1WK4A

Crystal structure of ttk003001606
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
174
structure length
174
Chain Sequence
VRIRRAGLEDLPGVARVLVDTWRATYRGVVPEAFLEGLSYEGQAERWAQRLKTPTWPGRLFVAESESGEVVGFAAFGPDRASGFPGYTAELWAIYVLPTWQRKGLGRALFHEGARLLQAEGYGRMLVWVLKENPKGRGFYEHLGGVLLGEREIELGGAKLWEVAYGFDLGGHKW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ttk003001606
publication title Crystal structure of ttk003001606
rcsb
source organism Thermus thermophilus
molecule tags Structural genomics, unknown function
total genus 43
structure length 174
sequence length 174
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2004-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1wk4A00
4BMHA 5F46A 3TO7A 1S7NA 2ARHA 3ZZIA 3G3SA 4KUBA 4AVCA 3JVNA 1M4GA 1Y9WA 4HNXB 5HH1A 2G3AA 2Z11A 2OH1A 2FXFA 3EXNA 3KKWA 4U9ZA 1YK3A 2B4BA 2PC1A 4JXRA 5EBVA 2FIWA 3TOBA 2OB0A 2DXQA 5HMNA 1KZFA 1YVKA 4KORA 1CM0A 1QSMA 2WPWA 3WR7A 4QB9A 4AB7A 2ZW7A 1TIQA 2H5MA 4LUAA 2QECA 1P0HA 2CNTA 5IV0A 2FCKA 2KCWA 2EVNA 2Z0ZA 4XPDB 3PGPA 4KVOE 2FE7A 2B4DA 4QUSA 2JLMA 5H86A 3R9EA 4XNHC 5DWMA 2PR8A 3PP9A 4FD6A 1IIDA 3D3SA 1J4JA 4NSQA 4YRHA 3MGDA 3E0KA 4RI1A 4R57A 4Y49B 4KLVA 4AG7A 5C88A 4L8AA 2HQYA 4B5PA 3FRMA 3D2MA 1BOBA 4JLYA 2PSWA 3F8KA 4AVAA 4KUAA 5F49A 4NCZA 2VZYA 2I00A 5KTCA 4PSXA 1VKCA 1S7KA 4QVTA 1LRZA 4UA3A 4FD7A 3P2FA 2CNSA 2J8NA 1QSRA 4JJXA 2G3TA 3R1KA 3FIXA 4JXQA 1S3ZA 2R1IA 4YGOA 5KTDA 3H4QA 1S5KA 2B58A 2P6EA 4LX9A 3F5BA 2OZUA 2P6GA 2GIVA 4CAXA 2C27A 4QC6A 4YFJA 4PSWA 4XPKA 4H6ZA 1MJ9A 2Z10A 3UY5A 4CRYB 2IL4A 1Q2DA 2WPXA 1XEBA 3JUWA 1SQHA 2AJ6A 2D4OA 1UFHA 2Q04A 2HV2A 2RC4A 2R8VA 3LODA 3W91A 1I12A 2P0WA 3QB8A 3EO4A 2ZXVA 1PU9A 4M3SA 4PK2A 4ZBGA 3S6KA 1NE9A 1BO4A 2ZW5A 4XNHB 1Z9UA 2PDOA 3SHPA 3W6SA 4EVYA 5GCNA 1B87A 4FD4A 4NXYA 3TFYA 2BEIA 3BJ8A 2Q7BA 1M1DA 1Y9KA 2QIRA 3DSBA 2JEVA 4R3LA 4RS2A 4IUSA 3D2PA 1WK4A 3R96A 2VQYA 5JPHA 4X5KA 5DWNA 4OADA 2PRBA 4I49A 1R57A 3EY5A 2VBQA 2J8MA 2VI7A 5FVJA 2Y0MA 3R9FA 4MJ8A 3TO6A 4E8OA 2OU2A 3R95A 2FSRA 3DNSA 4GS4A 4J3GA 1Q2YA 3RYOA 1YGHA 1YR0A 4DNCA 3TTHA 4CS0B 1MJAA 5IX3A 4KVME 1M4IA 1CJWA 2GANA 1IYKA 4NEXA 1QSOA 4HNYB 4KOYA 1GHEA 2NMTA 2PR1A 4E2AA 2CY2A 4MHDA 1XF8A 1N71A 1S7FA 3TCVA 2FIAA 2K5TA 3DR8A 3TO9A 2AE6A 1M4DA 2JDDA 4L89A 2PQ8A 4XPDC 2OZHA 2X7BA 2VZZA 4OLLA 2I79A 2BUEA 1MK4A 5KTAA 2EUIA 2REFA 3ZJ0A 3IWGA 3CXQA 4HNWB 1V0CA 4MY0A 1WWZA 1I21A 1I1DA 3S6GA 4KOXA 1U6MA 2B5GB 3FBUA 1P4NA 3DDDA 4Y49C 3B8GA 4FD5A 1KUVA 1RXTA 4KOSA 1L0CA 3F0AA 2R98A 4R9MA 1ON0A 1XMTA 2BSWA 1Q2CA 2GE3A 1MJBA 1B6BA 3TE4A 1NMTA 1Y7RA 4MY3A 4K30A 1XIXA 3LD2A 2J8RA 2Q4VA 4KVXA 5F48A 4R87A 4B5OA 1IICA 1YLEA 4IF5A 1FY7A 5CNPA 3QAHA 5I0CA 3BJ7A 4KOVA 1OZPA 4E0AA 4MI4A 1K4JA 4KZTA 2HUZA 5J8CA 4PV6A 3NE7A 2ZW6A 1S60A 3GY9A 2FL4A 4M85A 5E96A 3GYAA 2P6FA 3N7ZA 4CAWA 1KUYA 1YREA 1VHSA 4F6AA 4II9A 3C26A 2REEA 3BLNA 2VXKA 4HKFA 4KLWA 4UWJA 3GKRA 1QSNA 4ONUA 3DR6A 1PUAA 5J8FA 4PK3A 2O28A 4KOTA 5IB0A 4KOWA 2R7HA 2QMLA 3VWEA 2ZW4A 4H89A 3TT2A 2CNMA 4JD6A 1Z4RA 4U9YA 3SXNA 4CRZB 4R3KA 4H6UA 3VWDA 5H84A 1NSLA 3V8IA 3W6XA 3I9SA 2FT0A 3IGRA 2Q4YA 4OAEA 4UWIA 4U5YA 1RO5A 1M44A 3T90A 2B5GA 2B3VA 5EC4A 3CXPA 1Z4EA 3I3GA 4KOUA 4ORFA 1YX0A 2Q0YA 3PZJA 2B4DB 2G0BA 3FNCA 3CXSA 1IB1E 5ISVA 3FXTA 4UBRA 1XE4A 2D4PA 1IYLA 2ATRA 3FYNA 2JDCA 1QSTA 2ZPAA 4B5PB 1YVOA 3TOAA 4AVBA 3SXOA 4XPLA 3S6HA 5F47A 3P2HA 2B3UA 5C82A 3R9GA 4AG9A 4MBUA 3K9UA 3FB3A 4F0YA 3D8PA 3EFAA 1S7LA 2Q44A 3OWCA 4QBJA 2VEZA 2BL1A 4CAVA 4NF1A 3G8WA 2OZGA 3T9YA 2A4NA 5JQ4A 4JWPA 3EC4A 3S6FA 2FS5A 1KUXA 2F5IA
chains in the Genus database with same CATH superfamily
