1WJSA

Solution structure of the first mbt domain from human kiaa1798 protein
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
127
structure length
127
Chain Sequence
GSSGSSGPYNKNGFKVGMKLEGVDPEHQSVYCVLTVAEVCGYRIKLHFDGYSDCYDFWVNADALDIHPVGWCEKTGHKLHPPKGYKEEEFNWQTYLKTCKAQAAPKSLFENQNITVIPSGFSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords KIAA1798 protein
publication title Solution structure of the first mbt domain from human KIAA1798 protein
rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 11
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2004-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02820 MBT mbt repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1wjsA00
4IURA 3OY9A 3UWNA 2LTOA 2RI5A 3PNWC 2RHUA 2RI3A 2EQUA 2RHYA 3H8ZA 4BE2A 3S3MA 5KCHA 2RI2A 2LRQA 2M1HA 3ASKA 3MO8A 3OYDA 4BD3A 2FHDA 1WJQA 3META 4C5EA 4QQ6A 4ZTFA 1KHCA 4Q5WA 4IUVA 2HQXA 4IKFA 3P8DA 3M9QA 3LYIA 1XNIA 3PMIA 2P0KA 4FU6A 5J26A 3OYMA 2LVMA 3QIIA 3L42A 2GFUA 5C0MA 3QJ6A 3F70A 3OMCA 4PLIA 4QQDA 1SSFA 5KCOA 3ME9A 5J39A 4BACA 3LGLA 4RG2A 3EAEA 3LLRA 3OYBA 1G5VA 2X35A 2E6NA 2RJDA 2XK0A 3L2RA 3OQ5A 3OYCA 3OB9A 4QW2A 3GOXA 3PFSA 2RO0A 2RHIA 4L59A 3OMGA 1H3ZA 2R5AA 2LCCA 2R5MA 3P8HA 4EDUA 3FLGA 2NLUA 5KE2A 3MEUA 3DB4A 2DIQA 2YRVA 3UT1A 2EQKA 2O4XB 2R57A 5IN1A 4A4HA 4E7IA 1OZ3A 4GY5A 3S3NA 2HQEA 2E5QA 4X34A 2B8AA 3OYGA 3MEWA 1MHNA 4UC4A 2L3RA 3ZEHA 4C5HA 3CEYA 2RJEA 4ZTJA 2BIVA 3DB3A 5CIUA 3OYKA 3S3OA 2RHXA 3QKJA 3KUFA 2D9TA 4N4HA 1OYXA 3MEVA 2RJCA 4IUPA 5D6YA 5D6WA 2X4WA 2WACA 4BDZA 2EKOA 3C4SA 4IUQA 3L2VA 4BE1A 4E7LA 5KE3A 2EFIA 3DLMA 1WJRA 3MP1A 3H6ZA 4IUTA 4E7HA 3FDRA 3E9FA 3NTHA 4PLLA 4HCZA 2VYTA 2K3YA 2O4XA 2R58A 4Z02A 3LH0A 3L2UA 4E7KA 2DIGA 1N27A 2X4YA 2EQJA 2LDMA 3LX7A 3MEAA 4LD6A 4A4GA 2IG0A 3OYEA 3L2QA 2M0OA 3L2WA 3OYAA 2G3RA 4IUUA 2GF7A 4E7JA 3OYIA 4A4FA 4QVZA 2BUDA 3LGFA 1WJSA 2XDPA 5D6XA 3S6WA 2CKKA 5FROA 3MP8A 2RJFA 2M16A 4BDYA 2JZ2A 3OS0A 2BKDN 4OVAA 3OS2A 1WGSA 3PMTA 3OA6A 2EQMA 2MWOA 4CRIA 2L89A 3NTKA 4BE0A 2DAQA 2JTFA 5M9OA 3NTIA 1OZ2A 3Q1JA 5IAYA 3SD4A 4C5IA 3FEOA 3OS1A 2K3XA 2QQRA 4N4IA 3OYNA 3O8VA 2F5KA 4A4EA 4NS5A 4B9WA 3OYJA 4PL6A 5C6SA 4FL6A 5FRNA 1RI0A 3E9GA 3QBYA 2GFAA 2QQSA 3OYHA 1OI1A 5KH6A 3FC3A 3BDLA 2PQWA 4N4GA 2MWPA 2RHZA 2X4XA 4B9XA 4C5GA 4QQGA 3OYFA 3OYLA 4II1A 2L8DA 3MP6A 5FRMA
chains in the Genus database with same CATH superfamily
4J8OA 3UWNA 1VQMA 2GQIA 4OB1B 5GJWB 2JNGA 1RAAB 5KCHA 1U3OA 2L0AA 3MO8A 3MCAB 3FRNA 4IUVA 1PM3A 2CZ1B 3M9QA 4FU6A 4JJDA 1SF9A 2DTOA 2CSQA 2DM1A 3TSWA 2DL8A 4J7IA 1Q81U 4HKEA 5J39A 2DYBA 1S72A 1VQNA 3OYBA 2LT4A 1ZSZA 2L3PA 1K73C 4M78F 3LW5E 2KT8A 3CCMQ 1GFDA 5KE2A 4JUVA 1BI3A 1BU1A 5IN1A 2M02A 2PTKA 1Y96A 3QXEB 2HD0A 1YP5A 2RJEA 5GAMj 2VB6A 5IT9E 2D9TA 1AHJB 4MDWA 4ESRA 2DF6A 3CCLT 2D8HA 1BKBA 1D1BA 2M9UA 4KUDK 4BE1A 2EKOA 1XJWB 2VYTA 2K3BA 2IVWA 4Z02A 3EFOA 3WVDB 3CXCP 2OAWA 1VQ9T 1N27A 2VGMA 2KK4A 2QAZA 2MF2A 5GANg 4JJNK 3HSBA 2WSEE 2QTVA 1Q86R 2WSCE 2DYIA 4XU1A 2QA4A 4M7DA 2GCXA 1AT1B 2DTHA 3NTKA 2KRNA 3QG1A 4M75E 2YHTA 3OYNA 4CI0C 3GBQA 2CP5A 3CCLQ 1BI0A 2DXTA 2AIRB 2DFUA 3MPUB 1Z9ZA 2QQSA 1VQ7Q 2HDAA 2EYXA 2HAXA 3FC3A 4MMKA 1TUDA 2ZPEB 4R55A 2X4XA 2YSQA 4QQGA 2L3RA 5KYYB 1YJ9Q 1FXXA 2XMFA 3FJPA 4MZPA 4YTLA 2J6OA 1I4K1 1TUGB 2RHUA 4BI4A 4M7DE 2OTLQ 3H8ZA 2LP5A 4LUEA 3G6ET 1YITT 2VVKA 4QQ6A 4B6MA 1UJ0A 3RKYA 1AWJA 1M8VA 3M58A 3RMQA 2P0KA 3PTAA 1NM7A 1K9AA 4E2FB 2XKOC 1M9SA 1RLQC 2XI9A 4M78C 4J6XA 4A53A 1D1AA 1SSFA 4ME7A 1ABQA 1TU0B 1VIEA 3VJPA 2LQKA 4OGEA 5J3BA 1VQ6Q 4OMPA 2J6KA 2DRKA 1UE9A 2E6NA 3M0UA 4DEXA 3OB9A 4QW2A 2FPDA 1SHGA 4C8QC 5GAN2 3P8HA 3M0RA 4EDUA 1G3YA 2ZPHB 1WA7A 2DEUA 1G3WA 5I22A 2CP0A 1YITQ 2QGGA 3EG3A 5HKCA 1RADB 4RTTA 2NWMA 1PNJA 2DO3A 4OB0B 4ZGDB 4Z89A 1KHIA 2W0ZA 1YCSB 1NYGA 1M1KR 3MP1A 3M0SA 2R58A 2DIGA 2KBTA 3HP9A 2FVUA 1Q86U 2DERA 1P92A 2HSPA 1JO8A 2FPFA 5KYNA 1U8RA 1Q82C 3TCJA 3TQ7P 1WJSA 1C0MA 3BY7A 3JCMg 4XTZA 1M5Q1 2AZVA 2L89A 5GMKi 1ZSGA 2ECZA 4M75B 1NE8A 3EH2A 1RLPC 2DVJA 3M4GA 1VQ7A 3M59A 3OYJA 3V7SA 4FT4A 2ZPIB 3QWXX 2GFAA 4HVUA 1IHVA 2RPNA 1YJ9A 1V29B 3OYFA 4B9XA 1PSFA 1CKBA 1YCYA 2CP7A 2X4JA 1NG2A 2OTLA 2DL3A 1EZZB 2KR3A 1ZQ1A 1D0YA 1PSEA 1JJ2P 2LC4A 1GBRA 1N8RC 4M78D 2NYSA 3HFOA 1WJQA 4JDSA 1YJWQ 3OW2S 2VASA 4E47A 1FMKA 2HEQA 4PJNA 2IPOB 2OTJT 3JCMh 2ED0A 1VQ6A 2EYZA 2CT3A 2ED1A 1UFFA 2XG8D 3SWNC 1QVGS 2K5LA 2YRCA 4F7UA 5LJ3h 2RO0A 2DKGA 4L59A 1BIAA 3TSZA 3M0TA 4ZGEB 4LE9A 3EG9A 3VS2A 3EGXA 4RTWA 1NPPA 2EQKA 3X26B 1AWXA 1G3SA 4C5HA 4XTXA 4AFZC 2LQNA 3CMET 2BIVA 2E3IA 1T0JA 2XDBA 4M7AG 1BI2A 4OMQA 3VYGA 4RKUE 1BB9A 1M1KU 3BE3A 5GANe 8ATCB 3RNJA 1VQOQ 4ATOA 5CVIA 1VQLA 1ARKA 1IHWA 3FJ5A 5GAOq 4PLLA 3A1PA 3LH0A 1UGRB 2KAFA 1MMGA 4IUUA 3OYIA 3ULRB 1AWOA 1OU8A 4Y28E 3BFMA 3OW2A 4AG1C 2E1HA 4BDYA 3OS2A 2QEXT 3CMAT 3R6OA 2D1XA 2Y4XA 3ZFJA 3QSUA 1QVGA 4M78A 5LJ5h 1N5ZA 3LH5A 2F5KA 4A4EA 1FYNA 2D0NA 2JT4A 1NEGA 1WQWA 4PJOD 1OI1A 2C0OA 2CP2A 4N4GA 2Y4YA 1G83A 2DL5A 1WIEA 2HCKA 1LPLA 2BE9B 4KBMB 2RI5A 4WTOB 4RUGA 5I21A 4DOVA 2LRQA 4MMLA 4BI3A 1YJWA 2ESWA 1OX9A 3P8DA 4M78E 3CMAQ 2BZYA 4JJCA 2ROTA 3E2UA 3H41A 3V7CA 4EMHA 3SHWA 4M75F 5CKFA 4C8QE 2HBPA 2ZPFB 3M5AA 4JZ3A 3VS1A 4XTVA 2D0QB 1MV0B 3UATA 4J7FA 4JPBW 3OSSC 4GLKA 2R5AA 1Y7XA 2HQHA 3FLGA 3EHQA 1Q81C 2PNIA 3VKIA 2E3HA 2AHJB 1J3TA 1O75A 2E5QA 1T3SA 4M7DF 2LX9A 4EPCA 1VQOA 3VRZA 3URGA 2J05A 2XIDA 2JS0A 3JCMe 2CSIA 2LNVA 2CUDA 1U5SA 2D8JA 4M77B 1YFNA 1F1BB 2JM9A 3L2QA 2F69A 3VS3A 3EHRA 2COZA 4XU3A 3CD6A 2RB6A 5LJ3e 3LGFA 5KYWA 5D6XA 3HTRA 2M16A 4AFQC 3QZ5B 1JXMA 1UGPB 1RAEB 3JCMc 1HJDA 5M9OA 5IH2A 3D7SB 4JRPA 2EPDA 4VUBA 3SWNA 2DNUA 2YDLA 5DM7R 3PT9A 1YIJT 1AWWA 4ZN1A 1VQMT 2PQWA 2EGEA 3QUIA 1H641 2MCNA 2EQUA 1C1AA 2ZGWA 4F17A 2GTJA 2DJZA 3META 4AFUC 4LDXA 2KXCA 2KDSA 3VS0A 2GBQA 4M75C 3X28B 3UA6A 3CMAA 1S72T 1VQNT 1KFZA 4JS4A 1OEBA 1ABOA 3CCJQ 2FZCB 5CQYA 1HD3A 4LDWA 2C0TA 2RJDA 2XK0A 2V8IA 3EFRA 2ZPGB 1BYMA 1H3ZA 1OULA 2QYZA 3NGPA 1X75C 2DIQA 4FSSA 4BY6B 1QCNA 1BK2A 1WX6A 5KYUB 4F7UG 1AZEA 4LDUA 2K2VA 1WHJA 2ZZDA 5CQXA 2CZ7B 3QWYA 1VQNQ 2EFIA 4OMMA 3VS4A 4HCZA 5GMKm 1G3TA 2EWNA 5GAN8 2RM4A 4C92B 1SPKA 1UG1A 3FIFA 2L2PA 2XHCA 4A4GA 1WI7A 2QA4T 2J06A 4LD9K 2NUPA 1OU9A 2EAYA 3HRUA 2LX7A 3I55Q 1G8XA 2XDPA 2JN0A 2A37A 2RH2A 2RJFA 1Y57A 3P8BB 2CDTA 3OS0A 5L23A 5HK0A 4RCBA 4BB7A 2ENMA 4XU2A 1X6OA 5A0LA 1WHHA 4JZ4A 1I5OB 4K11A 1KD1C 4PK4A 1NBEB 3M0PA 2P4TA 1AZGB 2YLBA 5FRNA 2LQWA 1XOVA 1X01A 3A8HB 4J9HA 3A8GB 4XU0A 1I1JA 1RABB 1K9MR 4M75D 5IHKA 1HK9A 5IHIA 2L3QA 1WDXA 5FU6C 2RI2A 2KRMA 4C0GA 2ZCFB 3OYDA 4C0FA 2HQXA 2K9GA 3CCJA 1K8AR 5GAMf 1WQ7A 3VS5A 4J5YA 4BACA 4M7DD 2YWWA 2DJQA 