5J26A 3CMEA 2R5MA 1OZ2A 5GMKm 3LLRA 1DJ7B 3ZFJA 2VV5A 2PVDB 4PJOG 3CCVA 4L59A 2R57A 4M75G 5DLOA 5LJ3d 2DD4A 2KAFA 1D3BA 2K5IA 5AYFA 3OYFA 2LNVA 3KUFA 5GAOl 1OZ3A 3I56A 3GOXA 2YLBA 4B9XA 2RJEA 3S3OA 5LJ5f 4N0AC 1Q86U 4D6WA 2K3YA 3JB9J 4ZGEB 3SWNC 1LNXA 5GAMd 2E10A 4QW2A 1K8AU 2D9TA 2B8AA 3SWNA 3MO8A 4R56A 2MWOA 2JVVA 2RHYA 1VQLT 3J7AF 2VXEA 2LDMA 3LGLA 2EQJA 1M4ZA 4P5NA 4ZN1A 5LJ3j 1PSEA 1KC8U 3HRSA 3T9NA 2O01E 2QEXT 1X75C 2OAUA 1VQ9A 2AHJB 1UEBA 5L8RE 4ELYC 4XU1A 3RIRA 3BW1A 4M77G 1NJIC 3OB9A 3WXMB 2XICA 4KUDK 2V8JA 5GAOm 2DIQA 4LD9K 4C8QB 2ZPFB 2FL7A 2LCLA 3JCMh 1K9MC 2VGNA 3KBGA 3JCMf 4C5IA 1KQ2A 3BY7A 1M1GA 4M7AB 4BE1A 2EIFA 5GAMg 3A8LB 1RL2A 5FRNA 3VUZA 2WSCE 3FEOA 3QZ9B 4MDXA 1M8VA 2DXBA 4C8QG 2GFUA 3CCQT 1XTDA 5LJ5g 2O4XB 1RI0A 2K5LA 2JZ2A 2XDPA 5CO7A 5FU7B 2VYTA 2EWNA 3MCAB 3JCMe 4E7HA 3H8ZA 4NL3A 1VQMA 2HAXA 2RH2A 3MP6A 3ZBDA 4C92D 3ER0A 1QW1A 3QDRB 4F7UE 4BDZA 2E6NA 2R5AA 2EJGA 1YJ9A 4QVDA 1G3YA 3RESA 4C92F 3HP9A 1JJ2S 3X25B 4HT9A 3QHSA 4PJOD 3PMIA 1W4SA 4BE2A 2DO3A 2QQSA 1N9RA 1YITA 1YHQA 2PUOB 4M7AA 3G7ZA 3OYEA 1I4K1 4PJOF 1VQ6T 1WQ7A 2FVUA 4MDWA 4M75F 1B34B 2F69A 4RMOA 3SFMA 2E64A 4JUVA 2E5QA 2ZPEB 3OY9A 5I2MA 2HNIA 4XU0A 1YJNT 3OSSC 4O6JA 2I2LA 3M57A 2XK0A 1VQKA 4PKCC 2FB7A 1I81A 2DAQA 4N4GA 1R8OB 2X4JA 3CCUT 2XHCA 1KD1U 3HFOA 1H641 3FIFA 4XQ3A 3JCMb 4ELZC 2VUBA 4ZTJA 2K3XA 1BI0A 2L5QA 2FHDA 3OMGA 4M77D 4C5HA 1VQNT 2QXFA 3QKJA 3PGGA 2DK3A 4N4IA 4OP0A 4M7DE 4JDSA 4BACA 4OB2B 3E19A 3G6EA 3TU4K 1YIJT 2PVOB 2GFAA 4Q5WA 4M78C 4M77F 3RKYA 3OS0A 1Q81C 1M90U 3M55A 3CC7A 2OTLA 2Y4XA 2JTFA 2CZ0B 2DXCA 2XKOC 3BFMA 3CCLA 3H6ZA 3L2WA 3JB9H 3FDRA 4C0FA 3C94A 3E1SA 3META 1G5VA 2F5KA 4IUPA 3SD4A 3CCST 3JSCA 3I55T 4M7DD 3GNGA 3V8JA 2EQKA 2DZ9A 3CD6T 2EAYA 3X26B 4C8QF 3CMAA 3V8LA 2LTOA 4EMGA 4M7DF 4E7LA 3E9FA 3M4GA 4TVRA 1ZHIA 3QIIA 5KE3A 2BIVA 4BB7A 2EJ9A 5GAN3 2DTIA 2PVGB 3MEVA 2K4YA 3QYHB 5J3BA 4A4HA 3OYHA 2M9UA 1NE8A 4EMKB 2D6FA 1BYMA 1NPPA 2ZPGB 4C92B 5CK9A 2OTJT 2WSEE 3HRUA 2EYQA 1WNLA 2CGHA 4DA4A 1VIEA 4JRKA 1KG1A 1UGSB 3VYHB 2BUDA 4R55A 3RUXA 4HA8A 4ZGDB 4PJOB 3C12A 2VXFA 4C0DC 4JJNK 2EKOA 3VUBA 2DIGA 4PLIA 1QP3A 2CKKA 1VQLA 4OVAA 2DD5A 2CS7A 1EIFA 3OS5A 4IUTA 4J8OA 3G4ST 2RJFA 4J5YA 4E7IA 2QDYB 4QQDA 2VGMA 5GAOp 1Y96B 2LCCA 4OGCA 1XNIA 4IUVA 3CEYA 5GAN2 3JCMc 4EMKA 4HKEA 4C92A 1S72T 4XTZA 3OYYA 1JJ2A 2E6ZA 3M9QA 4LDYA 1UB4A 3A5ZB 4F7UG 4E7JA 4M75C 2EJFA 1KHCA 3P8HA 5FU6B 4M78E 4HCCA 5LJ3h 4PJOA 3CC2T 4M75A 1U1SA 1YI2T 5LJ5d 5CAIA 2RK1A 2HBPA 2Y4YA 4PL6A 2XDDA 4M77B 4JRIA 2RHZA 1WJRA 3V7SA 3CBPA 4YTLA 1Y96A 4GY5A 3OYDA 3CC4A 2KVQG 3L42A 4MZMA 1IREB 5LJ3e 4BI8B 3M56A 3OYAA 3S3MA 2MF2A 5GAMj 1K73U 1AHJB 2LQ8A 3L2ZA 3QBYA 3OYIA 1VQ8A 2ZGWA 2KMTA 2DVEA 5GAN8 2L8DA 2ZPHB 5LJ5j 4A53A 1QVFA 4M7DB 5GAOn 1BKBA 3GNFB 2DEQA 3CMET 1BI3A 2CZ1B 3TCJA 5GAN5 5A0LA 2K5FA 5IAYA 4M77A 4MZPA 3A8GB 4BDYA 1Q86C 3QO3A 2JN0A 3JCMd 2CZ6B 3GPLA 2RHUA 4XU2A 5FLXE 2A7YA 2GCXA 2LX9A 4RG8A 4BY6B 3V7CA 1G3WA 3CCVT 4M7DG 4FSXA 2RHIA 2EQUA 3QG1A 1K8AC 2IG0A 1HXDA 1O9SA 3CBMA 5DLQE 3OMCA 3VV0A 3I56T 3GP8A 1YJNA 2M0OA 3E9GA 1WJSA 2RK2A 2XI9A 4LDWA 4OGEA 3EFSA 4BI4A 2HD0A 2RM4A 2NLUA 4C8QC 4FT2A 1Q82U 4XK8E 1KC8C 3QYGB 1N8RU 4QVZA 3PTAA 1I5LA 3RKWA 4C8QA 1VQPT 3RMSA 2DPPB 4JLIA 4M7AC 3HL8A 3LX7A 5HKCA 3SB2A 3S3NA 3QJYA 5GANh 3OA6A 4L5GA 5FROA 4BI3A 3GF5A 4BUGA 5FU7C 5GANf 3CCMA 4IKFA 1VQNA 2E65A 2O4XA 1VQ9T 1BI2A 4VUBA 1VQ7A 2H3JA 3JCMg 1QVPA 3RKXA 1VQOA 2LC4A 2E12A 3CPWS 4N4HA 4F7UF 1IZ6A 3HRTA 5GAOq 5GANe 1H3ZA 3MEAA 2L3RA 4BE0A 3UPUA 4DOWA 2X35A 4ZN3A 1JRIA 3JB9I 3QPHA 2DTHA 2QQAA 4IUQA 3OYCA 2RA2A 4IURA 4RKUE 1X01A 4NS5A 2MAMA 3HSBA 4E47A 3PNWC 2RI3A 2WSFE 3OSVA 4RG2A 3P8DA 3OBYA 5HK0A 1M1KU 1N9SA 1TH7A 3NTIA 3JCMX 1B34A 1LJOA 1X6OA 2M1HA 1YJWT 2QA4A 3A8OB 2E41A 2JUFA 1VQMT 4QQ6A 4ATOA 5IT9E 2P0KA 4ME7A 2OTJA 2XU8A 2G3RA 2Y90A 3X28B 3HHTB 4NL2A 2V8IA 2LQKA 5EG2A 1YBYA 3L1AA 3M53A 3OYMA 1VQ4A 1YJ9T 3CCRA 1VQ5T 4OB1B 4XTWA 1UGPB 5A2QE 2RD1A 4XAXB 2XG8D 2DXTA 3LH0A 1G3SA 2F5TX 1YITT 5CVIA 4M78G 3M54A 4J7FA 3JAME 4A54A 4II1A 1QP2A 2KK4A 4LDVA 2HQEA 4DQ2A 3INZA 3HFNA 4M7AE 4X34A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OYG A;  4C5I A;  3PMT A;  2RJC A;  1OI1 A;  3L2U A;  4E7J A;  4BE1 A;  3C4S A;  4C5E A;  3P8H A;  1KHC A;  1WJQ A;  3MEU A;  5FRN A;  1SSF A;  3FEO A;  5J39 A;  2GFU A;  4ZTF A;  2O4X B;  1RI0 A;  4A4E A;  2JZ2 A;  2XDP A;  5KCH A;  4PL6 A;  5FRM A;  2VYT A;  2PQW