1WJVA

Solution structure of the n-terminal zinc finger domain of mouse cell growth regulating nucleolar protein lyar
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
79
structure length
79
Chain Sequence
b'GSSGSSGMVFFTCNACGESVKKIQVEKHVSNCRNCECLSCIDCGKDFWGDDYKSHVKCISEGQKYGGKGYEAKSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cell growth regulating nucleolar protein LYAR
publication title Solution structure of the N-terminal zinc finger domain of mouse cell growth regulating nucleolar protein LYAR
rcsb
source organism Mus musculus
molecule tags Dna binding protein
total genus 9
structure length 79
sequence length 79
ec nomenclature
pdb deposition date 2004-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08790 zf-LYAR LYAR-type C2HC zinc finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.28.110 Mainly Beta Single Sheet Rubrerythrin, domain 2 Rubrerythrin, domain 2 1wjvA01
1WJVA
chains in the Genus database with same CATH superfamily
3LWPB 3GTLL 7RXNA 4RXNA 3WWLA 1PFWA 3LWRB 5M5XL 2JI1A 5DM61 5AI3A 3S14L 4AR3A 3RYGA 3S2HL 2Z3QB 2NYDA 1T9PA 2R7ZL 4V196 1T9OA 3KYVA 3HJWB 3NFPI 4BBSL 1R0JA 3RZ6A 1IW7D 3HOUL 2AYJA 5GAEc 2XJSA 4C3HL 4AHWA 5MLC3 5DM71 2JA6L 5M3FL 4C2M1 3GTML 2BE5D 3MQKB 3JR7A 3HOXL 1CAAA 1YV1A 5C3EL 1R0IA 1VZHA 3S15L 2PYAA 2V0FA 5FJ8L 5JVH1 1IU6A 1R9TL 3H3VM 3PKIA 5K2ME 4LHNA 2WB1P 3S16L 3ZG6A 5M5YL 1I50L 1NXEA 4AI0A 2Y0SP 3PZAA 1DVBA 3GTOL 3I4NL 1RDGA 5C4XL 1FHMA 4A3CL 5GADc 3LPEB 1WJVA 5AN9H 3M4OL 3PIO1 1LTLA 3RZDL 4X6AL 3GTGL 3GTPL 3LWQB 1BQ8A 3P8BA 2K2DA 4A3LL 4ME3A 5MGNA 5FLML 3J7Z1 4BY7L 2PSMC 5H1Sc 4GS7D 2V3BB 3SS2A 2QL0A 1BE7A 5MFPA 3H97A 1PFVA 1SMWA 3CQZL 3K35A 2H12A 1TWAL 2B5ID 3M3YL 3HOVL 4A3FL 2M4VA 3WWNB 1TWGL 2A6HD 5IYBL 8RXNA 1I6HL 2VL6A 4JADA 2GMGA 2HR5A 3H9BA 5IY0A 4U671 3QQCE 1YUXA 1OWBA 1B13A 3FDJA 2E2JL 5M5WL 1VCXA 4BY1L 1RB9A 3FKIL 4BBRL 5JVG1 1QCVA 3LWOB 4B8CD 2RDVA 1RYQA 1OWCA 3LWVB 3MSUA 5MFZA 4AR4A 4C3JL 6RXNA 3QVDA 2A68D 4WFN1 1Y1VL 5C4JL 1QYBA 2AUSB 1YUZA 3GTQL 2JI2A 3HOYL 4XXBB 3IU3I 2M6OA 2NVXL 4AHYA 3I4ML 1Z92B 2LCQA 4UY81 