3OQ5A 1B34B 4E7ZA 2EGAA 3VV0A 1YJNA 4GBQA 3HFNA 2W10A 4PJJA 4OB2B 4MZMA 3S3NA 4OMNA 3SDZA 4UC4A 3ZEHA 1GL5A 1PD1A 3OYKA 4P5NA 1W6XA 2DK3A 3LWIA 5D6WA 5D6YA 5AYFA 5LJ3j 1VYUA 3H6ZA 3FDRA 2KI7A 1XQHA 1FMVA 2X4YA 1EFNA 5GJVB 4A63B 3OW2P 1LCKA 2IG0A 3I55A 4C8QF 3RMSA 3REAB 2M51A 1GBQA 4IIOA 1QVGP 1Q7YC 4CC7A 1M8MA 2FL7A 2FB7A 1SRMA 4M75A 1VQ7T 2Y90A 3UPUA 5IAYA 2KVQG 3JCMb 4PJOG 2BE7D 4C0ZA 4DBFA 4B9WA 1YJ9T 5FW9A 4IIMA 1UTIA 4F14A 2OTLT 5KH6A 4M77C 1K9MU 4C5GA 3CCRQ 4II1A 2QI2A 2RQVA 5A2QE 2XU8A 1U1TA 4JLGA 1D3BB 2HNIA 1WPYA 3EGDB 5LJ5j 1MUZA 4OGCA 1VYVA 1VIFA 4DQ2A 1M1GA 1K8AU 1VQ6T 2P0PA 4RTZA 2DLPA 3N5BB 2HKNA 1QKWA 3A98A 1VA7A 2EBPA 1H92A 4J9IA 3INZA 4HA8A 5GAOn 3H0FA 4EMKA 1X43A 1WFWA 4L5GA 5CR2A 2OX7A 2X9HA 1VQKQ 3JB9F 2VC8A 3CC7Q 1KG1A 2F2XA 1QCOA 3OYYA 3UT1A 3OBYA 5GANh 4E7IA 4GY5A 3OYGA 1MMDA 3C94A 3CEYA 4PJLA 1VQLT 5CIUA 1CSKA 3M55A 3S3OA 5CAIA 1PRLC 1BIBA 5GAMd 3RIRA 1Q95G 3MEVA 1CKAA 2RQTA 4IUPA 4KT0E 1TH7A 3HKSA 1QQJA 1W70A 2YLCA 5GMKl 2G6FX 2NUTA 3M4YA 3L2UA 2E12A 4XTUA 4EMGA 1AD5A 4XTYA 1VQPT 2E64A 4BY6C 4ZN3A 4Y91A 2CKKA 3MP8A 1IREB 2E70A 3E1SA 1IGUA 3OSVA 2MWOA 3VRYA 4C5IA 1VQLQ 3OS1A 4FSXA 4HT9A 1S1NA 3CCQQ 4NS5A 2QASA 1R0CB 1K73R 1TOVA 4C92C 3QBYA 1QVPA 4FYVB 3CCRA 1SEMA 2RN8A 2QGFB 2QQ9A 3MP6A 2WSFE 5CKEA 2SRCA 1YJWT 1KK7A 2P84A 1ZSZB 2J7IA 1UECA 2O01E 1VQPQ 1OPLA 2CP3A 3SEMA 2DZ9A 1PKSA 4C5EA 4M7AB 2FRWA 3VUZA 3QDRB 2LVMA 1WYXA 1TUCA 3TU4K 2GFUA 9ATCB 1Y96B 2RQUA 3OMCA 3CCEQ 4QQDA 3OBWA 3CCUQ 5GAN3 4BI8B 4JRIA 2PVGB 1E6GA 3OYCA 2CUBA 4FCYA 1VQKA 3CC7A 2LCCA 1KQSS 5KYXA 3EFOB 4V2SA 1OZ3A 1TWBA 1VQOT 2HQEA 1PWTA 1GCQC 3MEWA 1MHNA 4C8QD 2DZCA 1N9SA 1MMAA 3L2ZA 2LMJA 3LWHA 5CKBA 5GAMg 4XTWA 2E65A 4M77A 4WF2A 3CD6T 4JJBA 4BUGA 3LX7A 2GF7A 1MV3A 1TG0A 3I9QA 3X24B 1Y07A 2L5QA 4J9FA 1IRXA 1LOJA 1TSFA 1PHTA 3JCMV 1YNZA 2AKLA 2ROLA 4OF1A 2HBWA 2DTIA 3CCQA 3SD4A 3EH1A 4EIKA 3G71Q 1K73U 1NPRA 2PU9B 1QWEA 4M77E 3I56T 5A0DA 4JRKA 4FYYB 1RI0A 1RAHB 3AT1B 1RAGB 1KJWA 2E5KA 1JEGA 4M75G 1KQSA 2RHZA 1UGSB 5HY6A 1ZA2B 3CD6Q 2DD5A 1YI2Q 2QQAA 2I0NA 2YT6A 1VQPA 2HZYA 3NHNA 3KFVA 1I0CA 4KUIA 2BZXA 5HK3A 1M90C 4QVCA 2QK0A 3JB9D 3LYIA 3UDCA 4M7DG 3CCEA 4J83A 2KGTA 1VQ4A 3CCUA 2B86A 4C8QA 1BCOA 5I11A 4HCBA 1N9RA 4RTVA 3I56Q 1NYFA 1Q82R 4J9BA 4QVDA 2JTEA 3T9NA 2EYWA 6AT1B 3M53A 3CXCA 4X1VA 5EC7A 1PRMC 3QKJA 2FEIA 4N4HA 4KGZB 2OAUA 4NOYA 4BDZA 2EVRA 2X3XD 5GMKh 1VQ8Q 3JCMQ 2RF0A 2VGNA 2L3SA 4RG8A 4J9GA 2O4XA 5GAN5 4ZNXA 1RI9A 1YHQQ 3OYEA 1K76A 1VQ5Q 3CPFA 4CC2A 5DY9A 1DJ7B 3A8OB 2O31A 4PJMA 4N0AC 4M4ZA 3S6WA 5FROA 4OMOA 4PKCC 3PVQA 1ZBXA 1ZLMA 2CS7A 3PMTA 3TREA 2YUQA 3G71A 2LJ0A 1I07A 2LCSA 4C92E 2QQRA 1UEBA 2IIMA 1YI2A 2MWPA 3QYHB 2K7AA 2SEMA 8AT1B 5FLXE 1Y0MA 1M1FA 4ELZC 1C6VX 2EYQA 5GAN6 2DX1A 3CCJT 4F7UB 2RQWA 1XNIA 2LJ3A 4R56A 1D0ZA 2H3JA 5L8RE 1D09B 3ME9A 3I56A 1X27A 1D1CA 1Q82U 1EIFA 3QPHA 1V1CA 1YJNT 1O9SA 2O2OA 2K5IA 3AHUA 1SKUB 1TXQA 1ZSZC 3X20B 2QG9B 4XQ3A 1ZUKA 4HVVA 3CQTA 3BDUA 2JJ9A 5GAMe 2JW4A 1UHCA 4M7AC 3RR6A 1X69A 4ZGJB 3M57A 4FW1A 3UA7A 4JRQA 2LCLA 3CC2Q 2WACA 2CH4A 2VKNA 3L2VA 1VQ8A 3DLMA 4RMOA 3I55T 5A0GA 1FWZA 1BBZA 1YWPA 1YHQA 5GANj 1A0NB 2KY9A 2MIOA 4QKUA 2DEQA 2EQJA 1VQ5A 1TS9A 1YJNQ 4E7JA 1SHFA 4D8DA 5CO7A 2JM8A 2FO0A 2CT4A 3NPFA 1LNXA 2C0IA 2A28A 2EQMA 4CRIA 4BE0A 1U1SA 2K4YA 3PIPA 2KRSA 1OZ2A 2DMOA 2DBMA 3FEOA 2DBKA 2FZGB 4O6JA 3RBBB 2JMCA 2MMPA 2MAMA 3CPWS 2H8HA 1Z9QA 2ABLA 3C0CA 5GMKe 3G4SA 2EJGA 1GCPA 2P4RA 2V8KA 2A36A 2LTOA 3A5ZB 2EKHA 5DLOA 2CH4W 1JXOA 3ASKA 2CYZB 3JCMf 1Q86C 1BI1A 1ZUYA 1X6GA 4F16A 1T3LA 2JOYA 3TVTA 3QJ6A 1QWFA 5KYYA 4J9EA 1RL2A 5LJ3f 5KCOA 4L6V5 5CCAA 4DBQA 3G7ZA 2OI3A 3EAEA 1G5VA 4M78G 1B07A 2DVEA 3ZBDA 2GGRA 4M77F 3GOXA 2F1LA 2DL4A 2QDLA 1UDLA 5I2SA 1I81A 1RUWA 1N6AA 1OPKA 2YRDA 4C8QG 4KRTA 4DBRA 3I5RA 3CCVQ 1M3CA 1FX7A 3MKDA 4ZTJA 4PJOB 3WVEB 3GF5A 3CC2A 1IXDA 4C0DB 1UGVA 2PUKB 4OP0A 5CKDA 1OYXA 4RTYA 3CPWA 4Y92A 2CP6A 1KQ2A 3VYHB 2JXBA 4IUTA 2KT1A 3M0QA 5FWBA 2LT1A 3HL8A 3QO3A 2K3YA 2EJFA 1W2BS 3JB9J 2LDMA 3L2WA 4LD6A 3EG1A 3CBOA 1GXIE 5IHNA 2FG0A 1SG5A 2JVVA 2CZ0B 1BCMA 2X51A 4AMCA 4MZTA 2C06A 2DILA 1XTDA 2JZ2A 3A8LB 5LJ5f 3GPLA 5FU7B 5AT1B 3Q1JA 2KYBA 2JUFA 1ZBJA 1KQSP 1M4ZA 5HCKA 4AFSC 3CCRT 1HXDA 2E41A 2I2LA 3E9GA 1KC8R 3OYHA 4X9DA 4KGXB 1M1KC 3BDLA 2QTXA 1JU5C 4LXCA 1NLOC 1T0HA 3MHXA 1QP3A 3PNWC 4LDYA 2DXUA 3RUXA 3JB9G 4M7AA 4E7SA 4DBHA 1WXTA 4Q5WA 2F5TX 1VOMA 1PG5B 2OJ2A 3X25B 3V8LA 3CCSA 3G1JA 3L42A 3EG2A 2J6FA 2K6DA 4XK8E 1QP2A 1OOTA 4XAXB 1VQKT 2JMAA 1W2BA 1YN8A 3CC7T 4C92F 3L2RA 2DE0X 5GAN4 3JCMJ 2RQRA 1ACMB 3CC4T 1QVFS 4HXJA 2X3WD 3C12A 2R5MA 4M7AE 4A4KA 3DB4A 3THKA 3CCVA 2KMTA 3JV3A 2V26A 4LNPA 3JCMd 2B8AA 2VUBA 1IZ6A 1W1FA 1KD1R 2NUPB 1M30A 3JRZA 2X4WA 4OMFB 1NJIR 3PGGA 5LJ3d 1QKXA 1WJRA 4FM4B 3H0IA 2COYA 3I5SA 4E7KA 4PFPA 1PKTA 1R8OB 1K4US 3JB9H 3MEAA 2LJ1A 1VUBA 4PNOA 4Z8AA 4RTUA 1M3AA 1G2BA 3CC4Q 1K1ZA 2GNCA 3RKXA 1VQ9Q 3CCQT 4NL3A 2M0YA 4OVAA 4HVWA 1IO6A 5GAOr 5GMKj 2MK5A 4OB3B 3NTIA 2ZAEA 4FT2A 4PJOF 1KC8U 1Y71A 4D6WA 3RESA 1QVFA 3RERA 2PVDB 5IXBA 2QDYB 4A54A 1M2VB 4R0KA 4AT1B 5FRMA 3OY9A 3PE0A 2AZSA 4RCCA 3CCMA 3I35A 5ECAA 2RHYA 3DKMA 3L1AA 5LJ5d 4M77D 3CCET 2FHDA 4ZTFA 4CC4B 1KHCA 3WXMB 1VQ4T 3CCUT 2A3LA 2DA9A 3NMZC 1UB4A 1UUEA 2VV5A 5EG2A 3GP8A 3QIIA 3G6EQ 3HRTA 2RMOA 1RAIB 3R6NA 3E19A 4GLMA 2HKQB 2HMAA 1WXBA 2X35A 1W4SA 2K79A 4X9CA 1ZHIA 1B3QA 2GQVA 2RHIA 3OMGA 3SFMA 5GAN7 1Q7YR 3MEUA 2RNAA 2R57A 4A4HA 1NLPC 1KD1U 2V1RA 1K0SA 4X34A 4J9CA 3JCMP 4D8KA 3VUBA 3KUFA 1M3BA 1ZA1B 2DPPB 1NJIU 1VQ4Q 3CBMA 3OS5A 5I2MA 2KYMA 3E9FA 3SB2A 2KROA 3HPWA 3CCLA 2EQIA 5LJ3g 2XICA 2DETA 1QLYA 2F2VA 3CC4A 4DOWA 2G3RA 4OMLA 2E6ZA 1VQ9A 3KXTA 2BUDA 3G71T 5GAOm 4PJOC 1RAFB 4O5VA 2KSSA 3QZ9B 4M7DB 4C0DC 1QMCA 2HL3A 3DLLA 3J80E 3J7AF 4KULA 1YI2T 3CBPA 4PL6A 2V1QA 3HHTB 4KH1B 2E4HA 3TEEA 2CREA 1JQQA 3ZL7C 2VWFA 4IURA 4ORZA 1M27C 1YWOA 4C92D 1WHMA 3S3MA 5FU7C 4EMKB 3BW1A 3CXCS 5LJ5g 2EYYA 3PMIA 3G6EA 5J26A 1YITA 1KSWA 4J6YA 1TTHB 1H8KA 5FWCA 3LGLA 7AT1B 3LLRA 3MJXA 5GAMh 2OTJQ 1SSHA 1Q7YU 1KIKA 1QCFA 1X2KA 4HCKA 4F7UE 2MPXC 2NUTB 1R0BG 4RTXA 3V8JA 3QDFA 1ZX6A 4PFZA 4FYXB 3CPWP 2YUOA 1OQKA 5CK9A 3JAME 1VQ8T 2ATCB 5FU6B 3J81E 1E7OA 2O88A 1YHQT 1JRIA 3V8KA 3JB9I 2XD0A 3C4SA 5KE3A 2MOXA 3CMEQ 4E7HA 1VQ5T 2DRMA 4J9DA 1V76A 2YUNA 1RACB 3GLXA 4KH0B 1MMNA 3EG0A 5KYUA 2M0OA 3REBB 3OYAA 4PFOA 4A4FA 4QVZA 5IXFA 3H0HA 2DD4A 2PZ1A 4DA4A 1B7TA 2V8JA 2YUPA 2LZ6B 1I5LA 2FYKA 4FYWB 4M7AF 2A08A 1WGSA 5LL6S 4FIBA 2GTOA 1AVZC 4C92A 3JCMX 1UGQB 1LJOA 2EIFA 1IGQA 2DXCA 2XDDA 1PCXA 2E10A 2BZ8A 5C6SA 2EW3A 3G4ST 1MNDA 1I8FA 1QW1A 2QEXQ 4FW2A 2PVOB 1LVKA 1N8RR 1OV3A 3OYLA 2RA2A 1GRIA 2KEAA 