A;  3NTH A;  3L2Q A;  4E7H A;  2RHZ A;  1WJR A;  3H8Z A;  2WAC A;  2R58 A;  3QJ6 A;  3DB3 A;  3MP6 A;  3ME9 A;  4IUU A;  2RI2 A;  4BDZ A;  4GY5 A;  2RHX A;  3OYD A;  3L42 A;  3ZEH A;  2E6N A;  3DB4 A;  2R5A A;  2BKD N;  4A4F A;  3OYA A;  3S3M A;  3ASK A;  3OYJ A;  2EFI A;  3PMI A;  2LVM A;  3QBY A;  2QQS A;  3OYI A;  4BE2 A;  2X4Y A;  3OYE A;  4FU6 A;  2L8D A;  3L2V A;  3FC3 A;  3OQ5 A;  5M9O A;  5C6S A;  2E5Q A;  2M16 A;  5D6Y A;  4A4G A;  4BD3 A;  5IAY A;  5KE2 A;  3OY9 A;  4BDY A;  4HCZ A;  1MHN A;  2RHU A;  3OS2 A;  1N27 A;  2X4W A;  2XK0 A;  3LGF A;  2RHI A;  2EQU A;  2IG0 A;  3Q1J A;  1OYX A;  5C0M A;  3OMC A;  3OS1 A;  2DAQ A;  4N4G A;  2M0O A;  3OYK A;  3E9G A;  1WJS A;  3FLG A;  3NTK A;  4EDU A;  2NLU A;  5D6X A;  4B9W A;  2MWP A;  2RJD A;  4QVZ A;  4E7K A;  3PFS A;  3O8V A;  2QQR A;  4E7L A;  4ZTJ A;  2K3X A;  3MP1 A;  3LX7 A;  2FHD A;  3OMG A;  3LYI A;  4LD6 A;  4C5H A;  3BDL A;  3QKJ A;  4CRI A;  3L2R A;  2YRV A;  3MEW A;  4N4I A;  4FL6 A;  4PLL A;  4QQG A;  4BAC A;  3S3N A;  3OA6 A;  3OYL A;  4Q5W A;  2GFA A;  5FRO A;  4C5G A;  3OS0 A;  4IKF A;  2JTF A;  2O4X A;  3H6Z A;  2HQX A;  3L2W A;  3FDR A;  2X4X A;  5CIU A;  5KH6 A;  3MP8 A;  5J26 A;  3MET A;  4N4H A;  1G5V A;  2R5M A;  1OZ2 A;  2F5K A;  4IUP A;  3LLR A;  3SD4 A;  1H3Z A;  3MEA A;  2L3R A;  3F70 A;  4BE0 A;  2EQK A;  2X35 A;  2RI5 A;  4L59 A;  2R57 A;  3EAE A;  3OYC A;  4IUQ A;  4IUR A;  2LTO A;  2EQM A;  4NS5 A;  3E9F A;  3OYF A;  5D6W A;  3QII A;  5KE3 A;  3KUF A;  2BIV A;  3PNW C;  1OZ3 A;  3OYN A;  3GOX A;  3MEV A;  2RI3 A;  2RJE A;  4RG2 A;  4A4H A;  4B9X A;  3P8D A;  3OYH A;  3S3O A;  3NTI A;  2K3Y A;  4Z02 A;  2M1H A;  4QW2 A;  2D9T A;  2B8A A;  3UT1 A;  3MO8 A;  4QQ6 A;  2MWO A;  2RHY A;  2P0K A;  2BUD A;  1WGS A;  2LDM A;  3LGL A;  2EQJ A;  2GF7 A;  2G3R A;  3OYB A;  2EKO A;  3OYM A;  2DIG A;  4PLI A;  3UWN A;  5IN1 A;  2CKK A;  4UC4 A;  4OVA A;  4IUT A;  4E7I A;  2RJF A;  3LH0 A;  5KCO A;  4QQD A;  2LCC A;  1XNI A;  2LRQ A;  3CEY A;  4IUV A;  3OB9 A;  3S6W A;  4II1 A;  2DIQ A;  2HQE A;  2L89 A;  3DLM A;  3M9Q A;  4X34 A;  2RO0 A; 
#chains in the Genus database with same CATH topology
 1QCN A;  4ZGJ B;  2AKK A;  2CH4 A;  3JB9 D;  1VQK T;  2AKL A;  4Y92 A;  2KXD A;  1WDX A;  4ZTF A;  3CCU Q;  5GMK j;  4WF2 A;  1YFN A;  3L2Q A;  3M0R A;  2R58 A;  2RHX A;  2JOY A;  2ESW A;  3CCE T;  2KT1 A;  4EIK A;  1D3B B;  1SF9 A;  2GTJ A;  1H8K A;  3QDF A;  4FW1 A;  4FU6 A;  1YJ9 Q;  1RAB B;  2KYM A;  3TQ7 P;  2MOX A;  2ZPB B;  2M16 A;  3VKI A;  5LJ3 f;  2ZCF B;  3LGF A;  2DNU A;  5KYX B;  1VUB A;  5AT1 B;  2QQ9 A;  1MGQ A;  4B9W A;  5GAM f;  3PFS A;  5FWB A;  1ZSG A;  3CXC S;  1ZUY A;  3L2R A;  2MCN A;  4DEY A;  4M77 C;  1M90 R;  4V2S A;  4IIO A;  3EFO B;  3OW2 S;  3PIO A;  2V26 A;  4XTX A;  4ESR A;  3VRY A;  3PIP A;  3CCL Q;  3X20 B;  2RI5 A;  4OMO A;  4HCB A;  3BE3 A;  4C92 E;  2D8H A;  4L6V 5;  4QKU A;  4Y28 E;  3JB9 G;  2ROL A;  1Y07 A;  3QXE B;  1IHV A;  4PJO E;  3UT1 A;  3NFC A;  3LWI A;  1K73 C;  1V29 B;  1AWW A;  4KBM B;  1WGS A;  3FB9 A;  2GF7 A;  1YJW A;  3UWN A;  4AFS C;  2LT1 A;  1NLO C;  5GJV B;  5CR2 A;  2NWM A;  4WTO B;  1VA7 A;  2CH4 W;  3S6W A;  2L2P A;  1T0J A;  3CCS A;  1KHI A;  2GQV A;  2HCK A;  3CD6 A;  4AG2 C;  1AWX A;  2J6O A;  4IIM A;  1RAG B;  4JS4 A;  1LPL A;  3NMZ C;  4KGV B;  2RPN A;  2HL5 C;  3MHX A;  3JCM V;  1WPY A;  2B86 A;  3M4Y A;  1QVG A;  4J83 A;  3VS2 A;  4AFZ C;  3DB3 A;  4J9E A;  3ME9 A;  3GBQ A;  1F1B B;  4LDX A;  3EGD B;  3ZEH A;  3CCJ A;  1W2B A;  4A4F A;  4J7I A;  1MND A;  2SRC A;  2DXU A;  1KQS A;  2E1H A;  2EFI A;  2K2V A;  4RUG A;  3ULR B;  1VQ7 T;  1NEB A;  5GMK h;  3M59 A;  2EBP A;  2LT4 A;  2I0N A;  1RLP C;  4KT0 E;  4PFO A;  2CSI A;  4HT8 A;  2G6F X;  1YI2 A;  1TTH B;  4M7A D;  3FLG A;  1CKA A;  1UFF A;  2KRM A;  5I21 A;  1PKS A;  1TUC A;  2MMP A;  3LYI A;  1GCQ C;  3GIB A;  4EMH A;  2YRV A;  3CPF A;  2MI6 A;  3WVD B;  4OB0 B;  3EH2 A;  5KH6 A;  5GAN 4;  2KT8 A;  1DJ7 B;  5IHI A;  2RF0 A;  2VV5 A;  2PVD B;  1R0C B;  2F2W A;  2E3I A;  3KUF A;  3GOX A;  1U06 A;  3S3O A;  5FW9 A;  4D6W A;  2K3Y A;  4PJL A;  2A36 A;  4F17 A;  1K9A A;  2MWO A;  2DBM A;  2ED0 A;  2VXE A;  2LDM A;  3LGL A;  2E3H A;  2EQJ A;  2O88 A;  3HRS A;  1YN8 A;  2O01 E;  3REB B;  2AHJ B;  3C0C A;  3RIR A;  1WHH A;  2XIC A;  3CCR Q;  3JCM f;  2LCS A;  2DER A;  4JJB A;  4M7A B;  