1WJSA

Solution structure of the first mbt domain from human kiaa1798 protein
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
127
structure length
127
Chain Sequence
GSSGSSGPYNKNGFKVGMKLEGVDPEHQSVYCVLTVAEVCGYRIKLHFDGYSDCYDFWVNADALDIHPVGWCEKTGHKLHPPKGYKEEEFNWQTYLKTCKAQAAPKSLFENQNITVIPSGFSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the first mbt domain from human KIAA1798 protein
rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords KIAA1798 protein
total genus 11
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2004-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02820 MBT mbt repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1wjsA00
3S6WA 2RHZA 3QKJA 5IAYA 3OYAA 3L2WA 4BACA 2GF7A 2O4XB 4QQDA 2K3YA 4IUPA 3MP1A 5M9OA 3C4SA 4LD6A 4B9XA 2L3RA 3O8VA 3UT1A 2LDMA 1WJSA 3BDLA 3FDRA 2XDPA 5KH6A 3S3MA 2R58A 3SD4A 2X4XA 2EQKA 4ZTFA 1SSFA 2LRQA 4QQ6A 3DB4A 1H3ZA 2E5QA 2R5MA 2M0OA 2FHDA 3FLGA 3L2VA 4ZTJA 2LVMA 3OS1A 1RI0A 2R57A 3OYEA 4QQGA 3OYKA 4FU6A 4BE1A 3OYJA 1WGSA 3P8DA 4A4FA 2JTFA 4QW2A 3OA6A 2DAQA 3MEUA 2R5AA 4A4HA 3UWNA 3OYNA 1MHNA 2XK0A 4IUVA 3OYDA 2G3RA 3LLRA 3PMTA 4IUQA 2E6NA 3OMGA 4N4GA 2L8DA 3CEYA 3MEVA 3S3NA 2RJDA 4IKFA 2RI3A 3OYIA 2NLUA 4Z02A 2RI2A 4HCZA 3OYHA 5CIUA 2GFAA 3L2QA 2EKOA 4C5IA 3L2UA 2BKDN 3KUFA 3LGLA 5KE3A 2P0KA 4E7IA 2K3XA 3H6ZA 3LX7A 4Q5WA 2EFIA 4C5HA 1N27A 4UC4A 3MP6A 3LH0A 3PFSA 5KCOA 3META 3H8ZA 1KHCA 2HQEA 2LCCA 2EQMA 2RHIA 2M1HA 3OB9A 3MO8A 4IUUA 4X34A 3OYFA 3MEAA 3EAEA 4BE0A 2WACA 3NTHA 4N4IA 4RG2A 3S3OA 2RHXA 5J39A 2PQWA 4BDYA 2VYTA 2D9TA 1WJRA 1XNIA 3L42A 3LGFA 2QQSA 4E7HA 1OZ3A 2JZ2A 4E7JA 1WJQA 5D6WA 5KE2A 3OY9A 5FROA 2RO0A 4E7LA 2MWOA 3OMCA 2BIVA 2LTOA 5IN1A 4GY5A 2O4XA 3PMIA 4II1A 3P8HA 3OYBA 3ZEHA 4CRIA 2L89A 4E7KA 5FRMA 3MP8A 2RJCA 2BUDA 2GFUA 3OQ5A 2X4YA 2RJFA 3NTIA 2EQUA 2YRVA 3MEWA 3QJ6A 3L2RA 3OYCA 5C0MA 3ME9A 4B9WA 4IURA 4N4HA 2RJEA 4A4EA 5D6XA 3OYLA 2IG0A 4C5GA 3PNWC 4BDZA 2RI5A 3E9FA 5D6YA 2F5KA 3ASKA 4OVAA 2EQJA 2HQXA 4L59A 4FL6A 3E9GA 2M16A 3F70A 2DIQA 3DLMA 3LYIA 3NTKA 4EDUA 1OI1A 2CKKA 4BD3A 3OYMA 2DIGA 4BE2A 3QBYA 4C5EA 3FEOA 5C6SA 3OS2A 2B8AA 4IUTA 3QIIA 1OYXA 4PLIA 3OYGA 4PLLA 4QVZA 2QQRA 2MWPA 3M9QA 1OZ2A 4PL6A 3DB3A 5J26A 3GOXA 5KCHA 5FRNA 4NS5A 1G5VA 3OS0A 2X4WA 3Q1JA 4A4GA 2RHYA 2X35A 3FC3A 2RHUA
chains in the Genus database with same CATH superfamily
3HRTA 2VV5A 2QYZA 2OJ2A 4IUPA 5GAMg 2EJFA 1D0XA 5FU6C 1NYGA 4EMKC 3BDLA 1YJNA 1M1KR 3JB9F 2J6FA 4QQ6A 4M7AF 4R0KA 3CBOA 3OS1A 4L5GA 2DL3A 2QK0A 4J5YA 1M3CA 1E6GA 4JZ4A 3CBPA 4ELYC 3SWNB 2GQIA 3EG9B 4JJDA 2K5FA 1B34A 2QEXQ 2YUNA 4MMLA 1WXTA 2GTOA 2ZPEB 1N8RR 2YLBA 2K3BA 1NJIR 4J9CA 4VUBA 3VYHB 3V7SA 3VS0A 1B07A 1VQNQ 5HK3A 3X20B 2CUDA 1VQNA 1IHVA 5I22A 1PKTA 1WYXA 4M4ZA 2K2VA 1Q81C 3SFMA 1QWEA 1UG1A 3TREA 2CSQA 2JZ2A 1RAGB 1OULA 1OPLA 3JCMX 2XHCA 1X2QA 3VS3A 2ZAEA 1K9MU 3EFOB 1AVZC 3G6EQ 3CCRT 3CC7T 4RUGA 3A8LB 1GRIA 4D8KA 2DA9A 4J9EA 1FMKA 5C0MA 2Y4XA 3CC4A 4FYXB 4ZN1A 3C0CA 3HHTB 4LDUA 2AZSA 1JB0E 2C0OA 2FL7A 5LJ5f 3H9NA 3M59A 1N9RA 3DKMA 3DLMA 3NTKA 4M77C 2A36A 1TSFA 1YJWA 3EFSA 1VQ8T 2B8AA 4IUTA 1Q95G 3CMEQ 3SWNC 5A2QE 2A3LA 4N0AC 1S1NA 1LOJA 4BY6B 3QKJA 2CZ7B 2K6DA 5M9OA 2ED1A 4M7DA 1GBQA 3FRNA 5GMKj 3DB4A 2GTJA 1UJYA 3FLGA 3L2VA 2DTOA 1GFCA 4FIBA 2PTKA 5LJ5d 3OYEA 1OX8A 1WFWA 4BE1A 1YHQT 2LNVA 1K9AA 3EH2A 3OA6A 3HTRA 4JDSA 2MI6A 3SB2A 1BI1A 2PVOB 5GAN8 4RTVA 3VV0A 2LJ3A 3CXCS 4F7UE 4C8QA 2G3RA 4DQ2A 2J6KA 3OMGA 4LXCA 4N4GA 1S72T 2KEAA 3GBQA 3ZBDA 4M77F 2LJ1A 5HK0A 2DYBA 2P0PA 1NPRA 4JS4A 2E12A 3BY7A 3HRSA 5A0LA 1UHCA 1X6BA 5GANh 1N27A 2LX9A 4C8QD 4P5NA 2RB6A 4IUVA 3OB9A 2HQEA 1G3YA 2HBPA 1R0BG 3JCMV 3PIPA 3CMET 1PSFA 1GCQC 2DD5A 5GAN4 2L3SA 1BI0A 4AFUC 4A54A 4DOVA 2DM1A 2PVDB 3CMAQ 3CCUA 2E41A 3L2RA 4AT1B 4B9WA 1AD5A 3BE3A 1M4ZA 2DD4A 2JW4A 1NLPC 2GGRA 4OVAA 1XOVA 3A98A 4C92C 2HD0A 2QTXA 4EDUA 3I55T 4E47A 1YJNQ 5C6SA 4EMKB 2NWMA 1RAEB 1TXQA 1JXOA 3MPUB 4NS5A 2CP3A 1YHQQ 3OYAA 3G71Q 4Y91A 4EMHA 4KH1B 1VQMT 1Q7YR 3UDCA 1WXUA 2X9HA 4JJCA 4F17A 1V1CA 1UUEA 5HKCA 3NHNA 1YITQ 2E3IA 3C95A 2XG8D 4ELZC 2W0ZA 2R5AA 1PM3A 2JTMA 1VQ9A 4C0ZA 2HCKA 2CYZB 4M7DC 5IHNA 1OX9A 3CCEA 1K9MR 1QW1A 2KT1A 3KUFA 1ZBJA 1XTDA 3PIOA 2L3QA 2MPXC 3RUXA 2C06A 4FW1A 5LJ3f 2QDLA 3FIFA 2J05A 3H8ZA 1YI2A 2KROA 4PK4A 1QVFP 3SHWA 4C8QF 1VQ6T 1NZ9A 3EHQA 1BI3A 3MKDA 4MDWA 3CC4Q 3NFCA 2QA4Q 2VASA 5IN1A 4M75D 2ROLA 1BK2A 8AT1B 1QP2A 2KYMA 2MIOA 4HKEA 1VQ5Q 1ACMB 1D3BB 3OYCA 1M2VA 4N0AA 4N4HA 3OYLA 4M7DF 1SHFA 2F5TX 4FL6A 3HL8A 3F70A 1W2BA 4HCCA 5DLQE 2FO0A 3NPFA 1UFFA 2MWPA 1G5VA 2ZCFB 3E19A 2RA2A 1OU8A 2O4XB 2BTTA 3VKIA 2K3YA 3MP1A 3QWXX 3O8VA 4A63B 3KXTA 2DEQA 4QVCA 2EQKA 1IHWA 4FT4A 3H0HA 1WNLA 2RMOA 1QCOA 2LVMA 2R57A 3CPWA 4QQGA 1YWOA 2LX7A 1KC8U 2HEQA 2I0NA 5CR2A 1GL5A 4J9DA 3CCST 2DXBA 1KC8C 1HD3A 3OYDA 1VQ6Q 3G4SA 4IUQA 2JM9A 2LCSA 2RQTA 3G7ZA 2K9GA 2RI3A 4PFPA 1U1SA 5GMKh 1RAIB 5GAOl 3URGA 1QVFS 3G4ST 1VQ4T 2O01E 5GAMe 4Q5WA 1M30A 2EFIA 3JCMg 3HFNA 1H641 3I5RA 2PVGB 2COZA 1WZOA 3MHXA 2M02A 2DK3A 3NTHA 1BCMA 3OW2A 4N4IA 8ATCB 1Q86C 1M27C 1U5SA 1M90U 1SRMA 1WJQA 1BIAA 1T3LA 1LPLA 2WSEE 4A4KA 1A0NB 3JCMh 1MV0B 2KT8A 2I2LA 2HKNA 2YSQA 3G71T 2E1HA 4FCYA 2KAFA 2OAWA 1OU9A 2X4JA 1TOVA 1SSHA 4OB1B 2KNBB 1O9SA 2FEIA 2G6FX 3CCLQ 3FEOA 4PLIA 1JEGA 1G3TA 4J9HA 3OW2P 5FRNA 1Z9QA 2YT6A 1UGVA 1ZUYA 3VUBA 2KRSA 1GXIE 4OP0A 4XQ3A 2DMOA 2HMAA 2L3RA 2C0TA 5LL6S 2LDMA 3FDRA 1NE8A 3L2ZA 1VQKA 2O31A 4FYVB 1LNXA 1VQKQ 1T0JA 4ZTJA 2SRCA 2XICA 5CVIA 1SKUB 1ZA1B 2KE9A 4HXJA 2EIFA 1X27A 3CCEQ 1YN8A 4F7UG 3H41A 4XK8E 3OYNA 3EH1A 2KMTA 3JSCA 3LWIA 4DA4A 2RQVA 2EJGA 1N8RU 2RQRA 3CCMT 5FU6B 2QA4T 3E2UA 2VGMA 2DNUA 1BYMA 2HZYA 1YIJQ 4WTOB 3BDUA 2JT4A 4WF2A 2EVRA 2ZZDA 1M90R 4OMNA 3PFSA 2K5LA 2NUPA 3R6OA 2LZ6B 4DBQA 5CKDA 3CMEA 3S3OA 4M7AD 4AMCA 1JBMA 2EGCA 2CT4A 4HT8A 3JRZA 3AHUA 1I0CA 1RI9A 5GANg 3NMZC 4CRIA 1JQQA 1X43A 1KQSP 2EQUA 4OF1A 1JXMA 5GAMf 3TQ7P 3CXCP 3QYHB 2RJEA 3C12A 3RKYA 3LH5A 1SF9A 3I55A 2M16A 2EGEA 2ZGWA 1RLQC 1MUZA 2AT1B 3EHRA 1H92A 4LDWA 1Y96A 1UE9A 1BU1A 5LJ3h 4PJOD 2V1QA 5KYUA 1BBZA 4NOYA 2XDPA 4X9CA 5AYFA 2DZ9A 4ZTFA 1I1JA 3RIRA 5AT1B 1YITT 4OB0B 3HRUA 3V7RA 1JO8A 1E6HA 4J9FA 4J7FA 3CXCA 3CCQT 2HL5C 3P8DA 1HYOA 1PRMC 4E2FB 1MMDA 1FYNA 3CPWS 2DETA 2XDDA 2F69A 1QKXA 1VQMQ 4RMOA 2ZPGB 4DOWA 2DBMA 4XTZA 5EG2A 1OOTA 5GAMj 3CCQA 1T3SA 5I11A 5GANf 3J7AF 3CEYA 2A28A 3MEVA 1KD1C 4HCZA 1UGRB 5CIUA 5KE3A 3J81E 4M78B 2F1LA 2DL5A 1WHJA 2PNIA 3REBB 1M2VB 1EFNA 4BE0A 4RG2A 1X6OA 1Q82C 4M78C 2KXCA 1OZ3A 1YHQA 2OTJQ 1D09B 4PJJA 2D0NA 1UHFA 4PJNA 3P8HA 3EGUA 4JJBA 3JB9H 2RK1A 3EGXA 1Y71A 2RJFA 1SRLA 1S72Q 4FM4B 5CQYA 1S72A 2PU9B 