4A38A 4BMHA 5F46A 3TO7A 1S7NA 4X3RA 3SI1A 2ARHA 3SJFA 3B3TA 3ZZIA 3G3SA 4KUBA 1FNOA 5JGFA 4AVCA 3JVNA 1M4GA 1Y9WA 4IAVA 4HNXB 4GXHA 4DYOA 3IJ3A 2JBJA 4P4IA 2FVGA 2PJCA 5HH1A 2G3AA 2Z11A 2OH1A 2FXFA 4YWYA 3CDXA 3EXNA 2O53A 2ZENA 3JTKA 4LQ6A 3KKWA 4U9ZA 3FMCA 1YW4A 4ONWA 3TX8A 2EBJA 3A9LA 1YK3A 2B4BA 3RZAA 2C6CA 2OOTA 2PC1A 5AGEA 2PE3A 4JXRA 4Q7AA 2FIWA 5EBVA 2EK9A 2OB0A 4MCSA 2DXQA 3TOBA 3KR4A 2ZEMA 3D7FA 5HMNA 2ZELA 1A2ZA 1KZFA 1AUGA 1CM0A 1QSMA 1YVKA 2WPWA 4KORA 3WR7A 3FECA 4AVAA 3H5ZA 4QB9A 4AB7A 4F9UA 3LACA 2PJ0A 2WSAA 1CPXA 1TIQA 2ZW7A 5A27A 4P6YA 2H5MA 4LUAA 3KZWA 2QECA 4JZ0A 1P0HA 4OC3A 2ZEPA 2CNTA 1NSAA 1CPSA 4GM5A 2KCWA 2FCKA 1H8LA 5IV0A 2EVNA 2Z0ZA 4XPDB 4MFPA 4C2ZA 3PGPA 5LYIA 4MFZA 4KVOE 4B6ZA 2FE7A 2B4DA 2PJAA 4QUSA 5K8NA 1XBUA 2JLMA 5H86A 4UFXA 3R9EA 4XNHC 1TF8A 5DWMA 2PR8A 3L2NA 3PP9A 4FD6A 2CIJA 4OC0A 1DTDA 1IIDA 2V77A 3D3SA 4PPZA 1YQEA 1ZLIA 1OBRA 4ZY2A 1J4JA 4NFRA 4NSQA 4YRHA 3MGDA 3E0KA 2DEAA 4RI1A 4R57A 4Y49B 5ELYA 2PJ2A 4KLVA 4AG7A 3CZXA 5C88A 2O4HA 4L8AA 2HQYA 2YNCA 3SI0A 4B5PA 1ARLA 3FRMA 3D2MA 1BOBA 4JLYA 4NGSA 1CP7A 1Z8LA 2PJ1A 1QQ9A 1ZLHA 2AFXA 2PSWA 3CPAA 1PYTB 3F8KA 3KGQA 3PB8X 2EO8A 4KUAA 4NCZA 1XFOA 2VZYA 4MXUA 2I00A 5F49A 5KTCA 4OIWA 4PSXA 1VKCA 1UWYA 2DPSA 3ISZA 1VGYA 3RNZA 3SJXA 1S7KA 3MN8A 4QVTA 1F2OA 1LRZA 4OKOA 4NGTA 4KSFA 4UA3A 4P4JA 4MHNA 3FJUA 3P2FA 4FD7A 1LANA 4CGLA 3PBBA 4MHPA 2CNSA 2J8NA 2AFWA 1QSRA 4JJXA 2G3TA 3RO0A 3R1KA 4B10A 3FIXA 4JXQA 1S3ZA 2R1IA 5LRKA 4YGOA 1VHOA 2ZEGA 2IJZA 2PJ6A 8CPAA 5KTDA 1RTQA 3NH5A 4YU9A 3H4QA 1S5KA 2B58A 2P6EA 3KHXA 3F5BA 3PFEA 4LX9A 1R3NA 1IU8A 3IU2A 1Z2LA 4ZX8A 4B12A 2OZUA 2P6GA 2GIVA 4NGNA 1IGBA 4CAXA 1TKFA 2HB6A 2C27A 4QC6A 6CPAA 1XRYA 1PCAA 1X10A 3B3WA 4MHZA 3PB6X 3V7ZA 4YFJA 7CPAA 4PSWA 4XPKA 3NH4A 2Z3LA 3PRTA 2PRQA 4RN7A 4H6ZA 1MJ9A 3K2KA 2Z10A 5HVHA 3UY5A 2PJ5A 3PB4X 1HEEA 4UF4A 4CRYB 3TC8A 3H8EA 2IL4A 5AG7A 1Q2DA 4FUUA 5BWAB 2PCUA 2IMOA 3FH4A 2RFHA 4ZY1A 1KWMA 2WPXA 1XEBA 4ZY0A 3JUWA 4PXDA 5AG5A 2AFOA 1SQHA 2Q7SA 2AJ6A 2D4OA 1F57A 1UFHA 2HV2A 2Q04A 2R8VA 2RC4A 3I1UA 3IEHA 3LODA 5HVFA 3W91A 1I12A 2P0WA 2BOAA 4BBHA 3QB8A 4P4DA 2AFMA 3D7GA 3EO4A 4WJBA 2BO9A 2ZXVA 5AG4A 1PU9A 4CAEA 4MMOA 4M3SA 1R43A 4PK2A 4ZBGA 4P4BA 3S6KA 4F9VA 5K8MA 1NE9A 1BO4A 2F8HA 2ZW5A 4XNHB 2F7VA 3D7DA 1Z9UA 4O23A 2PDOA 1ZG7A 3SHPA 3W6SA 4EVYA 2C1CA 4NJRA 3HUVA 3CPXA 3KR5A 3KI9A 2YNCC 5GCNA 3BI1A 1Q7LA 3NE8A 4MCPA 4A31A 5LRGA 4F0XA 1B87A 3FX6A 4FD4A 4MFKA 4NXYA 3MRUA 3WC6A 3TFYA 2BEIA 3BJ8A 2Q7BA 1BPMA 1M1DA 1Y9KA 2QIRA 4A37A 4WWVA 2GLJA 5LYLA 3GUXA 5LRJA 5LYDA 3DSBA 2JEVA 4R3LA 4RS2A 4EMEA 4IUSA 3S9LA 3D2PA 3IC1A 1WK4A 3R96A 2ZOGA 4Z65A 2VQYA 1TXRA 2ZEEA 5JPHA 4X5KA 5DWNA 3B35A 4OADA 2AFUA 2PRBA 1Z5RA 4I49A 4OIDA 1R57A 4KSAA 3EY5A 3ISXA 1JQGA 1VIXA 5EMIA 2VBQA 2J8MA 2VI7A 5FVJA 2Y0MA 1ELLP 4FWUA 4R7MA 4NGQA 4Q38A 3R9FA 4P10A 4MJ8A 4UFWA 3TO6A 4E8OA 4MFJA 4C2XA 2OU2A 2YNDA 3R95A 3IIBA 1ARMA 2PJ3A 3SJGA 2ZEOA 2FSRA 3GIUA 3DNSA 4NGRA 4GS4A 3NFZA 4A30A 1LFWA 4B14A 4A94A 4C7IA 4J3GA 3KQZA 4EFDA 1Q2YA 2AFZA 1YGHA 3RYOA 4C7HA 1YR0A 2RB7A 3GLJA 4CGPA 4DNCA 4HPSA 3D7HA 3TTHA 4CS0B 2JBKA 1MJAA 5IX3A 1IOFA 4KVME 1YW6A 1M4IA 1CJWA 3D4UA 2GANA 1IYKA 4NEXA 1QSOA 4M6IA 4PXEA 1BLLE 4ZYQA 4A39A 5K8OA 2YGWA 4HNYB 4UIBA 3D66A 4UCMA 1TKJA 4KOYA 2V8DA 4UEEA 4MRIA 4A32A 4PQAA 3QNVA 3KQXA 3FVLA 3B7IA 1GHEA 1HDQA 2NMTA 2PR1A 1F2PA 4E2AA 2CY2A 4ZI6A 4MHDA 1XF8A 1N71A 3PB7X 1S7FA 2BCOA 1XOVA 4P4FA 4CAFA 5G1ZA 2YNEA 4Q36A 2V8VA 2WUUA 3TCVA 4DJLA 2GLFA 3VATA 1CP6A 2XEGA 1M4LA 2FIAA 2K5TA 3DR8A 4KSIA 4UEFA 1QMUA 3PFOA 3TO9A 2AE6A 1M4DA 2JDDA 4L89A 4LQGA 5LYFA 4G1PA 2PQ8A 2ABZA 4XPDC 1Z8XA 2OZHA 2X7BA 2VZZA 4IHMA 4OLLA 2I79A 5JM6A 3FEEA 2BUEA 1MK4A 5KTAA 4UCNA 2EUIA 2REFA 4P4EA 3ZJ0A 3IWGA 4R8FA 3RAMA 3CXQA 3JRUA 1Y0YA 4HNWB 3PB9X 1V0CA 4MY0A 1WWZA 3V38A 4OMEA 1I21A 1I1DA 3S6GA 4KOXA 1U6MA 2B5GB 3FBUA 1P4NA 2AFSA 3DDDA 3IU1A 1CX8A 4Y49C 4FAIA 1ZO0A 3D68A 3DGVA 3DLJA 1LOKA 3B8GA 4A2ZA 4FD5A 3VH9A 4PXBA 1KUVA 5J1QA 3T8WA 3PBEA 3B3SA 1RXTA 4KOSA 1L0CA 4ZX9A 5I4MA 1FT7A 2EK8A 3VARA 1XJOA 2PVVA 3F0AA 2R98A 4R9MA 1ON0A 2Z3KA 4P44A 2G9DA 3B2YA 2ANPA 1CBXA 1XMTA 2BSWA 4C68A 2CXAA 1Q2CA 2GE3A 3HLPA 2CTCA 4OC2A 2C6GA 2WYRA 1MJBA 5G21A 1B6BA 3TE4A 2GU2A 3SI2A 1NMTA 1Y7RA 4MY3A 4K30A 3WC5A 1XIXA 1IY7A 1AMPA 2NYQA 3KASA 4X8IA 4H2KA 2DPTA 3LD2A 2J8RA 2Q4VA 3SJEA 4KVXA 4R6TA 3WC7A 5F48A 4R87A 4B5OA 2J9AA 4NGMA 4TNUA 1IICA 1YLEA 4IF5A 1FY7A 5CNPA 3QAHA 2I3CA 3BJ7A 4KOVA 1OZPA 4UEZA 4E0AA 5I0CA 4MI4A 1K4JA 