5EC7 A;  3O5Z A;  3VUZ A;  3UA7 A;  5LJ5 g;  5FU7 B;  2EWN A;  1VYU A;  4E7H A;  1KSW A;  2EVR A;  4NL3 A;  2DET A;  2FZK B;  3MP6 A;  3QDR B;  1QW1 A;  4PJM A;  4F14 A;  1G3Y A;  1JJ2 S;  1OU8 A;  3X25 B;  3PMI A;  1VQL Q;  4BE2 A;  1YHQ A;  4HVW A;  3G7Z A;  3OYE A;  1VQ6 T;  1WQ7 A;  9ATC B;  2FVU A;  4MDW A;  2QEX Q;  1V1C A;  4RMO A;  2E64 A;  2YUO A;  2DFU A;  5KYW A;  3OSS C;  1H3H A;  2I2L A;  1VQK A;  1J3T A;  1PM3 A;  3CCU T;  2CP6 A;  4LUD A;  3FIF A;  4XQ3 A;  2ENM A;  4ELZ C;  4ZTJ A;  2K3X A;  1BI0 A;  4M77 D;  3CXC P;  2KRN A;  3JB9 H;  3JV3 A;  3OW2 P;  2X51 A;  3V8L A;  1CSK A;  2LNH B;  2LTO A;  1PKT A;  3E9F A;  3M4G A;  5KE3 A;  3G1J A;  1M3A A;  3QYH B;  1E6H A;  4A4H A;  1BYM A;  3A1P A;  1NE8 A;  5CK9 A;  1IHW A;  3H0F A;  5L23 A;  1TUD A;  2M02 A;  3VYH B;  1RI9 A;  2CSQ A;  2GGR A;  4J8O A;  2DD5 A;  4IUT A;  2MPX C;  4J5Y A;  3M0P A;  1OQK A;  3VS1 A;  4A63 B;  3I5R A;  1QCF A;  3M9Q A;  4E7J A;  2JM9 A;  4HCC A;  1HSQ A;  1KFZ A;  4M77 B;  1SPK A;  4YTL A;  3OYD A;  4MZM A;  4JJC A;  2J6K A;  1IRE B;  4AFQ C;  4BI8 B;  3M56 A;  3OYA A;  3S3M A;  2FZG B;  1K73 U;  1AHJ B;  2LQ8 A;  3OYI A;  1R77 A;  3VS7 A;  5LJ5 j;  1BKB A;  1BI3 A;  3TCJ A;  3EG2 A;  1NBE B;  1D1C A;  3V7C A;  1K8A C;  2GTO A;  3I56 T;  1WJS A;  2JS2 A;  2RK2 A;  2V1Q A;  3EFS A;  2RM4 A;  2NLU A;  4FT2 A;  2QDL A;  2DPP B;  1ABQ A;  3HL8 A;  5HKC A;  3SB2 A;  1ZX6 A;  2V1R A;  2EYY A;  1UDL A;  4BUG A;  1K0S A;  5GAN f;  4IKF A;  1LVK A;  1VQ9 T;  3EG1 A;  1VQ7 A;  2AK5 A;  4B6M A;  2X3W D;  3CPW S;  4F7U F;  1H3Z A;  2DBK A;  4ZN3 A;  3JB9 I;  3QPH A;  2RMO A;  3OYC A;  1RAF B;  1E7O A;  2C0I A;  2KRO A;  2RI3 A;  2WSF E;  4RG2 A;  4AMC A;  5HK0 A;  3OBY A;  3CCV Q;  3JCM X;  1C1A A;  1HYO A;  1YJW T;  3A8O B;  4E7Z A;  4ATO A;  2OTJ A;  3M0U A;  1JXO A;  3X28 B;  3L1A A;  4OB1 B;  1UGP B;  2RD1 A;  1PD1 A;  2XG8 D;  3JAM E;  4M7A E;  4X34 A;  4F16 A;  1BCM A;  2RJC A;  1KD1 C;  3C4S A;  4NOY A;  1S72 A;  1EFN A;  1NM7 A;  1SSF A;  1UGR B;  3CCJ T;  1Y7X A;  1TUG B;  3UF4 A;  1WXU A;  2F2V A;  1YIJ Q;  1NZ9 A;  1RUW A;  2V8K A;  1UTI A;  1Q81 R;  1JJ2 P;  1BCO A;  2KDS A;  1ZUK A;  4J9G A;  3FC3 A;  3OQ5 A;  1VQ5 Q;  4X9D A;  3IQL A;  1XQH A;  3TEE A;  2IVW A;  5KYN A;  3I55 Q;  1YIT Q;  4XU3 A;  1QQJ A;  3CMA T;  4KUI A;  1WZO A;  3I5S A;  2COW A;  1FYN A;  5IXF A;  3R6O A;  1UJY A;  2BTT A;  4F7U A;  4OML A;  2QQB A;  4KRT A;  5LJ5 h;  3O8V A;  1Y71 A;  5GAN 6;  2JNG A;  1M2V B;  4CRI A;  2CRE A;  3QSU A;  4QQG A;  3G71 Q;  1HD3 A;  4M78 F;  4N0A A;  3JCM P;  5GAM e;  4RCB A;  1VQ6 A;  4CC3 A;  2BZY A;  3G6E Q;  3JRZ A;  3CC7 Q;  2JT4 A;  2ZZD A;  2ZPI B;  2CUD A;  3WVE B;  2ECZ A;  3F70 A;  2CZ7 B;  5LJ3 g;  1VIF A;  1Q7Y U;  4FT4 A;  4J9C A;  4XTY A;  2NUZ A;  2EYZ A;  4M7D C;  1Y57 A;  2FEI A;  3CCU A;  4M7D A;  1M5Q 1;  1B07 A;  2ABL A;  2KY9 A;  2RB6 A;  4BY6 C;  2DM1 A;  4M75 E;  4LUE A;  2NUP A;  4OMN A;  1JQQ A;  1PHT A;  2QTX A;  2DZC A;  2BZX A;  4O5V A;  1KK7 A;  2DTO A;  4Z8A A;  4UC4 A;  2YT6 A;  3UDC A;  4JRP A;  1YP5 A;  1ZQ1 A;  5KCO A;  4FYY B;  2IIM A;  1M3C A;  3RBB B;  5CKD A;  3DLM A;  2P4T A;  2RO0 A;  5CKF A;  2PU9 B;  2LQN A;  1Q82 C;  1OI1 A;  3U23 A;  1G3T A;  4M77 E;  5FRM A;  2RN8 A;  1YCY A;  2WAC A;  2OAW A;  4IUU A;  5DY9 A;  4C0Z A;  2BKD N;  1YHQ T;  3PT9 A;  4C8Q E;  1XOV A;  2DJZ A;  3ASK A;  3R6N A;  1UG1 A;  2DE0 X;  3CCM T;  1K73 R;  1GXI E;  2F2X A;  3CC4 Q;  2E70 A;  1GL5 A;  3RMQ A;  3CXC A;  4ZNX A;  2VC8 A;  1U8R A;  3E2U A;  1FMV A;  2RQU A;  4M78 A;  1VQ8 Q;  5GJW B;  1M1K C;  3OS2 A;  4DOV A;  1I5O B;  3OW2 A;  5GMK l;  1OYX A;  2DMO A;  1SHF A;  4EDU A;  4PNO A;  5D6X A;  1MV0 B;  4E7K A;  1LOJ A;  2QA4 T;  4JZ3 A;  2DX1 A;  3M0Q A;  2CP0 A;  2PUK B;  4C5G A;  1M2O A;  4KH1 B;  3OBW A;  1WHJ A;  3UA6 A;  1UE9 A;  3EGU A;  2XD0 A;  5CIU A;  3MP8 A;  5IHK A;  4KH0 B;  3LLR A;  2HL3 A;  1ABO A;  3M0T A;  3CPW P;  4HXJ A;  2R57 A;  5DLO A;  1VQO Q;  2X9H A;  2KAF A;  2K79 A;  5KYY B;  1ZBJ A;  2K5I A;  5AYF A;  3I56 A;  2RJE A;  4ZGE B;  3SWN C;  4QW2 A;  1K8A U;  2D9T A;  2B8A A;  3SWN A;  1IXD A;  2JVV A;  2RHY A;  2RQR A;  3J7A F;  1M4Z A;  2YDL A;  5LJ3 j;  3H41 A;  1X75 C;  1QKW A;  1VQ9 A;  4FYV B;  1UEB A;  4KUD K;  2KI7 A;  2V8J A;  2QGG A;  5GAO m;  2EYW A;  3KBG A;  4C5I A;  1KQ2 A;  3BY7 A;  2DRK A;  2H3E