3PNWC 5D6YA 5LJ5g 4C92G 2L2PA 2D8HA 3CCQQ 2VVKA 2HNIA 1M5Q1 1QLYA 1Q7YU 1ZHIA 2HAXA 3M9QA 1BCOA 1OZ2A 2J7IA 3HP9A 2QQBA 1I81A 2RHYA 1FMWA 1FMVA 2RHUA 3FC3A 4C92F 4OMLA 1HXDA 4QQDA 1VQ5T 2AHJB 1KG1A 2DJQA 1Q7YC 1UECA 1GBRA 1HSQA 4M77D 1D1BA 4OMOA 1M1FA 1D1AA 2X4XA 2HL3A 2LRQA 4PNOA 4RTWA 2KSSA 2YUQA 1P92A 1I07A 2CDTA 3OYKA 4HVUA 4M7AE 3CCSA 1C6VX 2DFUA 5IHKA 4A4FA 2V8IA 2JTFA 4F7UB 5GJWB 4QW2A 1YI2Q 2YHTA 2OTJA 2YUOA 1YP5A 2FPEA 1R0CB 3M56A 4LNPA 2IVWA 1X69A 3OBWA 1E7OA 2RH2A 4PJMA 3JCMb 2B86A 1GCQA 3BFMA 2OTJT 1TG0A 4JUVA 4MZMA 1YCYA 4C0FA 3H0IA 2X3WD 1NJIU 3OYIA 4PFOA 4J9GA 4RTYA 2PZ1A 2ROTA 3GPLA 2P0KA 2EYWA 5GAOr 3HFOA 1NBEB 2VXFA 2XU8A 5GMKe 2COWA 2KR3A 2ZPHB 3IQLA 3MJXA 2AKLA 2MOXA 1IRXA 3CCJA 2A0FB 1VQLQ 4ZGEB 2M1HA 4DBRA 1ZSZC 1RAHB 3EFRA 2VYTA 2RF0A 3LGFA 1UDLA 2CGHA 2VB6A 1ZSZB 2XMFA 3GLXA 4M7DD 4E7LA 4KGVB 1MV3A 1UB4A 2QG9B 1FWZA 4C8QC 2IIMA 3CBMA 1VQ4Q 4FSXA 4KGZB 3JCMJ 3MP8A 4LDYA 4C92B 1YBYA 4F7UA 3OQ5A 3A8OB 4XTVA 1W2BS 2YRVA 3N5BB 3QDRB 4OB3B 1QP3A 2K7AA 2VC8A 2K79A 1UGSB 3QSUA 3ULRB 2DRKA 5J3BA 4TVRA 3OYMA 3OS2A 1WQ7A 2OI3A 2V26A 1KQSS 5CQXA 2QTVA 4PL6A 1AT1B 1MMNA 2LC4A 3OS0A 2CT3A 2X35A 2JS2A 2RHZA 3JB9D 1YJ9Q 3QHSA 2AK5A 4LD6A 1VQKT 1YJWQ 1OV3A 1NLOC 3SD4A 2KRMA 5FWCA 2DKGA 3QG1A 2R5MA 3PE0A 4M75F 2K2MA 3R6NA 2LMJA 2LQNA 3MEUA 3LW5E 4A4HA 1VQLT 3FJPA 4J9IA 1SPKA 1M8VA 3QZ9B 2DL4A 2LQ8A 2EPDA 1PKSA 3CCMQ 7AT1B 1W6XA 1AWOA 5LJ3e 2L8DA 5GANd 4IKFA 1Y57A 3JCMQ 3A1PA 1ZLMA 4C5IA 3CCUT 3LX7A 5GMKl 4RCBA 3A8GB 3INZA 1BI2A 1WI7A 4KUDK 4ZGJB 3M4YA 2KY9A 3META 3VS4A 2HBWA 3CPFA 1ZSZA 2PQWA 4F14A 5GAOm 1B7TA 2RO0A 4M75C 4F04B 1UEBA 2CREA 2O4XA 4PKCC 3X25B 4QKUA 3OS5A 2KXDA 2RJCA 3EG0A 3REAB 5CKEA 2LJ0A 1WIEA 3JCMf 4C5GA 1I8FA 2CS7A 2RI5A 2O2OA 2GBQA 5I2SA 1MGQA 2CKKA 4BE2A 4XAXB 1EIFA 2RD1A 2M9UA 6AT1B 3CC2T 2ESWA 1RABB 1YI2T 2KVQG 1Y96B 4XTWA 3L2WA 1Y0MA 4C8QB 2FPFA 1IZ6A 5CAIA 3WVEB 4JRKA 3S3MA 1SSFA 4MDXA 4FYWB 4A53A 2JMCA 3WVDB 2HKQB 1Q86R 4ATOA 1R77A 3PT9A 2YUPA 3JB9G 4AFZC 1NEBA 4BUGA 2LP5A 1CKBA 4RTTA 4WCIA 4JJNK 3UWNA 3FJ5A 3AT1B 5KYYA 2AIRB 1SHGA 3PMTA 4E6RA 1VQLA 1PNJA 9ATCB 4M75B 1VUBA 3OBYA 5ECAA 2JXBA 2YRCA 1MNEA 2EYYA 2OAUA 2GFAA 5KYWB 1VQ9Q 2E6ZA 1PD1A 4C5HA 5CKHA 3CMAA 2DE0X 1CKAA 1KHCA 2RHIA 2EQMA 3L1AA 3CCMA 2J6OA 3MEAA 2PUOB 2F2XA 3L42A 1YFNA 3QPHA 3RKWA 3CMAT 2GNCA 3UA6A 2DL7A 1VQPA 3GIBA 2BIVA 1W1FA 5DM7R 2DRMA 2WSFE 4EMKA 3RERA 3GNFB 1VQPQ 4PJOC 1G8XA 1ARKA 1T0HA 5FRMA 1QWFA 3I56T 1M8MA 3ZL7C 3DLLA 1C0MA 1I4K1 1RLPC 3RESA 1YJ9A 4DEYA 4XU3A 4ESRA 1X75C 4R55A 4LN2A 4AFSC 1WLPB 5LJ3d 4M7AB 1N6AA 3DB3A 3JB9I 1AWJA 4M78D 2DO3A 5IAYA 2DZCA 2HSPA 4ZNXA 2RQUA 3HSBA 5GAOp 2M0YA 5GAOn 1WJSA 4XTUA 1ABOA 3RMSA 5EC7A 1VQ7A 4DBFA 1EZZB 3H0FA 3PVLA 4J6YA 1G3SA 3VU3C 2ECZA 4PJOF 3CCUQ 1OEBA 1TUGB 4EPCA 5LJ3j 3O5ZA 3M55A 4RG8A 5FWBA 3QWYA 1NPPA 5IXFA 1LJOA 1ZSGA 4EMGA 4XU1A 2DVEA 4M7DG 3OSSC 2FRYA 2E6NA 4HT9A 2V1RA 4XU0A 3U23A 1KD1R 1WDXA 3M54A 2CZ0B 4Z89A 2DYIA 2L3PA 2RI2A 1IB8A 1F1BB 4M77A 2EYXA 4M75G 2DVJA 4CC4B 4D8DA 4QVDA 2KQWA 5FLXE 1TS9A 3LWHA 1V29B 1VQ6A 4M75A 2P4TA 3VRYA 4KT0E 3CD6T 2NUTB 3D7SB 1TUCA 2RNAA 2LT1A 2D9TA 2MCNA 1QQJA 1G2BA 1BKBA 4OMFB 1JJ2P 3UATA 4E7JA 1VQNT 5FU7B 4JLIA 1JU5C 1CSKA 4HCBA 3CD6A 1RACB 2QASA 3PMIA 3OYBA 2YRDA 4ZN3A 1M90C 1QCNA 4M78F 4E7KA 1KK7A 4V2SA 2NYSA 2QI2A 4JZ3A 4QT7A 1ZA2B 3PVQA 2VWFA 4A4EA 2FPDA 1YNZA 1HK9A 4KUIA 2EWNA 5CKBA 3EFOA 1QVPA 1JRIA 4JS5A 1OYXA 1UGPB 1X2KA 4QVZA 1QVGP 1IGUA 2AZVA 2ED0A 5J26A 2X4WA 1OQKA 1VQOA 1RL2A 1PC0A 2KBTA 2QQ9A 3QJ6A 2GF7A 2E70A 2Z0WA 1VQ8Q 2ATCB 2VGNA 3TSWA 1K0XA 1RAAB 1M1GA 2DJZA 1TU0B 1VIEA 2QA4A 2JTEA 5LJ5e 5LJ5j 2M0OA 2MAMA 4XU2A 4X1VA 1VQMA 4ME7A 2CH4W 4OGEA 1U06A 1ZQ1A 1SEMA 2H8HA 4RCCA 1TTHB 2P0QA 1K8AR 1H3HA 2VKNA 1W4SA 2HDAA 1MHNA 3VRZA 4C92E 4OMPA 3FB9A 1K4US 1NG2A 4O5VA 2FZGB 2JM8A 2DPPB 1VQ7Q 1VQ4A 4K11A 2QDYB 3I35A 1VYVA 2DEUA 3EG3A 3BW1A 3KFVA 4D6WA 2XIDA 1PCXA 2BKDN 2E3HA 3H6ZA 3MP6A 1Q81U 1SG5A 2DXCA 5KCOA 1XJWB 2JN0A 1B3QA 2MMPA 2P4RA 3GNGA 2W10A 4M7AG 1KFZA 2C0IA 1WHGA 3OYYA 4IIMA 2GQVA 2OTLQ 4E7HA 1K9MC 5I21A 1GCPA 2OX7A 5CK9A 2CZ6B 2L89A 3A8MB 1M1KU 5GJVB 2CP5A 2GFUA 1WX6A 2X4YA 1VA7A 3CPWP 4BI3A 4RTZA 5FU7C 2A7YA 4O6JA 3ME9A 2FYKA 4IURA 1M1KC 3UPUA 2E4HA 3QXEB 4C5EA 4PJOG 2L0AA 4PLLA 1IO6A 2QQRA 3QYGB 4DBHA 1QVFA 3HPWA 3PGGA 1RAFB 2PUKB 3I55Q 4J9BA 1EX4A 4B9XA 2EW3A 2RK2A 5KH6A 2R58A 2DXTA 4L6V5 3I5SA 5GAOq 2DTIA 4HVWA 2JJ9A 1UJ0A 2DLPA 2O88A 1VYUA 3VS2A 2CSIA 3M0TA 2A08A 2OTLT 4J6XA 4OMMA 2H3JA 4E7ZA 3JCMc 2K5IA 4RTUA 1PHTA 3HKSA 3M57A 2HQHA 3RR6A 1KQSA 4C0DC 1YWPA 3JB9J 3L2UA 4PJOA 4NL2A 2RQWA 4E7IA 1D3BA 1KD1U 5I2MA 3A8HB 1YJWT 3LH0A 1KHIA 1QKWA 4BI4A 2JVVA 4B6MA 1H3ZA 1IGQA 3MO8A 4X34A 3QZ5B 2RHXA 2LQKA 1BB9A 2E10A 2YLCA 1K76A 1W70A 5D6WA 1B34B 3OY9A 2EJ9A 4YTLA 2LTOA 3M0SA 4C8QE 1Q82U 4II1A 2ZPFB 4LUEA 2EBPA 1K73R 5CKFA 5GAN2 4F7UF 3CC4T 3THKA 4M7AA 4KULA 3QDFA 3CCVA 3VJPA 4OGCA 5D6XA 2ABLA 1MNDA 4KRTA 3QJYA 4HA8A 3E9FA 2HQXA 4XTXA 1AWXA 3E9GA 1OI1A 2JNGA 2DXUA 2X51A 2ENMA 3CCLA 3RDVA 1UGQB 2H3EB 4GLMA 4OB2B 2RPNA 1KQ2A 2D0QB 5L8RE 1TUDA 1Z9ZA 4JPBW 1OPKA 4BACA 3EG1A 3JCMP 1YITA 2SEMA 5FW9A 3OW2S 5GANj 1RADB 4ANJA 1KSWA 1QVGS 1ZBXA 2COYA 3EGDA 3EGDB 5GAMd 3VUZA 4M7DE 1O75A 1M3AA 2RN8A 2F2WA 1NM7A 3M4GA 4MZPA 2X3XD 4JRPA 2E65A 1U1TA 3CC2Q 2HSEB 3CC2A 1VYTA 2QAZA 3OSVA 5LJ5h 3G1JA 1JJ2S 1NJIC 1YIJA 3M0PA 4C92A 1YJNT 2ZPIB 1C1AA 2KGTA 4KH0B 2LNHB 2AKKA 3G4SQ 4M78G 3EAEA 4XTYA 3TSZA 2KDSA 5CO7A 2YWWA 3OMCA 2JS0A 2BZ8A 2QEXA 3T9NA 1D0ZA 4IIOA 2KRNA 4R56A 1I5OB 4Z88A 2BUDA 2K57A 4GLKA 3NTIA 1WHHA 3CD6Q 4ORZA 4FT2A 4BI8B 1LVKA 1AHJB 2FZCB 3KBGA 2EQJA 1VQ9T 4BD3A 4AG2C 4M77G 3OYGA 1I5LA 4PJOB 2EQIA 1QVGA 3M58A 3V8LA 4JRIA 3GOXA 1BIBA 3S6WA 3CCLT 1G83A 3C4SA 1K1ZA 2MF2A 5A0GA 1AEYA 1VQ8A 2Y4YA 3RMQA 2E5QA 4CC2A 3CCVT 3I56Q 3TU4K 4ZGDB 2DAQA 4MZTA 1M3BA 1JJ2A 5L23A 3JCMe 2JUFA 4FW2A 1VQ7T 2YDLA 2JOYA 3I9QA 2DERA 3ZFJA 5KYUB 4Y28E 1WHLA 4C0DB 2BZXA 2EKHA 1Q82R 2RJDA 3M0UA 2D1XA 3OYHA 1X01A 3L2QA 3LGLA 3RBBB 2DILA 3JV3A 5GAN7 1UTIA 3EGXB 1Q86U 3A5ZB 3SEMA 2P84A 2NUPB 4AFQC 4BB7A 1PWTA 4LDVA 3SDZA 2WACA 1MMAA 5HY6A 3G6EA 1KJWA 5IHIA 1R8OB 1VQOQ 2VXEA 3GF5A 4C8QG 4J7IA 3P8BB 4GY5A 2WSCE 2BE7D 3ZEHA 1QCFA 1IXDA 4CC3A 4M78A 3JCMd 1Y07A 2IPOB 4FYYB 3CQTA 2IG0A 2EGAA 2XI9A 1Q81R 3PTAA 4PJOE 4M75E 2KI7A 2CP2A 5GMKi 2MYSA 1YJ9T 2JMAA 5DLOA 4LUDA 3QIIA 1H8KA 3NGPA 2DX1A 3CCJQ 3Q1JA 2LQWA 2FVUA 2CP7A 4FSSA 2DBKA 4KBMB 3UT1A 2YXYA 2GCXA 1GFDA 2RM4A 1PRLC 2O9VA 1VQPT 3VS6A 3MCAB 1K8AU 4LE9A 2DL8A 4LD9K 3OYJA 1YCSB 1WGSA 4J83A 2QQAA 4PFZA 1QMCA 1K8AC 2CZ1B 3RNJA 2BZYA 2DTHA 2D8JA 3TCJA 1N8RC 2OTLA 4PJLA 5IXBA 3M5AA 