1WKGA

Acetylornithine aminotransferase from thermus thermophilus hb8
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
387
structure length
387
Chain Sequence
WRALLEAEKTLDSGVYNKHDLLIVRGQGARVWDAEGNEYIDCVGGYGVANLGHGNPEVVEAVKRQAETLMAMPQTLPTPMRGEFYRTLTAILPPELNRVFPVNSGTEANEAALKFARAHTGRKKFVAAMRGFSGRTMGSLSVTWEPKYREPFLPLVEPVEFIPYNDVEALKRAVDEETAAVILEPVQGEGGVRPATPEFLRAAREITQEKGALLILDEIQTGMGRTGKRFAFEHFGIVPDILTLAKALGGGVPLGVAVMREEVARSMPKGGHGTTFGGNPLAMAAGVAAIRYLERTRLWERAAELGPWFMEKLRAIPSPKIREVRGMGLMVGLELKEKAAPYIARLEKEHRVLALQAGPTVIRFLPPLVIEKEDLERVVEAVRAVLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Acetylornithine aminotransferase from thermus thermophilus HB8
rcsb
source organism Thermus thermophilus
molecule tags Transferase
molecule keywords Acetylornithine/acetyl-lysine aminotransferase
total genus 126
structure length 387
sequence length 387
chains with identical sequence B
ec nomenclature ec 2.6.1.11: Acetylornithine transaminase.
pdb deposition date 2004-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00202 Aminotran_3 Aminotransferase class-III
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 1wkgA02
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 1wkgA01
2ZY2A 3NU8A 4ISYA 1MDXA 1U08A 1UU1A 2W7JA 4LNMA 2BWNA 3HMUA 4A6TA 2AY2A 4A0FA 1C7GA 2WK9A 2QB3A 4ZWMA 1JS3A 2R0TA 2VLHA 5HDMA 4QGRA 1M0OA 2CTZA 1E5FA 2WK8A 4WB0A 3HVYA 3WY7A 2GQNA 3FCRA 3LG0A 3VOMA 5J8QA 1IAXA 1ASMA 1GC2A 4AO4A 3BB8A 2Z9WA 7AATA 3BS8A 4KAMA 4A0HA 2HOXA 3AEOA 1PMMA 1SZKA 4XJLA 2R5CB 4IXZA 2CB1A 4U2HA 4F5JA 3PDBA 2W8VA 3NU7A 4XK1A 4WXFA 2W7HA 4F5IA 3WCNA 5I92A 1OHVA 1B5OA 3COGA 1O61A 1OHWA 4LC3A 3AV7A 1D2FA 2Z67A 4OMAA 3AENB 4E3QA 3HL2A 4HF8A 2EPJA 4JE5A 3HT4A 3MAUA 1ARTA 2CSTA 5DB5A 1VEFA 1BQAA 3DR4A 3MC6C 4JEYA 2W7MA 1AMAA 2FNUA 3ISLA 3JW9A 2CINA 4CVQA 2GSAA 1EQBA 4K2IA 2W7KA 1V2DA 4RKDA 4IXSA 4ZDOA 3GWPA 1IBJA 3D6KA 2YRRA 3L8AA 4O6ZA 4OT8A 3FVSA 4ZSYA 3R4TA 5LHAA 2BIAA 2YOBA 3AENA 3QBOA 4Q6RA 3AEMA 3TFTA 2ZC0A 3PPLA 4CBSA 2FM1A 3B1EA 1M0PA 1O69A 2AY7A 3PDBB 4OYTA 3RQ1A 3VP6A 1DTYA 1OHYA 2D7ZA 1AAMA 4FL0A 1BKGA 2R5CA 2VMXA 3HLMA 4WYCA 4WP0A 5JAYA 1MGVA 3LVKA 4MGRA 1C7OA 2CH2A 2CJGA 1W7MA 2YKXA 4PFFA 4A00A 5LH9A 1ASEA 1RVYA 4WB0B 3FDBA 1AHXA 1IUGA 3WCOA 5K8BA 1AHEA 5D95A 4XQ2A 4F5KA 3PAAA 1QZ9A 1V2EA 2XH1A 4LNJA 4UHOA 2HUUA 1M32A 1M0QA 4F5LA 3HBXA 2OKKA 2WK7A 3BWOA 4AO9A 1ASCA 1DKAA 4IYOB 3PJ0A 3JZLA 5D5SA 5DX5A 4ITXA 4ZDLA 2VLFA 3BV0A 3NYSA 1AKBA 3G7QA 4CBRA 4LW2A 2V1PA 4TMRA 3ELPA 4MQQA 3ELEA 3K28A 3F9TA 4UHMA 3GJUA 2QA3A 1ASGA 1ECXA 1UU2A 4BQ0A 1DJ9A 3ATHA 2VGTA 1M0NA 1QIRA 1LC7A 3QI6A 1WYVA 3FFRA 1IAYA 1YNUA 3FZ6A 4PIWA 1E5EA 4MSOA 5DJ1A 1ASFA 1YIYA 3A8UX 2C44A 2W7IA 2BI3A 4ADDA 4W5KA 1AHFA 1D7RA 1KMJA 3BWNC 4GEBA 3AATA 4OBVA 3M5UA 1GD9A 1UU0A 2PO3A 4WBTA 1AX4A 2JISA 2YKVA 5M4DA 4ATQA 4DGTA 2W8WA 4UOYA 3DYDA 3JTXA 1AMQA 2ZSMA 4XJPA 1ELUA 1CZCA 