B;  1OU9 A;  3CCQ T;  1RI0 A;  2K5L A;  2JZ2 A;  5CO7 A;  2K9G A;  2VYT A;  3JCM e;  1D0Y A;  5FWC A;  2LX7 A;  4OMM A;  2C0T A;  1ACM B;  1JU5 C;  4RTZ A;  2O31 A;  3RES A;  4C92 F;  3QHS A;  1W4S A;  3MPU B;  2CT4 A;  4PJO F;  1ZSZ A;  1PNJ A;  2F69 A;  8AT1 B;  3SFM A;  1PD0 A;  4JUV A;  2ZPE B;  2EKH A;  3OY9 A;  2HNI A;  1LCK A;  1BU1 A;  1TWB A;  2DRM A;  3VS0 A;  2H8H A;  1I81 A;  2DAQ A;  1TXQ A;  1R8O B;  1KD1 U;  1H64 1;  1OPL A;  3I9Q A;  3EHQ A;  3EG9 A;  2K6D A;  2VUB A;  4PFP A;  4C5H A;  2DK3 A;  4JDS A;  3TU4 K;  1YIJ T;  2PVO B;  4Q5W A;  1G83 A;  1MMG A;  3M55 A;  2NUT B;  2JTF A;  2DXC A;  1TSF A;  3L2W A;  3FDR A;  3SD4 A;  3I55 T;  4M7D D;  3V8J A;  2DL4 A;  2DZ9 A;  2EAY A;  3X26 B;  3CMA A;  3RDV A;  1Q7Y R;  4EMG A;  3TSW A;  2ED1 A;  2EJ9 A;  4JJN K;  3MEV A;  5J3B A;  1YJN Q;  2ZPG B;  2GQI A;  2OTJ T;  2COZ A;  2JXB A;  4PJJ A;  1X27 A;  3SEM A;  1VIE A;  4R55 A;  3RUX A;  4HA8 A;  2VXF A;  4C0D C;  2EKO A;  3VUB A;  1K1Z A;  4DBF A;  4PLI A;  2CKK A;  1VQL A;  1VQN Q;  2CS7 A;  3OS5 A;  3G4S T;  4PFZ A;  5KYU B;  2VGM A;  1Y96 B;  3CEY A;  4RTY A;  5GAN 2;  2YUN A;  2LJ1 A;  4EMK A;  4HKE A;  4C92 A;  1S72 T;  1JJ2 A;  1WLP B;  1WHL A;  3H0I A;  3VS6 A;  1CKB A;  3HTR A;  4F7U G;  1T3S A;  2EJF A;  3CCS Q;  4PJO A;  5LJ3 h;  2L3P A;  3CC2 T;  3CD6 Q;  1U1S A;  5LJ5 d;  1M27 C;  2A28 A;  4JRI A;  1FMW A;  2J06 A;  2MYS A;  1VQ4 Q;  3QBY A;  4M4Z A;  1QVF A;  2DVE A;  2DIL A;  4M7D B;  2HEQ A;  2JW4 A;  2QGF B;  2D0N A;  2DEQ A;  3CME T;  5A0L A;  2K5F A;  5IAY A;  2COY A;  5FLX E;  2A7Y A;  2LX9 A;  4BY6 B;  4M7D G;  1GFC A;  2IG0 A;  1HXD A;  1O9S A;  3OMC A;  3GP8 A;  2YUP A;  4LDW A;  4BI4 A;  2L3S A;  1Q82 U;  4FW2 A;  1RLQ C;  3RMS A;  4JLI A;  1YI2 Q;  4RTT A;  5FRO A;  3CCM A;  2GBQ A;  2E65 A;  1BI2 A;  2FPE A;  3UAT A;  1QVP A;  2E12 A;  4J9D A;  4N4H A;  5HCK A;  5GAO q;  5GAN e;  3UPU A;  2EYX A;  4DOW A;  2DTH A;  2QQA A;  1PRL C;  2QYZ A;  4RKU E;  2MAM A;  3HSB A;  2JS0 A;  1M1K U;  1N9S A;  1TH7 A;  3NTI A;  1LJO A;  5D7U A;  2QA4 A;  1K8A R;  2E41 A;  5IT9 E;  2P0K A;  4ME7 A;  2D1X A;  1WHM A;  2XU8 A;  2Y90 A;  4NL2 A;  5EG2 A;  2LQK A;  1YBY A;  1YJ9 T;  1VQP Q;  4XTW A;  5A2Q E;  4XAX B;  4M78 G;  5IH2 A;  3EGX A;  5GAO r;  3PMT A;  4CC2 A;  1JO8 A;  2L0A A;  1WJQ A;  3MEU A;  2RQT A;  1M3B A;  1PC0 A;  1N5Z A;  2PQW A;  3NTH A;  4Z88 A;  4EPC A;  1FX7 A;  3JCM W;  4DBH A;  3CBO A;  1PSF A;  2KBT A;  1Q95 G;  2XID A;  3URG A;  5I22 A;  3CCL T;  2EGE A;  1IGU A;  1TS9 A;  1QWE A;  4CI0 C;  1C0M A;  4FYW B;  2QG9 B;  4FM4 B;  2A3L A;  2KQW A;  5D6Y A;  3SWN B;  4A4G A;  1JBM A;  1MHN A;  4OF1 A;  2A08 A;  4Y91 A;  2HZY A;  3CCQ A;  3OS1 A;  3CPW A;  5ECA A;  3NTK A;  5LL6 S;  2VKN A;  2MWP A;  2RJD A;  1NPR A;  4LD6 A;  2P84 A;  3A8H B;  3BDL A;  1OUL A;  4FL6 A;  2HQX A;  4MZT A;  2DKG A;  1ZBX A;  4LNP A;  3M58 A;  3J81 E;  4FSS A;  3THK A;  1XJW B;  2LMJ A;  3CCE Q;  5IXB A;  2FYK A;  2DA9 A;  1NYG A;  3X24 B;  4QVC A;  4RTX A;  4MMK A;  1Z9Z A;  3EAE A;  4CC4 B;  4C0G A;  3M5A A;  1QWF A;  5HK3 A;  3RER A;  2JJ9 A;  2FG0 A;  3GLX A;  1SRM A;  4JS5 A;  3EFO A;  1SG5 A;  2KNB B;  1MMN A;  4KGZ B;  2D8J A;  3V8K A;  2EW3 A;  4JPB W;  1YIJ A;  2K3B A;  1R0B G;  1BIA A;  4E6R A;  1FMK A;  1VQ5 A;  4J6W A;  3I55 A;  3OYG A;  1M1F A;  2A37 A;  1AZE A;  3L2U A;  1N8R C;  1W6X A;  4LN2 A;  2P0Q A;  3QZ5 B;  5GAN j;  1I1J A;  2D0Q B;  2RQV A;  1M9S A;  3H0H A;  3QUI A;  3VYG A;  3QJ6 A;  1YWO A;  2FPD A;  3G71 A;  2XDB A;  3I35 A;  1BIB A;  3V7R A;  3OYJ A;  3G4S A;  2LVM A;  2KSS A;  3KXT A;  4J6Y A;  3P8B B;  3VJP A;  4AT1 B;  4GLK A;  3EGD A;  1P92 A;  3CC2 A;  4C0D B;  3OYK A;  2YRC A;  5GMK e;  4XTV A;  1K0X A;  5HY6 A;  2M51 A;  1U1T A;  4RTV A;  1MMA A;  2QQR A;  4M7A F;  5CKE A;  1VQM Q;  1UGV A;  2XMF A;  3MP1 A;  2KXC A;  4LDU A;  3MEW A;  3OYL A;  4OB3 B;  2ROT A;  1VQ4 T;  3CCR T;  1X6G A;  4GLM A;  4C92 G;  2AIR B;  1RAA B;  3CME A;  2R5M A;  2P4R A;  2CUB A;  4PJO G;  1VQ7 Q;  5LJ3 d;  4CC7 A;  3OYF A;  1MUZ A;  1KIK A;  2LNV A;  1OZ3 A;  2DL7 A;  3PE0 A;  4RTU A;  4N0A C;  1X2K A;  2BZ8 A;  1LNX A;  5GAM d;  1OPK A;  1K76 A;  2CP7 A;  2K2M A;  4R56 A;  3MO8 A;  1VQL T;  4P5N A;  3EG0 A;  1IB8 A;  3T9N A;  3MKD A;  1SRL A;  4J9B A;  2QEX T;  2OTL Q;  2NYS A;  1GBQ A;  2J6F A;  5L8R E;  1NJI C;  3VS4 A;  3OB9 