4CGMA 4EWTA 4KZTA 4CYQA 2POKA 3D67A 2HUZA 4NGPA 2QJ8A 5J8CA 4PV6A 1CG2A 2PJ7A 3NE7A 4CYPA 3KHZA 1VHEA 2OR4A 1S60A 2ZW6A 3GY9A 2FL4A 4C2YA 2ZEHA 4M85A 3IWEA 3BHXA 1YSJA 5E96A 3GYAA 4W9YA 4R76A 3FEDA 3IO1A 2P6FA 3N7ZA 4CAWA 4DUKA 5A28A 1KUYA 1YREA 1VHSA 4MFQA 2QYVA 4CGNA 4F6AA 5CBMA 1Y0RA 3C26A 5DS0A 4II9A 5G22A 2PVWA 5AG6A 2REEA 2ODFA 3BLNA 2VXKA 4HKFA 4KLWA 1TKHA 1YMEA 4UWJA 3NH8A 3S9MA 1ZG9A 4A95A 5F09A 5JH9A 2ZEFA 2JEWA 2WZNA 3GKRA 2IQ6A 2HC9A 1QSNA 1DE4C 2PJ9A 4ONUA 4OC1A 2NSMA 2XEFA 3DR6A 4FBEA 3RBUA 4JYWA 2ZEDA 1PUAA 4MFLA 5J8FA 1ELMP 4PK3A 2O28A 1TF9A 3WABA 4KOTA 5IB0A 4P45A 4KOWA 1LCPA 1Z8WA 2R7HA 4X2TA 3PEIA 2QMLA 3VWEA 2ZW4A 1GYTA 4H89A 3TT2A 3WT4A 2EWBA 4PXCA 3K9TA 2CNMA 3H8GA 4JD6A 1Z4RA 4U9YA 3SXNA 4CRZB 4ZGYB 4R3KA 4H6UA 3VWDA 5H84A 5THWA 1NSLA 3V8IA 4UIAA 3W6XA 4BD9A 3I9SA 2FT0A 3IGRA 2VL1A 4UCPA 4RUHA 1HDUA 2Q4YA 5D8NA 3GB0A 4OAEA 4CGOA 1BPNA 2GREA 4UWIA 4U5YA 1RO5A 1M44A 5CPAA 3T90A 4CYNA 2B5GA 2CTBA 2B3VA 2C6PA 4OP4A 4B11A 5EC4A 3CXPA 1Z4EA 3I3GA 5IB9A 1Y7EA 3LMSA 4KOUA 4ORFA 1YX0A 2PJ4A 3NA6A 5HVGA 2Q0YA 3PZJA 5D29A 2B4DB 4B13A 2XEIA 1XMBA 2G0BA 2V8HA 3FNCA 2Z3NA 4UFVA 2DF5A 5HXDA 3FF3A 3CXSA 1IB1E 1LAMA 5ISVA 2XEJA 3FXTA 1ZG8A 2Z3OA 3LWUA 4UBRA 4M6GA 1XE4A 2D4PA 4OC5A 1X12A 4F8ZA 2ZOFA 4MCQA 1BAVA 1IYLA 4TWEA 2ATRA 3FYNA 2JDCA 1QSTA 2ZPAA 2Z3MA 4B5PB 1YVOA 3TOAA 3BI0A 4OC4A 3SXOA 4XPLA 4AVBA 2QVPA 3S6HA 5F47A 2PJ8A 3KL9A 4IK2A 2PIYA 3P2HA 4A33A 2B3UA 2Q51A 5C82A 3R9GA 2PIZA 4AG9A 4MBUA 1IOIA 3K9UA 4K3NA 3B3VA 2Q4ZA 3BXMA 3FB3A 4AXVA 4F0YA 2V8GA 1YLOA 3IWWA 3D8PA 4MHYA 3EFAA 5K8PA 1JWQA 1S7LA 1EE3P 3IFEA 2Q44A 3OWCA 3H8FA 4QBJA 4NJQA 2VEZA 2BL1A 4KS9A 3B3CA 4M6HA 2Z3PA 5G20A 4CAVA 4BINA 4NF1A 2Q43A 3G8WA 2OZGA 1AYEA 2CF4A 3N5FA 2GFQA 4MCRA 3T9YA 2A4NA 1Z8TA 5JQ4A 1LAPA 4JWPA 3CT9A 3EC4A 3S6FA 4CYOA 4CPAA 2FS5A 3QAYA 3S9NA 1KUXA 2PJBA 2F5IA
chains in the Genus database with same CATH topology
4BMHA 5F46A 3TO7A 1S7NA 2ARHA 3ZZIA 3G3SA 4KUBA 4AVCA 3JVNA 1M4GA 1Y9WA 4HNXB 5HH1A 2G3AA 2Z11A 2OH1A 2FXFA 3EXNA 3JTKA 3KKWA 4U9ZA 3A9LA 1YK3A 2B4BA 2PC1A 5AGEA 4JXRA 5EBVA 2FIWA 3TOBA 2OB0A 2DXQA 5HMNA 1KZFA 1YVKA 4KORA 1CM0A 1QSMA 2WPWA 3WR7A 3H5ZA 4QB9A 4AB7A 5A27A 2ZW7A 2WSAA 1TIQA 2H5MA 4LUAA 2QECA 1P0HA 2CNTA 5IV0A 2FCKA 2KCWA 2EVNA 2Z0ZA 4XPDB 4MFPA 4C2ZA 3PGPA 4MFZA 4KVOE 2FE7A 2B4DA 4QUSA 2JLMA 5H86A 4UFXA 3R9EA 4XNHC 5DWMA 2PR8A 3PP9A 4FD6A 1IIDA 3D3SA 1J4JA 4NSQA 4YRHA 3MGDA 3E0KA 4RI1A 4R57A 4Y49B 4KLVA 4AG7A 5C88A 4L8AA 2HQYA 2YNCA 4B5PA 3FRMA 3D2MA 1BOBA 4JLYA 2PSWA 3F8KA 4AVAA 4KUAA 5F49A 4NCZA 2VZYA 2I00A 5KTCA 4PSXA 1VKCA 2DPSA 1S7KA 4QVTA 1LRZA 4KSFA 4UA3A 4FD7A 3P2FA 4CGLA 2CNSA 2J8NA 1QSRA 4JJXA 2G3TA 3R1KA 4B10A 3FIXA 4JXQA 1S3ZA 2R1IA 4YGOA 5KTDA 3H4QA 1S5KA 2B58A 2P6EA 4LX9A 3F5BA 3IU2A 4B12A 2OZUA 2P6GA 2GIVA 4CAXA 2C27A 4QC6A 4YFJA 4PSWA 4XPKA 2Z3LA 4H6ZA 1MJ9A 2Z10A 3UY5A 4CRYB 2IL4A 5AG7A 1Q2DA 5BWAB 2WPXA 1XEBA 3JUWA 5AG5A 1SQHA 2AJ6A 2D4OA 1UFHA 2Q04A 2HV2A 2RC4A 2R8VA 3LODA 3W91A 1I12A 2P0WA 4BBHA 3QB8A 3EO4A 2ZXVA 5AG4A 1PU9A 4CAEA 4M3SA 4PK2A 4ZBGA 3S6KA 1NE9A 1BO4A 2ZW5A 4XNHB 1Z9UA 2PDOA 3SHPA 3W6SA 4EVYA 2YNCC 5GCNA 4A31A 4F0XA 1B87A 4FD4A 4MFKA 4NXYA 3TFYA 2BEIA 3BJ8A 2Q7BA 1M1DA 1Y9KA 2QIRA 3DSBA 2JEVA 4R3LA 4RS2A 4IUSA 3D2PA 1WK4A 3R96A 2VQYA 5JPHA 4X5KA 5DWNA 4OADA 2PRBA 4I49A 1R57A 4KSAA 3EY5A 2VBQA 2J8MA 2VI7A 5FVJA 2Y0MA 4Q38A 3R9FA 4MJ8A 4UFWA 3TO6A 4E8OA 4MFJA 4C2XA 2OU2A 2YNDA 3R95A 2FSRA 3DNSA 4GS4A 4A30A 4B14A 4C7IA 4J3GA 1Q2YA 3RYOA 1YGHA 4C7HA 1YR0A 4DNCA 4CGPA 3TTHA 4CS0B 1MJAA 5IX3A 4KVME 1M4IA 1CJWA 2GANA 1IYKA 4NEXA 1QSOA 2YGWA 4HNYB 4UCMA 4KOYA 4A32A 1GHEA 2NMTA 2PR1A 4E2AA 2CY2A 4MHDA 1XF8A 1N71A 1S7FA 4CAFA 5G1ZA 2YNEA 4Q36A 3TCVA 2WUUA 2FIAA 2K5TA 3DR8A 3TO9A 2AE6A 1M4DA 2JDDA 4L89A 2PQ8A 4XPDC 2OZHA 2X7BA 2VZZA 4OLLA 2I79A 2BUEA 1MK4A 5KTAA 4UCNA 2EUIA 2REFA 3ZJ0A 3IWGA 3CXQA 4HNWB 1V0CA 4MY0A 1WWZA 1I21A 1I1DA 3S6GA 4KOXA 1U6MA 2B5GB 3FBUA 1P4NA 3DDDA 3IU1A 4Y49C 1ZO0A 3B8GA 4A2ZA 4FD5A 1KUVA 1RXTA 4KOSA 1L0CA 3F0AA 2R98A 4R9MA 1ON0A 