4U1TA 2YCPA 5HHYA 1W7LA 1G7WA 4P7YA 2G6WA 3HQTA 3IF2A 3OKSA 2W7EA 3LVMA 3W1HA 2Z9UA 1XI9A 2CH1A 3LVLB 1SZSA 3FVUA 4R5FA 1KL2A 4Q75A 1CS1A 3NDNA 1OXOA 2TPLA 2Z61A 1TOIA 2AY4A 3EI7A 2OKJA 1ELQA 3KKIA 1CL1A 1TASA 2BWOA 3N5MA 5EAAA 3ZRRA 1TARA 1V2FA 1Z3ZA 4A6UA 1WYUB 3WX9A 1X2AA 1C0NA 2HUFA 5EUNA 1WYTB 1ASLA 2HP1A 2OATA 3RBFA 5EIGA 1MDZA 4JEWA 3TATA 2ORDA 4IX8A 1C7NA 4W1VA 2AEUA 1N2TA 4XJMA 1N8PA 1G4VA 2E54A 1EJIA 1GC4A 2O0RA 2Q7WA 2VMTA 3BCAA 2R5EA 4ADCA 4CXRA 2VMZA 4Q76A 2BI2A 3QHXA 2GMUA 4JEZA 3MAFB 2FNIA 3GETA 4W8IA 5HXXA 1I29A 1CQ7A 5C6UA 3W1JA 4WXGA 2BHXA 2W7DA 5G09A 2QMAA 3FFHA 4WYAA 2YCTA 4MQPA 4AOAA 5IWQA 4RKCA 3EUCA 1AY4A 3FVXA 2HORA 2PB2A 3JWBA 4ZSWA 3EI8A 4N0WA 4EU1A 5BJ3A 3WZFA 1YJYA 2OGAA 4R8DA 1W7NA 2V0YA 3ZRPA 5FT5A 1AJSA 1M6SA 3NUIA 1BJWA 1H1CA 1TOJA 2X5FA 3MC6A 4K2BA 5FT6A 2Z9XA 3NYUA 4Y0HA 1LKCA 2CFBA 3DXWA 4GE4A 1AJRA 3GZDC 4GDYA 1AHYA 4RM1A 3ECDA 3KGWA 4ZASA 3G0TA 4WYFA 2Z1YA 2JJHA 1W3UA 3DXVA 4JE5D 3FKDA 1YIZA 1EG5A 2AY8A 4LNLA 1DJEA 1X29A 1ZODA 2D61A 2VIAA 4R2NA 5G0AA 3FZ7A 3A9ZA 1WKHA 2ZY4A 3QPGA 1TOGA 1H0CA 4GE9A 1TATA 2F8JA 2VGVA 2W8JA 2EO5A 1G7XA 1IX7A 4ADBA 1KKJA 1GEXA 1I43A 2DGKA 2BI1A 3N0LA 2DKJA 2JJFA 2C81A 3ASAA 2ZP7A 5E5IA 5M46A 2VMUA 3EIBA 2FN6A 4RLGA 3GSBA 2AY6A 3H7FA 3A9YA 1D7VA 2HOZA 1BT4A 2VI9A 3DR7A 3DU4A 4E3RA 4ZM4A 1KKPA 4B9BA 1AY8A 3PIUA 3PD6A 4ZDPA 1CJ0A 2XBNA 3ZZKA 5EFSA 1KMKA 2VMQA 3II0A 3CQ5A 1GDEA 1GEWA 2CJHA 2VMNA 4Y0DA 4CXQA 1C9CA 1YJZA 1BJOA 2VMYA 4M2KA 4N0BA 3KE3A 4W91A 2BYLA 4AZKA 1LS3A 2YCNA 4F4EA 1AICA 2VGWA 3MEBA 3EZ1A 4EFFA 1GC3A 2DR1A 2ZY3A 3E2ZA 3A2BA 1AKCA 1IX8A 5M49A 4OC9A 4AH3A 4JEXA 3F6TA 3HDOA 2DOUA 4KYOA 1QJ3A 2AY5A 3RCHA 3WKSA 2VMVA 3BWNA 2ZJGA 1DGDA 3B1DA 3I4JA 3I5TA 4J8LA 2EH6A 2W7FA 3E77A 1J04A 4MKJA 9AATA 1O62A 2X3LA 4ZLVA 1RV3A 2BIEA 5G4JA 1B5PA 1FG7A 3EI5A 1OATA 1LC8A 3AEMC 4B98A 3MBBA 3TCMA 4RJYA 3RUYA 3QGUA 1AMSA 4MQRA 1BQDA 2GMSA 3WGCA 1SFFA 1SF2A 3DZZA 3NRAA 1PFFA 3AOVA 4ZWVA 5F9SA 1DFOA 1OXPA 4BHDA 3JWAA 4OCAA 4BMKA 4JF1A 3AOWA 3QM2A 1ZC9A 3GZCA 4PVFA 3VK3A 1Y4IA 3WKRA 1ARGA 4I8AA 1PMOA 4BA5A 4A0GA 2JG2A 3RCHB 3CBFA 1TOEA 1T3IA 4W1WA 3WLXA 4LW4A 2Z20A 3I16A 3B8XA 1S06A 3E2ZB 5G2PA 1MAQA 1ZOBA 3AELA 4DQ6A 1CQ6A 4PFNA 2JJEA 2FQ6A 4WYDA 2HP2A 3G8MA 1S0AA 1CQ8A 2W7GA 3K40A 5BJ4A 4UQVA 1BJOB 1WSTA 2Z9VA 2BI5A 1V72A 3UWCA 1MDOA 1YAAA 2D64A 1SVVA 4TV7A 4M2MA 3PD6B 1O4SA 2EZ2A 4DBCA 1QJ5A 2ZUKA 4FFCA 4E77A 5E3KA 1DGEA 4OBUA 1TOKA 4IW7A 2VGZA 3FRKA 4M2JA 3RI6A 4GE7A 4OTLA 2C0RA 1BJNA 1IX6A 4F5GA 3P1TA 1GCKA 2D63A 3DC1A 2DGLA 2E7UA 2NMPA 1QITA 4WYEA 4EMYA 3BCBA 4JF0A 5E4ZA 4R5ZA 2O7CA 2OGEA 5DJ9A 3EI9A 1XEYA 3FQAA 2EGYA 2FYFA 4WD2A 3GZDA 3TFUA 2VMSA 2AY3A 3LVJA 5EQCA 3P6KA 3PDXA 1ARIA 8AATA 4BA4A 2X8UA 1AY5A 2QB2A 3PA9A 4L0OA 3LV2A 1LW4A 1QISA 2YKYA 3T32A 1B8GA 1RV4A 5FT4A 1RVUA 1BJ4A 3GR9A 3BN1A 3AEJC 3GBXA 2BKWA 1QGNA 1PG8A 3L44A 3FDDA 4NOGA 2D5YA 2VI8A 3R9AA 1N31A 3UAKA 