2FZKB 3LLRA 1KIKA 4X9DA 3V7CA 2V8JA 1AZGB 4HCKA 3G71A 3M0QA 2NLUA 5GAN5 1XQHA 3CC7A 3CCRA 5D7UA 2EKOA 1PD0A 3I56A 2F2VA 2O9SA 2J06A 1PSEA 2CH4A 1DJ7B 1G3WA 3M53A 4DEXA 3V8JA 4C0GA 3TVTA 3VYGA 2NUTA 2K4YA 4M78E 4IUUA 3OYFA 2EYQA 1U8RA 4M7DB 3VS5A 1WPYA 1Y7XA 4CI0C 5J39A 4BDYA 1V76A 1WJRA 5LJ3g 2XDBA 1N5ZA 2QQSA 3TEEA 2FB7A 5KE2A 5FROA 1ZX6A 5KYWA 3CCJT 1LCKA 2QXFA 3EG2A 3C94A 5CCAA 5GAN6 4E7SA 4AG1C 1J3TA 3MEWA 2M51A 1WHKA 1N9SA 1HJDA 3UF4A 3CCET 5A0DA 2KK4A 1KQ1A 2Y90A 2F5KA 3RKXA 2E5KA 3LYIA 2LT4A 4M77E 2V8KA 2DIGA 3QBYA 5GMKm 1M9SA 3CCVQ 4M77B 4Y92A 3E1SA 5KCHA 3G6ET 3CCRQ 3CC7Q 4A4GA 1VOMA 2VUBA 1AOJA 4BY6C 3JAME 1AWWA 1AZEA 4GBQA 3EG9A 2BE9B 1K73U 3WXMB 3J80E 3SWNA 2E64A 1YIJT 1TWBA 4J6WA 1TH7A 1ABQA 1VQ5A 2FHDA 4KGXB 3X24B 1U3OA 1NYFA 4Z8AA 1RI0A 1K73C 4FU6A 1MMGA 5GAN3 1WXBA 1FX7A 1W2BP 2L5QA 2NUZA 5HCKA 1K0SA 2XK0A 3VS1A 4HVVA 3QUIA 1NEGA 4MMKA 5KYNA 2CP6A 2CP0A 4J8OA 3S3NA 3V8KA 4RKUE 1WQWA 3VS7A 1VQOT 2D6FA 4Z02A 3ER0A 1IREB 4RTXA 2K3XA 3JCMW 1ZUKA 4LDXA 4UC4A 3X26B 2LCCA 3UA7A 2EYZA 5KYYB 2QGFB 2DF6A 2KYBA 1XNIA 4M7AC 2ZPBB 5GAMh 1WHMA 2LCLA 2QEXT 2MWOA 4F16A 5IH2A 1VIFA 4C92D 2A37A 1M2OA 2FRWA 2MK5A 4NL3A 1ZUUA 2FG0A 4OMQA 5DY9A 3QO3A 5KYXB 5KYXA 4JLGA 1D1CA 3M0RA 4BDZA 1KC8R 3ASKA 4L59A 1X6GA 1D0YA 2EAYA 1RUWA 2DIQA 2XKOC 4CC7A 5IT9E 5GANe 1FXXA 2QGGA 1WA7A 3GP8A 2CUBA 3X28B 3CCSQ 4JRQA 2XD0A 1PG5B 4EIKA
chains in the Genus database with same CATH topology
4XTWA 3L2WA 3VUBA 4BACA 3HRTA 2VV5A 3JCMP 1YITA 1GXIE 4C8QB 4IUPA 4OP0A 4XQ3A 1IZ6A 5GAMg 2L3RA 2EJFA 5FU6C 5LL6S 2LDMA 3WVEB 4EMKC 3BDLA 3FDRA 4JRKA 5CAIA 3OW2S 5GANj 3S3MA 1YJNA 1NE8A 3JB9F 3L2ZA 1VQKA 1SSFA 4QQ6A 1LNXA 4M7AF 4MDXA 4ZTJA 4A53A 3CBOA 2XICA 3WVDB 3OS1A 4L5GA 5CVIA 1QVGS 4ATOA 1ZBXA 3PT9A 3JB9G 2EIFA 4J5YA 5GAMd 4BUGA 3VUZA 3CBPA 4F7UG 4M7DE 4ELYC 4XK8E 4JJNK 3UWNA 1O75A 3SWNB 3OYNA 2KMTA 3JSCA 3M4GA 3LWIA 3PMTA 4MZPA 4DA4A 4JRPA 2E65A 1VQLA 2K5FA 2EJGA 1B34A 1VUBA 1U1TA 4M75B 1N8RU 3OBYA 3CCMT 5FU6B 3CC2A 4MMLA 2OAUA 2QA4T 2VGMA 2GFAA 3OSVA 5LJ5h 1JJ2S 2E6ZA 1BYMA 2ZPEB 1NJIC 3BDUA 2YLBA 4C5HA 4WF2A 5CKHA 1YIJA 4VUBA 3CMAA 3VYHB 3V7SA 4C92A 2ZZDA 1YJNT 3PFSA 5HK3A 2K5LA 2ZPIB 3X20B 2RHIA 1KHCA 1VQNA 2EQMA 3L1AA 3CCMA 3R6OA 3MEAA 2PUOB 3EAEA 4M78G 5CKDA 3CMEA 4XTYA 3S3OA 4M7AD 2K2VA 1Q81C 3SFMA 2KDSA 3L42A 3TREA 2JZ2A 3QPHA 3RKWA 3CMAT 1JBMA 5CO7A 4HT8A 3JRZA 3OMCA 1VQPA 3GIBA 3JCMX 3AHUA 2BIVA 3RERA 2XHCA 2WSFE 4EMKA 5DM7R 5GANg 3GNFB 4PJOC 2QEXA 1K9MU 3T9NA 4CRIA 3CCRT 3CC7T 3A8LB 4R56A 5FRMA 3I56T 2BUDA 2K57A 4GLKA 3NTIA 2EQUA 4OF1A 5GAMf 5C0MA 2Y4XA 4FT2A 4BI8B 3QYHB 3CC4A 2RJEA 3C12A 3RKYA 4ZN1A 3HHTB 1AHJB 4LDUA 3DLLA 1JB0E 2FL7A 3KBGA 5LJ5f 3RESA 1I4K1 2EQJA 3I55A 1YJ9A 4XU3A 1VQ9T 2M16A 1N9RA 1X75C 3DKMA 3DLMA 3M59A 3NTKA 4M77C 4BD3A 1YJWA 3EFSA 4R55A 1VQ8T 2B8AA 4IUTA 4M77G 3SWNC 3OYGA 5A2QE 2ZGWA 1I5LA 5LJ3d 2A3LA 1QVGA 4N0AC 4M7AB 1N6AA 3M58A 4PJOB 3DB3A 4JRIA 3V8LA 3JB9I 3GOXA 1BIBA 1LOJA 4BY6B 4M78D 4LDWA 1Y96A 3QKJA 3S6WA 2DO3A 5IAYA 2DZCA 3CCLT 5LJ3h 2CZ7B 5M9OA 4PJOD 3C4SA 3HSBA 2MF2A 5A0GA 5GAOp 5GAOn 4M7DA 4NOYA 1WJSA 3FRNA 2XDPA 4XTUA 4X9CA 5AYFA 3RMSA 2DZ9A 1VQ8A 2Y4YA 1VQ7A 5GMKj 4ZTFA 3RIRA 1YITT 3DB4A 3RMQA 2E5QA 3FLGA 3L2VA 4OB0B 2DTOA 3HRUA 3V7RA 4FIBA 5LJ5d 3CCVT 3OYEA 4J6YA 1G3SA 4J7FA 3VU3C 3CXCA 4BE1A 1YHQT 2LNVA 3CCQT 4PJOF 3TU4K 3P8DA 5LJ3j 4EPCA 4ZGDB 3OA6A 2DAQA 4JDSA 2MI6A 3SB2A 3CPWS 4MZTA 2XDDA 1BI1A 2PVOB 3M55A 4RG8A 3JCMe 2F69A 5GAN8 1JJ2A 3VV0A 2JUFA 1NPPA 1LJOA 4EMGA 4XU1A 3CXCS 1VQ7T 4F7UE 2DVEA 4RMOA 2ZPGB 2JOYA 2G3RA 4C8QA 4M7DG 3ZFJA 4DOWA 4DQ2A 3OSSC 4XTZA 5EG2A 5GAMj 4Y28E 3CCQA 2E6NA 3OMGA 4HT9A 4N4GA 5GANf 4XU0A 3J7AF 4C0DB 3CEYA 3MEVA 1S72T 1KD1C 2RJDA 3ZBDA 3M54A 2CZ0B 4M77F 5HK0A 2P0PA 1NPRA 2RI2A 4JS4A 4HCZA 2E12A 3OYHA 1UGRB 5CIUA 1X01A 3L2QA 3BY7A 3LGLA 4M77A 3HRSA 4M75G 5A0LA 5KE3A 3J81E 4M78B 5GANh 4QVDA 1N27A 5GAN7 2KQWA 2LX9A 1Q86U 5FLXE 3A5ZB 3LWHA 1V29B 4C8QD 1VQ6A 4M75A 2P4TA 4KT0E 4P5NA 3CD6T 2RB6A 4IUVA 3OB9A 2HQEA 1G3YA 2XDBA 4BB7A 2HBPA 4LDVA 3SDZA 3JCMV 2WACA 4BE0A 4RG2A 1X6OA 2LT1A 5HY6A 3PIPA 4M78C 3G6EA 1Q82C 2D9TA 3CMET 1BKBA 1OZ3A 4OMFB 1R8OB 1PSFA 4E7JA 2VXEA 1YHQA 1VQ6T 5FU7B 1VQNT 4JLIA 3GF5A 4HCBA 2DD5A 3CD6A 4C8QG 4J7IA 5GAN4 3P8BB 4GY5A 2WSCE 3PMIA 3P8HA 3OYBA 3ZEHA 1BI0A 4ZN3A 1M90C 4E7KA 4M78F 4A54A 4V2SA 4DOVA 2PVDB 2QI2A 3JB9H 2RK1A 3CCUA 1Y71A 2RJFA 2E41A 3L2RA 4M78A 3JCMd 1Y07A 4B9WA 4FM4B 4A4EA 1M4ZA 5CQYA 2IG0A 1S72A 2DD4A 2PU9B 3PNWC 2XI9A 5D6YA 5LJ5g 1HK9A 4C92G 4OVAA 3PTAA 4PJOE 4KUIA 2EWNA 1XOVA 4M75E 4C92C 5CKBA 2HD0A 2QTXA 5GMKi 4EDUA 3I55T 4E47A 1QVPA 1JRIA 1M5Q1 2HNIA 5C6SA 5DLOA 4JS5A 1YJ9T 3QIIA 1OYXA 1UGPB 4EMKB 1Q7YU 1ZHIA 4QVZA 2HAXA 3M9QA 1OZ2A 5J26A 3HP9A 4NS5A 2X4WA 2QQBA 3Q1JA 1VQOA 2RHYA 1I81A 2QQ9A 2RHUA 1RL2A 2FVUA 3QJ6A 4C92F 3FC3A 3OYAA 1HXDA 2GF7A 4KBMB 2E70A 4QQDA 4Y91A 2AHJB 4EMHA 1VQ5T 1Q7YC 1VQMT 1KG1A 3UT1A 2GCXA 2VGNA 2RM4A 4M77D 1M1GA 1VQPT 2DJZA 3UDCA 1VIEA 1M1FA 2X4XA 2QA4A 3MCAB 2LRQA 5LJ5e 5LJ5j 4PNOA 1K8AU 2M0OA 2KSSA 5HKCA 1P92A 2MAMA 3OYKA 4M7AE 4XU2A 4LD9K 3CCSA 1VQMA 4ME7A 3OYJA 4OGEA 3C95A 1ZQ1A 1WGSA 4J83A 2QQAA 4A4FA 2V8IA 2JTFA 2XG8D 4QW2A 4ELZC 4F7UB 2YHTA 2CZ1B 4RCCA 1K8AC 2OTJA 2R5AA 2P0QA 2DTHA 3TCJA 2JTMA 3M56A 1W4SA 1N8RC 2IVWA 2OTLA 1MHNA 1VQ9A 3OBWA 4C0ZA 4C92E 3M5AA 2RH2A 2CYZB 3FB9A 3LLRA 3JCMb 4M7DC 4O5VA 4X9DA 3V7CA 3BFMA 2DPPB 5L8RE 4MZMA 2V8JA 4JUVA 3G71A 2OTJT 1VQ4A 3CCEA 1YCYA 2QDYB 4C0FA 1NJIU 1QW1A 3OYIA 2NLUA 5GAN5 1XQHA 3CC7A 3CCRA 3BW1A 4D6WA 2XIDA 2EKOA 3I56A 2BKDN 3KUFA 1XTDA 3PIOA 3GPLA 2P0KA 3H6ZA 3RUXA 2C06A 5GAOr 3HFOA 2VXFA 2XU8A 5LJ3f 3MP6A 3FIFA 5GMKe 1PSEA 1DJ7B 1Q81U 1G3WA 2ZPHB 2DXCA 3M53A 5KCOA 3CCJA 3V8JA 4C0GA 3VYGA 2K4YA 3H8ZA 4ZGEB 4M78E 4IUUA 2M1HA 3OYFA 2EYQA 1YI2A 2JN0A 1U8RA 4M7DB 1WPYA 1Y7XA 2MMPA 3GNGA 4C8QF 4CI0C 5J39A 4M7AG 3OYYA 4BDYA 2GQVA 2VYTA 1WJRA 3EFRA 5I21A 3LGFA 5LJ3g 2QQSA 2CGHA 1NZ9A 3TEEA 4E7HA 1K9MC 1BI3A 4MDWA 2FB7A 3GLXA 5KE2A 3NFCA 4M7DD 5FROA 5CK9A 4E7LA 3CCJT 1UB4A 5IN1A 2QXFA 1FWZA 3C94A 5CCAA 4M75D 2CZ6B 4C8QC 5GAN6 3CBMA 4FSXA 2L89A 3A8MB 3JCMJ 1M1KU 3MP8A 4LDYA 4C92B 1YBYA 1QP2A 4F7UA 2GFUA 3OQ5A 4HKEA 3A8OB 4XTVA 1W2BS 2X4YA 1D3BB 2YRVA 3MEWA 4BI3A 5FU7C 3OYCA 2A7YA 1N9SA 3ME9A 4O6JA 3N5BB 3QDRB 4N0AA 2FYKA 4IURA 4N4HA 4OB3B 1M1KC 3OYLA 3CCET 4M7DF 5A0DA 2KK4A 1KQ1A 3UPUA 2Y90A 1QP3A 2F5TX 2F5KA 3RKXA 4FL6A 2VC8A 3HL8A 1UGSB 3F70A 3LYIA 1W2BA 4HCCA 2LT4A 5DLQE 3QSUA 5J3BA 4M77E 3QXEB 2V8KA 2DIGA 4TVRA 3QBYA 4C5EA 3OS2A 5GMKm 1M9SA 3OYMA 1WQ7A 4PJOG 4M77B 4PLLA 2QQRA 2MWPA 3QYGB 1KQSS 1QVFA 5CQXA 4PL6A 1G5VA 3E1SA 3HPWA 5KCHA 3G6ET 