2Z3KA 1XMTA 2BSWA 4C68A 2CXAA 1Q2CA 2GE3A 1MJBA 5G21A 1B6BA 3TE4A 1NMTA 1Y7RA 4MY3A 4K30A 1XIXA 2DPTA 3LD2A 2J8RA 2Q4VA 4KVXA 5F48A 4R87A 4B5OA 1IICA 1YLEA 4IF5A 1FY7A 5CNPA 3QAHA 5I0CA 3BJ7A 4KOVA 1OZPA 4E0AA 4MI4A 1K4JA 4CGMA 4KZTA 4CYQA 2HUZA 5J8CA 4PV6A 3NE7A 4CYPA 2ZW6A 1S60A 3GY9A 2FL4A 4C2YA 4M85A 3IWEA 5E96A 3GYAA 2P6FA 3N7ZA 4CAWA 5A28A 1KUYA 1YREA 1VHSA 4MFQA 4F6AA 4CGNA 4II9A 3C26A 5G22A 5AG6A 2REEA 3BLNA 2VXKA 4HKFA 4KLWA 4UWJA 4A95A 3GKRA 1QSNA 4ONUA 3DR6A 4MFLA 1PUAA 5J8FA 4PK3A 2O28A 4KOTA 5IB0A 4KOWA 2R7HA 2QMLA 3VWEA 2ZW4A 4H89A 3TT2A 2CNMA 4JD6A 1Z4RA 4U9YA 3SXNA 4CRZB 4ZGYB 4R3KA 4H6UA 3VWDA 5H84A 1NSLA 3V8IA 3W6XA 3I9SA 2FT0A 3IGRA 4UCPA 2Q4YA 4OAEA 4CGOA 4UWIA 4U5YA 1RO5A 1M44A 3T90A 4CYNA 2B5GA 2B3VA 4B11A 5EC4A 3CXPA 1Z4EA 3I3GA 4KOUA 4ORFA 1YX0A 2Q0YA 3PZJA 2B4DB 4B13A 2G0BA 3FNCA 4UFVA 2Z3NA 3CXSA 1IB1E 5ISVA 3FXTA 2Z3OA 4UBRA 1XE4A 2D4PA 1IYLA 2ATRA 3FYNA 2JDCA 1QSTA 2ZPAA 2Z3MA 4B5PB 1YVOA 3TOAA 4AVBA 3SXOA 4XPLA 3S6HA 5F47A 3P2HA 4A33A 2B3UA 5C82A 3R9GA 4AG9A 4MBUA 3K9UA 3FB3A 4F0YA 3D8PA 3EFAA 1S7LA 2Q44A 3OWCA 4QBJA 2VEZA 2BL1A 4KS9A 2Z3PA 5G20A 4CAVA 4NF1A 3G8WA 2OZGA 3T9YA 2A4NA 5JQ4A 4JWPA 3EC4A 3S6FA 4CYOA 2FS5A 1KUXA 2F5IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BMH A;  5F46 A;  3TO7 A;  1S7N A;  2ARH A;  3ZZI A;  3G3S A;  4KUB A;  4AVC A;  3JVN A;  1M4G A;  1Y9W A;  4HNX B;  5HH1 A;  2G3A A;  2Z11 A;  2OH1 A;  2FXF A;  3EXN A;  3KKW A;  4U9Z A;  1YK3 A;  2B4B A;  2PC1 A;  4JXR A;  5EBV A;  2FIW A;  3TOB A;  2OB0 A;  2DXQ A;  5HMN A;  1KZF A;  1YVK A;  4KOR A;  1CM0 A;  1QSM A;  2WPW A;  3WR7 A;  4QB9 A;  4AB7 A;  2ZW7 A;  1TIQ A;  2H5M A;  4LUA A;  2QEC A;  1P0H A;  2CNT A;  5IV0 A;  2FCK A;  2KCW A;  2EVN A;  2Z0Z A;  4XPD B;  3PGP A;  4KVO E;  2FE7 A;  2B4D A;  4QUS A;  2JLM A;  5H86 A;  3R9E A;  4XNH C;  5DWM A;  2PR8 A;  3PP9 A;  4FD6 A;  1IID A;  3D3S A;  1J4J A;  4NSQ A;  4YRH A;  3MGD A;  3E0K A;  4RI1 A;  4R57 A;  4Y49 B;  4KLV A;  4AG7 A;  5C88 A;  4L8A A;  2HQY A;  4B5P A;  3FRM A;  3D2M A;  1BOB A;  4JLY A;  2PSW A;  3F8K A;  4AVA A;  4KUA A;  5F49 A;  4NCZ A;  2VZY A;  2I00 A;  5KTC A;  4PSX A;  1VKC A;  1S7K A;  4QVT A;  1LRZ A;  4UA3 A;  4FD7 A;  3P2F A;  2CNS A;  2J8N A;  1QSR A;  4JJX A;  2G3T A;  3R1K A;  3FIX A;  4JXQ A;  1S3Z A;  2R1I A;  4YGO A;  5KTD A;  3H4Q A;  1S5K A;  2B58 A;  2P6E A;  4LX9 A;  3F5B A;  2OZU A;  2P6G A;  2GIV A;  4CAX A;  2C27 A;  4QC6 A;  4YFJ A;  4PSW A;  4XPK A;  4H6Z A;  1MJ9 A;  2Z10 A;  3UY5 A;  4CRY B;  2IL4 A;  1Q2D A;  2WPX A;  1XEB A;  3JUW A;  1SQH A;  2AJ6 A;  2D4O A;  1UFH A;  2Q04 A;  2HV2 A;  2RC4 A;  2R8V A;  3LOD A;  3W91 A;  1I12 A;  2P0W A;  3QB8 A;  3EO4 A;  2ZXV A;  1PU9 A;  4M3S A;  4PK2 A;  4ZBG A;  3S6K A;  1NE9 A;  1BO4 A;  2ZW5 A;  4XNH B;  1Z9U A;  2PDO A;  3SHP A;  3W6S A;  4EVY A;  5GCN A;  1B87 A;  4FD4 A;  4NXY A;  3TFY A;  2BEI A;  3BJ8 A;  2Q7B A;  1M1D A;  1Y9K A;  2QIR A;  3DSB A;  2JEV A;  4R3L A;  4RS2 A;  4IUS A;  3D2P A;  1WK4 A;  3R96 A;  2VQY A;  5JPH A;  4X5K A;  5DWN A;  4OAD A;  2PRB A;  4I49 A;  1R57 A;  3EY5 A;  2VBQ A;  2J8M A;  2VI7 A;  5FVJ A;  2Y0M A;  3R9F A;  4MJ8 A;  3TO6 A;  4E8O A;  2OU2 A;  3R95 A;  2FSR A;  3DNS A;  4GS4 A;  4J3G A;  1Q2Y A;  3RYO A;  1YGH A;  1YR0 A;  4DNC A;  3TTH A;  4CS0 B;  1MJA A;  5IX3 A;  4KVM E;  1M4I A;  1CJW A;  2GAN A;  1IYK A;  4NEX A;  1QSO A;  4HNY B;  4KOY A;  1GHE A;  2NMT A;  2PR1 A;  4E2A A;  2CY2 A;  4MHD A;  1XF8 A;  1N71 A;  1S7F A;  3TCV A;  2FIA A;  2K5T A;  3DR8 A;  3TO9 A;  2AE6 A;  1M4D A;  2JDD A;  4L89 A;  2PQ8 A;  4XPD C;  2OZH A;  2X7B A;  2VZZ A;  4OLL A;  2I79 A;  2BUE A;  1MK4 A;  5KTA A;  2EUI A;  2REF A;  3ZJ0 A;  3IWG A;  3CXQ A;  4HNW B;  1V0C A;  4MY0 A;  1WWZ A;  1I21 A;  1I1D A;  3S6G A;  4KOX A;  1U6M A;  2B5G B;  3FBU A;  1P4N A;  3DDD A;  4Y49 C;  3B8G A;  4FD5 A;  1KUV A;  1RXT A;  4KOS A;  1L0C A;  3F0A A;  2R98 A;  4R9M A;  1ON0 A;  1XMT A;  2BSW A;  1Q2C A;  2GE3 A;  1MJB A;  1B6B A;  3TE4 A;  1NMT