2QBTA 4J5UA 2E7IA 1S09A 2AY1A 2WKAA 3NTJA 2YRIA 3ACZA 2VGSA 4P3MA 3NX3A 1B9HA 4AZJA 1AJSB 3ZZJA 2VYCA 2BYJA 5EAVA 4MKKA 2O1BA 4EB7A 4Y0IA 4A72A 1AHGA 1G4XA 2HZPA 4UHNA 5F8VA 4KXKA 3EZSA 2CY8A 3CQ4A 1LK9A 4F5MA 3LY1A 4RJ0A 4IY7A 3MAFA 3Q8NA 3FQ7A 4K2MA 3ASBA 3W1IA 1IJIA 1W23A 3IHJA 2HOYA 1ARSA 3MADA 1BW0A 1GBNA 4A6RA 1D7UA 1ASDA 2OQXA 1I41A 1CL2A 4HVKA 3B46A 2BIGA 2DKBA 2CANA 3E6GA 5G4IA 2BWPA 3CQ6A 5EIGB 4RAEA 1S08A 2JJGA 4XAUA 1WYTA 1P3WA 3E9KA 4ADEA 1B9IA 1WYUA 3PGYA 2W8UA 3QN6A 3VK4A 4WLHA 1WKGA 4GRXA 4F5FA 1Z7DA 2C7TA 1UKJA 2W7LA 3F0HA 1M4NA 3B1CA 5M4BA 1FG3A 2YKUA 4RITA 4ZAHA 3FTBA 3TQXA 1IVRA 4WLJA 4WYGA 1VJOA 3LWSA 2DGMA 4ITGA 4TN4A 3WGBA 2RFVA 2VMPA 1DJUA 3AEJA 1C4KA 4H51A 2VIBA 4EB5A 1ASNA 1CZEA 3MKJA 4MY5A 1AIBA 2X5DA 3OP7A 2QLRA 2Z1ZA 3BC8A 1MLYA 2VGUA 5TF5A 3K7YA 4E1OA 1X28A 1LC5A 3A9XA 4GSAA 1SZUA 2AATA 3FD0A 5AX8A 2PB0A 4W1XA 2AEVA 1ORDA 2EZ1A 3AEPA 1S07A 2E7JA 5FT8A 1TPLA 5EUDA 3VAXA 1ASBA 1GEYA 3FZ8A 2D7YA 3NUBA 2R2NA 3H14A 1JG8A 2VMWA 2W8TA 2YHKA 3CAIA 1YJSA 2VMRA 3E2FA 3NYTA 2ZSLA 1I48A 4Q31A 4XEWA 1MAPA 3UE8A 2BI9A 5G2QA 3NNKA 4XJOA 1LW5A 2CJDA 1D7SA 2D66A 1WYVB 2VMOA 3DODA 2ZYJA 1YOOA 4A0RA 2HUIA 1ASAA 1SPAA 3FSLA 5EUEA 3BCXA 2AY9A 3RBLA 2ZY5A 1AAWA 1FC4A 4WXBA 1BS0A 3EI6A 3EIAA 3FQ8A 1M7YA 1AIAA 3USFA 3ZRQA 1J32A 4F5HA 4JEVA 1JS6A 1VP4A 1X0MA 1JF9A 3KGXA 4IXOA 3DRDA 3JU7A 1MLZA 1AKAA 1KL1A 2JGTA 3E2YA 4RIZA 1AMRA 1GC0A 2D65A 3N75A 1ARHA 4ATPA 4ZM3A 1B4XA 3VK2A 2GB3A 4IYOA
chains in the Genus database with same CATH superfamily
2ZY2A 3NU8A 4ISYA 1MDXA 1U08A 2FKIA 1UU1A 2W7JA 4LNMA 2BWNA 3HMUA 4A6TA 2AY2A 4A0FA 1C7GA 2WK9A 2QB3A 4ZWMA 1JS3A 2R0TA 2VLHA 5HDMA 4QGRA 1M0OA 2CTZA 1E5FA 2WK8A 4WB0A 3HVYA 3WY7A 2GQNA 3FCRA 3LG0A 3VOMA 5J8QA 1IAXA 1ASMA 1GC2A 4AO4A 3BB8A 2Z9WA 7AATA 1KAFA 3BS8A 4KAMA 4A0HA 2HOXA 3AEOA 1PMMA 1SZKA 4XJLA 2R5CB 4IXZA 2CB1A 4U2HA 4F5JA 3PDBA 2W8VA 3NU7A 4XK1A 4WXFA 2W7HA 4F5IA 3WCNA 5I92A 1OHVA 1B5OA 3COGA 1O61A 1OHWA 4LC3A 3AV7A 1D2FA 2Z67A 4OMAA 3AENB 4E3QA 3HL2A 4HF8A 2EPJA 4JE5A 3HT4A 3MAUA 1ARTA 2CSTA 5DB5A 1VEFA 1BQAA 3DR4A 3MC6C 4JEYA 2W7MA 1AMAA 2FNUA 3ISLA 3JW9A 2CINA 4CVQA 2GSAA 1EQBA 4K2IA 2W7KA 1V2DA 4RKDA 4IXSA 4ZDOA 3GWPA 1IBJA 3D6KA 2YRRA 3L8AA 4O6ZA 4OT8A 3FVSA 4ZSYA 3R4TA 5LHAA 2BIAA 2YOBA 3AENA 3QBOA 4Q6RA 3AEMA 3TFTA 2ZC0A 3PPLA 4CBSA 2FM1A 3B1EA 1M0PA 1O69A 2AY7A 3PDBB 4OYTA 3RQ1A 3VP6A 1DTYA 1OHYA 2D7ZA 1AAMA 4FL0A 1BKGA 2R5CA 2VMXA 3HLMA 4WYCA 4WP0A 5JAYA 1MGVA 3LVKA 4MGRA 1C7OA 2CH2A 2CJGA 1W7MA 2YKXA 3N4RA 4PFFA 4A00A 5LH9A 1ASEA 1RVYA 4WB0B 3FDBA 1AHXA 1IUGA 3WCOA 5K8BA 1AHEA 5D95A 4XQ2A 4F5KA 3PAAA 1QZ9A 1V2EA 2XH1A 4LNJA 4UHOA 2HUUA 1M32A 1M0QA 4F5LA 3HBXA 2OKKA 2WK7A 3BWOA 4AO9A 1ASCA 1DKAA 4IYOB 3PJ0A 3JZLA 5D5SA 5DX5A 4ITXA 4ZDLA 2VLFA 3BV0A 3NYSA 1AKBA 3G7QA 4CBRA 4LW2A 2V1PA 4TMRA 3ELPA 4MQQA 3ELEA 3K28A 3F9TA 4UHMA 3GJUA 2QA3A 1ASGA 1ECXA 1UU2A 4BQ0A 4K05A 