2LC4A 4A4GA 3OS0A 3PGGA 2X35A 2ZCFB 2PUKB 3E19A 2RHZA 2RA2A 2VUBA 3JB9D 2O4XB 3QHSA 2K3YA 3VKIA 4BY6C 3MP1A 3JAME 4LD6A 4B9XA 3O8VA 3KXTA 1VQKT 2DEQA 1K73U 3WXMB 2RK2A 3SWNA 2E64A 4QVCA 5KH6A 2R58A 2DXTA 3J80E 1YIJT 4L6V5 3SD4A 2EQKA 4J6WA 1TH7A 1VQ5A 4FT4A 2DKGA 1WNLA 2R5MA 3QG1A 2FHDA 5GAOq 3X24B 2LVMA 2DTIA 1RI0A 1K73C 2R57A 3CPWA 4QQGA 4FU6A 4M75F 1KC8U 5CR2A 5GAN3 3CCST 1FX7A 2DXBA 3MEUA 3LW5E 4A4HA 1VQLT 2L5QA 3FJPA 2XK0A 1KC8C 1M8VA 3QZ9B 3OYDA 3QUIA 2LQ8A 4MMKA 2OTLT 3G4SA 4IUQA 4J6XA 2H3JA 4J8OA 3JCMc 5LJ3e 2K5IA 2L8DA 3G7ZA 3HKSA 3M57A 3S3NA 3V8KA 5GANd 4RKUE 1KQSA 4IKFA 2RI3A 1WQWA 1VQOT 2D6FA 4Z02A 4C0DC 3JB9J 1U1SA 3ER0A 5GMKh 1IREB 3JCMQ 4C5IA 5GAOl 3URGA 3L2UA 4NL2A 3G4ST 3CCUT 1QVFS 4PJOA 1VQ4T 4E7IA 2O01E 2K3XA 1D3BA 3LX7A 4Q5WA 5GAMe 3JCMW 1KD1U 2EFIA 3JCMg 5I2MA 3A8HB 5GMKl 3HFNA 4UC4A 4RCBA 4LDXA 1H641 3LH0A 1YJWT 1KHIA 4BI4A 2PVGB 3A8GB 3INZA 1BI2A 2JVVA 3X26B 4KUDK 4ZGJB 3M4YA 2KY9A 3META 2LCCA 3MHXA 1H3ZA 3MO8A 4X34A 2DK3A 3CPFA 3NTHA 3QZ5B 4N4IA 3OW2A 1Q86C 2RHXA 2LQKA 2PQWA 2E10A 1XNIA 4M7AC 1M90U 2YLCA 2ZPBB 5GAMh 1WJQA 5GAOm 5D6WA 1B34B 1BIAA 3OY9A 2LCLA 2RO0A 4M75C 2QEXT 2MWOA 2WSEE 2EJ9A 1UEBA 2LTOA 4YTLA 4A4KA 3JCMh 1VIFA 4C8QE 1Q82U 2O4XA 4II1A 2ZPFB 4PKCC 4C92D 3X25B 2I2LA 3OS5A 2RJCA 5CKFA 5GAN2 4F7UF 4NL3A 3CC4T 3G71T 4M7AA 2E1HA 2KAFA 5DY9A 4KULA 5CKEA 3CCVA 3QO3A 3VJPA 2X4JA 4OGCA 5D6XA 3JCMf 4JLGA 4OB1B 1I8FA 1O9SA 2CS7A 2RI5A 3E9FA 3QJYA 4HA8A 4C5GA 3ASKA 4BDZA 2HQXA 4XTXA 4L59A 5I2SA 3E9GA 2EAYA 2DIQA 2XKOC 1MGQA 1OI1A 2CKKA 2JNGA 2DXUA 4BE2A 5IT9E 5GANe 1EIFA 1FXXA 2RD1A 3FEOA 4PLIA 4XAXB 1G3TA 2M9UA 3CCLA 3CC2T 3GP8A 1UGQB 3X28B 5FRNA 4OB2B 1YI2T 4JRQA 2XD0A 2KVQG 1KQ2A 2D0QB 1Y96B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S6W A;  2RHZ A;  3QKJ A;  5IAY A;  3OYA A;  3L2W A;  4BAC A;  2GF7 A;  2O4X B;  4QQD A;  2K3Y A;  4IUP A;  3MP1 A;  5M9O A;  3C4S A;  4LD6 A;  4B9X A;  2L3R A;  3O8V A;  3UT1 A;  2LDM A;  1WJS A;  3BDL A;  3FDR A;  2XDP A;  5KH6 A;  3S3M A;  2R58 A;  3SD4 A;  2X4X A;  2EQK A;  4ZTF A;  1SSF A;  2LRQ A;  4QQ6 A;  3DB4 A;  1H3Z A;  2E5Q A;  2R5M A;  2M0O A;  2FHD A;  3FLG A;  3L2V A;  4ZTJ A;  2LVM A;  3OS1 A;  1RI0 A;  2R57 A;  3OYE A;  4QQG A;  3OYK A;  4FU6 A;  4BE1 A;  3OYJ A;  1WGS A;  3P8D A;  4A4F A;  2JTF A;  4QW2 A;  3OA6 A;  2DAQ A;  3MEU A;  2R5A A;  4A4H A;  3UWN A;  3OYN A;  1MHN A;  2XK0 A;  4IUV A;  3OYD A;  2G3R A;  3LLR A;  3PMT A;  4IUQ A;  2E6N A;  3OMG A;  4N4G A;  2L8D A;  3CEY A;  3MEV A;  3S3N A;  2RJD A;  4IKF A;  2RI3 A;  3OYI A;  2NLU A;  4Z02 A;  2RI2 A;  4HCZ A;  3OYH A;  5CIU A;  2GFA A;  3L2Q A;  2EKO A;  4C5I A;  3L2U A;  2BKD N;  3KUF A;  3LGL A;  5KE3 A;  2P0K A;  4E7I A;  2K3X A;  3H6Z A;  3LX7 A;  4Q5W A;  2EFI A;  4C5H A;  1N27 A;  4UC4 A;  3MP6 A;  3LH0 A;  3PFS A;  5KCO A;  3MET A;  3H8Z A;  1KHC A;  2HQE A;  2LCC A;  2EQM A;  2RHI A;  2M1H A;  3OB9 A;  3MO8 A;  4IUU A;  4X34 A;  3OYF A;  3MEA A;  3EAE A;  4BE0 A;  2WAC A;  3NTH A;  4N4I A;  4RG2 A;  3S3O A;  2RHX A;  5J39 A;  2PQW A;  4BDY A;  2VYT A;  2D9T A;  1WJR A;  1XNI A;  3L42 A;  3LGF A;  2QQS A;  4E7H A;  1OZ3 A;  2JZ2 A;  4E7J A;  1WJQ A;  5D6W A;  5KE2 A;  3OY9 A;  5FRO A;  2RO0 A;  4E7L A;  2MWO A;  3OMC A;  2BIV A;  2LTO A;  5IN1 A;  4GY5 A;  2O4X A;  3PMI A;  4II1 A;  3P8H A;  3OYB A;  3ZEH A;  4CRI A;  2L89 A;  4E7K A;  5FRM A;  3MP8 A;  2RJC A;  2BUD A;  2GFU A;  3OQ5 A;  2X4Y A;  2RJF A;  3NTI A;  2EQU A;  2YRV A;  3MEW A;  3QJ6 A;  3L2R A;  3OYC A;  5C0M A;  3ME9 A;  4B9W A;  4IUR A;  4N4H A;  2RJE A;  4A4E A;  5D6X A;  3OYL A;  2IG0 A;  4C5G A;  3PNW C;  4BDZ A;  2RI5 A;  3E9F A;  5D6Y A;  2F5K A;  3ASK A;  4OVA A;  2EQJ A;  2HQX A;  4L59 A;  4FL6 A;  3E9G A;  2M16 A;  3F70 A;  2DIQ A;  3DLM A;  3LYI A;  3NTK A;  4EDU A;  1OI1 A;  2CKK A;  4BD3 A;  3OYM A;  2DIG A;  4BE2 A;  3QBY A;  4C5E A;  3FEO A;  5C6S A;  3OS2 A;  2B8A A;  4IUT A;  3QII A;  1OYX A;  4PLI A;  3OYG A;  4PLL A;  4QVZ A;  2QQR A;  2MWP A;  3M9Q A;  1OZ2 A;  4PL6 A;  3DB3 A;  5J26 A;  3GOX A;  5KCH A;  5FRN A;  4NS5 A;  1G5V A;  3OS0 A;  2X4W A;  3Q1J A;  4A4G A;  2RHY A;  2X35 A;  3FC3 A;  2RHU A; 
#chains in the Genus database with same CATH topology
 3HRT A;  2VV5 A;  2QYZ A;  2OJ2 A;  4IUP A;  5GAM g;  2EJF A;  1D0X A;  5FU6 C;  1NYG A;  4EMK C;  3BDL A;  1YJN A;  1M1K R;  3JB9 F;  2J6F A;  4QQ6 A;  4M7A F;  4R0K A;  3CBO A;  3OS1 A;  4L5G A;  2DL3 A;  2QK0 A;  4J5Y A;  1M3C A;  1E6G A;  4JZ4 A;  3CBP A;  4ELY C;  3SWN B;  2GQI A;  3EG9 B;  4JJD A;  2K5F A;  1B34 A;  2QEX Q;  2YUN A;  4MML A;  1WXT A;  2GTO A;  2ZPE B;  1N8R R;  2YLB A;  2K3B A;  1NJI R;  4J9C A;  4VUB A;  3VYH B;  3V7S A;  3VS0 A;  1B07 A;  1VQN Q;  5HK3 A;  3X20 B;  2CUD A;  1VQN A;  1IHV A;  5I22 A;  1PKT A;  1WYX A;  4M4Z A;  2K2V A;  1Q81 C;  3SFM A;  1QWE A;  1UG1 A;  3TRE A;  2CSQ A;  2JZ2 A;  1RAG B;  1OUL A;  1OPL A;  3JCM X;  2XHC A;  1X2Q A;  3VS3 A;  2ZAE A;  1K9M U;  3EFO B;  1AVZ C;  3G6E Q;  3CCR T;  3CC7 T;  4RUG A;  3A8L B;  1GRI A;  4D8K A;  2DA9 A;  4J9E A;  1FMK A;  5C0M A;  2Y4X A;  3CC4 A;  4FYX B;  4ZN1 A;  3C0C A;  3HHT B;  4LDU A;  2AZS A;  1JB0 E;  2C0O A;  2FL7 A;  5LJ5 f;  3H9N A;  3M59 A;  1N9R A;  3DKM A;  3DLM A;  3NTK A;  4M77 C;  2A36 A;  1TSF A;  1YJW A;  3EFS A;  1VQ8 T;  2B8A A;  4IUT A;  1Q95 G;  3CME Q;  3SWN C;  5A2Q E;  2A3L A;  4N0A C;  1S1N A;  1LOJ A;  4BY6 B;  3QKJ A;  2CZ7 B;  2K6D A;  5M9O A;  2ED1 A;  4M7D A;  1GBQ A;  3FRN A;  5GMK j;  3DB4 A;  2GTJ A;  1UJY A;  3FLG A;  3L2V A;  2DTO A;  1GFC A;  4FIB A;  2PTK A;  5LJ5 d;  3OYE A;  1OX8 A;  1WFW A;  4BE1 A;  1YHQ T;  2LNV A;  1K9A A;  3EH2 A;  3OA6 A;  3HTR A;  4JDS A;  2MI6 A;  3SB2 A;  1BI1 A;  2PVO B;  5GAN 8;  4RTV A;  3VV0 A;  2LJ3 A;  3CXC S;  4F7U E;  4C8Q A;  2G3R A;  4DQ2 A;  2J6K A;  3OMG A;  4LXC A;  4N4G A;  1S72 T;  2KEA A;  3GBQ A;  3ZBD A;  4M77 F;  2LJ1 A;  5HK0 A;  2DYB A;  2P0P A;  1NPR A;  4JS4 A;  2E12 A;  3BY7 A;  3HRS A;  5A0L A;  1UHC A;  1X6B A;  5GAN h;  1N27 A;  2LX9 A;  4C8Q D;  4P5N A;  2RB6 A;  4IUV A;  3OB9 A;  2HQE A;  1G3Y A;  2HBP A;  1R0B G;  3JCM V;  3PIP A;  3CME T;  1PSF A;  1GCQ C;  2DD5 A;  5GAN 4;  2L3S A;  1BI0 A;  4AFU C;  4A54 A;  4DOV A;  2DM1 A;  2PVD B;  3CMA Q;  3CCU A;  2E41 A;  3L2R A;  4AT1 B;  4B9W A;  1AD5 A;  3BE3 A;  1M4Z A;  2DD4 A;  2JW4 A;  1NLP C;  2GGR A;  4OVA A;  1XOV A;  3A98 A;  4C92 C;  2HD0 A;  2QTX A;  4EDU A;  3I55 T;  4E47 A;  1YJN Q;  5C6S A;  4EMK B;  2NWM A;  1RAE B;  1TXQ A;  1JXO A;  3MPU B;  4NS5 A;  2CP3 A;  1YHQ Q;  3OYA