A;  2DIQ A;  4LD9 K;  2ZPF B;  1K9M C;  2VGN A;  1AT1 B;  1M30 A;  1M1G A;  4BE1 A;  5GAM g;  1RL2 A;  1JEG A;  2WSC E;  3QZ9 B;  4K11 A;  2DXB A;  1XTD A;  2XDP A;  1ZUU A;  5KYW B;  3H8Z A;  2HAX A;  3ER0 A;  2E6N A;  2EJG A;  1YJ9 A;  4QVD A;  1D0Z A;  3ZL7 C;  4HT9 A;  1N9R A;  4M7A A;  4M75 F;  1GCP A;  4FYX B;  3NGP A;  1D1B A;  2E5Q A;  1WHK A;  3A98 A;  4O6J A;  2KYB A;  2XK0 A;  4PKC C;  2FB7 A;  4D8K A;  2XHC A;  1U3O A;  3EG3 A;  3QWX X;  2DYB A;  2L5Q A;  2FHD A;  3EGX B;  3E19 A;  2GFA A;  4M78 C;  4M77 F;  3RKY A;  1Q81 C;  3BFM A;  2VAS A;  3CCL A;  1MMD A;  4C0F A;  2CP5 A;  3MET A;  4RTW A;  4IUP A;  3GNG A;  1VQ6 Q;  4C8Q F;  2DYI A;  2YSQ A;  4TVR A;  1ZHI A;  5GAN 3;  4BB7 A;  1SSH A;  2K4Y A;  3OYH A;  2M9U A;  2D6F A;  2HBW A;  2EYQ A;  1JXM A;  2OI3 A;  1WNL A;  2HKN A;  4JRK A;  1KG1 A;  1UGS B;  3C12 A;  2HSE B;  4AG1 C;  1H92 A;  2DIG A;  1QP3 A;  2W0Z A;  1AZG B;  4OVA A;  4E7I A;  2RJF A;  2QK0 A;  2AZV A;  4OGC A;  1TOV A;  1VYV A;  4IUV A;  3RNJ A;  4DEX A;  2GNC A;  4XTZ A;  4LDY A;  1IRX A;  1BBZ A;  3A5Z B;  4M75 C;  3P8H A;  1KHC A;  3CQT A;  1T0H A;  4M75 A;  1AD5 A;  1QMC A;  5CAI A;  2RK1 A;  2Y4Y A;  1UHC A;  3V7S A;  2FZC B;  1HJD A;  2MK5 A;  4GY5 A;  2KVQ G;  4LXC A;  1W70 A;  2MF2 A;  6AT1 B;  5GAM j;  3RR6 A;  3L2Z A;  4DBQ A;  1BK2 A;  2ZGW A;  5GAN 8;  1GRI A;  2L8D A;  4OMQ A;  2E5K A;  2CZ1 B;  3FJ5 A;  4M77 A;  3A8G B;  4MZP A;  4BDY A;  1Q86 C;  3JCM d;  2RHU A;  4XU2 A;  3CCV T;  2GCX A;  1NYF A;  3CBM A;  3QWY A;  5DLQ E;  1YJN A;  2M0O A;  3E9G A;  3LH5 A;  4C8Q C;  2HD0 A;  3VS5 A;  1KC8 C;  1N8R U;  4QVZ A;  1AVZ C;  3PVQ A;  4C8Q A;  3VRZ A;  3LX7 A;  2CT3 A;  1ZSZ C;  3OA6 A;  1Z9Q A;  4L5G A;  2KRS A;  4BI3 A;  2HDA A;  2VB6 A;  3TSZ A;  2FPF A;  2J7I A;  1VQN A;  2DL3 A;  2O4X A;  3JCM g;  3RKX A;  4JZ4 A;  3HRT A;  2L3R A;  4BE0 A;  2MIO A;  4IUQ A;  4IUR A;  3OSV A;  3P8D A;  1ZA2 B;  2C0O A;  1B34 A;  1X6O A;  2M1H A;  5I11 A;  3I56 Q;  1VQM T;  2JUF A;  2DF6 A;  1OOT A;  2G3R A;  3OYM A;  2FRY A;  3M53 A;  1VQ4 A;  3CCR A;  1VQ5 T;  2BE7 D;  1OEB A;  2DXT A;  1G3S A;  2F5T X;  1YIT T;  2O9V A;  3M54 A;  4A54 A;  4II1 A;  1VQ9 Q;  2HQE A;  4DQ2 A;  3HFN A;  2VWF A;  1X69 A;  4C5E A;  5CKH A;  2EGC A;  3VU3 C;  5GAN 7;  2HKQ B;  5J39 A;  5KCH A;  7AT1 B;  3G71 T;  4X9C A;  1D1A A;  1M90 C;  2L3Q A;  2RI2 A;  2VVK A;  3JCM J;  3DB4 A;  1ARK A;  4F7U B;  1YJW Q;  4EMK C;  3G6E T;  2QEX A;  4C92 C;  2OTL T;  3CC7 T;  2EGA A;  1T3L A;  4R0K A;  3L2V A;  1GCQ A;  4PJO C;  1N6A A;  1WA7 A;  1QVG S;  5C6S A;  2QAZ A;  4PK4 A;  5KE2 A;  5CQY A;  1EX4 A;  4HCZ A;  3SDZ A;  1NJI U;  1W2B S;  4HVU A;  1BI1 A;  3TRE A;  4JLG A;  3HPW A;  3Q1J A;  1I8F A;  1K9M U;  5GAM h;  1FXX A;  2ATC B;  2QI2 A;  1KQS S;  2YLC A;  2K57 A;  1B7T A;  2C06 A;  4M78 D;  5FU6 C;  3CCJ Q;  4J6X A;  5CQX A;  1VQP A;  4MML A;  4J9F A;  3DLL A;  2DL8 A;  1O75 A;  8ATC B;  1HK9 A;  5LJ5 e;  2NUP B;  3N5B B;  1U5S A;  5CCA A;  3H9N A;  4PJN A;  4WCI A;  1M2V A;  2EQM A;  1PWT A;  1QLY A;  5D6W A;  1IO6 A;  2JMA A;  1WQW A;  3NHN A;  2PZ1 A;  2AZS A;  3CMA Q;  1FWZ A;  3KFV A;  4KGX B;  4Z02 A;  1I07 A;  4J9H A;  4OMF B;  2DJQ A;  1VOM A;  2CYZ B;  3OYB A;  3CC4 T;  3BDU A;  3REA B;  2DLP A;  3HKS A;  1ZLM A;  4M7A G;  5IN1 A;  4X1V A;  1YNZ A;  5GAN d;  1PRM C;  5I2S A;  1VQ8 T;  2A0F B;  2HSP A;  2LRQ A;  4XTU A;  3MJX A;  1Q81 U;  4M75 D;  2L89 A;  2ZAE A;  1Q7Y C;  5DM7 R;  2YHT A;  4KUL A;  3LW5 E;  2KE9 A;  1JB0 E;  2JM8 A;  4A4E A;  1A0N B;  4M78 B;  3FJP A;  4AFU C;  1X2Q A;  4JRQ A;  5A0G A;  2RQW A;  1UGQ B;  5GAN g;  4HCK A;  2IPO B;  1QVF S;  4FIB A;  3EFR A;  1EZZ B;  2CP2 A;  2X4Y A;  3FRN A;  3CCE A;  1VQO T;  4JJD A;  5M9O A;  2HQH A;  4BD3 A;  3J80 E;  2YUQ A;  3DKM A;  3JCM Q;  1N27 A;  2O2O A;  4C8Q D;  3JB9 F;  2M0Y A;  2X4W A;  5CKB A;  3C95 A;  1KQ1 A;  3D7S B;  5C0M A;  2JMC A;  3A8M B;  5A0D A;  2LQW A;  5GMK i;  4RCC A;  1N8R R;  2DVJ A;  4J9I A;  4E2F B;  3AHU A;  4A4K A;  4PLL A;  2CP3 A;  2PNI A;  3EH1 A;  2E4H A;  1WIE A;  3LWH A;  1E6G A;  1KJW A;  4DBR A;  2LP5 A;  2P0P A;  4M75 B;  1YHQ Q;  2JTM A;  2X4X A;  1RAD B;  5J26 A;  1OZ2 A;  5GMK m;  3CCM Q;  4Z89 A;  1RAI B;  3ZFJ A;  3CCV A;  4L59 A;  4M75 G;  2K7A A;  2DD4 A;  1KD1 R;  1D3B A;  1BB9 A;  1WI7 A;  1UJ0 A;  5GAO l;  1VQK Q;  2YLB A;  4B9X A;  