1DJ9A 3ATHA 2VGTA 1M0NA 1QIRA 1LC7A 3QI6A 1WYVA 3FFRA 1IAYA 1YNUA 3FZ6A 4PIWA 1E5EA 4MSOA 5DJ1A 1ASFA 1YIYA 3A8UX 2C44A 2W7IA 2BI3A 4ADDA 4W5KA 1AHFA 1D7RA 1KMJA 3BWNC 5KTBA 4GEBA 3AATA 4OBVA 3M5UA 3N7NA 1GD9A 1UU0A 2PO3A 4WBTA 1AX4A 2JISA 2YKVA 5M4DA 4ATQA 4DGTA 2W8WA 4UOYA 2WB6A 3DYDA 3JTXA 1AMQA 2ZSMA 4XJPA 1ELUA 1CZCA 4U1TA 2YCPA 5HHYA 1W7LA 1G7WA 4P7YA 2G6WA 3HQTA 3IF2A 3OKSA 2W7EA 3LVMA 3W1HA 2Z9UA 1XI9A 2CH1A 3LVLB 1SZSA 3FVUA 4R5FA 3N4SA 1KL2A 4Q75A 1CS1A 3NDNA 1OXOA 2TPLA 2Z61A 1TOIA 2AY4A 3EI7A 2OKJA 1ELQA 3KKIA 1CL1A 1TASA 2BWOA 3N5MA 5EAAA 3ZRRA 1TARA 1V2FA 1Z3ZA 4A6UA 1WYUB 3WX9A 1X2AA 1C0NA 2HUFA 5EUNA 1WYTB 1ASLA 2HP1A 2OATA 3RBFA 5EIGA 1MDZA 4JEWA 3TATA 2ORDA 4IX8A 1C7NA 3N4XA 4W1VA 2AEUA 1N2TA 4XJMA 1N8PA 1G4VA 2E54A 1EJIA 1GC4A 2O0RA 2Q7WA 2VMTA 3BCAA 2R5EA 4ADCA 4CXRA 2VMZA 4Q76A 2BI2A 3QHXA 2GMUA 4JEZA 3MAFB 2FNIA 3GETA 4W8IA 5HXXA 1I29A 1CQ7A 5C6UA 3W1JA 4WXGA 2BHXA 2W7DA 5G09A 2QMAA 3FFHA 4WYAA 2YCTA 4MQPA 4AOAA 5IWQA 4RKCA 3EUCA 1AY4A 3FVXA 2HORA 2PB2A 3JWBA 4ZSWA 3EI8A 4N0WA 4EU1A 5BJ3A 3WZFA 1YJYA 2OGAA 4R8DA 1W7NA 2V0YA 3ZRPA 5FT5A 1AJSA 1M6SA 3NUIA 1BJWA 1H1CA 1TOJA 2X5FA 3MC6A 4K2BA 5FT6A 2Z9XA 3NYUA 4Y0HA 1LKCA 2CFBA 3DXWA 4GE4A 1AJRA 3GZDC 4GDYA 1AHYA 4RM1A 3ECDA 3KGWA 4ZASA 3G0TA 4WYFA 2Z1YA 2JJHA 1W3UA 3DXVA 4JE5D 3FKDA 1YIZA 1EG5A 2AY8A 4LNLA 1DJEA 1X29A 1ZODA 2D61A 2VIAA 4R2NA 5G0AA 3FZ7A 3A9ZA 1WKHA 2ZY4A 3QPGA 1TOGA 4H63Q 1H0CA 4GE9A 1TATA 2F8JA 2VGVA 2W8JA 2EO5A 1G7XA 1IX7A 4ADBA 1KKJA 1GEXA 1I43A 2DGKA 2BI1A 3N0LA 2DKJA 2JJFA 2C81A 3ASAA 2ZP7A 5E5IA 5M46A 2VMUA 3EIBA 2FN6A 4RLGA 3GSBA 2AY6A 3H7FA 3A9YA 1D7VA 2HOZA 1BT4A 2VI9A 3DR7A 3DU4A 4E3RA 4ZM4A 1KKPA 4B9BA 1AY8A 3PIUA 3PD6A 4ZDPA 1CJ0A 2XBNA 3ZZKA 2EYQA 5EFSA 1KMKA 2VMQA 3II0A 3CQ5A 1GDEA 1GEWA 2CJHA 2VMNA 4Y0DA 4CXQA 1C9CA 1YJZA 1BJOA 2VMYA 4M2KA 4N0BA 3KE3A 4W91A 2BYLA 4AZKA 1LS3A 2YCNA 4F4EA 1AICA 2KFPA 2VGWA 3MEBA 3EZ1A 4EFFA 1GC3A 2DR1A 2ZY3A 3E2ZA 3A2BA 1AKCA 1IX8A 5M49A 4OC9A 3H9XA 4AH3A 4JEXA 3F6TA 3HDOA 2DOUA 4KYOA 1QJ3A 2AY5A 3RCHA 3WKSA 2VMVA 3BWNA 2ZJGA 1DGDA 3B1DA 3I4JA 3I5TA 4J8LA 2EH6A 2W7FA 3E77A 1J04A 4MKJA 9AATA 1O62A 2X3LA 4ZLVA 1RV3A 2BIEA 5G4JA 1B5PA 1FG7A 3EI5A 1OATA 1LC8A 3AEMC 4B98A 3MBBA 3TCMA 4RJYA 3RUYA 3QGUA 1AMSA 4MQRA 1BQDA 2GMSA 3WGCA 1SFFA 1SF2A 3DZZA 3NRAA 1PFFA 3AOVA 4ZWVA 5F9SA 1DFOA 1OXPA 4BHDA 3JWAA 4OCAA 4BMKA 4JF1A 2G7JA 3AOWA 3QM2A 1ZC9A 3GZCA 4PVFA 3VK3A 1Y4IA 3WKRA 1ARGA 4I8AA 1PMOA 4BA5A 4A0GA 2JG2A 3RCHB 3CBFA 1TOEA 1T3IA 4W1WA 3WLXA 4LW4A 2Z20A 3I16A 3B8XA 1S06A 3E2ZB 5G2PA 1MAQA 1ZOBA 3AELA 4DQ6A 1CQ6A 4PFNA 2JJEA 2FQ6A 4WYDA 2HP2A 3G8MA 1S0AA 1CQ8A 2W7GA 3K40A 5BJ4A 4UQVA 1BJOB 1WSTA 2Z9VA 2BI5A 1V72A 3UWCA 1MDOA 1YAAA 2D64A 1SVVA 4TV7A 4M2MA 3PD6B 1O4SA 2EZ2A 4DBCA 1QJ5A 2ZUKA 4FFCA 4E77A 5E3KA 1DGEA 4OBUA 1TOKA 4IW7A 2VGZA 3FRKA 4M2JA 3RI6A 4GE7A 4OTLA 2C0RA 1BJNA 1IX6A 4F5GA 3P1TA 1GCKA 2D63A 