3RKWA 1MNEA 3EFSA 4ELYC 4BE2A 4Z88A 2M1HA 1JBMA 4BD3A 2AKKA 2AT1B 5KYXB 1W2BP 3VS6A 2O9VA 1FMWA 2BTTA 3QHSA 4HT8A 5C0MA 2CGHA 1AEYA 1U06A 2K2MA 2OTJA 1WLPB 4JLIA 3VU3C 3G4SQ 3IQLA 5GANf 1YBYA 1WHLA 4WCIA 3V7RA 1AOJA 1GCQA 2NLUA 2QQBA 5GAOp 3U23A 3QJYA 1D0XA 2JS2A 2MYSA 4CC3A 2LQ8A 1K9MC 1HYOA 3CC2T 3EG9B 4PJOA 3EGXB 3DB3A 1VYTA 2RHXA 2DXBA 4J6WA 1X2QA 2P0QA 3CMEA 4ANJA 4E7LA 4IUQA 1JJ2S 1B34A 1K8AC 1UJYA 1EX4A 1X6BA 3H9NA 4HCCA 2YXYA 5CKHA 1M90R 2VXFA 4PJOE 3M56A 5GAOl 1M2OA 2A7YA 3EGUA 5D7UA 2BKDN 4LN2A 3UF4A 2CZ6B 3ER0A 1PC0A 2DAQA 1NZ9A 1QVFP 3HRSA 2COWA 4N4IA 2FPEA 3O8VA 3C95A 2QEXA 3GNGA 3PIOA 2RK1A 2VXEA 1GFCA 4M78B 1N8RU 5DLQE 4F04B 2JTMA 1JB0E 1WXUA 2K5FA 1WHGA 1K0XA 2KE9A 5LJ5e 4C8QB 4M77G 2O9SA 1YIJQ 2RI3A 1VQMQ 1KC8C 1SRLA 2EJ9A 2FRYA 2Z0WA 3CCST 4M7DC 1HSQA 1UHFA 4IKFA 1WZOA 2NUZA 3OYMA 1JJ2A 3O5ZA 3F70A 4PLIA 4DEYA 2KXDA 4RG2A 4LDVA 1D3BA 1Q81R 3A8MB 3EGDA 1S72Q 3CCVT 3NFCA 2ZPBB 2LNHB 3PFSA 3JCMW 1OX8A 1R77A 2F2WA 2YRVA 2O4XB 4EMKC 4QT7A 1NEBA 3FB9A 2D6FA 2QXFA 2RK2A 3CCSQ 1E6HA 1KQ1A 4JS5A 4AG2C 2RJCA 3RDVA 4M7AD 2KQWA 2A0FB 2AK5A 3NTHA 2KNBB 5GANd 4N0AA 1M90U 2RD1A 4KGVB 1NJIC 3GIBA 4TVRA 3QYGB 1MGQA 2MI6A 4F7UF 5KYWB 1IB8A 2QA4Q 2HL5C 3PVLA 2FZKB 2PUOB 2HSEB 3OA6A 4NL2A 2JTFA 2DL7A 3VS7A 4MDXA 3M54A 1WNLA 2K3XA 4LUDA 3GNFB 1PD0A 2H3EB 4FL6A 2K57A 1M2VA 1ZUUA 3KBGA 3SWNB 1WHKA 1H3HA 3CCMT 4E6RA 4C92G 3JSCA 2EGCA 2L8DA 1YIJA
chains in the Genus database with same CATH topology
4J8OA 3QUIA 3OY9A 3UWNA 1VQMA 1VQPA 1H641 4OB1B 4RCCA 2JNGA 2EQUA 3CCMA 2RHYA 2ZGWA 3DKMA 5KCHA 3L1AA 4KUIA 3MO8A 4M77D 5LJ5d 3CCET 3MCAB 2FHDA 2DJZA 3FRNA 3META 5HK3A 4ZTFA 1M90C 1KHCA 4LDXA 4IUVA 4QVCA 3WXMB 3JB9D 2CZ1B 2KDSA 3CCUT 1VQ4T 3M9QA 2A3LA 3LYIA 4FU6A 4M75C 3X28B 3CMAA 1UB4A 3UDCA 4M7DG 1S72T 1VQNT 2VV5A 4J83A 5EG2A 3CCEA 4JS4A 3GP8A 3QIIA 3HRTA 2DTOA 4J7IA 1VQ4A 3CCUA 1Q81U 4C8QA 4HKEA 5J39A 4HCBA 1S72A 1VQNA 5CQYA 3E19A 3OYBA 1N9RA 2LT4A 4LDWA 2X35A 1W4SA 2RJDA 2XK0A 1K73C 4M78F 4QVDA 2V8IA 4X9CA 3T9NA 3LW5E 3EFRA 1ZHIA 2ZPGB 1BYMA 2GQVA 2RHIA 3OMGA 1H3ZA 3SFMA 5GAN7 5KE2A 3MEUA 4JUVA 1X75C 1BI3A 2DIQA 5IN1A 2R57A 4BY6B 4A4HA 1Y96A 1KD1U 4X34A 3QXEB 3M53A 3JCMP 2HD0A 2RJEA 3CXCA 4F7UG 3VUBA 4LDUA 3QKJA 5GAMj 3KUFA 5IT9E 2D9TA 1AHJB 2DPPB 4MDWA 4N4HA 1NJIU 2K2VA 3CCLT 2ZZDA 1BKBA 2M9UA 2OAUA 4KUDK 4NOYA 5CQXA 2CZ7B 2EKOA 3CBMA 3OS5A 4BDZA 4BE1A 2EFIA 5GMKh 5I2MA 3JCMQ 3E9FA 3SB2A 3HPWA 3CCLA 2VGNA 4HCZA 5GMKm 1G3TA 2VYTA 2EWNA 2XICA 2RM4A 2IVWA 2O4XA 4RG8A 4Z02A 3WVDB 4C92B 5GAN5 1VQ9T 1N27A 2VGMA 3FIFA 2XHCA 4A4GA 3OYEA 2QA4T 2KK4A 3CC4A 4DOWA 2G3RA 2MF2A 5GANg 4LD9K 4JJNK 3CPFA 2E6ZA 2EAYA 2WSEE 3HRUA 3HSBA 5DY9A 1DJ7B 3A8OB 1VQ9A 3KXTA 2BUDA 2XDPA 2JN0A 2WSCE 2RH2A 4N0AC 3S6WA 4XU1A 2RJFA 3P8BB 2GCXA 5FROA 3G71T 2QA4A 4M7DA 3OS0A 3CC2A 4PKCC 5GAOm 5HK0A 4PJOC 2DTHA 1ZBXA 4O5VA 4RCBA 2KSSA 2CS7A 3PMTA 3QZ9B 4BB7A 4M7DB 4C0DC 3NTKA 4XU2A 3TREA 3G71A 1X6OA 3QG1A 4M75E 5A0LA 3DLLA 2YHTA 4C92E 3OYNA 2QQRA 3J80E 4CI0C 1KD1C 3J7AF 5LJ3g 4KULA 1YI2T 3CBPA 2P4TA 1BI0A 4PL6A 2DXTA 2YLBA 5FRNA 2QQSA 1XOVA 1X01A 1UEBA 3HHTB 3A8HB 3TEEA 3FC3A 2HAXA 4MMKA 3A8GB 1YI2A 2ZPEB 4XU0A 2MWPA 2X4XA 3QYHB 4R55A 4QQGA 2L3RA 1FXXA 4IURA 3FJPA 4MZPA 5FLXE 4M75D 1M1FA 2RHUA 1I4K1 4YTLA 4BI4A 4ELZC 4M7DE 2EYQA 1HK9A 3H8ZA 4C92D 3G6ET 3S3MA 5GAN6 5FU6C 1YITT 5FU7C 2RI2A 3CCJT 4EMKB 4C0GA 2ZCFB 4F7UB 3OYDA 4QQ6A 3BW1A 4C0FA 3CXCS 2HQXA 3RKYA 5LJ5g 1M8VA 3M58A 3RMQA 1XNIA 3PMIA 2P0KA 5J26A 3PTAA 3G6EA 1YITA 4R56A 3CCJA 5L8RE 2H3JA 2XKOC 4J6YA 5GAMf 1M9SA 1WQ7A 2XI9A 4M78C 4J6XA 4A53A 1SSFA 4J5YA 4ME7A 3ME9A 4BACA 1VIEA 3LGLA 2LQKA 4OGEA 5J3BA 3VJPA 3I56A 4M7DD 3LLRA 1Q82U 1EIFA 3QPHA 5GAMh 2E6NA 1YJNT 3OQ5A 3OB9A 1O9SA 4QW2A 4C8QC 5GAN2 1Q7YU 2K5IA 4F7UE 3AHUA 1B34B 3P8HA 3VV0A 4EDUA 3X20B 1G3YA 2ZPHB 1YJNA 4XQ3A 3HFNA 3BDUA 5GAMe 4OB2B 4M7AC 1G3WA 4MZMA 3V8JA 3S3NA 3SDZA 4UC4A 3ZEHA 5CK9A 4ZGJB 3M57A 3JAME 1VQ8T 5HKCA 3OYKA 4P5NA 4JRQA 2DK3A 2DO3A 4OB0B 5FU6B 3J81E 3LWIA 5D6WA 4ZGDB 2LCLA 5D6YA 5AYFA 1KHIA 2XD0A 1YHQT 1JRIA 2WACA 3V8KA 5LJ3j 3C4SA 3JB9I 3L2VA 1VQ8A 5KE3A 3DLMA 3MP1A 3H6ZA 4E7HA 4RMOA 3FDRA 1VQ5T 3I55T 5A0GA 1FWZA 3GLXA 1YHQA 2R58A 5GANj 2DIGA 2KY9A 1XQHA 3HP9A 2X4YA 2DEQA 2EQJA 1VQ5A 2FVUA 2IG0A 2M0OA 3I55A 3OYAA 4C8QF 1Q86U 1P92A 4E7JA 3RMSA 1U8RA 3TCJA 1Q82C 4A4FA 4QVZA 5CO7A 1WJSA 3BY7A 2DD4A 3JCMg 4DA4A 2V8JA 4XTZA 1I5LA 1M5Q1 1Q7YC 2FYKA 4M7AF 1LNXA 2FL7A 1WGSA 2FB7A 5LL6S 4M75A 4FIBA 2EQMA 4CRIA 2L89A 5GMKi 4BE0A 1U1SA 2K4YA 2Y90A 3PIPA 3UPUA 1VQ7T 1OZ2A 4C92A 5IAYA 3JCMX 1UGQB 1LJOA 2EIFA 2KVQG 2DXCA 4M75B 1NE8A 3FEOA 4PJOG 3JCMb 2XDDA 4C0ZA 2E10A 4O6JA 4B9WA 1YJ9T 3M4GA 1VQ7A 3M59A 3OYJA 5C6SA 3V7SA 3G4ST 1I8FA 1QW1A 2PVOB 2MMPA 2ZPIB 4FT4A 2GFAA 2MAMA 3CPWS 2OTLT 5KH6A 4M77C 1YJ9A 4M7AG 1V29B 5GMKe 3OYFA 1K9MU 4B9XA 4C5GA 3OYLA 2EJGA 3G4SA 1PSFA 2RA2A 4II1A 1YCYA 2QI2A 2V8KA 2X4JA 2OTLA 2LTOA 3A5ZB 3RKWA 1ZQ1A 1U1TA 2XU8A 4JLGA 5A2QE 1D3BB 1PSEA 2HNIA 3EFSA 5DLOA 2LC4A 1WPYA 4ELYC 4BE2A 1N8RC 5LJ5j 4M78D 2M1HA 3ASKA 1JBMA 4OGCA 3HFOA 1VIFA 2CYZB 1WJQA 3JCMf 4BD3A 4DQ2A 1Q86C 1BI1A 4JDSA 1M1GA 1K8AU 1VQ6T 2P0PA 3OW2S 2JOYA 3N5BB 4E47A 2OTJT 3QHSA 4HT8A 3JCMh 5C0MA 3QJ6A 1VQ6A 1RL2A 5LJ3f 5KCOA 2CGHA 4L6V5 5CCAA 3SWNC 2XG8D 3G7ZA 1QVGS 3EAEA 2OTJA 1G5VA 4M78G 4JLIA 3VU3C 3INZA 2K5LA 2DVEA 4HA8A 5GAOn 3ZBDA 5GANf 4M77F 4EMKA 4F7UA 5LJ3h 3GOXA 2RO0A 2DKGA 4L5GA 5CR2A 4L59A 1YBYA 1BIAA 3V7RA 3JB9F 4ZGEB 2NLUA 2QQBA 5I2SA 5GAOp 2VC8A 1KG1A 1I81A 1N6AA 4C8QG 3QJYA 3OYYA 3UT1A 3OBYA 1NPPA 2EQKA 2LQ8A 5GANh 4E7IA 1K9MC 3X26B 3CC2T 4GY5A 4PJOA 1FX7A 3OYGA 1G3SA 4C5HA 4XTXA 3C94A 3CEYA 3CMET 4ZTJA 2BIVA 3DB3A 1VQLT 4PJOB 2XDBA 5CIUA 3M55A 3S3OA 2RHXA 2DXBA 3GF5A 3WVEB 5CAIA 1BI2A 4J6WA 1BIBA 2PUKB 4C0DB 4OP0A 3VYGA 4RKUE 5GAMd 5CKDA 3RIRA 1OYXA 3MEVA 1M1KU 4IUPA 5GANe 3CPWA 4ATOA 2P0QA 3CMEA 5CVIA 4E7LA 4IUQA 1TH7A 4KT0E 1JJ2S 1VQLA 3VYHB 3HKSA 1KQ2A 1B34A 1K8AC 4IUTA 2YLCA 5GMKl 5GAOq 4PLLA 2LT1A 3HL8A 3QO3A 2K3YA 2EJFA 3M4YA 3L2UA 3LH0A 2E12A 1UGRB 2KAFA 4XTUA 4HCCA 4EMGA 1W2BS 3JB9J 2LDMA 3L2WA 4LD6A 1VQPT 4XTYA 4IUUA 3CBOA 5CKHA 3OYIA 1GXIE 2E64A 4BY6C 2VXFA 4PJOE 4ZN3A 2JVVA 4Y91A 2CZ0B 4Y28E 2CKKA 3M56A 3BFMA 3MP8A 4MZTA 5GAOl 1IREB 3OW2A 2A7YA 2E1HA 2E70A 1XTDA 2JZ2A 2BKDN 3A8LB 3E1SA 5LJ5f 4BDYA 3GPLA 2CZ6B 3ER0A 3OS2A 5FU7B 2QEXT 3OSVA 2MWOA 2DAQA 3CMAT 3R6OA 2Y4XA 3QSUA 3ZFJA 3Q1JA 1NZ9A 2JUFA 3HRSA 4C5IA 1QVGA 4M78A 5LJ5h 3OS1A 4N4IA 4FSXA 3O8VA 3C95A 4HT9A 1M4ZA 2F5KA 4A4EA 4NS5A 3GNGA 2QEXA 3CCRT 1HXDA 3PIOA 2RK1A 2VXEA 4M78B 1N8RU 2E41A 5DLQE 1WQWA 2I2LA 3E9GA 3QBYA 4C92C 4PJOD 2JTMA 4X9DA 3OYHA 1JB0E 1OI1A 