A;  3G71 Q;  4Y91 A;  4EMH A;  4KH1 B;  1VQM T;  1Q7Y R;  3UDC A;  1WXU A;  2X9H A;  4JJC A;  4F17 A;  1V1C A;  1UUE A;  5HKC A;  3NHN A;  1YIT Q;  2E3I A;  3C95 A;  2XG8 D;  4ELZ C;  2W0Z A;  2R5A A;  1PM3 A;  2JTM A;  1VQ9 A;  4C0Z A;  2HCK A;  2CYZ B;  4M7D C;  5IHN A;  1OX9 A;  3CCE A;  1K9M R;  1QW1 A;  2KT1 A;  3KUF A;  1ZBJ A;  1XTD A;  3PIO A;  2L3Q A;  2MPX C;  3RUX A;  2C06 A;  4FW1 A;  5LJ3 f;  2QDL A;  3FIF A;  2J05 A;  3H8Z A;  1YI2 A;  2KRO A;  4PK4 A;  1QVF P;  3SHW A;  4C8Q F;  1VQ6 T;  1NZ9 A;  3EHQ A;  1BI3 A;  3MKD A;  4MDW A;  3CC4 Q;  3NFC A;  2QA4 Q;  2VAS A;  5IN1 A;  4M75 D;  2ROL A;  1BK2 A;  8AT1 B;  1QP2 A;  2KYM A;  2MIO A;  4HKE A;  1VQ5 Q;  1ACM B;  1D3B B;  3OYC A;  1M2V A;  4N0A A;  4N4H A;  3OYL A;  4M7D F;  1SHF A;  2F5T X;  4FL6 A;  3HL8 A;  3F70 A;  1W2B A;  4HCC A;  5DLQ E;  2FO0 A;  3NPF A;  1UFF A;  2MWP A;  1G5V A;  2ZCF B;  3E19 A;  2RA2 A;  1OU8 A;  2O4X B;  2BTT A;  3VKI A;  2K3Y A;  3MP1 A;  3QWX X;  3O8V A;  4A63 B;  3KXT A;  2DEQ A;  4QVC A;  2EQK A;  1IHW A;  4FT4 A;  3H0H A;  1WNL A;  2RMO A;  1QCO A;  2LVM A;  2R57 A;  3CPW A;  4QQG A;  1YWO A;  2LX7 A;  1KC8 U;  2HEQ A;  2I0N A;  5CR2 A;  1GL5 A;  4J9D A;  3CCS T;  2DXB A;  1KC8 C;  1HD3 A;  3OYD A;  1VQ6 Q;  3G4S A;  4IUQ A;  2JM9 A;  2LCS A;  2RQT A;  3G7Z A;  2K9G A;  2RI3 A;  4PFP A;  1U1S A;  5GMK h;  1RAI B;  5GAO l;  3URG A;  1QVF S;  3G4S T;  1VQ4 T;  2O01 E;  5GAM e;  4Q5W A;  1M30 A;  2EFI A;  3JCM g;  3HFN A;  1H64 1;  3I5R A;  2PVG B;  2COZ A;  1WZO A;  3MHX A;  2M02 A;  2DK3 A;  3NTH A;  1BCM A;  3OW2 A;  4N4I A;  8ATC B;  1Q86 C;  1M27 C;  1U5S A;  1M90 U;  1SRM A;  1WJQ A;  1BIA A;  1T3L A;  1LPL A;  2WSE E;  4A4K A;  1A0N B;  3JCM h;  1MV0 B;  2KT8 A;  2I2L A;  2HKN A;  2YSQ A;  3G71 T;  2E1H A;  4FCY A;  2KAF A;  2OAW A;  1OU9 A;  2X4J A;  1TOV A;  1SSH A;  4OB1 B;  2KNB B;  1O9S A;  2FEI A;  2G6F X;  3CCL Q;  3FEO A;  4PLI A;  1JEG A;  1G3T A;  4J9H A;  3OW2 P;  5FRN A;  1Z9Q A;  2YT6 A;  1UGV A;  1ZUY A;  3VUB A;  2KRS A;  1GXI E;  4OP0 A;  4XQ3 A;  2DMO A;  2HMA A;  2L3R A;  2C0T A;  5LL6 S;  2LDM A;  3FDR A;  1NE8 A;  3L2Z A;  1VQK A;  2O31 A;  4FYV B;  1LNX A;  1VQK Q;  1T0J A;  4ZTJ A;  2SRC A;  2XIC A;  5CVI A;  1SKU B;  1ZA1 B;  2KE9 A;  4HXJ A;  2EIF A;  1X27 A;  3CCE Q;  1YN8 A;  4F7U G;  3H41 A;  4XK8 E;  3OYN A;  3EH1 A;  2KMT A;  3JSC A;  3LWI A;  4DA4 A;  2RQV A;  2EJG A;  1N8R U;  2RQR A;  3CCM T;  5FU6 B;  2QA4 T;  3E2U A;  2VGM A;  2DNU A;  1BYM A;  2HZY A;  1YIJ Q;  4WTO B;  3BDU A;  2JT4 A;  4WF2 A;  2EVR A;  2ZZD A;  1M90 R;  4OMN A;  3PFS A;  2K5L A;  2NUP A;  3R6O A;  2LZ6 B;  4DBQ A;  5CKD A;  3CME A;  3S3O A;  4M7A D;  4AMC A;  1JBM A;  2EGC A;  2CT4 A;  4HT8 A;  3JRZ A;  3AHU A;  1I0C A;  1RI9 A;  5GAN g;  3NMZ C;  4CRI A;  1JQQ A;  1X43 A;  1KQS P;  2EQU A;  4OF1 A;  1JXM A;  5GAM f;  3TQ7 P;  3CXC P;  3QYH B;  2RJE A;  3C12 A;  3RKY A;  3LH5 A;  1SF9 A;  3I55 A;  2M16 A;  2EGE A;  2ZGW A;  1RLQ C;  1MUZ A;  2AT1 B;  3EHR A;  1H92 A;  4LDW A;  1Y96 A;  1UE9 A;  1BU1 A;  5LJ3 h;  4PJO D;  2V1Q A;  5KYU A;  1BBZ A;  4NOY A;  2XDP A;  4X9C A;  5AYF A;  2DZ9 A;  4ZTF A;  1I1J A;  3RIR A;  5AT1 B;  1YIT T;  4OB0 B;  3HRU A;  3V7R A;  1JO8 A;  1E6H A;  4J9F A;  4J7F A;  3CXC A;  3CCQ T;  2HL5 C;  3P8D A;  1HYO A;  1PRM C;  4E2F B;  1MMD A;  1FYN A;  3CPW S;  2DET A;  2XDD A;  2F69 A;  1QKX A;  1VQM Q;  4RMO A;  2ZPG B;  4DOW A;  2DBM A;  4XTZ A;  5EG2 A;  1OOT A;  5GAM j;  3CCQ A;  1T3S A;  5I11 A;  5GAN f;  3J7A F;  3CEY A;  2A28 A;  3MEV A;  1KD1 C;  4HCZ A;  1UGR B;  5CIU A;  5KE3 A;  3J81 E;  4M78 B;  2F1L A;  2DL5 A;  1WHJ A;  2PNI A;  3REB B;  1M2V B;  1EFN A;  4BE0 A;  4RG2 A;  1X6O A;  1Q82 C;  4M78 C;  2KXC A;  1OZ3 A;  1YHQ A;  2OTJ Q;  1D09 B;  4PJJ A;  2D0N A;  1UHF A;  4PJN A;  3P8H A;  3EGU A;  4JJB A;  3JB9 H;  2RK1 A;  3EGX A;  1Y71 A;  2RJF A;  1SRL A;  1S72 Q;  4FM4 B;  5CQY A;  1S72 A;  2PU9 B;  3PNW C;  5D6Y A;  5LJ5 g;  4C92 G;  2L2P A;  2D8H A;  3CCQ Q;  2VVK A;  2HNI A;  1M5Q 1;  1QLY A;  1Q7Y U;  1ZHI A;  2HAX A;  3M9Q A;  1BCO A;  1OZ2 A;  2J7I A;  3HP9 A;  2QQB A;  1I81 A;  2RHY A;  1FMW A;  1FMV A;  2RHU A;  3FC3 A;  4C92 F;  4OML A;  1HXD A;  4QQD A;  1VQ5 T;  2AHJ B;  1KG1 A;  2DJQ A;  1Q7Y C;  1UEC A;  1GBR A;  1HSQ A;  4M77 D;  1D1B A;  4OMO A;  1M1F A;  1D1A A;  2X4X A;  2HL3 A;  2LRQ A;  4PNO A;  4RTW A;  2KSS A;  2YUQ A;  1P92 A;  1I07 A;  2CDT A;  3OYK A;  4HVU A;  4M7A E;  3CCS A;  1C6V X;  2DFU A;  5IHK A;  4A4F A;  2V8I A;  2JTF A;  4F7U B;  5GJW B;  4QW2 A;  1YI2 Q;  2YHT A;  2OTJ A;  2YUO A;  1YP5 A;  2FPE A;  1R0C B;  3M56 A;  4LNP A;  2IVW A;  1X69 A;  3OBW A;  1E7O A;  2RH2 A;  4PJM A;  3JCM b;  2B86 A;  1GCQ A;  3BFM A;  2OTJ T;  1TG0 A;  4JUV A;  4MZM A;  1YCY A;  4C0F A;  3H0I A;  2X3W D;  1NJI U;  3OYI A;  4PFO A;  4J9G A;  4RTY A;  2PZ1 A;  2ROT A;  3GPL A;  2P0K A;  2EYW A;  5GAO r;  3HFO A;  1NBE B;  2VXF A;  2XU8 A;  5GMK e;  2COW A;  2KR3 A;  2ZPH B;  3IQL A;  3MJX A;  2AKL A;  2MOX A;  1IRX A;  3CCJ A;  2A0F B;  1VQL Q;  4ZGE B;  2M1H A;  4DBR A;  1ZSZ C;  1RAH B;  3EFR A;  2VYT A;  2RF0 A;  3LGF A;  1UDL A;  2CGH A;  2VB6 A;  1ZSZ B;  2XMF A;  3GLX A;  4M7D D;  4E7L A;  4KGV B;  1MV3 A;  1UB4 A;  2QG9 B;  1FWZ A;  4C8Q C;  2IIM A;  3CBM A;  1VQ4 Q;  4FSX A;  4KGZ B;  3JCM J;  3MP8 A;  4LDY A;  4C92 B;  1YBY A;  4F7U A;  3OQ5 A;  3A8O B;  4XTV A;  1W2B S;  2YRV A;  3N5B B;  3QDR B;  4OB3 B;  1QP3 A;  2K7A A;  2VC8 A;  2K79 A;  1UGS B;  3QSU A;  3ULR B;  2DRK A;  5J3B A;  4TVR A;  3OYM A;  3OS2 A;  1WQ7 A;  2OI3 A;  2V26 A;  1KQS S;  5CQX A;  2QTV A;  4PL6 A;  1AT1 B;  1MMN A;  2LC4 A;  3OS0 A;  2CT3 A;  2X35 A;  2JS2 A;  2RHZ A;  3JB9 D;  1YJ9 Q;  3QHS A;  2AK5 A;  4LD6 A;  1VQK T;  1YJW Q;  1OV3 A;  1NLO C;  3SD4 A;  2KRM A;  5FWC A;  2DKG A;  3QG1 A;  2R5M A;  3PE0 A;  4M75 F;  2K2M A;  3R6N A;  2LMJ A;  2LQN A;  3MEU A;  3LW5 E;  4A4H A;  1VQL T;  3FJP A;  4J9I A;  1SPK A;  1M8V A;  3QZ9 B;  2DL4 A;  2LQ8 A;  2EPD A;  1PKS A;  3CCM Q;  7AT1 B;  1W6X A;  1AWO A;  5LJ3 e;  2L8D A;  5GAN d;  4IKF A;  1Y57 A;  3JCM Q;  3A1P A;  1ZLM A;  4C5I A;  3CCU T;  3LX7 A;  5GMK l;  4RCB A;  3A8G B;  3INZ A;  1BI2 A;  1WI7 A;  4KUD K;  4ZGJ B;  3M4Y A;  2KY9 A;  3MET A;  3VS4 A;  2HBW A;  3CPF A;  1ZSZ A;  2PQW A;  4F14 A;  5GAO m;  1B7T A;  2RO0 A;  4M75 C;  4F04 B;  1UEB A;  2CRE A;  2O4X A;  4PKC C;  3X25 B;  4QKU A;  3OS5 A;  2KXD A;  2RJC A;  3EG0 A;  3REA B;  5CKE A;  2LJ0 A;  1WIE A;  3JCM f;  4C5G A;  1I8F A;  2CS7 A;  