3DC1A 2DGLA 2E7UA 2NMPA 1QITA 4WYEA 4EMYA 3BCBA 4JF0A 5E4ZA 4R5ZA 2O7CA 2OGEA 5DJ9A 3EI9A 1XEYA 3FQAA 2EGYA 2FYFA 4WD2A 3GZDA 3TFUA 2VMSA 2AY3A 3LVJA 5EQCA 3P6KA 3PDXA 1ARIA 8AATA 4BA4A 2X8UA 1AY5A 2QB2A 3PA9A 4L0OA 3LV2A 1LW4A 1QISA 2YKYA 3T32A 1B8GA 1RV4A 5FT4A 1RVUA 1BJ4A 3GR9A 3BN1A 3AEJC 3GBXA 2BKWA 1QGNA 1PG8A 3L44A 3FDDA 4NOGA 2D5YA 2VI8A 3R9AA 1N31A 3UAKA 2QBTA 4J5UA 2E7IA 1S09A 2AY1A 2WKAA 3NTJA 2YRIA 3ACZA 2VGSA 4P3MA 3NX3A 1B9HA 4AZJA 1AJSB 3ZZJA 2VYCA 2BYJA 5EAVA 4MKKA 2O1BA 4EB7A 4Y0IA 4A72A 1AHGA 1G4XA 2HZPA 4UHNA 5F8VA 4KXKA 3EZSA 2CY8A 3CQ4A 1LK9A 4F5MA 3LY1A 4RJ0A 4IY7A 3MAFA 3Q8NA 3FQ7A 4K2MA 3ASBA 3W1IA 1IJIA 1W23A 3IHJA 2HOYA 1ARSA 3MADA 1BW0A 1GBNA 4A6RA 1D7UA 1ASDA 2OQXA 1I41A 1CL2A 4HVKA 3B46A 2BIGA 2DKBA 2CANA 3E6GA 5G4IA 2BWPA 3CQ6A 5EIGB 4RAEA 1S08A 2JJGA 4XAUA 1WYTA 1P3WA 3E9KA 4ADEA 1B9IA 1WYUA 3PGYA 2W8UA 3QN6A 3VK4A 4WLHA 1WKGA 4GRXA 4F5FA 1Z7DA 2C7TA 1UKJA 2W7LA 3F0HA 1M4NA 3B1CA 5M4BA 1FG3A 2YKUA 4RITA 4ZAHA 3FTBA 3TQXA 1IVRA 4WLJA 4WYGA 1VJOA 3LWSA 2DGMA 4ITGA 4TN4A 3WGBA 2RFVA 2VMPA 1DJUA 3AEJA 1C4KA 4H51A 2VIBA 4EB5A 1ASNA 1CZEA 3MKJA 4MY5A 1AIBA 2X5DA 3OP7A 2QLRA 2Z1ZA 3BC8A 1MLYA 2VGUA 5TF5A 3K7YA 4E1OA 1X28A 1LC5A 3A9XA 4GSAA 1SZUA 2AATA 3FD0A 5AX8A 2PB0A 4W1XA 2AEVA 1ORDA 2EZ1A 3AEPA 1S07A 2E7JA 5FT8A 1TPLA 5EUDA 3VAXA 1ASBA 1GEYA 3FZ8A 2D7YA 3NUBA 2R2NA 3H14A 1JG8A 2VMWA 2W8TA 2YHKA 3CAIA 1YJSA 2VMRA 3E2FA 3NYTA 2ZSLA 1I48A 4Q31A 4XEWA 1MAPA 3UE8A 2BI9A 5G2QA 3NNKA 4XJOA 1LW5A 2CJDA 1D7SA 2D66A 1WYVB 2VMOA 3DODA 2ZYJA 1YOOA 4A0RA 2HUIA 1ASAA 1SPAA 3FSLA 5EUEA 3BCXA 2AY9A 3RBLA 2ZY5A 1AAWA 1FC4A 4WXBA 1BS0A 3EI6A 3EIAA 3FQ8A 1M7YA 1AIAA 3USFA 3ZRQA 1J32A 4F5HA 4JEVA 2A1VA 1JS6A 1VP4A 1X0MA 1JF9A 3KGXA 4IXOA 3DRDA 3JU7A 1MLZA 1AKAA 1KL1A 2JGTA 3E2YA 4RIZA 1AMRA 2QSRA 1GC0A 2D65A 3N75A 1ARHA 4ATPA 4ZM3A 1B4XA 3VK2A 2GB3A 4IYOA
chains in the Genus database with same CATH topology
2ZY2A 3NU8A 4ISYA 1MDXA 1U08A 2FKIA 1UU1A 2W7JA 4LNMA 2BWNA 3HMUA 4A6TA 2AY2A 4A0FA 1C7GA 2WK9A 2QB3A 4ZWMA 1JS3A 2R0TA 2VLHA 5HDMA 4QGRA 1M0OA 2CTZA 1E5FA 2WK8A 4WB0A 3HVYA 3WY7A 2GQNA 3FCRA 3LG0A 3VOMA 5J8QA 1IAXA 1ASMA 1GC2A 4AO4A 3BB8A 2Z9WA 7AATA 3BS8A 4KAMA 4A0HA 2HOXA 3AEOA 1PMMA 1SZKA 4XJLA 2R5CB 4IXZA 2CB1A 4U2HA 4F5JA 3PDBA 2W8VA 3NU7A 4XK1A 4WXFA 2W7HA 4F5IA 3WCNA 5I92A 1OHVA 1B5OA 3COGA 1O61A 1OHWA 4LC3A 3AV7A 1D2FA 2Z67A 4OMAA 3AENB 4E3QA 3HL2A 4HF8A 2EPJA 4JE5A 3HT4A 3MAUA 1ARTA 2CSTA 5DB5A 1VEFA 1BQAA 3DR4A 3MC6C 4JEYA 2W7MA 1AMAA 2FNUA 3ISLA 3JW9A 2CINA 4CVQA 2GSAA 1EQBA 4K2IA 2W7KA 1V2DA 4RKDA 4IXSA 4ZDOA 3GWPA 1IBJA 3D6KA 2YRRA 3L8AA 4O6ZA 4OT8A 3FVSA 4ZSYA 3R4TA 5LHAA 2BIAA 2YOBA 3AENA 3QBOA 4Q6RA 3AEMA 3TFTA 2ZC0A 3PPLA 4CBSA 2FM1A 3B1EA 1M0PA 1O69A 2AY7A 3PDBB 4OYTA 3RQ1A 3VP6A 1DTYA 1OHYA 2D7ZA 1AAMA 4FL0A 1BKGA 2R5CA 2VMXA 3HLMA 4WYCA 4WP0A 5JAYA 1MGVA 3LVKA 4MGRA 1C7OA 2CH2A 2CJGA 1W7MA 2YKXA 3N4RA 