1QVPA 3CCRA 1M1KC 3BDLA 2K5FA 2QTXA 2Y4YA 4N4GA 2QQ9A 5LJ5e 3MP6A 2WSFE 4C8QB 5CKEA 4M77G 3MHXA 4KBMB 1QP3A 2RI5A 3PNWC 4LDYA 1YJWT 2RI3A 2DXUA 3RUXA 5I21A 1KC8C 2O01E 3JB9G 4M7AA 2EJ9A 4DOVA 2LRQA 4MMLA 4BI3A 3CCST 4M7DC 2DZ9A 1YJWA 4C5EA 4M7AB 3VUZA 3QDRB 4Q5WA 5GAN8 4IKFA 2F5TX 3P8DA 4M78E 3OYMA 1JJ2A 2LVMA 3V8LA 3X25B 3CCSA 3TU4K 3L42A 2GFUA 1Y96B 3F70A 3OMCA 4PLIA 4QQDA 3OBWA 3V7CA 4EMHA 4XK8E 1QP2A 4XAXB 1VQKT 4M75F 5CKFA 4RG2A 4LDVA 1D3BA 4C8QE 5GAN3 2HBPA 1W2BA 4BI8B 3CC7T 3A8MB 2ZPFB 2PVGB 4JRIA 3M5AA 4C92F 3L2RA 4XTVA 5GAN4 3OYCA 2D0QB 3CCVT 3JCMJ 3NFCA 2ZPBB 1VQKA 3PFSA 3CC4T 3JCMW 1QVFS 4J7FA 3CC7A 3C12A 3OSSC 4GLKA 2R5AA 2LCCA 2R5MA 1KQSS 4M7AE 1Y7XA 3FLGA 4A4KA 3DB4A 3CCVA 2KMTA 2YRVA 1Q81C 2O4XB 4EMKC 3VKIA 4V2SA 1OZ3A 2AHJB 1VQOT 2HQEA 1O75A 2E5QA 2B8AA 2VUBA 3FB9A 3JCMd 2D6FA 3MEWA 1MHNA 1IZ6A 2QXFA 4C8QD 2DZCA 4M7DF 2RK2A 1N9SA 1KQ1A 2LX9A 4EPCA 4JS5A 1VQOA 3JRZA 2RJCA 3L2ZA 3LWHA 5CKBA 3URGA 2X4WA 4OMFB 3PGGA 5LJ3d 5GAMg 4XTWA 2KQWA 4M7AD 1WJRA 4FM4B 2XIDA 2C06A 2E65A 3NTHA 3JCMe 4M77A 4WF2A 2LNVA 3CD6T 4E7KA 5GANd 4N0AA 1R8OB 4M77B 4BUGA 3JB9H 3MEAA 3LX7A 3L2QA 2F69A 1M90U 1VUBA 2RD1A 4PNOA 1NJIC 2GF7A 4XU3A 3CD6A 4TVRA 3GIBA 2RB6A 5LJ3e 3LGFA 3QYGB 3X24B 5D6XA 1MGQA 1Y07A 2L5QA 2M16A 2MI6A 3RKXA 3CCQT 4F7UF 4NL3A 3QZ5B 1LOJA 4OVAA 1UGPB 3JCMV 3JCMc 5GAOr 2PUOB 5GMKj 3OA6A 4NL2A 2JTFA 5M9OA 4OB3B 3NTIA 4OF1A 4MDXA 2DTIA 3CCQA 3SD4A 3M54A 1WNLA 4JRPA 4FT2A 2K3XA 1K73U 1NPRA 3GNFB 4VUBA 4PJOF 2PU9B 1KC8U 4M77E 3SWNA 1Y71A 3I56T 4FL6A 2K57A 4JRKA 5A0DA 4D6WA 1RI0A 5DM7R 3KBGA 3PT9A 3RESA 1YIJT 1QVFA 3RERA 2PVDB 4ZN1A 2QDYB 3SWNB 1VQMT 4M75G 4A54A 1KQSA 2PQWA 3CCMT 2RHZA 1UGSB 3JSCA 5HY6A 4C92G 2L8DA 1YIJA 2DD5A 2QQAA 5FRMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IUR A;  3OY9 A;  3UWN A;  2LTO A;  2RI5 A;  3PNW C;  2RHU A;  2RI3 A;  2EQU A;  2RHY A;  3H8Z A;  4BE2 A;  3S3M A;  5KCH A;  2RI2 A;  2LRQ A;  2M1H A;  3ASK A;  3MO8 A;  3OYD A;  4BD3 A;  2FHD A;  1WJQ A;  3MET A;  4C5E A;  4QQ6 A;  4ZTF A;  1KHC A;  4Q5W A;  4IUV A;  2HQX A;  4IKF A;  3P8D A;  3M9Q A;  3LYI A;  1XNI A;  3PMI A;  2P0K A;  4FU6 A;  5J26 A;  3OYM A;  2LVM A;  3QII A;  3L42 A;  2GFU A;  5C0M A;  3QJ6 A;  3F70 A;  3OMC A;  4PLI A;  4QQD A;  1SSF A;  5KCO A;  3ME9 A;  5J39 A;  4BAC A;  3LGL A;  4RG2 A;  3EAE A;  3LLR A;  3OYB A;  1G5V A;  2X35 A;  2E6N A;  2RJD A;  2XK0 A;  3L2R A;  3OQ5 A;  3OYC A;  3OB9 A;  4QW2 A;  3GOX A;  3PFS A;  2RO0 A;  2RHI A;  4L59 A;  3OMG A;  1H3Z A;  2R5A A;  2LCC A;  2R5M A;  3P8H A;  4EDU A;  3FLG A;  2NLU A;  5KE2 A;  3MEU A;  3DB4 A;  2DIQ A;  2YRV A;  3UT1 A;  2EQK A;  2O4X B;  2R57 A;  5IN1 A;  4A4H A;  4E7I A;  1OZ3 A;  4GY5 A;  3S3N A;  2HQE A;  2E5Q A;  4X34 A;  2B8A A;  3OYG A;  3MEW A;  1MHN A;  4UC4 A;  2L3R A;  3ZEH A;  4C5H A;  3CEY A;  2RJE A;  4ZTJ A;  2BIV A;  3DB3 A;  5CIU A;  3OYK A;  3S3O A;  2RHX A;  3QKJ A;  3KUF A;  2D9T A;  4N4H A;  1OYX A;  3MEV A;  2RJC A;  4IUP A;  5D6Y A;  5D6W A;  2X4W A;  2WAC A;  4BDZ A;  2EKO A;  3C4S A;  4IUQ A;  3L2V A;  4BE1 A;  4E7L A;  5KE3 A;  2EFI A;  3DLM A;  1WJR A;  3MP1 A;  3H6Z A;  4IUT A;  4E7H A;  3FDR A;  3E9F A;  3NTH A;  4PLL A;  4HCZ A;  2VYT A;  2K3Y A;  2O4X A;  2R58 A;  4Z02 A;  3LH0 A;  3L2U A;  4E7K A;  2DIG A;  1N27 A;  2X4Y A;  2EQJ A;  2LDM A;  3LX7 A;  3MEA A;  4LD6 A;  4A4G A;  2IG0 A;  3OYE A;  3L2Q A;  2M0O A;  3L2W A;  3OYA A;  2G3R A;  4IUU A;  2GF7 A;  4E7J A;  3OYI A;  4A4F A;  4QVZ A;  2BUD A;  3LGF A;  1WJS A;  2XDP A;  5D6X A;  3S6W A;  2CKK A;  5FRO A;  3MP8 A;  2RJF A;  2M16 A;  4BDY A;  2JZ2 A;  3OS0 A;  2BKD N;  4OVA A;  3OS2 A;  1WGS A;  3PMT A;  3OA6 A;  2EQM A;  2MWO A;  4CRI A;  2L89 A;  3NTK A;  4BE0 A;  2DAQ A;  2JTF A;  5M9O A;  3NTI A;  1OZ2 A;  3Q1J A;  5IAY A;  3SD4 A;  4C5I A;  3FEO A;  3OS1 A;  2K3X A;  2QQR A;  4N4I A;  3OYN A;  3O8V A;  2F5K A;  4A4E A;  4NS5 A;  4B9W A;  3OYJ A;  4PL6 A;  5C6S A;  4FL6 A;  5FRN A;  1RI0 A;  3E9G A;  3QBY A;  2GFA A;  2QQS A;  3OYH A;  1OI1 A;  5KH6 A;  3FC3 A;  3BDL A;  2PQW A;  4N4G A;  2MWP A;  2RHZ A;  2X4X A;  4B9X A;  4C5G A;  4QQG A;  3OYF A;  3OYL A;  4II1 A;  2L8D A;  3MP6 A;  5FRM A; 
#chains in the Genus database with same CATH topology
 4J8O A;  3UWN A;  1VQM A;  2GQI A;  4OB1 B;  5GJW B;  2JNG A;  1RAA B;  5KCH A;  1U3O A;  2L0A A;  3MO8 A;  3MCA B;  3FRN A;  4IUV A;  1PM3 A;  2CZ1 B;  3M9Q A;  4FU6 A;  4JJD A;  1SF9 A;  2DTO A;  2CSQ A;  2DM1 A;  3TSW A;  2DL8 A;  4J7I A;  1Q81 U;  4HKE A;  5J39 A;  2DYB A;  1S72 A;  1VQN A;  3OYB A;  2LT4 A;  1ZSZ A;  2L3P A;  1K73 C;  4M78 F;  3LW5 E;  2KT8 A;  3CCM Q;  1GFD A;  5KE2 A;  4JUV A;  1BI3 A;  1BU1 A;  5IN1 A;  2M02 A;  2PTK A;  1Y96 A;  3QXE B;  2HD0 A;  1YP5 A;  2RJE A;  5GAM j;  2VB6 A;  5IT9 E;  2D9T A;  1AHJ B;  4MDW A;  4ESR A;  2DF6 A;  3CCL T;  2D8H A;  1BKB A;  1D1B A;  2M9U A;  4KUD K;  4BE1 A;  2EKO A;  1XJW B;  2VYT A;  2K3B A;  2IVW A;  4Z02 A;  3EFO A;  3WVD B;  3CXC P;  2OAW A;  1VQ9 T;  1N27 A;  2VGM A;  2KK4 A;  2QAZ A;  2MF2 A;  5GAN g;  4JJN K;  3HSB A;  2WSE E;  2QTV A;  1Q86 R;  2WSC E;  2DYI A;  4XU1 A;  2QA4 A;  4M7D A;  2GCX A;  1AT1 B;  2DTH A;  3NTK A;  2KRN A;  3QG1 A;  4M75 E;  2YHT A;  3OYN A;  4CI0 C;  3GBQ A;  2CP5 A;  3CCL Q;  1BI0 A;  2DXT A;  2AIR B;  2DFU A;  3MPU B;  1Z9Z A;  2QQS A;  1VQ7 Q;  2HDA A;  2EYX A;  2HAX A;  3FC3 A;  4MMK A;  1TUD A;  2ZPE B;  4R55 A;  2X4X A;  2YSQ A;  4QQG A;  2L3R A;  5KYY B;  1YJ9 Q;  1FXX A;  2XMF A;  3FJP A;  4MZP A;  4YTL A;  2J6O A;  1I4K 1;  1TUG B;  2RHU A;  4BI4 A;  4M7D E;  2OTL Q;  3H8Z A;  2LP5 A;  4LUE A;  3G6E T;  1YIT T;  2VVK A;  4QQ6 A;  4B6M A;  1UJ0 A;  3RKY A;  1AWJ A;  1M8V A;  3M58 A;  3RMQ A;  2P0K A;  3PTA A;  1NM7 A;  1K9A A;  4E2F B;  2XKO C;  1M9S A;  1RLQ C;  2XI9 A;  4M78 C;  4J6X A;  4A53 A;  1D1A A;  1SSF A;  4ME7 A;  1ABQ A;  1TU0 B;  1VIE A;  3VJP A;  2LQK A;  4OGE A;  5J3B A;  1VQ6 Q;  4OMP A;  2J6K A;  2DRK A;  1UE9 A;  2E6N A;  3M0U A;  4DEX A;  3OB9 A;  4QW2 A;  2FPD A;  1SHG A;  4C8Q C;  5GAN 2;  3P8H A;  3M0R A;  4EDU A;  1G3Y A;  2ZPH B;  1WA7 A;  2DEU A;  1G3W A;  5I22 A;  2CP0 A;  1YIT Q;  2QGG A;  3EG3 A;  5HKC A;  1RAD B;  4RTT A;  2NWM A;  1PNJ A;  2DO3 A;  4OB0 B;  4ZGD B;  4Z89 A;  1KHI A;  2W0Z A;  1YCS B;  1NYG A;  1M1K R;  3MP1 A;  3M0S A;  2R58 A;  2DIG A;  2KBT A;  3HP9 A;  2FVU A;  1Q86 U;  2DER A;  1P92 A;  2HSP A;  1JO8 A;  2FPF A;  5KYN A;  1U8R A;  1Q82 C;  3TCJ A;  3TQ7 P;  1WJS A;  1C0M A;  3BY7 A;  3JCM g;  4XTZ A;  1M5Q 1;  2AZV A;  2L89 A;  5GMK i;  1ZSG A;  