2RI5 A;  2O2O A;  2GBQ A;  5I2S A;  1MGQ A;  2CKK A;  4BE2 A;  4XAX B;  1EIF A;  2RD1 A;  2M9U A;  6AT1 B;  3CC2 T;  2ESW A;  1RAB B;  1YI2 T;  2KVQ G;  1Y96 B;  4XTW A;  3L2W A;  1Y0M A;  4C8Q B;  2FPF A;  1IZ6 A;  5CAI A;  3WVE B;  4JRK A;  3S3M A;  1SSF A;  4MDX A;  4FYW B;  4A53 A;  2JMC A;  3WVD B;  2HKQ B;  1Q86 R;  4ATO A;  1R77 A;  3PT9 A;  2YUP A;  3JB9 G;  4AFZ C;  1NEB A;  4BUG A;  2LP5 A;  1CKB A;  4RTT A;  4WCI A;  4JJN K;  3UWN A;  3FJ5 A;  3AT1 B;  5KYY A;  2AIR B;  1SHG A;  3PMT A;  4E6R A;  1VQL A;  1PNJ A;  9ATC B;  4M75 B;  1VUB A;  3OBY A;  5ECA A;  2JXB A;  2YRC A;  1MNE A;  2EYY A;  2OAU A;  2GFA A;  5KYW B;  1VQ9 Q;  2E6Z A;  1PD1 A;  4C5H A;  5CKH A;  3CMA A;  2DE0 X;  1CKA A;  1KHC A;  2RHI A;  2EQM A;  3L1A A;  3CCM A;  2J6O A;  3MEA A;  2PUO B;  2F2X A;  3L42 A;  1YFN A;  3QPH A;  3RKW A;  3CMA T;  2GNC A;  3UA6 A;  2DL7 A;  1VQP A;  3GIB A;  2BIV A;  1W1F A;  5DM7 R;  2DRM A;  2WSF E;  4EMK A;  3RER A;  3GNF B;  1VQP Q;  4PJO C;  1G8X A;  1ARK A;  1T0H A;  5FRM A;  1QWF A;  3I56 T;  1M8M A;  3ZL7 C;  3DLL A;  1C0M A;  1I4K 1;  1RLP C;  3RES A;  1YJ9 A;  4DEY A;  4XU3 A;  4ESR A;  1X75 C;  4R55 A;  4LN2 A;  4AFS C;  1WLP B;  5LJ3 d;  4M7A B;  1N6A A;  3DB3 A;  3JB9 I;  1AWJ A;  4M78 D;  2DO3 A;  5IAY A;  2DZC A;  2HSP A;  4ZNX A;  2RQU A;  3HSB A;  5GAO p;  2M0Y A;  5GAO n;  1WJS A;  4XTU A;  1ABO A;  3RMS A;  5EC7 A;  1VQ7 A;  4DBF A;  1EZZ B;  3H0F A;  3PVL A;  4J6Y A;  1G3S A;  3VU3 C;  2ECZ A;  4PJO F;  3CCU Q;  1OEB A;  1TUG B;  4EPC A;  5LJ3 j;  3O5Z A;  3M55 A;  4RG8 A;  5FWB A;  3QWY A;  1NPP A;  5IXF A;  1LJO A;  1ZSG A;  4EMG A;  4XU1 A;  2DVE A;  4M7D G;  3OSS C;  2FRY A;  2E6N A;  4HT9 A;  2V1R A;  4XU0 A;  3U23 A;  1KD1 R;  1WDX A;  3M54 A;  2CZ0 B;  4Z89 A;  2DYI A;  2L3P A;  2RI2 A;  1IB8 A;  1F1B B;  4M77 A;  2EYX A;  4M75 G;  2DVJ A;  4CC4 B;  4D8D A;  4QVD A;  2KQW A;  5FLX E;  1TS9 A;  3LWH A;  1V29 B;  1VQ6 A;  4M75 A;  2P4T A;  3VRY A;  4KT0 E;  3CD6 T;  2NUT B;  3D7S B;  1TUC A;  2RNA A;  2LT1 A;  2D9T A;  2MCN A;  1QQJ A;  1G2B A;  1BKB A;  4OMF B;  1JJ2 P;  3UAT A;  4E7J A;  1VQN T;  5FU7 B;  4JLI A;  1JU5 C;  1CSK A;  4HCB A;  3CD6 A;  1RAC B;  2QAS A;  3PMI A;  3OYB A;  2YRD A;  4ZN3 A;  1M90 C;  1QCN A;  4M78 F;  4E7K A;  1KK7 A;  4V2S A;  2NYS A;  2QI2 A;  4JZ3 A;  4QT7 A;  1ZA2 B;  3PVQ A;  2VWF A;  4A4E A;  2FPD A;  1YNZ A;  1HK9 A;  4KUI A;  2EWN A;  5CKB A;  3EFO A;  1QVP A;  1JRI A;  4JS5 A;  1OYX A;  1UGP B;  1X2K A;  4QVZ A;  1QVG P;  1IGU A;  2AZV A;  2ED0 A;  5J26 A;  2X4W A;  1OQK A;  1VQO A;  1RL2 A;  1PC0 A;  2KBT A;  2QQ9 A;  3QJ6 A;  2GF7 A;  2E70 A;  2Z0W A;  1VQ8 Q;  2ATC B;  2VGN A;  3TSW A;  1K0X A;  1RAA B;  1M1G A;  2DJZ A;  1TU0 B;  1VIE A;  2QA4 A;  2JTE A;  5LJ5 e;  5LJ5 j;  2M0O A;  2MAM A;  4XU2 A;  4X1V A;  1VQM A;  4ME7 A;  2CH4 W;  4OGE A;  1U06 A;  1ZQ1 A;  1SEM A;  2H8H A;  4RCC A;  1TTH B;  2P0Q A;  1K8A R;  1H3H A;  2VKN A;  1W4S A;  2HDA A;  1MHN A;  3VRZ A;  4C92 E;  4OMP A;  3FB9 A;  1K4U S;  1NG2 A;  4O5V A;  2FZG B;  2JM8 A;  2DPP B;  1VQ7 Q;  1VQ4 A;  4K11 A;  2QDY B;  3I35 A;  1VYV A;  2DEU A;  3EG3 A;  3BW1 A;  3KFV A;  4D6W A;  2XID A;  1PCX A;  2BKD N;  2E3H A;  3H6Z A;  3MP6 A;  1Q81 U;  1SG5 A;  2DXC A;  5KCO A;  1XJW B;  2JN0 A;  1B3Q A;  2MMP A;  2P4R A;  3GNG A;  2W10 A;  4M7A G;  1KFZ A;  2C0I A;  1WHG A;  3OYY A;  4IIM A;  2GQV A;  2OTL Q;  4E7H A;  1K9M C;  5I21 A;  1GCP A;  2OX7 A;  5CK9 A;  2CZ6 B;  2L89 A;  3A8M B;  1M1K U;  5GJV B;  2CP5 A;  2GFU A;  1WX6 A;  2X4Y A;  1VA7 A;  3CPW P;  4BI3 A;  4RTZ A;  5FU7 C;  2A7Y A;  4O6J A;  3ME9 A;  2FYK A;  4IUR A;  1M1K C;  3UPU A;  2E4H A;  3QXE B;  4C5E A;  4PJO G;  2L0A A;  4PLL A;  1IO6 A;  2QQR A;  3QYG B;  4DBH A;  1QVF A;  3HPW A;  3PGG A;  1RAF B;  2PUK B;  3I55 Q;  4J9B A;  1EX4 A;  4B9X A;  2EW3 A;  2RK2 A;  5KH6 A;  2R58 A;  2DXT A;  4L6V 5;  3I5S A;  5GAO q;  2DTI A;  4HVW A;  2JJ9 A;  1UJ0 A;  2DLP A;  2O88 A;  1VYU A;  3VS2 A;  2CSI A;  3M0T A;  2A08 A;  2OTL T;  4J6X A;  4OMM A;  2H3J A;  4E7Z A;  3JCM c;  2K5I A;  4RTU A;  1PHT A;  3HKS A;  3M57 A;  2HQH A;  3RR6 A;  1KQS A;  4C0D C;  1YWP A;  3JB9 J;  3L2U A;  4PJO A;  4NL2 A;  2RQW A;  4E7I A;  1D3B A;  1KD1 U;  5I2M A;  3A8H B;  1YJW T;  3LH0 A;  1KHI A;  1QKW A;  4BI4 A;  2JVV A;  4B6M A;  1H3Z A;  1IGQ A;  3MO8 A;  4X34 A;  3QZ5 B;  2RHX A;  2LQK A;  1BB9 A;  2E10 A;  2YLC A;  1K76 A;  1W70 A;  5D6W A;  1B34 B;  3OY9 A;  2EJ9 A;  4YTL A;  2LTO A;  3M0S A;  4C8Q E;  1Q82 U;  4II1 A;  2ZPF B;  4LUE A;  2EBP A;  1K73 R;  5CKF A;  5GAN 2;  4F7U F;  3CC4 T;  3THK A;  4M7A A;  4KUL A;  3QDF A;  3CCV A;  3VJP A;  4OGC A;  5D6X A;  2ABL A;  1MND A;  4KRT A;  3QJY A;  4HA8 A;  3E9F A;  2HQX A;  4XTX A;  1AWX A;  3E9G A;  1OI1 A;  2JNG A;  2DXU A;  2X51 A;  2ENM A;  3CCL A;  3RDV A;  1UGQ B;  2H3E B;  4GLM A;  4OB2 B;  2RPN A;  1KQ2 A;  2D0Q B;  5L8R E;  1TUD A;  1Z9Z A;  4JPB W;  1OPK A;  4BAC A;  3EG1 A;  3JCM P;  1YIT A;  2SEM A;  5FW9 A;  3OW2 S;  5GAN j;  1RAD B;  4ANJ A;  1KSW A;  1QVG S;  1ZBX A;  2COY A;  3EGD A;  3EGD B;  5GAM d;  3VUZ A;  4M7D E;  1O75 A;  1M3A A;  2RN8 A;  2F2W A;  1NM7 A;  3M4G A;  4MZP A;  2X3X D;  4JRP A;  2E65 A;  1U1T A;  3CC2 Q;  2HSE B;  3CC2 A;  1VYT A;  2QAZ A;  3OSV A;  5LJ5 h;  3G1J A;  1JJ2 S;  1NJI C;  1YIJ A;  3M0P A;  4C92 A;  1YJN T;  2ZPI B;  1C1A A;  2KGT A;  4KH0 B;  2LNH B;  2AKK A;  3G4S Q;  4M78 G;  3EAE A;  4XTY A;  3TSZ A;  2KDS A;  5CO7 A;  2YWW A;  3OMC A;  2JS0 A;  2BZ8 A;  2QEX A;  3T9N A;  1D0Z A;  4IIO A;  2KRN A;  4R56 A;  1I5O B;  4Z88 A;  2BUD A;  2K57 A;  4GLK A;  3NTI A;  1WHH A;  3CD6 Q;  4ORZ A;  4FT2 A;  4BI8 B;  1LVK A;  1AHJ B;  2FZC B;  3KBG A;  2EQJ A;  1VQ9 T;  4BD3 A;  4AG2 C;  4M77 G;  3OYG A;  1I5L A;  4PJO B;  2EQI A;  1QVG A;  3M58 A;  3V8L A;  4JRI A;  3GOX A;  1BIB A;  3S6W A;  3CCL T;  1G83 A;  3C4S A;  1K1Z A;  2MF2 A;  5A0G A;  1AEY A;  1VQ8 A;  2Y4Y A;  3RMQ A;  2E5Q A;  4CC2 A;  3CCV T;  3I56 Q;  3TU4 K;  4ZGD B;  2DAQ A;  4MZT A;  1M3B A;  1JJ2 A;  5L23 A;  3JCM e;  2JUF A;  4FW2 A;  1VQ7 T;  2YDL A;  2JOY A;  3I9Q A;  2DER A;  3ZFJ A;  5KYU B;  4Y28 E;  1WHL A;  4C0D B;  2BZX A;  2EKH A;  1Q82 R;  2RJD A;  3M0U A;  2D1X A;  3OYH A;  1X01 A;  3L2Q A;  3LGL A;  3RBB B;  2DIL A;  3JV3 A;  5GAN 7;  1UTI A;  3EGX B;  1Q86 U;  3A5Z B;  3SEM A;  2P84 A;  2NUP B;  4AFQ C;  4BB7 A;  1PWT A;  4LDV A;  3SDZ A;  2WAC A;  1MMA A;  5HY6 A;  3G6E A;  1KJW A;  5IHI A;  1R8O B;  1VQO Q;  2VXE A;  3GF5 A;  4C8Q G;  4J7I A;  3P8B