4PFFA 4A00A 5LH9A 1ASEA 1RVYA 4WB0B 3FDBA 1AHXA 1IUGA 3WCOA 5K8BA 1AHEA 5D95A 4XQ2A 4F5KA 3PAAA 1QZ9A 1V2EA 2XH1A 4LNJA 4UHOA 2HUUA 1M32A 1M0QA 4F5LA 3HBXA 2OKKA 2WK7A 3BWOA 4AO9A 1ASCA 1DKAA 4IYOB 3PJ0A 3JZLA 5D5SA 5DX5A 4ITXA 4ZDLA 2VLFA 3BV0A 3NYSA 1AKBA 3G7QA 4CBRA 4LW2A 2V1PA 4TMRA 3ELPA 4MQQA 3ELEA 3K28A 3F9TA 4UHMA 3GJUA 2QA3A 1ASGA 1ECXA 1UU2A 4BQ0A 4K05A 1DJ9A 3ATHA 2VGTA 1M0NA 1QIRA 1LC7A 3QI6A 1WYVA 3FFRA 1IAYA 1YNUA 3FZ6A 4PIWA 1E5EA 4MSOA 5DJ1A 1ASFA 1YIYA 3A8UX 2C44A 2W7IA 2BI3A 4ADDA 4W5KA 1AHFA 1D7RA 1KMJA 3BWNC 5KTBA 4GEBA 3AATA 4OBVA 3M5UA 3N7NA 1GD9A 1UU0A 2PO3A 4WBTA 1AX4A 2JISA 2YKVA 5M4DA 4ATQA 4DGTA 2W8WA 4UOYA 2WB6A 3DYDA 3JTXA 1AMQA 2ZSMA 4XJPA 1ELUA 1CZCA 4U1TA 2YCPA 5HHYA 1W7LA 1G7WA 4P7YA 2G6WA 3HQTA 3IF2A 3OKSA 2W7EA 3LVMA 3W1HA 2Z9UA 1XI9A 2CH1A 3LVLB 1SZSA 3FVUA 4R5FA 3N4SA 1KL2A 4Q75A 1CS1A 3NDNA 1OXOA 2TPLA 2Z61A 1TOIA 2AY4A 3EI7A 2OKJA 1ELQA 3KKIA 1CL1A 1TASA 2BWOA 3N5MA 5EAAA 3ZRRA 1TARA 1V2FA 1Z3ZA 4A6UA 1WYUB 3WX9A 1X2AA 1C0NA 2HUFA 5EUNA 1WYTB 1ASLA 2HP1A 2OATA 3RBFA 5EIGA 1MDZA 4JEWA 3TATA 2ORDA 4IX8A 1C7NA 3N4XA 4W1VA 2AEUA 1N2TA 4XJMA 1N8PA 1G4VA 2E54A 1EJIA 1GC4A 2O0RA 2Q7WA 2VMTA 3BCAA 2R5EA 4ADCA 4CXRA 2VMZA 4Q76A 2BI2A 3QHXA 2GMUA 4JEZA 3MAFB 2FNIA 3GETA 4W8IA 5HXXA 1I29A 1CQ7A 5C6UA 3W1JA 4WXGA 2BHXA 2W7DA 5G09A 2QMAA 3FFHA 4WYAA 2YCTA 4MQPA 4AOAA 5IWQA 4RKCA 3EUCA 1AY4A 3FVXA 2HORA 2PB2A 3JWBA 4ZSWA 3EI8A 4N0WA 4EU1A 5BJ3A 3WZFA 1YJYA 2OGAA 4R8DA 1W7NA 2V0YA 3ZRPA 5FT5A 1AJSA 1M6SA 3NUIA 1BJWA 1H1CA 1TOJA 2X5FA 3MC6A 4K2BA 5FT6A 2Z9XA 3NYUA 4Y0HA 1LKCA 2CFBA 3DXWA 4GE4A 1AJRA 3GZDC 4GDYA 1AHYA 4RM1A 3ECDA 3KGWA 4ZASA 3G0TA 4WYFA 2Z1YA 2JJHA 1W3UA 3DXVA 4JE5D 3FKDA 1YIZA 1EG5A 2AY8A 4LNLA 1DJEA 1X29A 1ZODA 2D61A 2VIAA 4R2NA 5G0AA 3FZ7A 3A9ZA 1WKHA 2ZY4A 3QPGA 1TOGA 4H63Q 1H0CA 4GE9A 1TATA 2F8JA 2VGVA 2W8JA 2EO5A 1G7XA 1IX7A 4ADBA 1KKJA 1GEXA 1I43A 2DGKA 2BI1A 3N0LA 2DKJA 2JJFA 2C81A 3ASAA 2ZP7A 5E5IA 5M46A 2VMUA 3EIBA 2FN6A 4RLGA 3GSBA 2AY6A 3H7FA 3A9YA 1D7VA 2HOZA 1BT4A 2VI9A 3DR7A 3DU4A 4E3RA 4ZM4A 1KKPA 4B9BA 1AY8A 3PIUA 3PD6A 4ZDPA 1CJ0A 2XBNA 3ZZKA 2EYQA 5EFSA 1KMKA 2VMQA 3II0A 3CQ5A 1GDEA 1GEWA 2CJHA 2VMNA 4Y0DA 4CXQA 1C9CA 1YJZA 1BJOA 2VMYA 4M2KA 4N0BA 3KE3A 4W91A 2BYLA 4AZKA 1LS3A 2YCNA 4F4EA 1AICA 2KFPA 2VGWA 3MEBA 3EZ1A 4EFFA 1GC3A 2DR1A 2ZY3A 3E2ZA 3A2BA 1AKCA 1IX8A 5M49A 4OC9A 3H9XA 4AH3A 4JEXA 3F6TA 3HDOA 2DOUA 4KYOA 1QJ3A 2AY5A 3RCHA 3WKSA 2VMVA 3BWNA 2ZJGA 1DGDA 3B1DA 3I4JA 3I5TA 4J8LA 2EH6A 2W7FA 3E77A 1J04A 4MKJA 9AATA 1O62A 2X3LA 4ZLVA 1RV3A 2BIEA 5G4JA 1B5PA 1FG7A 3EI5A 1OATA 1LC8A 3AEMC 4B98A 3MBBA 3TCMA 4RJYA 3RUYA 3QGUA 1AMSA 4MQRA 1BQDA 2GMSA 3WGCA 1SFFA 1SF2A 3DZZA 3NRAA 1PFFA 3AOVA 4ZWVA 5F9SA 1DFOA 1OXPA 4BHDA 3JWAA 4OCAA 4BMKA 4JF1A 2G7JA 3AOWA 3QM2A 1ZC9A 3GZCA 4PVFA 3VK3A 1Y4IA 3WKRA 1ARGA 4I8AA 1PMOA 4BA5A 4A0GA 2JG2A 3RCHB 3CBFA 1TOEA 1T3IA 4W1WA 3WLXA 4LW4A 