1WCML 1R0FA 1R0HA 5EINC 1Y1WL 3H9CA 3K7AL 4ZN3B 1R0GA 2APOB 4AHXA 3B0AB 4AI1A 4E6YA 1IROA 5RXNA 3GTJL 4TPUA 2CKCA 1IU5A 5IP7L 4A93L 5AI2A 3HAXC 4AR5A 4AR6A 4POGA 4A3IL 4AI3A 4YWMA 1JYBA 2A69D 3A44A 4AI2A 3PWFA 3KYUA 4ZN1B 5IYCL 3PL5A 4AHZA 4TVMA 3J7Y1 1IRNA 2E2HL 1T9QA 1PZXA 1NXGA 3PO3L 2J9UB 5M3ML 2RFKB 2O5JD 1S30A 3PKJA 3HOWL 1DX8A 2JI3A 4A3BL 2XJTA 3KYXA 1PFUA 1VZGA 2KKDA 5IYDL 3HOZL 3GTKL 3LNLA 4Y7NL 4A3DL 2XJVA 3P2AA 1B71A 1BQ9A 3B08B 2PVEA 2PVXA 4LHLA 2E2IL 1CADA 2M4YA 4AYBP 2XJUA 1SMUA 3VPBE 2A6ED 2NVTL 2YU9L 1TWFL 2V0EA 2M6PA 2XJPA 1I3QL 2CR8A 2PPTA 5IP9L 2JA5L 3H99A 1ZRPA 2XJRA 1FHHA 4JAGA 4XGHA 4A3JL 5EIOC 1ODHA 2KN9A 3H0GL 3S2DL 2B63L 1H7VA 3KYWA 4JAFA 1SMMA 5C44L 1BFYA 4BXXL 2HVYC 3S1NL 1B2JA 2R92L 1B2OA 3S1ML 2C6AA 1S2ZA 2ERSA 4A3GL 2NVYL 3S1RL 3RZOL 2R93L 2VUML 5GAGc 5MF6A 1PFYA 1QQTA 3HJYB 1RWDA 3S1QL 2JA7L 4C3IL 3PIP1 1K83L 2ZIXA 3HKZP 1TWCL 4A3ML 2Z3RB 1C09A 4K9FA 2PMZP 2XJQA 4G6BA 2ERJA 3RZTA 1NNQA 1LKMA 1RDVA 3S17L 1TWHL 5GAHc 4QIWP 1F4LA 1P7PA 4POFA 2CKAA 1LKOA 3MPSA 1LKPA 4A3EL 2DSXA 4YWLA 3KYYA 3PO2L 2AQCA 2L0ZA 4JAEA 1YK4A 1RYTA 1YK5A 4Y52L 1E8JA 2C6BA 2EY4E 2MS3A 4A3KL 1VZIA 1SFOL 2JA8L 2NVQL 1S24A 1BRFA 2WAQP
chains in the Genus database with same CATH topology
4ME3A 1SMUA 3VPBE 5MGNA 2A6ED 4AHYA 3J7Z1 7RXNA 1Z92B 2V0EA 4RXNA 2LCQA 3WWLA 4UY81 2M6PA 2XJPA 2PSMC 1R0FA 5H1Sc 2CR8A 2PPTA 4GS7D 2JI1A 2V3BB 1R0HA 3SS2A 5EINC 5DM61 5AI3A 2QL0A 4ZN3B 1BE7A 5MFPA 1R0GA 4AR3A 1ZRPA 2XJRA 3RYGA 1FHHA 4JAGA 4XGHA 4AHXA 2Z3QB 1SMWA 2NYDA 3B0AB 5EIOC 1ODHA 1T9PA 2KN9A 4AI1A 3K35A 4E6YA 1H7VA 1IROA 3KYWA 5RXNA 4V196 1T9OA 2H12A 3KYVA 4TPUA 4JAFA 1SMMA 2CKCA 1IU5A 2B5ID 1BFYA 3NFPI 2M4VA 5AI2A 3WWNB 4AR5A 1R0JA 3RZ6A 1IW7D 4AR6A 2AYJA 5GAEc 2XJSA 2A6HD 1B2JA 8RXNA 4POGA 4AHWA 4AI3A 5MLC3 4YWMA 1B2OA 2VL6A 2C6AA 5DM71 1S2ZA 1JYBA 2ERSA 2BE5D 4JADA 2A69D 2GMGA 3A44A 2HR5A 5IY0A 4AI2A 5GAGc 1CAAA 3PWFA 4U671 5MF6A 3KYUA 4ZN1B 4AHZA 1YV1A 1R0IA 3QQCE 1RWDA 1YUXA 1VZHA 4TVMA 3PIP1 2PYAA 1OWBA 2ZIXA 3J7Y1 1IRNA 2V0FA 2Z3RB 1C09A 5JVH1 1IU6A 1T9QA 4K9FA 2XJQA 3PKIA 1B13A 1NXGA 