2ECZ A;  4M75 B;  1NE8 A;  3EH2 A;  1RLP C;  2DVJ A;  3M4G A;  1VQ7 A;  3M59 A;  3OYJ A;  3V7S A;  4FT4 A;  2ZPI B;  3QWX X;  2GFA A;  4HVU A;  1IHV A;  2RPN A;  1YJ9 A;  1V29 B;  3OYF A;  4B9X A;  1PSF A;  1CKB A;  1YCY A;  2CP7 A;  2X4J A;  1NG2 A;  2OTL A;  2DL3 A;  1EZZ B;  2KR3 A;  1ZQ1 A;  1D0Y A;  1PSE A;  1JJ2 P;  2LC4 A;  1GBR A;  1N8R C;  4M78 D;  2NYS A;  3HFO A;  1WJQ A;  4JDS A;  1YJW Q;  3OW2 S;  2VAS A;  4E47 A;  1FMK A;  2HEQ A;  4PJN A;  2IPO B;  2OTJ T;  3JCM h;  2ED0 A;  1VQ6 A;  2EYZ A;  2CT3 A;  2ED1 A;  1UFF A;  2XG8 D;  3SWN C;  1QVG S;  2K5L A;  2YRC A;  4F7U A;  5LJ3 h;  2RO0 A;  2DKG A;  4L59 A;  1BIA A;  3TSZ A;  3M0T A;  4ZGE B;  4LE9 A;  3EG9 A;  3VS2 A;  3EGX A;  4RTW A;  1NPP A;  2EQK A;  3X26 B;  1AWX A;  1G3S A;  4C5H A;  4XTX A;  4AFZ C;  2LQN A;  3CME T;  2BIV A;  2E3I A;  1T0J A;  2XDB A;  4M7A G;  1BI2 A;  4OMQ A;  3VYG A;  4RKU E;  1BB9 A;  1M1K U;  3BE3 A;  5GAN e;  8ATC B;  3RNJ A;  1VQO Q;  4ATO A;  5CVI A;  1VQL A;  1ARK A;  1IHW A;  3FJ5 A;  5GAO q;  4PLL A;  3A1P A;  3LH0 A;  1UGR B;  2KAF A;  1MMG A;  4IUU A;  3OYI A;  3ULR B;  1AWO A;  1OU8 A;  4Y28 E;  3BFM A;  3OW2 A;  4AG1 C;  2E1H A;  4BDY A;  3OS2 A;  2QEX T;  3CMA T;  3R6O A;  2D1X A;  2Y4X A;  3ZFJ A;  3QSU A;  1QVG A;  4M78 A;  5LJ5 h;  1N5Z A;  3LH5 A;  2F5K A;  4A4E A;  1FYN A;  2D0N A;  2JT4 A;  1NEG A;  1WQW A;  4PJO D;  1OI1 A;  2C0O A;  2CP2 A;  4N4G A;  2Y4Y A;  1G83 A;  2DL5 A;  1WIE A;  2HCK A;  1LPL A;  2BE9 B;  4KBM B;  2RI5 A;  4WTO B;  4RUG A;  5I21 A;  4DOV A;  2LRQ A;  4MML A;  4BI3 A;  1YJW A;  2ESW A;  1OX9 A;  3P8D A;  4M78 E;  3CMA Q;  2BZY A;  4JJC A;  2ROT A;  3E2U A;  3H41 A;  3V7C A;  4EMH A;  3SHW A;  4M75 F;  5CKF A;  4C8Q E;  2HBP A;  2ZPF B;  3M5A A;  4JZ3 A;  3VS1 A;  4XTV A;  2D0Q B;  1MV0 B;  3UAT A;  4J7F A;  4JPB W;  3OSS C;  4GLK A;  2R5A A;  1Y7X A;  2HQH A;  3FLG A;  3EHQ A;  1Q81 C;  2PNI A;  3VKI A;  2E3H A;  2AHJ B;  1J3T A;  1O75 A;  2E5Q A;  1T3S A;  4M7D F;  2LX9 A;  4EPC A;  1VQO A;  3VRZ A;  3URG A;  2J05 A;  2XID A;  2JS0 A;  3JCM e;  2CSI A;  2LNV A;  2CUD A;  1U5S A;  2D8J A;  4M77 B;  1YFN A;  1F1B B;  2JM9 A;  3L2Q A;  2F69 A;  3VS3 A;  3EHR A;  2COZ A;  4XU3 A;  3CD6 A;  2RB6 A;  5LJ3 e;  3LGF A;  5KYW A;  5D6X A;  3HTR A;  2M16 A;  4AFQ C;  3QZ5 B;  1JXM A;  1UGP B;  1RAE B;  3JCM c;  1HJD A;  5M9O A;  5IH2 A;  3D7S B;  4JRP A;  2EPD A;  4VUB A;  3SWN A;  2DNU A;  2YDL A;  5DM7 R;  3PT9 A;  1YIJ T;  1AWW A;  4ZN1 A;  1VQM T;  2PQW A;  2EGE A;  3QUI A;  1H64 1;  2MCN A;  2EQU A;  1C1A A;  2ZGW A;  4F17 A;  2GTJ A;  2DJZ A;  3MET A;  4AFU C;  4LDX A;  2KXC A;  2KDS A;  3VS0 A;  2GBQ A;  4M75 C;  3X28 B;  3UA6 A;  3CMA A;  1S72 T;  1VQN T;  1KFZ A;  4JS4 A;  1OEB A;  1ABO A;  3CCJ Q;  2FZC B;  5CQY A;  1HD3 A;  4LDW A;  2C0T A;  2RJD A;  2XK0 A;  2V8I A;  3EFR A;  2ZPG B;  1BYM A;  1H3Z A;  1OUL A;  2QYZ A;  3NGP A;  1X75 C;  2DIQ A;  4FSS A;  4BY6 B;  1QCN A;  1BK2 A;  1WX6 A;  5KYU B;  4F7U G;  1AZE A;  4LDU A;  2K2V A;  1WHJ A;  2ZZD A;  5CQX A;  2CZ7 B;  3QWY A;  1VQN Q;  2EFI A;  4OMM A;  3VS4 A;  4HCZ A;  5GMK m;  1G3T A;  2EWN A;  5GAN 8;  2RM4 A;  4C92 B;  1SPK A;  1UG1 A;  3FIF A;  2L2P A;  2XHC A;  4A4G A;  1WI7 A;  2QA4 T;  2J06 A;  4LD9 K;  2NUP A;  1OU9 A;  2EAY A;  3HRU A;  2LX7 A;  3I55 Q;  1G8X A;  2XDP A;  2JN0 A;  2A37 A;  2RH2 A;  2RJF A;  1Y57 A;  3P8B B;  2CDT A;  3OS0 A;  5L23 A;  5HK0 A;  4RCB A;  4BB7 A;  2ENM A;  4XU2 A;  1X6O A;  5A0L A;  1WHH A;  4JZ4 A;  1I5O B;  4K11 A;  1KD1 C;  4PK4 A;  1NBE B;  3M0P A;  2P4T A;  1AZG B;  2YLB A;  5FRN A;  2LQW A;  1XOV A;  1X01 A;  3A8H B;  4J9H A;  3A8G B;  4XU0 A;  1I1J A;  1RAB B;  1K9M R;  4M75 D;  5IHK A;  1HK9 A;  5IHI A;  2L3Q A;  1WDX A;  5FU6 C;  2RI2 A;  2KRM A;  4C0G A;  2ZCF B;  3OYD A;  4C0F A;  2HQX A;  2K9G A;  3CCJ A;  1K8A R;  5GAM f;  1WQ7 A;  3VS5 A;  4J5Y A;  4BAC A;  4M7D D;  2YWW A;  2DJQ A;  3OQ5 A;  1B34 B;  4E7Z A;  2EGA A;  3VV0 A;  1YJN A;  4GBQ A;  3HFN A;  2W10 A;  4PJJ A;  4OB2 B;  4MZM A;  3S3N A;  4OMN A;  3SDZ A;  4UC4 A;  3ZEH A;  1GL5 A;  1PD1 A;  3OYK A;  4P5N A;  1W6X A;  2DK3 A;  3LWI A;  5D6W A;  5D6Y A;  5AYF A;  5LJ3 j;  1VYU A;  3H6Z A;  3FDR A;  2KI7 A;  1XQH A;  1FMV A;  2X4Y A;  1EFN A;  5GJV B;  4A63 B;  3OW2 P;  1LCK A;  2IG0 A;  3I55 A;  4C8Q F;  3RMS A;  3REA B;  2M51 A;  1GBQ A;  4IIO A;  1QVG P;  1Q7Y C;  4CC7 A;  1M8M A;  2FL7 A;  2FB7 A;  1SRM A;  4M75 A;  1VQ7 T;  2Y90 A;  3UPU A;  5IAY A;  2KVQ G;  3JCM b;  4PJO G;  2BE7 D;  4C0Z A;  4DBF A;  4B9W A;  1YJ9 T;  5FW9 A;  4IIM A;  1UTI A;  4F14 A;  2OTL T;  5KH6 A;  4M77 C;  1K9M U;  4C5G A;  3CCR Q;  4II1 A;  2QI2 A;  2RQV A;  5A2Q E;  2XU8 A;  1U1T A;  4JLG A;  1D3B B;  2HNI A;  1WPY A;  3EGD B;  5LJ5 j;  1MUZ A;  4OGC A;  1VYV A;  1VIF A;  4DQ2 A;  1M1G A;  1K8A U;  1VQ6 T;  2P0P A;  4RTZ A;  2DLP A;  3N5B B;  2HKN A;  1QKW A;  3A98 A;  1VA7 A;  2EBP A;  1H92 A;  4J9I A;  3INZ A;  4HA8 A;  5GAO n;  3H0F A;  4EMK A;  1X43 A;  1WFW A;  4L5G A;  5CR2 A;  2OX7 A;  2X9H A;  1VQK Q;  3JB9 F;  2VC8 A;  3CC7 Q;  1KG1 A;  2F2X A;  1QCO A;  3OYY A;  3UT1 A;  3OBY A;  5GAN h;  4E7I A;  4GY5 A;  3OYG A;  1MMD A;  3C94 A;  3CEY A;  4PJL A;  1VQL T;  5CIU A;  1CSK A;  3M55 A;  3S3O A;  5CAI A;  1PRL C;  1BIB A;  5GAM d;  3RIR A;  1Q95 G;  3MEV A;  1CKA A;  2RQT A;  4IUP A;  4KT0 E;  1TH7 A;  3HKS A;  1QQJ A;  1W70 A;  2YLC A;  5GMK l;  2G6F X;  2NUT A;  3M4Y A;  3L2U A;  2E12 A;  4XTU A;  4EMG A;  1AD5 A;  4XTY A;  1VQP T;  2E64 A;  4BY6 C;  4ZN3 A;  4Y91 A;  2CKK A;  3MP8 A;  1IRE B;  2E70 A;  3E1S A;  1IGU A;  3OSV A;  2MWO A;  3VRY A;  4C5I A;  1VQL Q;  3OS1 A;  4FSX A;  4HT9 A;  1S1N A;  3CCQ Q;  4NS5 A;  2QAS A;  1R0C B;  1K73 R;  1TOV A;  4C92 C;  3QBY A;  1QVP A;  4FYV B;  3CCR A;  1SEM A;  2RN8 A;  2QGF B;  2QQ9 A;  3MP6 A;  2WSF E;  5CKE A;  2SRC A;  1YJW T;  1KK7 A;  2P84 A;  1ZSZ B;  2J7I A;  1UEC A;  2O01 E;  1VQP Q;  1OPL A;  2CP3 A;  3SEM A;  2DZ9 A;  1PKS A;  4C5E A;  4M7A B;  2FRW A;  3VUZ A;  3QDR B;  2LVM A;  1WYX A;  1TUC A;  3TU4 K;  2GFU A;  9ATC B;  1Y96 B;  2RQU A;  3OMC A;  3CCE Q;  4QQD A;  3OBW A;  3CCU Q;  5GAN 3;  4BI8 B;  4JRI A;  2PVG B;  1E6G A;  3OYC A;  2CUB A;  4FCY A;  1VQK A;  3CC7 A;  2LCC A;  1KQS S;  5KYX A;  3EFO B;  4V2S A;  1OZ3 A;  1TWB A;  1VQO T;  2HQE A;  1PWT A;  1GCQ C;  3MEW A;  1MHN A;  4C8Q D;  2DZC A;  1N9S A;  1MMA A;  3L2Z A;  2LMJ A;  3LWH A;  5CKB A;  5GAM g;  4XTW A;  2E65 A;  4M77 A;  4WF2 A;  3CD6 T;  4JJB A;  4BUG A;  3LX7 A;  2GF7 A;  1MV3 A;  