5LJ5 f;  1Q86 U;  3JB9 J;  1AEY A;  2YRD A;  2E10 A;  2YXY A;  1W1F A;  1M8M A;  4ZN1 A;  1KC8 U;  1PSE A;  1GBR A;  2OX7 A;  1QKX A;  1V76 A;  2QA4 Q;  5KYX A;  1NLP C;  2OAU A;  4ELY C;  5KYY A;  4XU1 A;  3BW1 A;  4M77 G;  3WXM B;  2OJ2 A;  4C8Q B;  3JCM h;  2FL7 A;  2LCL A;  2EIF A;  3A8L B;  5FRN A;  3FEO A;  4MDX A;  1M8V A;  1ZSZ B;  4C8Q G;  2GFU A;  2O4X B;  3MCA B;  2DEU A;  1VQM A;  2RH2 A;  3ZBD A;  4C92 D;  4F7U E;  4BDZ A;  2R5A A;  3HP9 A;  1RAE B;  4PJO D;  2O9S A;  3EG9 B;  2DO3 A;  2QQS A;  1YIT A;  2PUO B;  2EQI A;  1I4K 1;  1K4U S;  1B34 B;  2Z0W A;  1NEG A;  5I2M A;  2LJ3 A;  4XU0 A;  1YJN T;  4GBQ A;  1QVG P;  3M57 A;  1ZA1 B;  1NJI R;  4N4G A;  1W2B P;  2BE9 B;  1K9M R;  2QAS A;  2X4J A;  4HVV A;  3HFO A;  3JCM b;  1KQS P;  3CCQ Q;  3OMG A;  3TVT A;  1VQN T;  4M7D E;  4OMP A;  2DL5 A;  2QXF A;  3PGG A;  3QKJ A;  4N4I A;  4OP0 A;  4QT7 A;  4BAC A;  4OB2 B;  1PCX A;  3G6E A;  3EHR A;  3OS0 A;  1M90 U;  2OTL A;  3CC7 A;  2Y4X A;  2CZ0 B;  2XKO C;  3H6Z A;  1SKU B;  3C94 A;  3E1S A;  1YCS B;  1G5V A;  2F5K A;  3CCS T;  3JSC A;  2EQK A;  3CD6 T;  2JTE A;  1YWP A;  2KGT A;  4M7D F;  4E7L A;  1Q82 R;  1IGQ A;  3QII A;  2BIV A;  3OYN A;  1QCO A;  2DTI A;  2PVG B;  2W10 A;  4EMK B;  1NPP A;  2QTV A;  4C92 B;  2NUT A;  1Y0M A;  2WSE E;  3HRU A;  3SHW A;  1D0X A;  1AOJ A;  2CGH A;  4DA4 A;  4F04 B;  1SEM A;  2BUD A;  4PJO B;  4ZGD B;  1MNE A;  1B3Q A;  1UUE A;  1TG0 A;  1EIF A;  2KR3 A;  3VS3 A;  2QDY B;  4QQD A;  5GAO p;  2LCC A;  1XNI A;  3JCM c;  4ANJ A;  3OYY A;  2E6Z A;  3PVL A;  1SHG A;  1UB4 A;  1WHG A;  2KEA A;  1M1K R;  5FU6 B;  1WXB A;  4M78 E;  2EPD A;  1G8X A;  1YI2 T;  4PL6 A;  2HBP A;  2XDD A;  2RHZ A;  1WJR A;  3CBP A;  1OV3 A;  5KYU A;  1Y96 A;  3M0S A;  3CC4 A;  3L42 A;  1UEC A;  2RNA A;  2OTJ Q;  1WYX A;  1S1N A;  5LJ3 e;  2SEM A;  1VQ8 A;  1QVF P;  2KMT A;  2ZPH B;  2F1L A;  3AT1 B;  4A53 A;  5GAO n;  3GNF B;  3G4S Q;  1RAC B;  1RAH B;  5GAN 5;  1PG5 B;  2CDT A;  3QO3 A;  1AWO A;  2JN0 A;  3GPL A;  2CZ6 B;  2LZ6 B;  4RG8 A;  1G3W A;  4FSX A;  2J05 A;  2EQU A;  2RHI A;  3QG1 A;  1S72 Q;  3VV0 A;  1TU0 B;  2XI9 A;  4OGE A;  1D09 B;  4XK8 E;  4D8D A;  1OX9 A;  3QYG B;  1I0C A;  3PTA A;  1I5L A;  3RKW A;  1VQP T;  3CC2 Q;  5IHN A;  4M7A C;  2FO0 A;  1WX6 A;  3S3N A;  3QJY A;  5GAN h;  3GF5 A;  5FU7 C;  2LJ0 A;  4VUB A;  4LE9 A;  2H3J A;  1OX8 A;  2FRW A;  1AWJ A;  1WXT A;  1VQO A;  2LC4 A;  1IZ6 A;  4FCY A;  3MEA A;  1NG2 A;  3NPF A;  2X35 A;  1JRI A;  1MV3 A;  2RA2 A;  3CME Q;  1X43 A;  1X01 A;  4NS5 A;  2X3X D;  4E47 A;  3PNW C;  1VYT A;  1X6B A;  2AT1 B;  4E7S A;  1UHF A;  1Q86 R;  2HMA A;  4QQ6 A;  1WFW A;  2PTK A;  3HHT B;  2V8I A;  1KC8 R;  1C6V X;  4ORZ A;  1GFD A;  3LH0 A;  5CVI A;  1G2B A;  4J7F A;  2YWW A;  1QP2 A;  2KK4 A;  4LDV A;  3INZ A; 
#chains in the Genus database with same CATH homology
 3PMT A;  2RJC A;  4ZGJ B;  1KD1 C;  3C4S A;  4C5E A;  4NOY A;  1WJQ A;  3JB9 D;  3MEU A;  5CKH A;  1S72 A;  1VQK T;  1SSF A;  3VU3 C;  5GAN 7;  5J39 A;  4ZTF A;  5KCH A;  1UGR B;  2PQW A;  5GMK j;  3CCJ T;  4WF2 A;  3NTH A;  3L2Q A;  3G71 T;  1Y7X A;  4X9C A;  2R58 A;  1M90 C;  4EPC A;  2RI2 A;  2RHX A;  1FX7 A;  3JCM J;  2JOY A;  3DB4 A;  3JCM W;  4F7U B;  1NZ9 A;  3CBO A;  4EMK C;  3G6E T;  2QEX A;  1PSF A;  4C92 C;  5GAO r;  2V8K A;  3CCE T;  1D3B B;  2OTL T;  3CC7 T;  2XID A;  3URG A;  3CCL T;  4FU6 A;  2KDS A;  3L2V A;  3FC3 A;  4CI0 C;  3OQ5 A;  4PJO C;  4X9D A;  1N6A A;  1XQH A;  3TEE A;  2IVW A;  4FM4 B;  2A3L A;  1QVG S;  2ZPB B;  5C6S A;  2M16 A;  2KQW A;  5D6Y A;  3SWN B;  4A4G A;  5KE2 A;  1JBM A;  5CQY A;  4XU3 A;  3VKI A;  4HCZ A;  5LJ3 f;  1MHN A;  3SDZ A;  3CMA T;  4OF1 A;  4KUI A;  2ZCF B;  1NJI U;  1W2B S;  3LGF A;  1BI1 A;  3TRE A;  4JLG A;  3R6O A;  4Y91 A;  3HPW A;  3Q1J A;  3CCQ A;  3OS1 A;  1I8F A;  1VUB A;  4F7U A;  1K9M U;  5GAM h;  3CPW A;  1FXX A;  3NTK A;  5LL6 S;  2QI2 A;  2QQ9 A;  1KQS S;  1MGQ A;  2K57 A;  2QQB A;  2MWP A;  2RJD A;  2YLC A;  4B9W A;  5GAM f;  3PFS A;  5LJ5 h;  3O8V A;  1Y71 A;  5GAN 6;  2C06 A;  1NPR A;  4M78 D;  3CXC S;  2JNG A;  4CRI A;  4LD6 A;  5FU6 C;  3A8H B;  3BDL A;  3L2R A;  3QSU A;  4J6X A;  5CQX A;  4FL6 A;  4QQG A;  1VQP A;  4MML A;  4M78 F;  4N0A A;  3JCM P;  5GAM e;  3DLL A;  4M77 C;  1O75 A;  4V2S A;  4RCB A;  1HK9 A;  2HQX A;  4MZT A;  2DKG A;  1ZBX A;  5LJ5 e;  3M58 