A;  1Y7R A;  4MY3 A;  4K30 A;  1XIX A;  3LD2 A;  2J8R A;  2Q4V A;  4KVX A;  5F48 A;  4R87 A;  4B5O A;  1IIC A;  1YLE A;  4IF5 A;  1FY7 A;  5CNP A;  3QAH A;  5I0C A;  3BJ7 A;  4KOV A;  1OZP A;  4E0A A;  4MI4 A;  1K4J A;  4KZT A;  2HUZ A;  5J8C A;  4PV6 A;  3NE7 A;  2ZW6 A;  1S60 A;  3GY9 A;  2FL4 A;  4M85 A;  5E96 A;  3GYA A;  2P6F A;  3N7Z A;  4CAW A;  1KUY A;  1YRE A;  1VHS A;  4F6A A;  4II9 A;  3C26 A;  2REE A;  3BLN A;  2VXK A;  4HKF A;  4KLW A;  4UWJ A;  3GKR A;  1QSN A;  4ONU A;  3DR6 A;  1PUA A;  5J8F A;  4PK3 A;  2O28 A;  4KOT A;  5IB0 A;  4KOW A;  2R7H A;  2QML A;  3VWE A;  2ZW4 A;  4H89 A;  3TT2 A;  2CNM A;  4JD6 A;  1Z4R A;  4U9Y A;  3SXN A;  4CRZ B;  4R3K A;  4H6U A;  3VWD A;  5H84 A;  1NSL A;  3V8I A;  3W6X A;  3I9S A;  2FT0 A;  3IGR A;  2Q4Y A;  4OAE A;  4UWI A;  4U5Y A;  1RO5 A;  1M44 A;  3T90 A;  2B5G A;  2B3V A;  5EC4 A;  3CXP A;  1Z4E A;  3I3G A;  4KOU A;  4ORF A;  1YX0 A;  2Q0Y A;  3PZJ A;  2B4D B;  2G0B A;  3FNC A;  3CXS A;  1IB1 E;  5ISV A;  3FXT A;  4UBR A;  1XE4 A;  2D4P A;  1IYL A;  2ATR A;  3FYN A;  2JDC A;  1QST A;  2ZPA A;  4B5P B;  1YVO A;  3TOA A;  4AVB A;  3SXO A;  4XPL A;  3S6H A;  5F47 A;  3P2H A;  2B3U A;  5C82 A;  3R9G A;  4AG9 A;  4MBU A;  3K9U A;  3FB3 A;  4F0Y A;  3D8P A;  3EFA A;  1S7L A;  2Q44 A;  3OWC A;  4QBJ A;  2VEZ A;  2BL1 A;  4CAV A;  4NF1 A;  3G8W A;  2OZG A;  3T9Y A;  2A4N A;  5JQ4 A;  4JWP A;  3EC4 A;  3S6F A;  2FS5 A;  1KUX A;  2F5I A; 
#chains in the Genus database with same CATH topology
 4A38 A;  4BMH A;  5F46 A;  3TO7 A;  1S7N A;  4X3R A;  3SI1 A;  2ARH A;  3SJF A;  3B3T A;  3ZZI A;  3G3S A;  4KUB A;  1FNO A;  5JGF A;  4AVC A;  3JVN A;  1M4G A;  1Y9W A;  4IAV A;  4HNX B;  4GXH A;  4DYO A;  3IJ3 A;  2JBJ A;  4P4I A;  2FVG A;  2PJC A;  5HH1 A;  2G3A A;  2Z11 A;  2OH1 A;  2FXF A;  4YWY A;  3CDX A;  3EXN A;  2O53 A;  2ZEN A;  3JTK A;  4LQ6 A;  3KKW A;  4U9Z A;  3FMC A;  1YW4 A;  4ONW A;  3TX8 A;  2EBJ A;  3A9L A;  1YK3 A;  2B4B A;  3RZA A;  2C6C A;  2OOT A;  2PC1 A;  5AGE A;  2PE3 A;  4JXR A;  4Q7A A;  2FIW A;  5EBV A;  2EK9 A;  2OB0 A;  4MCS A;  2DXQ A;  3TOB A;  3KR4 A;  2ZEM A;  3D7F A;  5HMN A;  2ZEL A;  1A2Z A;  1KZF A;  1AUG A;  1CM0 A;  1QSM A;  1YVK A;  2WPW A;  4KOR A;  3WR7 A;  3FEC A;  4AVA A;  3H5Z A;  4QB9 A;  4AB7 A;  4F9U A;  3LAC A;  2PJ0 A;  2WSA A;  1CPX A;  1TIQ A;  2ZW7 A;  5A27 A;  4P6Y A;  2H5M A;  4LUA A;  3KZW A;  2QEC A;  4JZ0 A;  1P0H A;  4OC3 A;  2ZEP A;  2CNT A;  1NSA A;  1CPS A;  4GM5 A;  2KCW A;  2FCK A;  1H8L A;  5IV0 A;  2EVN A;  2Z0Z A;  4XPD B;  4MFP A;  4C2Z A;  3PGP A;  5LYI A;  4MFZ A;  4KVO E;  4B6Z A;  2FE7 A;  2B4D A;  2PJA A;  4QUS A;  5K8N A;  1XBU A;  2JLM A;  5H86 A;  4UFX A;  3R9E A;  4XNH C;  1TF8 A;  5DWM A;  2PR8 A;  3L2N A;  3PP9 A;  4FD6 A;  2CIJ A;  4OC0 A;  1DTD A;  1IID A;  2V77 A;  3D3S A;  4PPZ A;  1YQE A;  1ZLI A;  1OBR A;  4ZY2 A;  1J4J A;  4NFR A;  4NSQ A;  4YRH A;  3MGD A;  3E0K A;  2DEA A;  4RI1 A;  4R57 A;  4Y49 B;  5ELY A;  2PJ2 A;  4KLV A;  4AG7 A;  3CZX A;  5C88 A;  2O4H A;  4L8A A;  2HQY A;  2YNC A;  3SI0 A;  4B5P A;  1ARL A;  3FRM A;  3D2M A;  1BOB A;  4JLY A;  4NGS A;  1CP7 A;  1Z8L A;  2PJ1 A;  1QQ9 A;  1ZLH A;  2AFX A;  2PSW A;  3CPA A;  1PYT B;  3F8K A;  3KGQ A;  3PB8 X;  2EO8 A;  4KUA A;  4NCZ A;  1XFO A;  2VZY A;  4MXU A;  2I00 A;  5F49 A;  5KTC A;  4OIW A;  4PSX A;  1VKC A;  1UWY A;  2DPS A;  3ISZ A;  1VGY A;  3RNZ A;  3SJX A;  1S7K A;  3MN8 A;  4QVT A;  1F2O A;  1LRZ A;  4OKO A;  4NGT A;  4KSF A;  4UA3 A;  4P4J A;  4MHN A;  3FJU A;  3P2F A;  4FD7 A;  1LAN A;  4CGL A;  3PBB A;  4MHP A;  2CNS A;  2J8N A;  2AFW A;  1QSR A;  4JJX A;  2G3T A;  3RO0 A;  3R1K A;  4B10 A;  3FIX A;  4JXQ A;  1S3Z A;  2R1I A;  5LRK A;  4YGO A;  1VHO A;  2ZEG A;  2IJZ A;  2PJ6 A;  8CPA A;  5KTD A;  1RTQ A;  3NH5 A;  4YU9 A;  3H4Q A;  1S5K A;  2B58 A;  2P6E A;  3KHX A;  3F5B A;  3PFE A;  4LX9 A;  1R3N A;  1IU8 A;  3IU2 A;  1Z2L A;  4ZX8 A;  4B12 A;  2OZU A;  2P6G A;  2GIV A;  4NGN A;  1IGB A;  4CAX A;  1TKF