1TG0 A;  3I9Q A;  3X24 B;  1Y07 A;  2L5Q A;  4J9F A;  1IRX A;  1LOJ A;  1TSF A;  1PHT A;  3JCM V;  1YNZ A;  2AKL A;  2ROL A;  4OF1 A;  2HBW A;  2DTI A;  3CCQ A;  3SD4 A;  3EH1 A;  4EIK A;  3G71 Q;  1K73 U;  1NPR A;  2PU9 B;  1QWE A;  4M77 E;  3I56 T;  5A0D A;  4JRK A;  4FYY B;  1RI0 A;  1RAH B;  3AT1 B;  1RAG B;  1KJW A;  2E5K A;  1JEG A;  4M75 G;  1KQS A;  2RHZ A;  1UGS B;  5HY6 A;  1ZA2 B;  3CD6 Q;  2DD5 A;  1YI2 Q;  2QQA A;  2I0N A;  2YT6 A;  1VQP A;  2HZY A;  3NHN A;  3KFV A;  1I0C A;  4KUI A;  2BZX A;  5HK3 A;  1M90 C;  4QVC A;  2QK0 A;  3JB9 D;  3LYI A;  3UDC A;  4M7D G;  3CCE A;  4J83 A;  2KGT A;  1VQ4 A;  3CCU A;  2B86 A;  4C8Q A;  1BCO A;  5I11 A;  4HCB A;  1N9R A;  4RTV A;  3I56 Q;  1NYF A;  1Q82 R;  4J9B A;  4QVD A;  2JTE A;  3T9N A;  2EYW A;  6AT1 B;  3M53 A;  3CXC A;  4X1V A;  5EC7 A;  1PRM C;  3QKJ A;  2FEI A;  4N4H A;  4KGZ B;  2OAU A;  4NOY A;  4BDZ A;  2EVR A;  2X3X D;  5GMK h;  1VQ8 Q;  3JCM Q;  2RF0 A;  2VGN A;  2L3S A;  4RG8 A;  4J9G A;  2O4X A;  5GAN 5;  4ZNX A;  1RI9 A;  1YHQ Q;  3OYE A;  1K76 A;  1VQ5 Q;  3CPF A;  4CC2 A;  5DY9 A;  1DJ7 B;  3A8O B;  2O31 A;  4PJM A;  4N0A C;  4M4Z A;  3S6W A;  5FRO A;  4OMO A;  4PKC C;  3PVQ A;  1ZBX A;  1ZLM A;  2CS7 A;  3PMT A;  3TRE A;  2YUQ A;  3G71 A;  2LJ0 A;  1I07 A;  2LCS A;  4C92 E;  2QQR A;  1UEB A;  2IIM A;  1YI2 A;  2MWP A;  3QYH B;  2K7A A;  2SEM A;  8AT1 B;  5FLX E;  1Y0M A;  1M1F A;  4ELZ C;  1C6V X;  2EYQ A;  5GAN 6;  2DX1 A;  3CCJ T;  4F7U B;  2RQW A;  1XNI A;  2LJ3 A;  4R56 A;  1D0Z A;  2H3J A;  5L8R E;  1D09 B;  3ME9 A;  3I56 A;  1X27 A;  1D1C A;  1Q82 U;  1EIF A;  3QPH A;  1V1C A;  1YJN T;  1O9S A;  2O2O A;  2K5I A;  3AHU A;  1SKU B;  1TXQ A;  1ZSZ C;  3X20 B;  2QG9 B;  4XQ3 A;  1ZUK A;  4HVV A;  3CQT A;  3BDU A;  2JJ9 A;  5GAM e;  2JW4 A;  1UHC A;  4M7A C;  3RR6 A;  1X69 A;  4ZGJ B;  3M57 A;  4FW1 A;  3UA7 A;  4JRQ A;  2LCL A;  3CC2 Q;  2WAC A;  2CH4 A;  2VKN A;  3L2V A;  1VQ8 A;  3DLM A;  4RMO A;  3I55 T;  5A0G A;  1FWZ A;  1BBZ A;  1YWP A;  1YHQ A;  5GAN j;  1A0N B;  2KY9 A;  2MIO A;  4QKU A;  2DEQ A;  2EQJ A;  1VQ5 A;  1TS9 A;  1YJN Q;  4E7J A;  1SHF A;  4D8D A;  5CO7 A;  2JM8 A;  2FO0 A;  2CT4 A;  3NPF A;  1LNX A;  2C0I A;  2A28 A;  2EQM A;  4CRI A;  4BE0 A;  1U1S A;  2K4Y A;  3PIP A;  2KRS A;  1OZ2 A;  2DMO A;  2DBM A;  3FEO A;  2DBK A;  2FZG B;  4O6J A;  3RBB B;  2JMC A;  2MMP A;  2MAM A;  3CPW S;  2H8H A;  1Z9Q A;  2ABL A;  3C0C A;  5GMK e;  3G4S A;  2EJG A;  1GCP A;  2P4R A;  2V8K A;  2A36 A;  2LTO A;  3A5Z B;  2EKH A;  5DLO A;  2CH4 W;  1JXO A;  3ASK A;  2CYZ B;  3JCM f;  1Q86 C;  1BI1 A;  1ZUY A;  1X6G A;  4F16 A;  1T3L A;  2JOY A;  3TVT A;  3QJ6 A;  1QWF A;  5KYY A;  4J9E A;  1RL2 A;  5LJ3 f;  5KCO A;  4L6V 5;  5CCA A;  4DBQ A;  3G7Z A;  2OI3 A;  3EAE A;  1G5V A;  4M78 G;  1B07 A;  2DVE A;  3ZBD A;  2GGR A;  4M77 F;  3GOX A;  2F1L A;  2DL4 A;  2QDL A;  1UDL A;  5I2S A;  1I81 A;  1RUW A;  1N6A A;  1OPK A;  2YRD A;  4C8Q G;  4KRT A;  4DBR A;  3I5R A;  3CCV Q;  1M3C A;  1FX7 A;  3MKD A;  4ZTJ A;  4PJO B;  3WVE B;  3GF5 A;  3CC2 A;  1IXD A;  4C0D B;  1UGV A;  2PUK B;  4OP0 A;  5CKD A;  1OYX A;  4RTY A;  3CPW A;  4Y92 A;  2CP6 A;  1KQ2 A;  3VYH B;  2JXB A;  4IUT A;  2KT1 A;  3M0Q A;  5FWB A;  2LT1 A;  3HL8 A;  3QO3 A;  2K3Y A;  2EJF A;  1W2B S;  3JB9 J;  2LDM A;  3L2W A;  4LD6 A;  3EG1 A;  3CBO A;  1GXI E;  5IHN A;  2FG0 A;  1SG5 A;  2JVV A;  2CZ0 B;  1BCM A;  2X51 A;  4AMC A;  4MZT A;  2C06 A;  2DIL A;  1XTD A;  2JZ2 A;  3A8L B;  5LJ5 f;  3GPL A;  5FU7 B;  5AT1 B;  3Q1J A;  2KYB A;  2JUF A;  1ZBJ A;  1KQS P;  1M4Z A;  5HCK A;  4AFS C;  3CCR T;  1HXD A;  2E41 A;  2I2L A;  3E9G A;  1KC8 R;  3OYH A;  4X9D A;  4KGX B;  1M1K C;  3BDL A;  2QTX A;  1JU5 C;  4LXC A;  1NLO C;  1T0H A;  3MHX A;  1QP3 A;  3PNW C;  4LDY A;  2DXU A;  3RUX A;  3JB9 G;  4M7A A;  4E7S A;  4DBH A;  1WXT A;  4Q5W A;  2F5T X;  1VOM A;  1PG5 B;  2OJ2 A;  3X25 B;  3V8L A;  3CCS A;  3G1J A;  3L42 A;  3EG2 A;  2J6F A;  2K6D A;  4XK8 E;  1QP2 A;  1OOT A;  4XAX B;  1VQK T;  2JMA A;  1W2B A;  1YN8 A;  3CC7 T;  4C92 F;  3L2R A;  2DE0 X;  5GAN 4;  3JCM J;  2RQR A;  1ACM B;  3CC4 T;  1QVF S;  4HXJ A;  2X3W D;  3C12 A;  2R5M A;  4M7A E;  4A4K A;  3DB4 A;  3THK A;  3CCV A;  2KMT A;  3JV3 A;  2V26 A;  4LNP A;  3JCM d;  2B8A A;  2VUB A;  1IZ6 A;  1W1F A;  1KD1 R;  2NUP B;  1M30 A;  3JRZ A;  2X4W A;  4OMF B;  1NJI R;  3PGG A;  5LJ3 d;  1QKX A;  1WJR A;  4FM4 B;  3H0I A;  2COY A;  3I5S A;  4E7K A;  4PFP A;  1PKT A;  1R8O B;  1K4U S;  3JB9 H;  3MEA A;  2LJ1 A;  1VUB A;  4PNO A;  4Z8A A;  4RTU A;  1M3A A;  1G2B A;  3CC4 Q;  1K1Z A;  2GNC A;  3RKX A;  1VQ9 Q;  3CCQ T;  4NL3 A;  2M0Y A;  4OVA A;  4HVW A;  1IO6 A;  5GAO r;  5GMK j;  2MK5 A;  4OB3 B;  3NTI A;  2ZAE A;  4FT2 A;  4PJO F;  1KC8 U;  1Y71 A;  4D6W A;  3RES A;  1QVF A;  3RER A;  2PVD B;  5IXB A;  2QDY B;  4A54 A;  1M2V B;  4R0K A;  4AT1 B;  5FRM A;  3OY9 A;  3PE0 A;  2AZS A;  4RCC A;  3CCM A;  3I35 A;  5ECA A;  2RHY A;  3DKM A;  3L1A A;  5LJ5 d;  4M77 D;  3CCE T;  2FHD A;  4ZTF A;  4CC4 B;  1KHC A;  3WXM B;  1VQ4 T;  3CCU T;  2A3L A;  2DA9 A;  3NMZ C;  1UB4 A;  1UUE A;  2VV5 A;  5EG2 A;  3GP8 A;  3QII A;  3G6E Q;  3HRT A;  2RMO A;  1RAI B;  3R6N A;  3E19 A;  4GLM A;  2HKQ B;  2HMA A;  1WXB A;  2X35 A;  1W4S A;  2K79 A;  4X9C A;  1ZHI A;  1B3Q A;  2GQV A;  2RHI A;  3OMG A;  3SFM A;  5GAN 7;  1Q7Y R;  3MEU A;  2RNA A;  2R57 A;  4A4H A;  1NLP C;  1KD1 U;  2V1R A;  1K0S A;  4X34 A;  4J9C A;  3JCM P;  4D8K A;  3VUB A;  3KUF A;  1M3B A;  1ZA1 B;  2DPP B;  1NJI U;  1VQ4 Q;  3CBM A;  3OS5 A;  5I2M A;  2KYM A;  3E9F A;  3SB2 A;  2KRO A;  3HPW A;  3CCL A;  2EQI A;  5LJ3 g;  2XIC A;  2DET A;  1QLY A;  2F2V A;  3CC4 A;  4DOW A;  2G3R A;  4OML A;  2E6Z A;  1VQ9 A;  3KXT A;  2BUD A;  3G71 T;  5GAO m;  4PJO C;  1RAF B;  4O5V A;  2KSS A;  3QZ9 B;  4M7D B;  4C0D C;  1QMC A;  2HL3 A;  3DLL A;  3J80 E;  3J7A F;  4KUL A;  1YI2 T;  3CBP A;  4PL6 A;  2V1Q A;  3HHT B;  4KH1 B;  2E4H A;  3TEE A;  2CRE A;  1JQQ A;  3ZL7 C;  2VWF A;  4IUR A;  4ORZ A;  1M27 C;  1YWO A;  4C92 D;  1WHM A;  3S3M A;  5FU7 C;  4EMK B;  3BW1 A;  3CXC S;  5LJ5 g;  2EYY A;  3PMI A;  3G6E A;  5J26 A;  1YIT A;  1KSW A;  4J6Y A;  1TTH B;  1H8K A;  5FWC A;  3LGL A;  7AT1 B;  3LLR A;  3MJX A;  5GAM h;  2OTJ Q;  1SSH A;  1Q7Y U;  1KIK A;  1QCF A;  1X2K A;  4HCK A;  4F7U E;  2MPX C;  2NUT B;  1R0B G;  4RTX A;  3V8J A;  3QDF A;  1ZX6 A;  4PFZ A;  4FYX B;  3CPW P;  2YUO A;  1OQK A;  5CK9 A;  3JAM E;  1VQ8 T;  2ATC B;  5FU6 B;  3J81 E;  1E7O A;  2O88 A;  1YHQ T;  1JRI A;  3V8K A;  