4G6BA 5K2ME 4LHNA 2J9UB 2ERJA 1VCXA 3ZG6A 3RZTA 1NNQA 2O5JD 1RB9A 1LKMA 1NXEA 1S30A 3PKJA 4AI0A 3PZAA 1DX8A 2JI3A 1DVBA 1RDVA 5JVG1 1QCVA 5GAHc 2XJTA 3KYXA 4B8CD 2RDVA 1RYQA 1RDGA 1OWCA 1FHMA 1VZGA 2KKDA 5GADc 4POFA 2CKAA 1LKOA 3LPEB 1WJVA 5AN9H 3MPSA 1LKPA 3MSUA 5MFZA 2DSXA 4YWLA 4AR4A 6RXNA 3KYYA 3QVDA 2A68D 2L0ZA 4WFN1 3PIO1 4JAEA 1LTLA 1YK4A 3LNLA 1RYTA 1YK5A 2XJVA 1E8JA 1QYBA 2C6BA 3P2AA 1YUZA 2MS3A 1B71A 1BQ8A 1BQ9A 2PVEA 1VZIA 2PVXA 3B08B 3P8BA 4LHLA 2JI2A 4XXBB 1CADA 3IU3I 2M4YA 1S24A 2M6OA 1BRFA 2K2DA 2XJUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WJV A; 
#chains in the Genus database with same CATH topology
 3LWP B;  3GTL L;  7RXN A;  4RXN A;  3WWL A;  1PFW A;  3LWR B;  5M5X L;  2JI1 A;  5DM6 1;  5AI3 A;  3S14 L;  4AR3 A;  3RYG A;  3S2H L;  2Z3Q B;  2NYD A;  1T9P A;  2R7Z L;  4V19 6;  1T9O A;  3KYV A;  3HJW B;  3NFP I;  4BBS L;  1R0J A;  3RZ6 A;  1IW7 D;  3HOU L;  2AYJ A;  5GAE c;  2XJS A;  4C3H L;  4AHW A;  5MLC 3;  5DM7 1;  2JA6 L;  5M3F L;  4C2M 1;  3GTM L;  2BE5 D;  3MQK B;  3JR7 A;  3HOX L;  1CAA A;  1YV1 A;  5C3E L;  1R0I A;  1VZH A;  3S15 L;  2PYA A;  2V0F A;  5FJ8 L;  5JVH 1;  1IU6 A;  1R9T L;  3H3V M;  3PKI A;  5K2M E;  4LHN A;  2WB1 P;  3S16 L;  3ZG6 A;  5M5Y L;  1I50 L;  1NXE A;  4AI0 A;  2Y0S P;  3PZA A;  1DVB A;  3GTO L;  3I4N L;  1RDG A;  5C4X L;  1FHM A;  4A3C L;  5GAD c;  3LPE B;  1WJV A;  5AN9 H;  3M4O L;  3PIO 1;  1LTL A;  3RZD L;  4X6A L;  3GTG L;  3GTP L;  3LWQ B;  1BQ8 A;  3P8B A;  2K2D A;  4A3L L;  4ME3 A;  5MGN A;  5FLM L;  3J7Z 1;  4BY7 L;  2PSM C;  5H1S c;  4GS7 D;  2V3B B;  3SS2 A;  2QL0 A;  1BE7 A;  5MFP A;  3H97 A;  1PFV A;  1SMW A;  3CQZ L;  3K35 A;  2H12 A;  1TWA L;  2B5I D;  3M3Y L;  3HOV L;  4A3F L;  2M4V A;  3WWN B;  1TWG L;  2A6H D;  5IYB L;  8RXN A;  1I6H L;  2VL6 A;  4JAD A;  2GMG A;  2HR5 A;  3H9B A;  5IY0 A;  4U67 1;  3QQC E;  1YUX A;  1OWB A;  1B13 A;  3FDJ A;  2E2J L;  5M5W L;  1VCX A;  4BY1 L;  1RB9 A;  3FKI L;  4BBR L;  5JVG 1;  1QCV A;  3LWO B;  4B8C D;  2RDV A;  1RYQ A;  1OWC A;  3LWV B;  3MSU A;  5MFZ A;  4AR4 A;  