A;  3J81 E;  3PIO A;  3OW2 S;  1VQ6 A;  4XTX A;  3N5B B;  3PIP A;  3JRZ A;  2FYK A;  2ZZD A;  2ZPI B;  3WVE B;  3X24 B;  5CCA A;  3F70 A;  2CZ7 B;  4QVC A;  3X20 B;  2RI5 A;  4MMK A;  5LJ3 g;  1VIF A;  3EAE A;  1Q7Y U;  4HCB A;  4FT4 A;  4XTY A;  4C0G A;  2EQM A;  5D6W A;  4M7D C;  4C92 E;  3M5A A;  4L6V 5;  1WQW A;  5HK3 A;  3CCU A;  3RER A;  4M7D A;  1M5Q 1;  4Y28 E;  3JB9 G;  1FWZ A;  1Y07 A;  3GLX A;  3QXE B;  4Z02 A;  2KY9 A;  4PJO E;  4OMF B;  2RB6 A;  3NFC A;  3UT1 A;  1V29 B;  4M75 E;  4BY6 C;  3LWI A;  4KBM B;  4JS5 A;  1K73 C;  2CYZ B;  1WGS A;  3FB9 A;  3V8K A;  2GF7 A;  3BDU A;  3OYB A;  3CC4 T;  1YJW A;  1YIJ A;  2QTX A;  2DZC A;  3HKS A;  4O5V A;  4M7A G;  3UWN A;  5IN1 A;  2DTO A;  4UC4 A;  3UDC A;  5GAN d;  2LT1 A;  4JRP A;  1BIA A;  5CR2 A;  1ZQ1 A;  5I2S A;  5KCO A;  1VQ8 T;  1VQ5 A;  2LRQ A;  4XTU A;  5CKD A;  3S6W A;  4J6W A;  4M75 D;  3I55 A;  1KHI A;  3CCS A;  1Q81 U;  2GQV A;  2L89 A;  3DLM A;  3CD6 A;  2P4T A;  1Q7Y C;  2RO0 A;  3OYG A;  5CKF A;  1M1F A;  2PU9 B;  5DM7 R;  1Q82 C;  1OI1 A;  3L2U A;  4JS4 A;  1N8R C;  2YHT A;  1G3T A;  3LW5 E;  4KUL A;  1JB0 E;  3MHX A;  2P0Q A;  3QZ5 B;  3JCM V;  4M77 E;  5GAN j;  2D0Q B;  1WPY A;  4A4E A;  5FRM A;  4M78 B;  3M4Y A;  1QVG A;  1M9S A;  3FJP A;  4J83 A;  3QUI A;  3VYG A;  1YCY A;  2WAC A;  3QJ6 A;  5A0G A;  3DB3 A;  4JRQ A;  1UGQ B;  3ME9 A;  4IUU A;  5GAN g;  4LDX A;  3ZEH A;  3CCJ A;  1W2B A;  5DY9 A;  4C0Z A;  3G71 A;  2BKD N;  1YHQ T;  2XDB A;  4A4F A;  3PT9 A;  1QVF S;  1BIB A;  4J7I A;  3V7R A;  1XOV A;  4C8Q E;  2DJZ A;  3ASK A;  3OYJ A;  4FIB A;  2DXU A;  3EFR A;  2E1H A;  2EFI A;  2LVM A;  2K2V A;  3G4S A;  3CCM T;  1KQS A;  1GXI E;  2KSS A;  2X4Y A;  3KXT A;  2E70 A;  3FRN A;  3RMQ A;  4J6Y A;  3CXC A;  3CCE A;  1VQ7 T;  2VC8 A;  3P8B B;  1VQO T;  1U8R A;  5M9O A;  3M59 A;  5GMK h;  4M78 A;  2LT4 A;  3VJP A;  4BD3 A;  3J80 E;  1M1K C;  3DKM A;  4GLK A;  3OS2 A;  3JCM Q;  1N27 A;  4KT0 E;  4C8Q D;  4DOV A;  3JB9 F;  2X4W A;  5CKB A;  3C95 A;  1KQ1 A;  1P92 A;  3OW2 A;  4HT8 A;  3CC2 A;  5GMK l;  1OYX A;  5C0M A;  4C0D B;  1YI2 A;  3OYK A;  4M7A D;  3A8M B;  3FLG A;  5A0D A;  4EDU A;  5GMK e;  5I21 A;  4PNO A;  4XTV A;  5D6X A;  5HY6 A;  1U1T A;  4E7K A;  5GMK i;  1LOJ A;  4RCC A;  2QQR A;  4M7A F;  5CKE A;  2QA4 T;  3AHU A;  3MP1 A;  2MMP A;  4LDU A;  3LYI A;  4A4K A;  3GIB A;  4EMH A;  2YRV A;  3MEW A;  4PLL A;  2PUK B;  3OYL A;  3CPF A;  4C5G A;  4OB3 B;  2MI6 A;  3LWH A;  1VQ4 T;  3OBW A;  3OYN A;  3CCR T;  2P0P A;  4M75 B;  4OB0 B;  3WVD B;  2JTM A;  2XD0 A;  2X4X A;  4C92 G;  5CIU A;  5KH6 A;  5GAN 4;  3MP8 A;  5J26 A;  3CME A;  2R5M A;  1OZ2 A;  5GMK m;  3LLR A;  1DJ7 B;  3ZFJ A;  2VV5 A;  2PVD B;  4PJO G;  3CCV A;  4L59 A;  2R57 A;  4M75 G;  5DLO A;  5LJ3 d;  2DD4 A;  2KAF A;  1D3B A;  2K5I A;  5AYF A;  3OYF A;  2LNV A;  3KUF A;  5GAO l;  1OZ3 A;  3I56 A;  3GOX A;  2YLB A;  4B9X A;  2RJE A;  3S3O A;  5LJ5 f;  4N0A C;  1Q86 U;  4D6W A;  2K3Y A;  3JB9 J;  4ZGE B;  3SWN C;  1LNX A;  5GAM d;  2E10 A;  4QW2 A;  1K8A U;  2D9T A;  2B8A A;  3SWN A;  3MO8 A;  4R56 A;  2MWO A;  2JVV A;  2RHY A;  1VQL T;  3J7A F;  2VXE A;  2LDM A;  3LGL A;  2EQJ A;  1M4Z A;  4P5N A;  4ZN1 A;  5LJ3 j;  1PSE A;  1KC8 U;  3HRS A;  3T9N A;  2O01 E;  2QEX T;  1X75 C;  2OAU A;  1VQ9 A;  2AHJ B;  1UEB A;  5L8R E;  4ELY C;  4XU1 A;  3RIR A;  3BW1 A;  4M77 G;  1NJI C;  3OB9 A;  3WXM B;  2XIC A;  4KUD K;  2V8J A;  5GAO m;  2DIQ A;  4LD9 K;  4C8Q B;  2ZPF B;  2FL7 A;  2LCL A;  3JCM h;  1K9M C;  2VGN A;  3KBG A;  3JCM f;  4C5I A;  1KQ2 A;  3BY7 A;  1M1G A;  4M7A B;  4BE1 A;  2EIF A;  5GAM g;  3A8L B;  1RL2 A;  5FRN A;  3VUZ A;  2WSC E;  3FEO A;  3QZ9 B;  4MDX A;  1M8V A;  2DXB A;  4C8Q G;  2GFU A;  3CCQ T;  1XTD A;  5LJ5 g;  2O4X B;  1RI0 A;  2K5L A;  2JZ2 A;  2XDP A;  5CO7 A;  5FU7 B;  2VYT A;  2EWN A;  3MCA B;  3JCM e;  4E7H A;  3H8Z A;  4NL3 A;  1VQM A;  2HAX A;  2RH2 A;  3MP6 A;  3ZBD A;  4C92 D;  3ER0 A;  1QW1 A;  3QDR B;  4F7U E;  4BDZ A;  2E6N A;  2R5A A;  2EJG A;  1YJ9 A;  4QVD A;  1G3Y A;  3RES A;  4C92 F;  3HP9 A;  1JJ2 S;  3X25 B;  4HT9 A;  3QHS A;  4PJO D;  3PMI A;  1W4S A;  4BE2 A;  2DO3 A;  2QQS A;  1N9R A;  1YIT A;  1YHQ A;  2PUO B;  4M7A A;  3G7Z A;  3OYE A;  1I4K 1;  4PJO F;  1VQ6 T;  1WQ7 A;  2FVU A;  4MDW A;  4M75 F;  1B34 B;  2F69 A;  4RMO A;  3SFM A;  2E64 A;  4JUV A;  2E5Q A;  2ZPE B;  