3JB9 I;  2XD0 A;  3C4S A;  5KE3 A;  2MOX A;  3CME Q;  4E7H A;  1VQ5 T;  2DRM A;  4J9D A;  1V76 A;  2YUN A;  1RAC B;  3GLX A;  4KH0 B;  1MMN A;  3EG0 A;  5KYU A;  2M0O A;  3REB B;  3OYA A;  4PFO A;  4A4F A;  4QVZ A;  5IXF A;  3H0H A;  2DD4 A;  2PZ1 A;  4DA4 A;  1B7T A;  2V8J A;  2YUP A;  2LZ6 B;  1I5L A;  2FYK A;  4FYW B;  4M7A F;  2A08 A;  1WGS A;  5LL6 S;  4FIB A;  2GTO A;  1AVZ C;  4C92 A;  3JCM X;  1UGQ B;  1LJO A;  2EIF A;  1IGQ A;  2DXC A;  2XDD A;  1PCX A;  2E10 A;  2BZ8 A;  5C6S A;  2EW3 A;  3G4S T;  1MND A;  1I8F A;  1QW1 A;  2QEX Q;  4FW2 A;  2PVO B;  1LVK A;  1N8R R;  1OV3 A;  3OYL A;  2RA2 A;  1GRI A;  2KEA A;  3RKW A;  1MNE A;  3EFS A;  4ELY C;  4BE2 A;  4Z88 A;  2M1H A;  1JBM A;  4BD3 A;  2AKK A;  2AT1 B;  5KYX B;  1W2B P;  3VS6 A;  2O9V A;  1FMW A;  2BTT A;  3QHS A;  4HT8 A;  5C0M A;  2CGH A;  1AEY A;  1U06 A;  2K2M A;  2OTJ A;  1WLP B;  4JLI A;  3VU3 C;  3G4S Q;  3IQL A;  5GAN f;  1YBY A;  1WHL A;  4WCI A;  3V7R A;  1AOJ A;  1GCQ A;  2NLU A;  2QQB A;  5GAO p;  3U23 A;  3QJY A;  1D0X A;  2JS2 A;  2MYS A;  4CC3 A;  2LQ8 A;  1K9M C;  1HYO A;  3CC2 T;  3EG9 B;  4PJO A;  3EGX B;  3DB3 A;  1VYT A;  2RHX A;  2DXB A;  4J6W A;  1X2Q A;  2P0Q A;  3CME A;  4ANJ A;  4E7L A;  4IUQ A;  1JJ2 S;  1B34 A;  1K8A C;  1UJY A;  1EX4 A;  1X6B A;  3H9N A;  4HCC A;  2YXY A;  5CKH A;  1M90 R;  2VXF A;  4PJO E;  3M56 A;  5GAO l;  1M2O A;  2A7Y A;  3EGU A;  5D7U A;  2BKD N;  4LN2 A;  3UF4 A;  2CZ6 B;  3ER0 A;  1PC0 A;  2DAQ A;  1NZ9 A;  1QVF P;  3HRS A;  2COW A;  4N4I A;  2FPE A;  3O8V A;  3C95 A;  2QEX A;  3GNG A;  3PIO A;  2RK1 A;  2VXE A;  1GFC A;  4M78 B;  1N8R U;  5DLQ E;  4F04 B;  2JTM A;  1JB0 E;  1WXU A;  2K5F A;  1WHG A;  1K0X A;  2KE9 A;  5LJ5 e;  4C8Q B;  4M77 G;  2O9S A;  1YIJ Q;  2RI3 A;  1VQM Q;  1KC8 C;  1SRL A;  2EJ9 A;  2FRY A;  2Z0W A;  3CCS T;  4M7D C;  1HSQ A;  1UHF A;  4IKF A;  1WZO A;  2NUZ A;  3OYM A;  1JJ2 A;  3O5Z A;  3F70 A;  4PLI A;  4DEY A;  2KXD A;  4RG2 A;  4LDV A;  1D3B A;  1Q81 R;  3A8M B;  3EGD A;  1S72 Q;  3CCV T;  3NFC A;  2ZPB B;  2LNH B;  3PFS A;  3JCM W;  1OX8 A;  1R77 A;  2F2W A;  2YRV A;  2O4X B;  4EMK C;  4QT7 A;  1NEB A;  3FB9 A;  2D6F A;  2QXF A;  2RK2 A;  3CCS Q;  1E6H A;  1KQ1 A;  4JS5 A;  4AG2 C;  2RJC A;  3RDV A;  4M7A D;  2KQW A;  2A0F B;  2AK5 A;  3NTH A;  2KNB B;  5GAN d;  4N0A A;  1M90 U;  2RD1 A;  4KGV B;  1NJI C;  3GIB A;  4TVR A;  3QYG B;  1MGQ A;  2MI6 A;  4F7U F;  5KYW B;  1IB8 A;  2QA4 Q;  2HL5 C;  3PVL A;  2FZK B;  2PUO B;  2HSE B;  3OA6 A;  4NL2 A;  2JTF A;  2DL7 A;  3VS7 A;  4MDX A;  3M54 A;  1WNL A;  2K3X A;  4LUD A;  3GNF B;  1PD0 A;  2H3E B;  4FL6 A;  2K57 A;  1M2V A;  1ZUU A;  3KBG A;  3SWN B;  1WHK A;  1H3H A;  3CCM T;  4E6R A;  4C92 G;  3JSC A;  2EGC A;  2L8D A;  1YIJ A; 
#chains in the Genus database with same CATH homology
 4J8O A;  3QUI A;  3OY9 A;  3UWN A;  1VQM A;  1VQP A;  1H64 1;  4OB1 B;  4RCC A;  2JNG A;  2EQU A;  3CCM A;  2RHY A;  2ZGW A;  3DKM A;  5KCH A;  3L1A A;  4KUI A;  3MO8 A;  4M77 D;  5LJ5 d;  3CCE T;  3MCA B;  2FHD A;  2DJZ A;  3FRN A;  3MET A;  5HK3 A;  4ZTF A;  1M90 C;  1KHC A;  4LDX A;  4IUV A;  4QVC A;  3WXM B;  3JB9 D;  2CZ1 B;  2KDS A;  3CCU T;  1VQ4 T;  3M9Q A;  2A3L A;  3LYI A;  4FU6 A;  4M75 C;  3X28 B;  3CMA A;  1UB4 A;  3UDC A;  4M7D G;  1S72 T;  1VQN T;  2VV5 A;  4J83 A;  5EG2 A;  3CCE A;  4JS4 A;  3GP8 A;  3QII A;  3HRT A;  2DTO A;  4J7I A;  1VQ4 A;  3CCU A;  1Q81 U;  4C8Q A;  4HKE A;  5J39 A;  4HCB A;  1S72 A;  1VQN A;  5CQY A;  3E19 A;  3OYB A;  1N9R A;  2LT4 A;  4LDW A;  2X35 A;  1W4S A;  2RJD A;  2XK0 A;  1K73 C;  4M78 F;  4QVD A;  2V8I A;  4X9C A;  3T9N A;  3LW5 E;  3EFR A;  1ZHI A;  2ZPG B;  1BYM A;  2GQV A;  2RHI A;  3OMG A;  1H3Z A;  3SFM A;  5GAN 7;  5KE2 A;  3MEU A;  4JUV A;  1X75 C;  1BI3 A;  2DIQ A;  5IN1 A;  2R57 A;  4BY6 B;  4A4H A;  1Y96 A;  1KD1 U;  4X34 A;  3QXE B;  3M53 A;  3JCM P;  2HD0 A;  2RJE A;  3CXC A;  4F7U G;  3VUB A;  4LDU A;  3QKJ A;  5GAM j;  3KUF A;  5IT9 E;  2D9T A;  1AHJ B;  2DPP B;  4MDW A;  4N4H A;  1NJI U;  2K2V A;  3CCL T;  2ZZD A;  1BKB A;  2M9U A;  2OAU A;  4KUD K;  4NOY A;  5CQX A;  2CZ7 B;  2EKO A;  3CBM A;  3OS5 A;  4BDZ A;  4BE1 A;  2EFI A;  5GMK h;  5I2M A;  3JCM Q;  3E9F A;  3SB2 A;  3HPW A;  3CCL A;  2VGN A;  4HCZ A;  5GMK m;  1G3T A;  2VYT A;  2EWN A;  2XIC A;  2RM4 A;  2IVW A;  2O4X A;  4RG8 A;  4Z02 A;  3WVD B;  4C92 B;  5GAN 5;  1VQ9 T;  1N27 A;  2VGM A;  3FIF A;  2XHC A;  4A4G A;  3OYE A;  2QA4 T;  2KK4 A;  3CC4 A;  4DOW A;  2G3R A;  2MF2 A;  5GAN g;  4LD9 K;  4JJN K;  3CPF A;  2E6Z A;  2EAY A;  2WSE E;  3HRU A;  3HSB A;  5DY9 A;  1DJ7 B;  3A8O B;  1VQ9 A;  3KXT A;  2BUD A;  2XDP A;  2JN0 A;  2WSC E;  2RH2 A;  4N0A C;  3S6W A;  4XU1 A;  2RJF A;  3P8B B;  2GCX A;  5FRO A;  3G71 T;  2QA4 A;  4M7D A;  3OS0 A;  3CC2 A;  4PKC C;  5GAO m;  5HK0 A;  4PJO C;  2DTH A;  1ZBX A;  4O5V A;  4RCB A;  2KSS A;  2CS7 A;  3PMT A;  3QZ9 B;  4BB7 A;  4M7D B;  4C0D C;  3NTK A;  4XU2 A;  3TRE A;  3G71 A;  1X6O A;  3QG1 A;  4M75 E;  5A0L A;  3DLL A;  2YHT A;  4C92 E;  3OYN A;  2QQR A;  3J80 E;  4CI0 C;  1KD1 C;  3J7A F;  5LJ3 g;  4KUL A;  1YI2 T;  3CBP A;  2P4T A;  1BI0 A;  4PL6 A;  2DXT A;  2YLB A;  5FRN A;  2QQS A;  1XOV A;  1X01 A;  1UEB A;  3HHT B;  3A8H B;  3TEE A;  3FC3 A;  2HAX A;  4MMK A;  3A8G B;  1YI2 A;  2ZPE B;  4XU0 A;  2MWP A;  2X4X A;  3QYH B;  4R55 A;  4QQG A;  2L3R A;  1FXX A;  4IUR A;  3FJP A;  4MZP A;  5FLX E;  4M75 D;  1M1F A;  2RHU A;  1I4K 1;  4YTL A;  4BI4 A;  4ELZ C;  4M7D E;  2EYQ A;  1HK9 A;  3H8Z A;  4C92 D;  3G6E T;  3S3M A;  5GAN 6;  5FU6 C;  1YIT T;  5FU7 C;  2RI2 A;  3CCJ T;  4EMK B;  4C0G A;  2ZCF B;  4F7U B;  3OYD A;  4QQ6 A;  3BW1 A;  4C0F A;  3CXC S;  2HQX A;  3RKY A;  5LJ5 g;  1M8V A;  3M58 A;  3RMQ A;  1XNI A;  3PMI A;  2P0K A;  5J26 A;  3PTA A;  3G6E A;  1YIT A;  4R56 A;  3CCJ A;  5L8R E;  2H3J A;  2XKO C;  4J6Y A;  5GAM f;  1M9S A;  1WQ7 A;  2XI9 A;  4M78 C;  4J6X A;  4A53 A;  1SSF A;  4J5Y A;  4ME7 A;  3ME9 A;  4BAC A;  1VIE A;  3LGL A;  2LQK A;  4OGE A;  5J3B A;  3VJP A;  3I56 A;  4M7D D;  3LLR A;  1Q82 U;  1EIF A;  3QPH A;  5GAM h;  2E6N A;  1YJN T;  3OQ5 A;  3OB9 A;  1O9S A;  4QW2 A;  4C8Q C;  5GAN 2;  1Q7Y U;  2K5I A;  4F7U E;  3AHU A;  1B34 B;  3P8H A;  3VV0 A;  4EDU A;  3X20 B;  1G3Y A;  2ZPH B;  1YJN A;  4XQ3 A;  3HFN A;  3BDU A;  5GAM e;  4OB2 B;  4M7A C;  1G3W A;  4MZM A;  3V8J A;  3S3N A;  3SDZ A;  4UC4 A;  3ZEH A;  5CK9 A;  4ZGJ B;  3M57 A;  3JAM E;  1VQ8 T;  5HKC A;  3OYK A;  4P5N A;  4JRQ A;  2DK3 A;  2DO3 A;  4OB0 B;  5FU6 B;  3J81 E;  3LWI