A;  2HB6 A;  2C27 A;  4QC6 A;  6CPA A;  1XRY A;  1PCA A;  1X10 A;  3B3W A;  4MHZ A;  3PB6 X;  3V7Z A;  4YFJ A;  7CPA A;  4PSW A;  4XPK A;  3NH4 A;  2Z3L A;  3PRT A;  2PRQ A;  4RN7 A;  4H6Z A;  1MJ9 A;  3K2K A;  2Z10 A;  5HVH A;  3UY5 A;  2PJ5 A;  3PB4 X;  1HEE A;  4UF4 A;  4CRY B;  3TC8 A;  3H8E A;  2IL4 A;  5AG7 A;  1Q2D A;  4FUU A;  5BWA B;  2PCU A;  2IMO A;  3FH4 A;  2RFH A;  4ZY1 A;  1KWM A;  2WPX A;  1XEB A;  4ZY0 A;  3JUW A;  4PXD A;  5AG5 A;  2AFO A;  1SQH A;  2Q7S A;  2AJ6 A;  2D4O A;  1F57 A;  1UFH A;  2HV2 A;  2Q04 A;  2R8V A;  2RC4 A;  3I1U A;  3IEH A;  3LOD A;  5HVF A;  3W91 A;  1I12 A;  2P0W A;  2BOA A;  4BBH A;  3QB8 A;  4P4D A;  2AFM A;  3D7G A;  3EO4 A;  4WJB A;  2BO9 A;  2ZXV A;  5AG4 A;  1PU9 A;  4CAE A;  4MMO A;  4M3S A;  1R43 A;  4PK2 A;  4ZBG A;  4P4B A;  3S6K A;  4F9V A;  5K8M A;  1NE9 A;  1BO4 A;  2F8H A;  2ZW5 A;  4XNH B;  2F7V A;  3D7D A;  1Z9U A;  4O23 A;  2PDO A;  1ZG7 A;  3SHP A;  3W6S A;  4EVY A;  2C1C A;  4NJR A;  3HUV A;  3CPX A;  3KR5 A;  3KI9 A;  2YNC C;  5GCN A;  3BI1 A;  1Q7L A;  3NE8 A;  4MCP A;  4A31 A;  5LRG A;  4F0X A;  1B87 A;  3FX6 A;  4FD4 A;  4MFK A;  4NXY A;  3MRU A;  3WC6 A;  3TFY A;  2BEI A;  3BJ8 A;  2Q7B A;  1BPM A;  1M1D A;  1Y9K A;  2QIR A;  4A37 A;  4WWV A;  2GLJ A;  5LYL A;  3GUX A;  5LRJ A;  5LYD A;  3DSB A;  2JEV A;  4R3L A;  4RS2 A;  4EME A;  4IUS A;  3S9L A;  3D2P A;  3IC1 A;  1WK4 A;  3R96 A;  2ZOG A;  4Z65 A;  2VQY A;  1TXR A;  2ZEE A;  5JPH A;  4X5K A;  5DWN A;  3B35 A;  4OAD A;  2AFU A;  2PRB A;  1Z5R A;  4I49 A;  4OID A;  1R57 A;  4KSA A;  3EY5 A;  3ISX A;  1JQG A;  1VIX A;  5EMI A;  2VBQ A;  2J8M A;  2VI7 A;  5FVJ A;  2Y0M A;  1ELL P;  4FWU A;  4R7M A;  4NGQ A;  4Q38 A;  3R9F A;  4P10 A;  4MJ8 A;  4UFW A;  3TO6 A;  4E8O A;  4MFJ A;  4C2X A;  2OU2 A;  2YND A;  3R95 A;  3IIB A;  1ARM A;  2PJ3 A;  3SJG A;  2ZEO A;  2FSR A;  3GIU A;  3DNS A;  4NGR A;  4GS4 A;  3NFZ A;  4A30 A;  1LFW A;  4B14 A;  4A94 A;  4C7I A;  4J3G A;  3KQZ A;  4EFD A;  1Q2Y A;  2AFZ A;  1YGH A;  3RYO A;  4C7H A;  1YR0 A;  2RB7 A;  3GLJ A;  4CGP A;  4DNC A;  4HPS A;  3D7H A;  3TTH A;  4CS0 B;  2JBK A;  1MJA A;  5IX3 A;  1IOF A;  4KVM E;  1YW6 A;  1M4I A;  1CJW A;  3D4U A;  2GAN A;  1IYK A;  4NEX A;  1QSO A;  4M6I A;  4PXE A;  1BLL E;  4ZYQ A;  4A39 A;  5K8O A;  2YGW A;  4HNY B;  4UIB A;  3D66 A;  4UCM A;  1TKJ A;  4KOY A;  2V8D A;  4UEE A;  4MRI A;  4A32 A;  4PQA A;  3QNV A;  3KQX A;  3FVL A;  3B7I A;  1GHE A;  1HDQ A;  2NMT A;  2PR1 A;  1F2P A;  4E2A A;  2CY2 A;  4ZI6 A;  4MHD A;  1XF8 A;  1N71 A;  3PB7 X;  1S7F A;  2BCO A;  1XOV A;  4P4F A;  4CAF A;  5G1Z A;  2YNE A;  4Q36 A;  2V8V A;  2WUU A;  3TCV A;  4DJL A;  2GLF A;  3VAT A;  1CP6 A;  2XEG A;  1M4L A;  2FIA A;  2K5T A;  3DR8 A;  4KSI A;  4UEF A;  1QMU A;  3PFO A;  3TO9 A;  2AE6 A;  1M4D A;  2JDD A;  4L89 A;  4LQG A;  5LYF A;  4G1P A;  2PQ8 A;  2ABZ A;  4XPD C;  1Z8X A;  2OZH A;  2X7B A;  2VZZ A;  4IHM A;  4OLL A;  2I79 A;  5JM6 A;  3FEE A;  2BUE A;  1MK4 A;  5KTA A;  4UCN A;  2EUI A;  2REF A;  4P4E A;  3ZJ0 A;  3IWG A;  4R8F A;  3RAM A;  3CXQ A;  3JRU A;  1Y0Y A;  4HNW B;  3PB9 X;  1V0C A;  4MY0 A;  1WWZ A;  3V38 A;  4OME A;  1I21 A;  1I1D A;  3S6G A;  4KOX A;  1U6M A;  2B5G B;  3FBU A;  1P4N A;  2AFS A;  3DDD A;  3IU1 A;  1CX8 A;  4Y49 C;  4FAI A;  1ZO0 A;  3D68 A;  3DGV A;  3DLJ A;  1LOK A;  3B8G A;  4A2Z A;  4FD5 A;  3VH9 A;  4PXB A;  1KUV A;  5J1Q A;  3T8W A;  3PBE A;  3B3S A;  1RXT A;  4KOS A;  1L0C A;  4ZX9 A;  5I4M A;  1FT7 A;  2EK8 A;  3VAR A;  1XJO A;  2PVV A;  3F0A A;  2R98 A;  4R9M A;  1ON0 A;  2Z3K A;  4P44 A;  2G9D A;  3B2Y A;  2ANP A;  1CBX A;  1XMT A;  2BSW A;  4C68 A;  2CXA A;  1Q2C A;  2GE3 A;  3HLP A;  2CTC A;  4OC2 A;  2C6G A;  2WYR A;  1MJB A;  5G21 A;  1B6B A;  3TE4 A;  2GU2 A;  3SI2 A;  1NMT A;  1Y7R A;  4MY3 A;  4K30 A;  3WC5 A;  1XIX A;  1IY7 A;  1AMP A;  2NYQ A;  3KAS A;  4X8I A;  4H2K A;  2DPT A;  3LD2 A;  2J8R A;  2Q4V A;  3SJE A;  4KVX A;  4R6T A;  3WC7 A;  5F48 A;  4R87 A;  4B5O A;  2J9A A;  