2Z20A 3I16A 3B8XA 1S06A 3E2ZB 5G2PA 1MAQA 1ZOBA 3AELA 4DQ6A 1CQ6A 4PFNA 2JJEA 2FQ6A 4WYDA 2HP2A 3G8MA 1S0AA 1CQ8A 2W7GA 3K40A 5BJ4A 4UQVA 1BJOB 1WSTA 2Z9VA 2BI5A 1V72A 3UWCA 1MDOA 1YAAA 2D64A 1SVVA 4TV7A 4M2MA 3PD6B 1O4SA 2EZ2A 4DBCA 1QJ5A 2ZUKA 4FFCA 4E77A 5E3KA 1DGEA 4OBUA 1TOKA 4IW7A 2VGZA 3FRKA 4M2JA 3RI6A 4GE7A 4OTLA 2C0RA 1BJNA 1IX6A 4F5GA 3P1TA 1GCKA 2D63A 3DC1A 2DGLA 2E7UA 2NMPA 1QITA 4WYEA 4EMYA 3BCBA 4JF0A 5E4ZA 4R5ZA 2O7CA 2OGEA 5DJ9A 3EI9A 1XEYA 3FQAA 2EGYA 2FYFA 4WD2A 3GZDA 3TFUA 2VMSA 2AY3A 3LVJA 5EQCA 3P6KA 3PDXA 1ARIA 8AATA 4BA4A 2X8UA 1AY5A 2QB2A 3PA9A 4L0OA 3LV2A 1LW4A 1QISA 2YKYA 3T32A 1B8GA 1RV4A 5FT4A 1RVUA 1BJ4A 3GR9A 3BN1A 3AEJC 3GBXA 2BKWA 1QGNA 1PG8A 3L44A 3FDDA 4NOGA 2D5YA 2VI8A 3R9AA 1N31A 3UAKA 2QBTA 4J5UA 2E7IA 1S09A 2AY1A 2WKAA 3NTJA 2YRIA 3ACZA 2VGSA 4P3MA 3NX3A 1B9HA 4AZJA 1AJSB 3ZZJA 2VYCA 2BYJA 5EAVA 4MKKA 2O1BA 4EB7A 4Y0IA 4A72A 1AHGA 1G4XA 2HZPA 4UHNA 5F8VA 4KXKA 3EZSA 2CY8A 3CQ4A 1LK9A 4F5MA 3LY1A 4RJ0A 4IY7A 3MAFA 3Q8NA 3FQ7A 4K2MA 3ASBA 3W1IA 1IJIA 1W23A 3IHJA 2HOYA 1ARSA 3MADA 1BW0A 1GBNA 4A6RA 1D7UA 1ASDA 2OQXA 1I41A 1CL2A 4HVKA 3B46A 2BIGA 2DKBA 2CANA 3E6GA 5G4IA 2BWPA 3CQ6A 5EIGB 4RAEA 1S08A 2JJGA 4XAUA 1WYTA 1P3WA 3E9KA 4ADEA 1B9IA 1WYUA 3PGYA 2W8UA 3QN6A 3VK4A 4WLHA 1WKGA 4GRXA 4F5FA 1Z7DA 2C7TA 1UKJA 2W7LA 3F0HA 1M4NA 3B1CA 5M4BA 1FG3A 2YKUA 4RITA 4ZAHA 3FTBA 3TQXA 1IVRA 4WLJA 4WYGA 1VJOA 3LWSA 2DGMA 4ITGA 4TN4A 3WGBA 2RFVA 2VMPA 1DJUA 3AEJA 1C4KA 4H51A 2VIBA 4EB5A 1ASNA 1CZEA 3MKJA 4MY5A 1AIBA 2X5DA 3OP7A 2QLRA 2Z1ZA 3BC8A 1MLYA 2VGUA 5TF5A 3K7YA 4E1OA 1X28A 1LC5A 3A9XA 4GSAA 1SZUA 2AATA 3FD0A 5AX8A 2PB0A 4W1XA 2AEVA 1ORDA 2EZ1A 3AEPA 1S07A 2E7JA 5FT8A 1TPLA 5EUDA 3VAXA 1ASBA 1GEYA 3FZ8A 2D7YA 3NUBA 2R2NA 3H14A 1JG8A 2VMWA 2W8TA 2YHKA 3CAIA 1YJSA 2VMRA 3E2FA 3NYTA 2ZSLA 1I48A 4Q31A 4XEWA 1MAPA 3UE8A 2BI9A 5G2QA 3NNKA 4XJOA 1LW5A 2CJDA 1D7SA 2D66A 1WYVB 2VMOA 3DODA 2ZYJA 1YOOA 4A0RA 2HUIA 1ASAA 1SPAA 3FSLA 5EUEA 3BCXA 2AY9A 3RBLA 2ZY5A 1AAWA 1FC4A 4WXBA 1BS0A 3EI6A 3EIAA 3FQ8A 1M7YA 1AIAA 3USFA 3ZRQA 1J32A 4F5HA 4JEVA 2A1VA 1JS6A 1VP4A 1X0MA 1JF9A 3KGXA 4IXOA 3DRDA 3JU7A 1MLZA 1AKAA 1KL1A 2JGTA 3E2YA 4RIZA 1AMRA 2QSRA 1GC0A 2D65A 3N75A 1ARHA 4ATPA 4ZM3A 1B4XA 3VK2A 2GB3A 4IYOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZY2 A;  3NU8 A;  4ISY A;  1MDX A;  1U08 A;  1UU1 A;  2W7J A;  4LNM A;  2BWN A;  3HMU A;  4A6T A;  2AY2 A;  4A0F A;  1C7G A;  2WK9 A;  2QB3 A;  4ZWM A;  1JS3 A;  2R0T A;  2VLH A;  5HDM A;  4QGR A;  1M0O A;  2CTZ A;  1E5F A;  2WK8 A;  4WB0 A;  3HVY A;  3WY7 A;  2GQN A;  3FCR A;  3LG0 A;  3VOM A;  5J8Q A;  1IAX A;  1ASM A;  1GC2 A;  4AO4 A;  3BB8 A;  2Z9W A;  7AAT A;  3BS8 A;  4KAM A;  4A0H A;  2HOX A;  3AEO A;  1PMM A;  1SZK A;  4XJL A;  2R5C B;  4IXZ A;  2CB1 A;  4U2H A;  4F5J A;  3PDB A;  2W8V A;  3NU7 A;  4XK1 A;  4WXF A;  2W7H A;  4F5I A;  3WCN A;  5I92 A;  1OHV A;  