4C3J L;  6RXN A;  3QVD A;  2A68 D;  4WFN 1;  1Y1V L;  5C4J L;  1QYB A;  2AUS B;  1YUZ A;  3GTQ L;  2JI2 A;  3HOY L;  4XXB B;  3IU3 I;  2M6O A;  2NVX L;  4AHY A;  3I4M L;  1Z92 B;  2LCQ A;  4UY8 1;  1WCM L;  1R0F A;  1R0H A;  5EIN C;  1Y1W L;  3H9C A;  3K7A L;  4ZN3 B;  1R0G A;  2APO B;  4AHX A;  3B0A B;  4AI1 A;  4E6Y A;  1IRO A;  5RXN A;  3GTJ L;  4TPU A;  2CKC A;  1IU5 A;  5IP7 L;  4A93 L;  5AI2 A;  3HAX C;  4AR5 A;  4AR6 A;  4POG A;  4A3I L;  4AI3 A;  4YWM A;  1JYB A;  2A69 D;  3A44 A;  4AI2 A;  3PWF A;  3KYU A;  4ZN1 B;  5IYC L;  3PL5 A;  4AHZ A;  4TVM A;  3J7Y 1;  1IRN A;  2E2H L;  1T9Q A;  1PZX A;  1NXG A;  3PO3 L;  2J9U B;  5M3M L;  2RFK B;  2O5J D;  1S30 A;  3PKJ A;  3HOW L;  1DX8 A;  2JI3 A;  4A3B L;  2XJT A;  3KYX A;  1PFU A;  1VZG A;  2KKD A;  5IYD L;  3HOZ L;  3GTK L;  3LNL A;  4Y7N L;  4A3D L;  2XJV A;  3P2A A;  1B71 A;  1BQ9 A;  3B08 B;  2PVE A;  2PVX A;  4LHL A;  2E2I L;  1CAD A;  2M4Y A;  4AYB P;  2XJU A;  1SMU A;  3VPB E;  2A6E D;  2NVT L;  2YU9 L;  1TWF L;  2V0E A;  2M6P A;  2XJP A;  1I3Q L;  2CR8 A;  2PPT A;  5IP9 L;  2JA5 L;  3H99 A;  1ZRP A;  2XJR A;  1FHH A;  4JAG A;  4XGH A;  4A3J L;  5EIO C;  1ODH A;  2KN9 A;  3H0G L;  3S2D L;  2B63 L;  1H7V A;  3KYW A;  4JAF A;  1SMM A;  5C44 L;  1BFY A;  4BXX L;  2HVY C;  3S1N L;  1B2J A;  2R92 L;  1B2O A;  3S1M L;  2C6A A;  1S2Z A;  2ERS A;  4A3G L;  2NVY L;  3S1R L;  3RZO L;  2R93 L;  2VUM L;  5GAG c;  5MF6 A;  1PFY A;  1QQT A;  3HJY B;  1RWD A;  3S1Q L;  2JA7 L;  4C3I L;  3PIP 1;  1K83 L;  2ZIX A;  3HKZ P;  1TWC L;  4A3M L;  2Z3R B;  1C09 A;  4K9F A;  2PMZ P;  2XJQ A;  4G6B A;  2ERJ A;  3RZT A;  1NNQ A;  1LKM A;  1RDV A;  3S17 L;  1TWH L;  5GAH c;  4QIW P;  1F4L A;  1P7P A;  4POF A;  2CKA A;  1LKO A;  3MPS A;  1LKP A;  4A3E L;  2DSX A;  4YWL A;  3KYY A;  3PO2 L;  2AQC A;  2L0Z A;  4JAE A;  1YK4 A;  1RYT A;  1YK5 A;  4Y52 L;  1E8J A;  2C6B A;  2EY4 E;  2MS3 A;  4A3K L;  1VZI A;  1SFO L;  2JA8 L;  2NVQ L;  1S24 A;  1BRF A;  2WAQ P; 
#chains in the Genus database with same CATH homology