4NGM A;  4TNU A;  1IIC A;  1YLE A;  4IF5 A;  1FY7 A;  5CNP A;  3QAH A;  2I3C A;  3BJ7 A;  4KOV A;  1OZP A;  4UEZ A;  4E0A A;  5I0C A;  4MI4 A;  1K4J A;  4CGM A;  4EWT A;  4KZT A;  4CYQ A;  2POK A;  3D67 A;  2HUZ A;  4NGP A;  2QJ8 A;  5J8C A;  4PV6 A;  1CG2 A;  2PJ7 A;  3NE7 A;  4CYP A;  3KHZ A;  1VHE A;  2OR4 A;  1S60 A;  2ZW6 A;  3GY9 A;  2FL4 A;  4C2Y A;  2ZEH A;  4M85 A;  3IWE A;  3BHX A;  1YSJ A;  5E96 A;  3GYA A;  4W9Y A;  4R76 A;  3FED A;  3IO1 A;  2P6F A;  3N7Z A;  4CAW A;  4DUK A;  5A28 A;  1KUY A;  1YRE A;  1VHS A;  4MFQ A;  2QYV A;  4CGN A;  4F6A A;  5CBM A;  1Y0R A;  3C26 A;  5DS0 A;  4II9 A;  5G22 A;  2PVW A;  5AG6 A;  2REE A;  2ODF A;  3BLN A;  2VXK A;  4HKF A;  4KLW A;  1TKH A;  1YME A;  4UWJ A;  3NH8 A;  3S9M A;  1ZG9 A;  4A95 A;  5F09 A;  5JH9 A;  2ZEF A;  2JEW A;  2WZN A;  3GKR A;  2IQ6 A;  2HC9 A;  1QSN A;  1DE4 C;  2PJ9 A;  4ONU A;  4OC1 A;  2NSM A;  2XEF A;  3DR6 A;  4FBE A;  3RBU A;  4JYW A;  2ZED A;  1PUA A;  4MFL A;  5J8F A;  1ELM P;  4PK3 A;  2O28 A;  1TF9 A;  3WAB A;  4KOT A;  5IB0 A;  4P45 A;  4KOW A;  1LCP A;  1Z8W A;  2R7H A;  4X2T A;  3PEI A;  2QML A;  3VWE A;  2ZW4 A;  1GYT A;  4H89 A;  3TT2 A;  3WT4 A;  2EWB A;  4PXC A;  3K9T A;  2CNM A;  3H8G A;  4JD6 A;  1Z4R A;  4U9Y A;  3SXN A;  4CRZ B;  4ZGY B;  4R3K A;  4H6U A;  3VWD A;  5H84 A;  5THW A;  1NSL A;  3V8I A;  4UIA A;  3W6X A;  4BD9 A;  3I9S A;  2FT0 A;  3IGR A;  2VL1 A;  4UCP A;  4RUH A;  1HDU A;  2Q4Y A;  5D8N A;  3GB0 A;  4OAE A;  4CGO A;  1BPN A;  2GRE A;  4UWI A;  4U5Y A;  1RO5 A;  1M44 A;  5CPA A;  3T90 A;  4CYN A;  2B5G A;  2CTB A;  2B3V A;  2C6P A;  4OP4 A;  4B11 A;  5EC4 A;  3CXP A;  1Z4E A;  3I3G A;  5IB9 A;  1Y7E A;  3LMS A;  4KOU A;  4ORF A;  1YX0 A;  2PJ4 A;  3NA6 A;  5HVG A;  2Q0Y A;  3PZJ A;  5D29 A;  2B4D B;  4B13 A;  2XEI A;  1XMB A;  2G0B A;  2V8H A;  3FNC A;  2Z3N A;  4UFV A;  2DF5 A;  5HXD A;  3FF3 A;  3CXS A;  1IB1 E;  1LAM A;  5ISV A;  2XEJ A;  3FXT A;  1ZG8 A;  2Z3O A;  3LWU A;  4UBR A;  4M6G A;  1XE4 A;  2D4P A;  4OC5 A;  1X12 A;  4F8Z A;  2ZOF A;  4MCQ A;  1BAV A;  1IYL A;  4TWE A;  2ATR A;  3FYN A;  2JDC A;  1QST A;  2ZPA A;  2Z3M A;  4B5P B;  1YVO A;  3TOA A;  3BI0 A;  4OC4 A;  3SXO A;  4XPL A;  4AVB A;  2QVP A;  3S6H A;  5F47 A;  2PJ8 A;  3KL9 A;  4IK2 A;  2PIY A;  3P2H A;  4A33 A;  2B3U A;  2Q51 A;  5C82 A;  3R9G A;  2PIZ A;  4AG9 A;  4MBU A;  1IOI A;  3K9U A;  4K3N A;  3B3V A;  2Q4Z A;  3BXM A;  3FB3 A;  4AXV A;  4F0Y A;  2V8G A;  1YLO A;  3IWW A;  3D8P A;  4MHY A;  3EFA A;  5K8P A;  1JWQ A;  1S7L A;  1EE3 P;  3IFE A;  2Q44 A;  3OWC A;  3H8F A;  4QBJ A;  4NJQ A;  2VEZ A;  2BL1 A;  4KS9 A;  3B3C A;  4M6H A;  2Z3P A;  5G20 A;  4CAV A;  4BIN A;  4NF1 A;  2Q43 A;  3G8W A;  2OZG A;  1AYE A;  2CF4 A;  3N5F A;  2GFQ A;  4MCR A;  3T9Y A;  2A4N A;  1Z8T A;  5JQ4 A;  1LAP A;  4JWP A;  3CT9 A;  3EC4 A;  3S6F A;  4CYO A;  4CPA A;  2FS5 A;  3QAY A;  3S9N A;  1KUX A;  2PJB A;  2F5I A; 
#chains in the Genus database with same CATH homology
 4BMH A;  5F46 A;  3TO7 A;  1S7N A;  2ARH A;  3ZZI A;  3G3S A;  4KUB A;  4AVC A;  3JVN A;  1M4G A;  1Y9W A;  4HNX B;  5HH1 A;  2G3A A;  2Z11 A;  2OH1 A;  2FXF A;  3EXN A;  3JTK A;  3KKW A;  4U9Z A;  3A9L A;  1YK3 A;  2B4B A;  2PC1 A;  5AGE A;  4JXR A;  5EBV A;  2FIW A;  3TOB A;  2OB0 A;  2DXQ A;  5HMN A;  1KZF A;  1YVK A;  4KOR A;  1CM0 A;  1QSM A;  2WPW A;  3WR7 A;  3H5Z A;  4QB9 A;  4AB7 A;  5A27 A;  2ZW7 A;  2WSA A;  1TIQ A;  2H5M A;  4LUA A;  2QEC A;  1P0H A;  2CNT A;  5IV0 A;  2FCK A;  2KCW A;  2EVN A;  2Z0Z A;  4XPD B;  4MFP A;  4C2Z A;  3PGP A;  4MFZ A;  4KVO E;  2FE7 A;  2B4D A;  4QUS A;  2JLM A;  5H86 A;  4UFX A;  3R9E A;  4XNH C;  5DWM A;  2PR8 A;  3PP9 A;  4FD6 A;  1IID A;  3D3S A;  1J4J A;  4NSQ A;  4YRH A;  3MGD A;  3E0K A;  4RI1 A;  4R57 A;  4Y49 B;  4KLV A;  4AG7 A;  5C88 A;  4L8A A;  2HQY A;  2YNC A;  4B5P A;  3FRM A;  3D2M A;  1BOB A;  4JLY A;  2PSW A;  3F8K A;  4AVA A;  4KUA A;  5F49 A;  4NCZ A;  2VZY A;  2I00 A;  5KTC A;  4PSX A;  1VKC A;  2DPS A;  1S7K