A;  5D6W A;  4ZGD B;  2LCL A;  5D6Y A;  5AYF A;  1KHI A;  2XD0 A;  1YHQ T;  1JRI A;  2WAC A;  3V8K A;  5LJ3 j;  3C4S A;  3JB9 I;  3L2V A;  1VQ8 A;  5KE3 A;  3DLM A;  3MP1 A;  3H6Z A;  4E7H A;  4RMO A;  3FDR A;  1VQ5 T;  3I55 T;  5A0G A;  1FWZ A;  3GLX A;  1YHQ A;  2R58 A;  5GAN j;  2DIG A;  2KY9 A;  1XQH A;  3HP9 A;  2X4Y A;  2DEQ A;  2EQJ A;  1VQ5 A;  2FVU A;  2IG0 A;  2M0O A;  3I55 A;  3OYA A;  4C8Q F;  1Q86 U;  1P92 A;  4E7J A;  3RMS A;  1U8R A;  3TCJ A;  1Q82 C;  4A4F A;  4QVZ A;  5CO7 A;  1WJS A;  3BY7 A;  2DD4 A;  3JCM g;  4DA4 A;  2V8J A;  4XTZ A;  1I5L A;  1M5Q 1;  1Q7Y C;  2FYK A;  4M7A F;  1LNX A;  2FL7 A;  1WGS A;  2FB7 A;  5LL6 S;  4M75 A;  4FIB A;  2EQM A;  4CRI A;  2L89 A;  5GMK i;  4BE0 A;  1U1S A;  2K4Y A;  2Y90 A;  3PIP A;  3UPU A;  1VQ7 T;  1OZ2 A;  4C92 A;  5IAY A;  3JCM X;  1UGQ B;  1LJO A;  2EIF A;  2KVQ G;  2DXC A;  4M75 B;  1NE8 A;  3FEO A;  4PJO G;  3JCM b;  2XDD A;  4C0Z A;  2E10 A;  4O6J A;  4B9W A;  1YJ9 T;  3M4G A;  1VQ7 A;  3M59 A;  3OYJ A;  5C6S A;  3V7S A;  3G4S T;  1I8F A;  1QW1 A;  2PVO B;  2MMP A;  2ZPI B;  4FT4 A;  2GFA A;  2MAM A;  3CPW S;  2OTL T;  5KH6 A;  4M77 C;  1YJ9 A;  4M7A G;  1V29 B;  5GMK e;  3OYF A;  1K9M U;  4B9X A;  4C5G A;  3OYL A;  2EJG A;  3G4S A;  1PSF A;  2RA2 A;  4II1 A;  1YCY A;  2QI2 A;  2V8K A;  2X4J A;  2OTL A;  2LTO A;  3A5Z B;  3RKW A;  1ZQ1 A;  1U1T A;  2XU8 A;  4JLG A;  5A2Q E;  1D3B B;  1PSE A;  2HNI A;  3EFS A;  5DLO A;  2LC4 A;  1WPY A;  4ELY C;  4BE2 A;  1N8R C;  5LJ5 j;  4M78 D;  2M1H A;  3ASK A;  1JBM A;  4OGC A;  3HFO A;  1VIF A;  2CYZ B;  1WJQ A;  3JCM f;  4BD3 A;  4DQ2 A;  1Q86 C;  1BI1 A;  4JDS A;  1M1G A;  1K8A U;  1VQ6 T;  2P0P A;  3OW2 S;  2JOY A;  3N5B B;  4E47 A;  2OTJ T;  3QHS A;  4HT8 A;  3JCM h;  5C0M A;  3QJ6 A;  1VQ6 A;  1RL2 A;  5LJ3 f;  5KCO A;  2CGH A;  4L6V 5;  5CCA A;  3SWN C;  2XG8 D;  3G7Z A;  1QVG S;  3EAE A;  2OTJ A;  1G5V A;  4M78 G;  4JLI A;  3VU3 C;  3INZ A;  2K5L A;  2DVE A;  4HA8 A;  5GAO n;  3ZBD A;  5GAN f;  4M77 F;  4EMK A;  4F7U A;  5LJ3 h;  3GOX A;  2RO0 A;  2DKG A;  4L5G A;  5CR2 A;  4L59 A;  1YBY A;  1BIA A;  3V7R A;  3JB9 F;  4ZGE B;  2NLU A;  2QQB A;  5I2S A;  5GAO p;  2VC8 A;  1KG1 A;  1I81 A;  1N6A A;  4C8Q G;  3QJY A;  3OYY A;  3UT1 A;  3OBY A;  1NPP A;  2EQK A;  2LQ8 A;  5GAN h;  4E7I A;  1K9M C;  3X26 B;  3CC2 T;  4GY5 A;  4PJO A;  1FX7 A;  3OYG A;  1G3S A;  4C5H A;  4XTX A;  3C94 A;  3CEY A;  3CME T;  4ZTJ A;  2BIV A;  3DB3 A;  1VQL T;  4PJO B;  2XDB A;  5CIU A;  3M55 A;  3S3O A;  2RHX A;  2DXB A;  3GF5 A;  3WVE B;  5CAI A;  1BI2 A;  4J6W A;  1BIB A;  2PUK B;  4C0D B;  4OP0 A;  3VYG A;  4RKU E;  5GAM d;  5CKD A;  3RIR A;  1OYX A;  3MEV A;  1M1K U;  4IUP A;  5GAN e;  3CPW A;  4ATO A;  2P0Q A;  3CME A;  5CVI A;  4E7L A;  4IUQ A;  1TH7 A;  4KT0 E;  1JJ2 S;  1VQL A;  3VYH B;  3HKS A;  1KQ2 A;  1B34 A;  1K8A C;  4IUT A;  2YLC A;  5GMK l;  5GAO q;  4PLL A;  2LT1 A;  3HL8 A;  3QO3 A;  2K3Y A;  2EJF A;  3M4Y A;  3L2U A;  3LH0 A;  2E12 A;  1UGR B;  2KAF A;  4XTU A;  4HCC A;  4EMG A;  1W2B S;  3JB9 J;  2LDM A;  3L2W A;  4LD6 A;  1VQP T;  4XTY A;  4IUU A;  3CBO A;  5CKH A;  3OYI A;  1GXI E;  2E64 A;  4BY6 C;  2VXF A;  4PJO E;  4ZN3 A;  2JVV A;  4Y91 A;  2CZ0 B;  4Y28 E;  2CKK A;  3M56 A;  3BFM A;  3MP8 A;  4MZT A;  5GAO l;  1IRE B;  3OW2 A;  2A7Y A;  2E1H A;  2E70 A;  1XTD A;  2JZ2 A;  2BKD N;  3A8L B;  3E1S A;  5LJ5 f;  4BDY A;  3GPL A;  2CZ6 B;  3ER0 A;  3OS2 A;  5FU7 B;  2QEX T;  3OSV A;  2MWO A;  2DAQ A;  3CMA T;  3R6O A;  2Y4X A;  3QSU A;  3ZFJ A;  3Q1J A;  1NZ9 A;  2JUF A;  3HRS A;  4C5I A;  1QVG A;  4M78 A;  5LJ5 h;  3OS1 A;  4N4I A;  4FSX A;  3O8V A;  3C95 A;  4HT9 A;  1M4Z A;  2F5K A;  4A4E A;  4NS5 A;  3GNG A;  2QEX A;  3CCR T;  1HXD A;  3PIO A;  2RK1 A;  2VXE A;  4M78 B;  1N8R U;  2E41 A;  5DLQ E;  1WQW A;  2I2L A;  3E9G A;  3QBY A;  4C92 C;  4PJO D;  2JTM A;  4X9D A;  3OYH A;  1JB0 E;  1OI1 A;  1QVP A;  3CCR A;  1M1K C;  3BDL A;  2K5F A;  2QTX A;  2Y4Y A;  4N4G A;  2QQ9 A;  5LJ5 e;  3MP6 A;  2WSF E;  4C8Q B;  5CKE A;  4M77 G;  3MHX A;  4KBM B;  1QP3 A;  2RI5 A;  3PNW C;  4LDY A;  1YJW T;  2RI3 A;  2DXU A;  3RUX A;  5I21 A;  1KC8 C;  2O01 E;  3JB9 G;  4M7A A;  2EJ9 A;  4DOV A;  2LRQ A;  4MML A;  4BI3 A;  3CCS T;  4M7D C;  2DZ9 A;  1YJW A;  4C5E A;  4M7A B;  3VUZ A;  3QDR B;  4Q5W A;  5GAN 8;  4IKF A;  2F5T X;  3P8D A;  4M78 E;  3OYM A;  1JJ2 A;  2LVM A;  3V8L A;  3X25 B;  3CCS A;  3TU4 K;  3L42 A;  2GFU A;  1Y96 B;  3F70 A;  3OMC A;  4PLI A;  4QQD A;  3OBW A;  3V7C A;  4EMH A;  4XK8 E;  1QP2 A;  4XAX B;  1VQK T;  4M75 F;  5CKF A;  4RG2 A;  4LDV A;  1D3B A;  4C8Q E;  5GAN 3;  2HBP A;  1W2B A;  4BI8 B;  3CC7 T;  3A8M B;  2ZPF B;  2PVG B;  4JRI A;  3M5A A;  4C92 F;  3L2R A;  4XTV A;  5GAN 4;  3OYC A;  2D0Q B;  3CCV T;  3JCM J;  3NFC A;  2ZPB B;  1VQK A;  3PFS A;  3CC4 T;  3JCM W;  1QVF S;  4J7F A;  3CC7 A;  3C12 A;  3OSS C;  4GLK A;  2R5A A;  2LCC A;  2R5M A;  1KQS S;  4M7A E;  1Y7X A;  3FLG A;  4A4K A;  3DB4 A;  3CCV A;  2KMT A;  2YRV A;  1Q81 C;  2O4X B;  4EMK C;  3VKI A;  4V2S A;  1OZ3 A;  2AHJ B;  1VQO T;  2HQE A;  1O75 A;  2E5Q A;  2B8A A;  2VUB A;  3FB9 A;  3JCM d;  2D6F A;  3MEW A;  1MHN A;  1IZ6 A;  2QXF A;  4C8Q D;  2DZC A;  4M7D F;  2RK2 A;  1N9S A;  1KQ1 A;  2LX9 A;  4EPC A;  4JS5 A;  1VQO A;  3JRZ A;  2RJC A;  3L2Z A;  3LWH A;  5CKB A;  3URG A;  2X4W A;  4OMF B;  3PGG A;  5LJ3 d;  5GAM g;  4XTW A;  2KQW A;  4M7A D;  1WJR A;  4FM4 B;  2XID A;  2C06 A;  2E65 A;  3NTH A;  3JCM e;  4M77 A;  4WF2 A;  2LNV A;  3CD6 T;  4E7K A;  5GAN d;  4N0A A;  1R8O B;  4M77 B;  4BUG A;  3JB9 H;  3MEA A;  3LX7 A;  3L2Q A;  2F69 A;  1M90 U;  1VUB A;  2RD1 A;  4PNO A;  1NJI C;  2GF7 A;  4XU3 A;  3CD6 A;  4TVR A;  3GIB A;  2RB6 A;  5LJ3 e;  3LGF A;  3QYG B;  3X24 B;  5D6X A;  1MGQ A;  1Y07 A;  2L5Q A;  2M16 A;  2MI6 A;  3RKX A;  3CCQ T;  4F7U F;  4NL3 A;  3QZ5 B;  1LOJ A;  4OVA A;  1UGP B;  3JCM V;  3JCM c;  5GAO r;  2PUO B;  5GMK j;  3OA6 A;  4NL2 A;  2JTF A;  5M9O A;  4OB3 B;  3NTI A;  4OF1 A;  4MDX A;  2DTI A;  3CCQ A;  3SD4 A;  3M54 A;  1WNL A;  4JRP A;  4FT2 A;  2K3X A;  1K73 U;  1NPR A;  3GNF B;  4VUB A;  4PJO F;  2PU9 B;  1KC8 U;  4M77 E;  3SWN A;  1Y71 A;  3I56 T;  4FL6 A;  2K57 A;  4JRK A;  5A0D A;  4D6W A;  1RI0 A;  5DM7 R;  3KBG A;  3PT9 A;  3RES A;  1YIJ T;  1QVF A;  3RER A;  2PVD B;  4ZN1 A;  2QDY B;  3SWN B;  1VQM T;  4M75 G;  4A54 A;  1KQS A;  2PQW A;  3CCM T;  2RHZ A;  1UGS B;  3JSC A;  5HY6 A;  4C92 G;  2L8D A;  1YIJ A;  2DD5 A;  2QQA A;  5FRM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...