B;  4GY5 A;  2WSC E;  2BE7 D;  3ZEH A;  1QCF A;  1IXD A;  4CC3 A;  4M78 A;  3JCM d;  1Y07 A;  2IPO B;  4FYY B;  3CQT A;  2IG0 A;  2EGA A;  2XI9 A;  1Q81 R;  3PTA A;  4PJO E;  4M75 E;  2KI7 A;  2CP2 A;  5GMK i;  2MYS A;  1YJ9 T;  2JMA A;  5DLO A;  4LUD A;  3QII A;  1H8K A;  3NGP A;  2DX1 A;  3CCJ Q;  3Q1J A;  2LQW A;  2FVU A;  2CP7 A;  4FSS A;  2DBK A;  4KBM B;  3UT1 A;  2YXY A;  2GCX A;  1GFD A;  2RM4 A;  1PRL C;  2O9V A;  1VQP T;  3VS6 A;  3MCA B;  1K8A U;  4LE9 A;  2DL8 A;  4LD9 K;  3OYJ A;  1YCS B;  1WGS A;  4J83 A;  2QQA A;  4PFZ A;  1QMC A;  1K8A C;  2CZ1 B;  3RNJ A;  2BZY A;  2DTH A;  2D8J A;  3TCJ A;  1N8R C;  2OTL A;  4PJL A;  5IXB A;  3M5A A;  2FZK B;  3LLR A;  1KIK A;  4X9D A;  3V7C A;  2V8J A;  1AZG B;  4HCK A;  3G71 A;  3M0Q A;  2NLU A;  5GAN 5;  1XQH A;  3CC7 A;  3CCR A;  5D7U A;  2EKO A;  1PD0 A;  3I56 A;  2F2V A;  2O9S A;  2J06 A;  1PSE A;  2CH4 A;  1DJ7 B;  1G3W A;  3M53 A;  4DEX A;  3V8J A;  4C0G A;  3TVT A;  3VYG A;  2NUT A;  2K4Y A;  4M78 E;  4IUU A;  3OYF A;  2EYQ A;  1U8R A;  4M7D B;  3VS5 A;  1WPY A;  1Y7X A;  4CI0 C;  5J39 A;  4BDY A;  1V76 A;  1WJR A;  5LJ3 g;  2XDB A;  1N5Z A;  2QQS A;  3TEE A;  2FB7 A;  5KE2 A;  5FRO A;  1ZX6 A;  5KYW A;  3CCJ T;  1LCK A;  2QXF A;  3EG2 A;  3C94 A;  5CCA A;  5GAN 6;  4E7S A;  4AG1 C;  1J3T A;  3MEW A;  2M51 A;  1WHK A;  1N9S A;  1HJD A;  3UF4 A;  3CCE T;  5A0D A;  2KK4 A;  1KQ1 A;  2Y90 A;  2F5K A;  3RKX A;  2E5K A;  3LYI A;  2LT4 A;  4M77 E;  2V8K A;  2DIG A;  3QBY A;  5GMK m;  1M9S A;  3CCV Q;  4M77 B;  4Y92 A;  3E1S A;  5KCH A;  3G6E T;  3CCR Q;  3CC7 Q;  4A4G A;  1VOM A;  2VUB A;  1AOJ A;  4BY6 C;  3JAM E;  1AWW A;  1AZE A;  4GBQ A;  3EG9 A;  2BE9 B;  1K73 U;  3WXM B;  3J80 E;  3SWN A;  2E64 A;  1YIJ T;  1TWB A;  4J6W A;  1TH7 A;  1ABQ A;  1VQ5 A;  2FHD A;  4KGX B;  3X24 B;  1U3O A;  1NYF A;  4Z8A A;  1RI0 A;  1K73 C;  4FU6 A;  1MMG A;  5GAN 3;  1WXB A;  1FX7 A;  1W2B P;  2L5Q A;  2NUZ A;  5HCK A;  1K0S A;  2XK0 A;  3VS1 A;  4HVV A;  3QUI A;  1NEG A;  4MMK A;  5KYN A;  2CP6 A;  2CP0 A;  4J8O A;  3S3N A;  3V8K A;  4RKU E;  1WQW A;  3VS7 A;  1VQO T;  2D6F A;  4Z02 A;  3ER0 A;  1IRE B;  4RTX A;  2K3X A;  3JCM W;  1ZUK A;  4LDX A;  4UC4 A;  3X26 B;  2LCC A;  3UA7 A;  2EYZ A;  5KYY B;  2QGF B;  2DF6 A;  2KYB A;  1XNI A;  4M7A C;  2ZPB B;  5GAM h;  1WHM A;  2LCL A;  2QEX T;  2MWO A;  4F16 A;  5IH2 A;  1VIF A;  4C92 D;  2A37 A;  1M2O A;  2FRW A;  2MK5 A;  4NL3 A;  1ZUU A;  2FG0 A;  4OMQ A;  5DY9 A;  3QO3 A;  5KYX B;  5KYX A;  4JLG A;  1D1C A;  3M0R A;  4BDZ A;  1KC8 R;  3ASK A;  4L59 A;  1X6G A;  1D0Y A;  2EAY A;  1RUW A;  2DIQ A;  2XKO C;  4CC7 A;  5IT9 E;  5GAN e;  1FXX A;  2QGG A;  1WA7 A;  3GP8 A;  2CUB A;  3X28 B;  3CCS Q;  4JRQ A;  2XD0 A;  1PG5 B;  4EIK A; 
#chains in the Genus database with same CATH homology
 4XTW A;  3L2W A;  3VUB A;  4BAC A;  3HRT A;  2VV5 A;  3JCM P;  1YIT A;  1GXI E;  4C8Q B;  4IUP A;  4OP0 A;  4XQ3 A;  1IZ6 A;  5GAM g;  2L3R A;  2EJF A;  5FU6 C;  5LL6 S;  2LDM A;  3WVE B;  4EMK C;  3BDL A;  3FDR A;  4JRK A;  5CAI A;  3OW2 S;  5GAN j;  3S3M A;  1YJN A;  1NE8 A;  3JB9 F;  3L2Z A;  1VQK A;  1SSF A;  4QQ6 A;  1LNX A;  4M7A F;  4MDX A;  4ZTJ A;  4A53 A;  3CBO A;  2XIC A;  3WVD B;  3OS1 A;  4L5G A;  5CVI A;  1QVG S;  4ATO A;  1ZBX A;  3PT9 A;  3JB9 G;  2EIF A;  4J5Y A;  5GAM d;  4BUG A;  3VUZ A;  3CBP A;  4F7U G;  4M7D E;  4ELY C;  4XK8 E;  4JJN K;  3UWN A;  1O75 A;  3SWN B;  3OYN A;  2KMT A;  3JSC A;  3M4G A;  3LWI A;  3PMT A;  4MZP A;  4DA4 A;  4JRP A;  2E65 A;  1VQL A;  2K5F A;  2EJG A;  1B34 A;  1VUB A;  1U1T A;  4M75 B;  1N8R U;  3OBY A;  3CCM T;  5FU6 B;  3CC2 A;  4MML A;  2OAU A;  2QA4 T;  2VGM A;  2GFA A;  3OSV A;  5LJ5 h;  1JJ2 S;  2E6Z A;  1BYM A;  2ZPE B;  1NJI C;  3BDU A;  2YLB A;  4C5H A;  4WF2 A;  5CKH A;  1YIJ A;  4VUB A;  3CMA A;  3VYH B;  3V7S A;  4C92 A;  2ZZD A;  1YJN T;  3PFS A;  5HK3 A;  2K5L A;  2ZPI B;  3X20 B;  2RHI A;  1KHC A;  1VQN A;  2EQM A;  3L1A A;  3CCM A;  3R6O A;  3MEA A;  2PUO B;  3EAE A;  4M78 G;  5CKD A;  3CME A;  4XTY A;  3S3O A;  4M7A D;  2K2V A;  1Q81 C;  3SFM A;  2KDS A;  3L42 A;  3TRE A;  2JZ2 A;  3QPH A;  3RKW A;  3CMA T;  1JBM A;  5CO7 A;  4HT8 A;  3JRZ A;  3OMC A;  1VQP A;  3GIB A;  3JCM X;  3AHU A;  2BIV A;  3RER A;  2XHC A;  2WSF E;  4EMK A;  5DM7 R;  5GAN g;  3GNF B;  4PJO C;  2QEX A;  1K9M U;  3T9N A;  4CRI A;  3CCR T;  3CC7 T;  3A8L B;  4R56 A;  5FRM A;  3I56 T;  2BUD A;  2K57 A;  4GLK A;  3NTI A;  2EQU A;  4OF1 A;  5GAM f;  5C0M A;  2Y4X A;  4FT2 A;  4BI8 B;  3QYH B;  3CC4 A;  2RJE A;  3C12 A;  3RKY A;  4ZN1 A;  3HHT B;  1AHJ B;  4LDU A;  3DLL A;  1JB0 E;  2FL7 A;  3KBG A;  5LJ5 f;  3RES A;  1I4K 1;  2EQJ A;  3I55 A;  1YJ9 A;  4XU3 A;  1VQ9 T;  2M16 A;  1N9R A;  1X75 C;  3DKM A;  3DLM A;  3M59 A;  3NTK A;  4M77 C;  4BD3 A;  1YJW A;  3EFS A;  4R55 A;  1VQ8 T;  2B8A A;  4IUT A;  4M77 G;  3SWN C;  3OYG A;  5A2Q E;  2ZGW A;  1I5L A;  5LJ3 d;  2A3L A;  1QVG A;  4N0A C;  4M7A B;  1N6A A;  3M58 A;  4PJO B;  3DB3 A;  4JRI A;  3V8L A;  3JB9 I;  3GOX A;  1BIB A;  1LOJ A;  4BY6 B;  4M78 D;  4LDW A;  1Y96 A;  3QKJ A;  3S6W A;  2DO3 A;  5IAY A;  2DZC A;  3CCL T;  5LJ3 h;  2CZ7 B;  5M9O A;  4PJO D;  3C4S A;  3HSB A;  2MF2 A;  5A0G A;  5GAO p;  5GAO n;  4M7D A;  4NOY A;  1WJS A;  3FRN A;  2XDP A;  4XTU A;  4X9C A;  5AYF A;  3RMS A;  2DZ9 A;  1VQ8 A;  2Y4Y A;  1VQ7 A;  5GMK j;  4ZTF A;  3RIR A;  1YIT T;  3DB4 A;  3RMQ A;  2E5Q A;  3FLG A;  3L2V A;  4OB0 B;  2DTO A;  3HRU A;  3V7R A;  4FIB A;  5LJ5 d;  3CCV T;  3OYE A;  4J6Y A;  1G3S A;  4J7F A;  3VU3 C;  3CXC A;  4BE1 A;  1YHQ T;  2LNV A;  3CCQ T;  4PJO F;  3TU4 K;  3P8D A;  5LJ3 j;  4EPC A;  4ZGD B;  3OA6 A;  2DAQ A;  4JDS A;  2MI6 A;  3SB2 A;  3CPW S;  4MZT A;  2XDD A;  1BI1 A;  2PVO B;  3M55 A;  4RG8 A;  3JCM e;  2F69 A;  5GAN 8;  1JJ2 A;  3VV0 A;  2JUF A;  1NPP A;  1LJO A;  4EMG A;  4XU1 A;  3CXC S;  1VQ7 T;  4F7U E;  2DVE A;  4RMO A;  2ZPG B;  2JOY A;  2G3R A;  4C8Q A;  4M7D G;  3ZFJ A;  4DOW A;  4DQ2 A;  3OSS C;  4XTZ A;  5EG2 A;  5GAM j;  4Y28 E;  3CCQ A;  2E6N A;  3OMG A;  4HT9 A;  4N4G A;  5GAN f;  4XU0 A;  3J7A F;  4C0D B;  3CEY A;  3MEV A;  1S72 T;  1KD1 C;  2RJD A;  3ZBD A;  3M54 A;  2CZ0 B;  4M77 F;  5HK0 A;  2P0P A;  1NPR A;  2RI2 A;  4JS4 A;  4HCZ A;  2E12 A;  3OYH A;  1UGR B;  5CIU A;  1X01 A;  3L2Q A;  3BY7 A;  3LGL A;  4M77 A;  3HRS A;  4M75 G;  5A0L A;  5KE3 A;  3J81 E;  4M78 B;  5GAN h;  4QVD A;  1N27 A;  5GAN 7;  2KQW A;  2LX9 A;  1Q86 U;  5FLX E;  3A5Z B;  3LWH A;  1V29 B;  4C8Q D;  1VQ6 A;  4M75 A;  2P4T A;  4KT0 E;  