3OY9 A;  5I2M A;  2HNI A;  4XU0 A;  1YJN T;  3OSS C;  4O6J A;  2I2L A;  3M57 A;  2XK0 A;  1VQK A;  4PKC C;  2FB7 A;  1I81 A;  2DAQ A;  4N4G A;  1R8O B;  2X4J A;  3CCU T;  2XHC A;  1KD1 U;  3HFO A;  1H64 1;  3FIF A;  4XQ3 A;  3JCM b;  4ELZ C;  2VUB A;  4ZTJ A;  2K3X A;  1BI0 A;  2L5Q A;  2FHD A;  3OMG A;  4M77 D;  4C5H A;  1VQN T;  2QXF A;  3QKJ A;  3PGG A;  2DK3 A;  4N4I A;  4OP0 A;  4M7D E;  4JDS A;  4BAC A;  4OB2 B;  3E19 A;  3G6E A;  3TU4 K;  1YIJ T;  2PVO B;  2GFA A;  4Q5W A;  4M78 C;  4M77 F;  3RKY A;  3OS0 A;  1Q81 C;  1M90 U;  3M55 A;  3CC7 A;  2OTL A;  2Y4X A;  2JTF A;  2CZ0 B;  2DXC A;  2XKO C;  3BFM A;  3CCL A;  3H6Z A;  3L2W A;  3JB9 H;  3FDR A;  4C0F A;  3C94 A;  3E1S A;  3MET A;  1G5V A;  2F5K A;  4IUP A;  3SD4 A;  3CCS T;  3JSC A;  3I55 T;  4M7D D;  3GNG A;  3V8J A;  2EQK A;  2DZ9 A;  3CD6 T;  2EAY A;  3X26 B;  4C8Q F;  3CMA A;  3V8L A;  2LTO A;  4EMG A;  4M7D F;  4E7L A;  3E9F A;  3M4G A;  4TVR A;  1ZHI A;  3QII A;  5KE3 A;  2BIV A;  4BB7 A;  2EJ9 A;  5GAN 3;  2DTI A;  2PVG B;  3MEV A;  2K4Y A;  3QYH B;  5J3B A;  4A4H A;  3OYH A;  2M9U A;  1NE8 A;  4EMK B;  2D6F A;  1BYM A;  1NPP A;  2ZPG B;  4C92 B;  5CK9 A;  2OTJ T;  2WSE E;  3HRU A;  2EYQ A;  1WNL A;  2CGH A;  4DA4 A;  1VIE A;  4JRK A;  1KG1 A;  1UGS B;  3VYH B;  2BUD A;  4R55 A;  3RUX A;  4HA8 A;  4ZGD B;  4PJO B;  3C12 A;  2VXF A;  4C0D C;  4JJN K;  2EKO A;  3VUB A;  2DIG A;  4PLI A;  1QP3 A;  2CKK A;  1VQL A;  4OVA A;  2DD5 A;  2CS7 A;  1EIF A;  3OS5 A;  4IUT A;  4J8O A;  3G4S T;  2RJF A;  4J5Y A;  4E7I A;  2QDY B;  4QQD A;  2VGM A;  5GAO p;  1Y96 B;  2LCC A;  4OGC A;  1XNI A;  4IUV A;  3CEY A;  5GAN 2;  3JCM c;  4EMK A;  4HKE A;  4C92 A;  1S72 T;  4XTZ A;  3OYY A;  1JJ2 A;  2E6Z A;  3M9Q A;  4LDY A;  1UB4 A;  3A5Z B;  4F7U G;  4E7J A;  4M75 C;  2EJF A;  1KHC A;  3P8H A;  5FU6 B;  4M78 E;  4HCC A;  5LJ3 h;  4PJO A;  3CC2 T;  4M75 A;  1U1S A;  1YI2 T;  5LJ5 d;  5CAI A;  2RK1 A;  2HBP A;  2Y4Y A;  4PL6 A;  2XDD A;  4M77 B;  4JRI A;  2RHZ A;  1WJR A;  3V7S A;  3CBP A;  4YTL A;  1Y96 A;  4GY5 A;  3OYD A;  3CC4 A;  2KVQ G;  3L42 A;  4MZM A;  1IRE B;  5LJ3 e;  4BI8 B;  3M56 A;  3OYA A;  3S3M A;  2MF2 A;  5GAM j;  1K73 U;  1AHJ B;  2LQ8 A;  3L2Z A;  3QBY A;  3OYI A;  1VQ8 A;  2ZGW A;  2KMT A;  2DVE A;  5GAN 8;  2L8D A;  2ZPH B;  5LJ5 j;  4A53 A;  1QVF A;  4M7D B;  5GAO n;  1BKB A;  3GNF B;  2DEQ A;  3CME T;  1BI3 A;  2CZ1 B;  3TCJ A;  5GAN 5;  5A0L A;  2K5F A;  5IAY A;  4M77 A;  4MZP A;  3A8G B;  4BDY A;  1Q86 C;  3QO3 A;  2JN0 A;  3JCM d;  2CZ6 B;  3GPL A;  2RHU A;  4XU2 A;  5FLX E;  2A7Y A;  2GCX A;  2LX9 A;  4RG8 A;  4BY6 B;  3V7C A;  1G3W A;  3CCV T;  4M7D G;  4FSX A;  2RHI A;  2EQU A;  3QG1 A;  1K8A C;  2IG0 A;  1HXD A;  1O9S A;  3CBM A;  5DLQ E;  3OMC A;  3VV0 A;  3I56 T;  3GP8 A;  1YJN A;  2M0O A;  3E9G A;  1WJS A;  2RK2 A;  2XI9 A;  4LDW A;  4OGE A;  3EFS A;  4BI4 A;  2HD0 A;  2RM4 A;  2NLU A;  4C8Q C;  4FT2 A;  1Q82 U;  4XK8 E;  1KC8 C;  3QYG B;  1N8R U;  4QVZ A;  3PTA A;  1I5L A;  3RKW A;  4C8Q A;  1VQP T;  3RMS A;  2DPP B;  4JLI A;  4M7A C;  3HL8 A;  3LX7 A;  5HKC A;  3SB2 A;  3S3N A;  3QJY A;  5GAN h;  3OA6 A;  4L5G A;  5FRO A;  4BI3 A;  3GF5 A;  4BUG A;  5FU7 C;  5GAN f;  3CCM A;  4IKF A;  1VQN A;  2E65 A;  2O4X A;  1VQ9 T;  1BI2 A;  4VUB A;  1VQ7 A;  2H3J A;  3JCM g;  1QVP A;  3RKX A;  1VQO A;  2LC4 A;  2E12 A;  3CPW S;  4N4H A;  4F7U F;  1IZ6 A;  3HRT A;  5GAO q;  5GAN e;  1H3Z A;  3MEA A;  2L3R A;  4BE0 A;  3UPU A;  4DOW A;  2X35 A;  4ZN3 A;  1JRI A;  3JB9 I;  3QPH A;  2DTH A;  2QQA A;  4IUQ A;  3OYC A;  2RA2 A;  4IUR A;  4RKU E;  1X01 A;  4NS5 A;  2MAM A;  3HSB A;  4E47 A;  3PNW C;  2RI3 A;  2WSF E;  3OSV A;  4RG2 A;  3P8D A;  3OBY A;  5HK0 A;  1M1K U;  1N9S A;  1TH7 A;  3NTI A;  3JCM X;  1B34 A;  1LJO A;  1X6O A;  2M1H A;  1YJW T;  2QA4 A;  3A8O B;  2E41 A;  2JUF A;  1VQM T;  4QQ6 A;  4ATO A;  5IT9 E;  2P0K A;  4ME7 A;  2OTJ A;  2XU8 A;  2G3R A;  2Y90 A;  3X28 B;  3HHT B;  4NL2 A;  2V8I A;  2LQK A;  5EG2 A;  1YBY A;  3L1A A;  3M53 A;  3OYM A;  1VQ4 A;  1YJ9 T;  3CCR A;  1VQ5 T;  4OB1 B;  4XTW A;  1UGP B;  5A2Q E;  2RD1 A;  4XAX B;  2XG8 D;  2DXT A;  3LH0 A;  1G3S A;  2F5T X;  1YIT T;  5CVI A;  4M78 G;  3M54 A;  4J7F A;  3JAM E;  4A54 A;  4II1 A;  1QP2 A;  2KK4 A;  4LDV A;  2HQE A;  4DQ2 A;  3INZ A;  3HFN A;  4M7A E;  4X34 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...