A;  4QVT A;  1LRZ A;  4KSF A;  4UA3 A;  4FD7 A;  3P2F A;  4CGL A;  2CNS A;  2J8N A;  1QSR A;  4JJX A;  2G3T A;  3R1K A;  4B10 A;  3FIX A;  4JXQ A;  1S3Z A;  2R1I A;  4YGO A;  5KTD A;  3H4Q A;  1S5K A;  2B58 A;  2P6E A;  4LX9 A;  3F5B A;  3IU2 A;  4B12 A;  2OZU A;  2P6G A;  2GIV A;  4CAX A;  2C27 A;  4QC6 A;  4YFJ A;  4PSW A;  4XPK A;  2Z3L A;  4H6Z A;  1MJ9 A;  2Z10 A;  3UY5 A;  4CRY B;  2IL4 A;  5AG7 A;  1Q2D A;  5BWA B;  2WPX A;  1XEB A;  3JUW A;  5AG5 A;  1SQH A;  2AJ6 A;  2D4O A;  1UFH A;  2Q04 A;  2HV2 A;  2RC4 A;  2R8V A;  3LOD A;  3W91 A;  1I12 A;  2P0W A;  4BBH A;  3QB8 A;  3EO4 A;  2ZXV A;  5AG4 A;  1PU9 A;  4CAE A;  4M3S A;  4PK2 A;  4ZBG A;  3S6K A;  1NE9 A;  1BO4 A;  2ZW5 A;  4XNH B;  1Z9U A;  2PDO A;  3SHP A;  3W6S A;  4EVY A;  2YNC C;  5GCN A;  4A31 A;  4F0X A;  1B87 A;  4FD4 A;  4MFK A;  4NXY A;  3TFY A;  2BEI A;  3BJ8 A;  2Q7B A;  1M1D A;  1Y9K A;  2QIR A;  3DSB A;  2JEV A;  4R3L A;  4RS2 A;  4IUS A;  3D2P A;  1WK4 A;  3R96 A;  2VQY A;  5JPH A;  4X5K A;  5DWN A;  4OAD A;  2PRB A;  4I49 A;  1R57 A;  4KSA A;  3EY5 A;  2VBQ A;  2J8M A;  2VI7 A;  5FVJ A;  2Y0M A;  4Q38 A;  3R9F A;  4MJ8 A;  4UFW A;  3TO6 A;  4E8O A;  4MFJ A;  4C2X A;  2OU2 A;  2YND A;  3R95 A;  2FSR A;  3DNS A;  4GS4 A;  4A30 A;  4B14 A;  4C7I A;  4J3G A;  1Q2Y A;  3RYO A;  1YGH A;  4C7H A;  1YR0 A;  4DNC A;  4CGP A;  3TTH A;  4CS0 B;  1MJA A;  5IX3 A;  4KVM E;  1M4I A;  1CJW A;  2GAN A;  1IYK A;  4NEX A;  1QSO A;  2YGW A;  4HNY B;  4UCM A;  4KOY A;  4A32 A;  1GHE A;  2NMT A;  2PR1 A;  4E2A A;  2CY2 A;  4MHD A;  1XF8 A;  1N71 A;  1S7F A;  4CAF A;  5G1Z A;  2YNE A;  4Q36 A;  3TCV A;  2WUU A;  2FIA A;  2K5T A;  3DR8 A;  3TO9 A;  2AE6 A;  1M4D A;  2JDD A;  4L89 A;  2PQ8 A;  4XPD C;  2OZH A;  2X7B A;  2VZZ A;  4OLL A;  2I79 A;  2BUE A;  1MK4 A;  5KTA A;  4UCN A;  2EUI A;  2REF A;  3ZJ0 A;  3IWG A;  3CXQ A;  4HNW B;  1V0C A;  4MY0 A;  1WWZ A;  1I21 A;  1I1D A;  3S6G A;  4KOX A;  1U6M A;  2B5G B;  3FBU A;  1P4N A;  3DDD A;  3IU1 A;  4Y49 C;  1ZO0 A;  3B8G A;  4A2Z A;  4FD5 A;  1KUV A;  1RXT A;  4KOS A;  1L0C A;  3F0A A;  2R98 A;  4R9M A;  1ON0 A;  2Z3K A;  1XMT A;  2BSW A;  4C68 A;  2CXA A;  1Q2C A;  2GE3 A;  1MJB A;  5G21 A;  1B6B A;  3TE4 A;  1NMT A;  1Y7R A;  4MY3 A;  4K30 A;  1XIX A;  2DPT A;  3LD2 A;  2J8R A;  2Q4V A;  4KVX A;  5F48 A;  4R87 A;  4B5O A;  1IIC A;  1YLE A;  4IF5 A;  1FY7 A;  5CNP A;  3QAH A;  5I0C A;  3BJ7 A;  4KOV A;  1OZP A;  4E0A A;  4MI4 A;  1K4J A;  4CGM A;  4KZT A;  4CYQ A;  2HUZ A;  5J8C A;  4PV6 A;  3NE7 A;  4CYP A;  2ZW6 A;  1S60 A;  3GY9 A;  2FL4 A;  4C2Y A;  4M85 A;  3IWE A;  5E96 A;  3GYA A;  2P6F A;  3N7Z A;  4CAW A;  5A28 A;  1KUY A;  1YRE A;  1VHS A;  4MFQ A;  4F6A A;  4CGN A;  4II9 A;  3C26 A;  5G22 A;  5AG6 A;  2REE A;  3BLN A;  2VXK A;  4HKF A;  4KLW A;  4UWJ A;  4A95 A;  3GKR A;  1QSN A;  4ONU A;  3DR6 A;  4MFL A;  1PUA A;  5J8F A;  4PK3 A;  2O28 A;  4KOT A;  5IB0 A;  4KOW A;  2R7H A;  2QML A;  3VWE A;  2ZW4 A;  4H89 A;  3TT2 A;  2CNM A;  4JD6 A;  1Z4R A;  4U9Y A;  3SXN A;  4CRZ B;  4ZGY B;  4R3K A;  4H6U A;  3VWD A;  5H84 A;  1NSL A;  3V8I A;  3W6X A;  3I9S A;  2FT0 A;  3IGR A;  4UCP A;  2Q4Y A;  4OAE A;  4CGO A;  4UWI A;  4U5Y A;  1RO5 A;  1M44 A;  3T90 A;  4CYN A;  2B5G A;  2B3V A;  4B11 A;  5EC4 A;  3CXP A;  1Z4E A;  3I3G A;  4KOU A;  4ORF A;  1YX0 A;  2Q0Y A;  3PZJ A;  2B4D B;  4B13 A;  2G0B A;  3FNC A;  4UFV A;  2Z3N A;  3CXS A;  1IB1 E;  5ISV A;  3FXT A;  2Z3O A;  4UBR A;  1XE4 A;  2D4P A;  1IYL A;  2ATR A;  3FYN A;  2JDC A;  1QST A;  2ZPA A;  2Z3M A;  4B5P B;  1YVO A;  3TOA A;  4AVB A;  3SXO A;  4XPL A;  3S6H A;  5F47 A;  3P2H A;  4A33 A;  2B3U A;  5C82 A;  3R9G A;  4AG9 A;  4MBU A;  3K9U A;  3FB3 A;  4F0Y A;  3D8P A;  3EFA A;  1S7L A;  2Q44 A;  3OWC A;  4QBJ A;  2VEZ A;  2BL1 A;  4KS9 A;  2Z3P A;  5G20 A;  4CAV A;  4NF1 A;  3G8W A;  2OZG A;  3T9Y A;  2A4N A;  5JQ4 A;  4JWP A;  3EC4 A;  3S6F A;  4CYO A;  2FS5 A;  1KUX A;  2F5I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...