4P5N A;  3CD6 T;  2RB6 A;  4IUV A;  3OB9 A;  2HQE A;  1G3Y A;  2XDB A;  4BB7 A;  2HBP A;  4LDV A;  3SDZ A;  3JCM V;  2WAC A;  4BE0 A;  4RG2 A;  1X6O A;  2LT1 A;  5HY6 A;  3PIP A;  4M78 C;  3G6E A;  1Q82 C;  2D9T A;  3CME T;  1BKB A;  1OZ3 A;  4OMF B;  1R8O B;  1PSF A;  4E7J A;  2VXE A;  1YHQ A;  1VQ6 T;  5FU7 B;  1VQN T;  4JLI A;  3GF5 A;  4HCB A;  2DD5 A;  3CD6 A;  4C8Q G;  4J7I A;  5GAN 4;  3P8B B;  4GY5 A;  2WSC E;  3PMI A;  3P8H A;  3OYB A;  3ZEH A;  1BI0 A;  4ZN3 A;  1M90 C;  4E7K A;  4M78 F;  4A54 A;  4V2S A;  4DOV A;  2PVD B;  2QI2 A;  3JB9 H;  2RK1 A;  3CCU A;  1Y71 A;  2RJF A;  2E41 A;  3L2R A;  4M78 A;  3JCM d;  1Y07 A;  4B9W A;  4FM4 B;  4A4E A;  1M4Z A;  5CQY A;  2IG0 A;  1S72 A;  2DD4 A;  2PU9 B;  3PNW C;  2XI9 A;  5D6Y A;  5LJ5 g;  1HK9 A;  4C92 G;  4OVA A;  3PTA A;  4PJO E;  4KUI A;  2EWN A;  1XOV A;  4M75 E;  4C92 C;  5CKB A;  2HD0 A;  2QTX A;  5GMK i;  4EDU A;  3I55 T;  4E47 A;  1QVP A;  1JRI A;  1M5Q 1;  2HNI A;  5C6S A;  5DLO A;  4JS5 A;  1YJ9 T;  3QII A;  1OYX A;  1UGP B;  4EMK B;  1Q7Y U;  1ZHI A;  4QVZ A;  2HAX A;  3M9Q A;  1OZ2 A;  5J26 A;  3HP9 A;  4NS5 A;  2X4W A;  2QQB A;  3Q1J A;  1VQO A;  2RHY A;  1I81 A;  2QQ9 A;  2RHU A;  1RL2 A;  2FVU A;  3QJ6 A;  4C92 F;  3FC3 A;  3OYA A;  1HXD A;  2GF7 A;  4KBM B;  2E70 A;  4QQD A;  4Y91 A;  2AHJ B;  4EMH A;  1VQ5 T;  1Q7Y C;  1VQM T;  1KG1 A;  3UT1 A;  2GCX A;  2VGN A;  2RM4 A;  4M77 D;  1M1G A;  1VQP T;  2DJZ A;  3UDC A;  1VIE A;  1M1F A;  2X4X A;  2QA4 A;  3MCA B;  2LRQ A;  5LJ5 e;  5LJ5 j;  4PNO A;  1K8A U;  2M0O A;  2KSS A;  5HKC A;  1P92 A;  2MAM A;  3OYK A;  4M7A E;  4XU2 A;  4LD9 K;  3CCS A;  1VQM A;  4ME7 A;  3OYJ A;  4OGE A;  3C95 A;  1ZQ1 A;  1WGS A;  4J83 A;  2QQA A;  4A4F A;  2V8I A;  2JTF A;  2XG8 D;  4QW2 A;  4ELZ C;  4F7U B;  2YHT A;  2CZ1 B;  4RCC A;  1K8A C;  2OTJ A;  2R5A A;  2P0Q A;  2DTH A;  3TCJ A;  2JTM A;  3M56 A;  1W4S A;  1N8R C;  2IVW A;  2OTL A;  1MHN A;  1VQ9 A;  3OBW A;  4C0Z A;  4C92 E;  3M5A A;  2RH2 A;  2CYZ B;  3FB9 A;  3LLR A;  3JCM b;  4M7D C;  4O5V A;  4X9D A;  3V7C A;  3BFM A;  2DPP B;  5L8R E;  4MZM A;  2V8J A;  4JUV A;  3G71 A;  2OTJ T;  1VQ4 A;  3CCE A;  1YCY A;  2QDY B;  4C0F A;  1NJI U;  1QW1 A;  3OYI A;  2NLU A;  5GAN 5;  1XQH A;  3CC7 A;  3CCR A;  3BW1 A;  4D6W A;  2XID A;  2EKO A;  3I56 A;  2BKD N;  3KUF A;  1XTD A;  3PIO A;  3GPL A;  2P0K A;  3H6Z A;  3RUX A;  2C06 A;  5GAO r;  3HFO A;  2VXF A;  2XU8 A;  5LJ3 f;  3MP6 A;  3FIF A;  5GMK e;  1PSE A;  1DJ7 B;  1Q81 U;  1G3W A;  2ZPH B;  2DXC A;  3M53 A;  5KCO A;  3CCJ A;  3V8J A;  4C0G A;  3VYG A;  2K4Y A;  3H8Z A;  4ZGE B;  4M78 E;  4IUU A;  2M1H A;  3OYF A;  2EYQ A;  1YI2 A;  2JN0 A;  1U8R A;  4M7D B;  1WPY A;  1Y7X A;  2MMP A;  3GNG A;  4C8Q F;  4CI0 C;  5J39 A;  4M7A G;  3OYY A;  4BDY A;  2GQV A;  2VYT A;  1WJR A;  3EFR A;  5I21 A;  3LGF A;  5LJ3 g;  2QQS A;  2CGH A;  1NZ9 A;  3TEE A;  4E7H A;  1K9M C;  1BI3 A;  4MDW A;  2FB7 A;  3GLX A;  5KE2 A;  3NFC A;  4M7D D;  5FRO A;  5CK9 A;  4E7L A;  3CCJ T;  1UB4 A;  5IN1 A;  2QXF A;  1FWZ A;  3C94 A;  5CCA A;  4M75 D;  2CZ6 B;  4C8Q C;  5GAN 6;  3CBM A;  4FSX A;  2L89 A;  3A8M B;  3JCM J;  1M1K U;  3MP8 A;  4LDY A;  4C92 B;  1YBY A;  1QP2 A;  4F7U A;  2GFU A;  3OQ5 A;  4HKE A;  3A8O B;  4XTV A;  1W2B S;  2X4Y A;  1D3B B;  2YRV A;  3MEW A;  4BI3 A;  5FU7 C;  3OYC A;  2A7Y A;  1N9S A;  3ME9 A;  4O6J A;  3N5B B;  3QDR B;  4N0A A;  2FYK A;  4IUR A;  4N4H A;  4OB3 B;  1M1K C;  3OYL A;  3CCE T;  4M7D F;  5A0D A;  2KK4 A;  1KQ1 A;  3UPU A;  2Y90 A;  1QP3 A;  2F5T X;  2F5K A;  3RKX A;  4FL6 A;  2VC8 A;  3HL8 A;  1UGS B;  3F70 A;  3LYI A;  1W2B A;  4HCC A;  2LT4 A;  5DLQ E;  3QSU A;  5J3B A;  4M77 E;  3QXE B;  2V8K A;  2DIG A;  4TVR A;  3QBY A;  4C5E A;  3OS2 A;  5GMK m;  1M9S A;  3OYM A;  1WQ7 A;  4PJO G;  4M77 B;  4PLL A;  2QQR A;  2MWP A;  3QYG B;  1KQS S;  1QVF A;  5CQX A;  4PL6 A;  1G5V A;  3E1S A;  3HPW A;  5KCH A;  3G6E T;  2LC4 A;  4A4G A;  3OS0 A;  3PGG A;  2X35 A;  2ZCF B;  2PUK B;  3E19 A;  2RHZ A;  2RA2 A;  2VUB A;  3JB9 D;  2O4X B;  3QHS A;  2K3Y A;  3VKI A;  4BY6 C;  3MP1 A;  3JAM E;  4LD6 A;  4B9X A;  3O8V A;  3KXT A;  1VQK T;  2DEQ A;  1K73 U;  3WXM B;  2RK2 A;  3SWN A;  2E64 A;  4QVC A;  5KH6 A;  2R58 A;  2DXT A;  3J80 E;  1YIJ T;  4L6V 5;  3SD4 A;  2EQK A;  4J6W A;  1TH7 A;  1VQ5 A;  4FT4 A;  2DKG A;  1WNL A;  2R5M A;  3QG1 A;  2FHD A;  5GAO q;  3X24 B;  2LVM A;  2DTI A;  1RI0 A;  1K73 C;  2R57 A;  3CPW A;  4QQG A;  4FU6 A;  4M75 F;  1KC8 U;  5CR2 A;  5GAN 3;  3CCS T;  1FX7 A;  2DXB A;  3MEU A;  3LW5 E;  4A4H A;  1VQL T;  2L5Q A;  3FJP A;  2XK0 A;  1KC8 C;  1M8V A;  3QZ9 B;  3OYD A;  3QUI A;  2LQ8 A;  4MMK A;  2OTL T;  3G4S A;  4IUQ A;  4J6X A;  2H3J A;  4J8O A;  3JCM c;  5LJ3 e;  2K5I A;  2L8D A;  3G7Z A;  3HKS A;  3M57 A;  3S3N A;  3V8K A;  5GAN d;  4RKU E;  1KQS A;  4IKF A;  2RI3 A;  1WQW A;  1VQO T;  2D6F A;  4Z02 A;  4C0D C;  3JB9 J;  1U1S A;  3ER0 A;  5GMK h;  1IRE B;  3JCM Q;  4C5I A;  5GAO l;  3URG A;  3L2U A;  4NL2 A;  3G4S T;  3CCU T;  1QVF S;  4PJO A;  1VQ4 T;  4E7I A;  2O01 E;  2K3X A;  1D3B A;  3LX7 A;  4Q5W A;  5GAM e;  3JCM W;  1KD1 U;  2EFI A;  3JCM g;  5I2M A;  3A8H B;  5GMK l;  3HFN A;  4UC4 A;  4RCB A;  4LDX A;  1H64 1;  3LH0 A;  1YJW T;  1KHI A;  4BI4 A;  2PVG B;  3A8G B;  3INZ A;  1BI2 A;  2JVV A;  3X26 B;  4KUD K;  4ZGJ B;  3M4Y A;  2KY9 A;  3MET A;  2LCC A;  3MHX A;  1H3Z A;  3MO8 A;  4X34 A;  2DK3 A;  3CPF A;  3NTH A;  3QZ5 B;  4N4I A;  3OW2 A;  1Q86 C;  2RHX A;  2LQK A;  2PQW A;  2E10 A;  1XNI A;  4M7A C;  1M90 U;  2YLC A;  2ZPB B;  5GAM h;  1WJQ A;  5GAO m;  5D6W A;  1B34 B;  1BIA A;  3OY9 A;  2LCL A;  2RO0 A;  4M75 C;  2QEX T;  2MWO A;  2WSE E;  2EJ9 A;  1UEB A;  2LTO A;  4YTL A;  4A4K A;  3JCM h;  1VIF A;  4C8Q E;  1Q82 U;  2O4X A;  4II1 A;  2ZPF B;  4PKC C;  4C92 D;  3X25 B;  2I2L A;  3OS5 A;  2RJC A;  5CKF A;  5GAN 2;  4F7U F;  4NL3 A;  3CC4 T;  3G71 T;  4M7A A;  2E1H A;  2KAF A;  5DY9 A;  4KUL A;  5CKE A;  3CCV A;  3QO3 A;  3VJP A;  2X4J A;  4OGC A;  5D6X A;  3JCM f;  4JLG A;  4OB1 B;  1I8F A;  1O9S A;  2CS7 A;  2RI5 A;  3E9F A;  3QJY A;  4HA8 A;  4C5G A;  3ASK A;  4BDZ A;  2HQX A;  4XTX A;  4L59 A;  5I2S A;  3E9G A;  2EAY A;  2DIQ A;  2XKO C;  1MGQ A;  1OI1 A;  2CKK A;  2JNG A;  2DXU A;  4BE2 A;  5IT9 E;  5GAN e;  1EIF A;  1FXX A;  2RD1 A;  3FEO A;  4PLI A;  4XAX B;  1G3T A;  2M9U A;  3CCL A;  3CC2 T;  3GP8 A;  1UGQ B;  3X28 B;  5FRN A;  4OB2 B;  1YI2 T;  4JRQ A;  2XD0 A;  2KVQ G;  1KQ2 A;  2D0Q B;  1Y96 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...