 4ME3 A;  1SMU A;  3VPB E;  5MGN A;  2A6E D;  4AHY A;  3J7Z 1;  7RXN A;  1Z92 B;  2V0E A;  4RXN A;  2LCQ A;  3WWL A;  4UY8 1;  2M6P A;  2XJP A;  2PSM C;  1R0F A;  5H1S c;  2CR8 A;  2PPT A;  4GS7 D;  2JI1 A;  2V3B B;  1R0H A;  3SS2 A;  5EIN C;  5DM6 1;  5AI3 A;  2QL0 A;  4ZN3 B;  1BE7 A;  5MFP A;  1R0G A;  4AR3 A;  1ZRP A;  2XJR A;  3RYG A;  1FHH A;  4JAG A;  4XGH A;  4AHX A;  2Z3Q B;  1SMW A;  2NYD A;  3B0A B;  5EIO C;  1ODH A;  1T9P A;  2KN9 A;  4AI1 A;  3K35 A;  4E6Y A;  1H7V A;  1IRO A;  3KYW A;  5RXN A;  4V19 6;  1T9O A;  2H12 A;  3KYV A;  4TPU A;  4JAF A;  1SMM A;  2CKC A;  1IU5 A;  2B5I D;  1BFY A;  3NFP I;  2M4V A;  5AI2 A;  3WWN B;  4AR5 A;  1R0J A;  3RZ6 A;  1IW7 D;  4AR6 A;  2AYJ A;  5GAE c;  2XJS A;  2A6H D;  1B2J A;  8RXN A;  4POG A;  4AHW A;  4AI3 A;  5MLC 3;  4YWM A;  1B2O A;  2VL6 A;  2C6A A;  5DM7 1;  1S2Z A;  1JYB A;  2ERS A;  2BE5 D;  4JAD A;  2A69 D;  2GMG A;  3A44 A;  2HR5 A;  5IY0 A;  4AI2 A;  5GAG c;  1CAA A;  3PWF A;  4U67 1;  5MF6 A;  3KYU A;  4ZN1 B;  4AHZ A;  1YV1 A;  1R0I A;  3QQC E;  1RWD A;  1YUX A;  1VZH A;  4TVM A;  3PIP 1;  2PYA A;  1OWB A;  2ZIX A;  3J7Y 1;  1IRN A;  2V0F A;  2Z3R B;  1C09 A;  5JVH 1;  1IU6 A;  1T9Q A;  4K9F A;  2XJQ A;  3PKI A;  1B13 A;  1NXG A;  4G6B A;  5K2M E;  4LHN A;  2J9U B;  2ERJ A;  1VCX A;  3ZG6 A;  3RZT A;  1NNQ A;  2O5J D;  1RB9 A;  1LKM A;  1NXE A;  1S30 A;  3PKJ A;  4AI0 A;  3PZA A;  1DX8 A;  2JI3 A;  1DVB A;  1RDV A;  5JVG 1;  1QCV A;  5GAH c;  2XJT A;  3KYX A;  4B8C D;  2RDV A;  1RYQ A;  1RDG A;  1OWC A;  1FHM A;  1VZG A;  2KKD A;  5GAD c;  4POF A;  2CKA A;  1LKO A;  3LPE B;  1WJV A;  5AN9 H;  3MPS A;  1LKP A;  3MSU A;  5MFZ A;  2DSX A;  4YWL A;  4AR4 A;  6RXN A;  3KYY A;  3QVD A;  2A68 D;  2L0Z A;  4WFN 1;  3PIO 1;  4JAE A;  1LTL A;  1YK4 A;  3LNL A;  1RYT A;  1YK5 A;  2XJV A;  1E8J A;  1QYB A;  2C6B A;  3P2A A;  1YUZ A;  2MS3 A;  1B71 A;  1BQ8 A;  1BQ9 A;  2PVE A;  1VZI A;  2PVX A;  3B08 B;  3P8B A;  4LHL A;  2JI2 A;  4XXB B;  1CAD A;  3IU3 I;  2M4Y A;  1S24 A;  2M6O A;  1BRF A;  2K2D A;  2XJU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...