1B5O A;  3COG A;  1O61 A;  1OHW A;  4LC3 A;  3AV7 A;  1D2F A;  2Z67 A;  4OMA A;  3AEN B;  4E3Q A;  3HL2 A;  4HF8 A;  2EPJ A;  4JE5 A;  3HT4 A;  3MAU A;  1ART A;  2CST A;  5DB5 A;  1VEF A;  1BQA A;  3DR4 A;  3MC6 C;  4JEY A;  2W7M A;  1AMA A;  2FNU A;  3ISL A;  3JW9 A;  2CIN A;  4CVQ A;  2GSA A;  1EQB A;  4K2I A;  2W7K A;  1V2D A;  4RKD A;  4IXS A;  4ZDO A;  3GWP A;  1IBJ A;  3D6K A;  2YRR A;  3L8A A;  4O6Z A;  4OT8 A;  3FVS A;  4ZSY A;  3R4T A;  5LHA A;  2BIA A;  2YOB A;  3AEN A;  3QBO A;  4Q6R A;  3AEM A;  3TFT A;  2ZC0 A;  3PPL A;  4CBS A;  2FM1 A;  3B1E A;  1M0P A;  1O69 A;  2AY7 A;  3PDB B;  4OYT A;  3RQ1 A;  3VP6 A;  1DTY A;  1OHY A;  2D7Z A;  1AAM A;  4FL0 A;  1BKG A;  2R5C A;  2VMX A;  3HLM A;  4WYC A;  4WP0 A;  5JAY A;  1MGV A;  3LVK A;  4MGR A;  1C7O A;  2CH2 A;  2CJG A;  1W7M A;  2YKX A;  4PFF A;  4A00 A;  5LH9 A;  1ASE A;  1RVY A;  4WB0 B;  3FDB A;  1AHX A;  1IUG A;  3WCO A;  5K8B A;  1AHE A;  5D95 A;  4XQ2 A;  4F5K A;  3PAA A;  1QZ9 A;  1V2E A;  2XH1 A;  4LNJ A;  4UHO A;  2HUU A;  1M32 A;  1M0Q A;  4F5L A;  3HBX A;  2OKK A;  2WK7 A;  3BWO A;  4AO9 A;  1ASC A;  1DKA A;  4IYO B;  3PJ0 A;  3JZL A;  5D5S A;  5DX5 A;  4ITX A;  4ZDL A;  2VLF A;  3BV0 A;  3NYS A;  1AKB A;  3G7Q A;  4CBR A;  4LW2 A;  2V1P A;  4TMR A;  3ELP A;  4MQQ A;  3ELE A;  3K28 A;  3F9T A;  4UHM A;  3GJU A;  2QA3 A;  1ASG A;  1ECX A;  1UU2 A;  4BQ0 A;  1DJ9 A;  3ATH A;  2VGT A;  1M0N A;  1QIR A;  1LC7 A;  3QI6 A;  1WYV A;  3FFR A;  1IAY A;  1YNU A;  3FZ6 A;  4PIW A;  1E5E A;  4MSO A;  5DJ1 A;  1ASF A;  1YIY A;  3A8U X;  2C44 A;  2W7I A;  2BI3 A;  4ADD A;  4W5K A;  1AHF A;  1D7R A;  1KMJ A;  3BWN C;  4GEB A;  3AAT A;  4OBV A;  3M5U A;  1GD9 A;  1UU0 A;  2PO3 A;  4WBT A;  1AX4 A;  2JIS A;  2YKV A;  5M4D A;  4ATQ A;  4DGT A;  2W8W A;  4UOY A;  3DYD A;  3JTX A;  1AMQ A;  2ZSM A;  4XJP A;  1ELU A;  1CZC A;  4U1T A;  2YCP A;  5HHY A;  1W7L A;  1G7W A;  4P7Y A;  2G6W A;  3HQT A;  3IF2 A;  3OKS A;  2W7E A;  3LVM A;  3W1H A;  2Z9U A;  1XI9 A;  2CH1 A;  3LVL B;  1SZS A;  3FVU A;  4R5F A;  1KL2 A;  4Q75 A;  1CS1 A;  3NDN A;  1OXO A;  2TPL A;  2Z61 A;  1TOI A;  2AY4 A;  3EI7 A;  2OKJ A;  1ELQ A;  3KKI A;  1CL1 A;  1TAS A;  2BWO A;  3N5M A;  5EAA A;  3ZRR A;  1TAR A;  1V2F A;  1Z3Z A;  4A6U A;  1WYU B;  3WX9 A;  1X2A A;  1C0N A;  2HUF A;  5EUN A;  1WYT B;  1ASL A;  2HP1 A;  2OAT A;  3RBF A;  5EIG A;  1MDZ A;  4JEW A;  3TAT A;  2ORD A;  4IX8 A;  1C7N A;  4W1V A;  2AEU A;  1N2T A;  4XJM A;  1N8P A;  1G4V A;  2E54 A;  1EJI A;  1GC4 A;  2O0R A;  2Q7W A;  2VMT A;  3BCA A;  2R5E A;  4ADC A;  4CXR A;  2VMZ A;  4Q76 A;  2BI2 A;  3QHX A;  2GMU A;  4JEZ A;  3MAF B;  2FNI A;  3GET A;  4W8I A;  5HXX A;  1I29 A;  1CQ7 A;  5C6U A;  3W1J A;  4WXG A;  2BHX A;  2W7D A;  5G09 A;  2QMA A;  3FFH A;  4WYA A;  2YCT A;  4MQP A;  4AOA A;  5IWQ A;  4RKC A;  3EUC A;  1AY4 A;  3FVX A;  2HOR A;  2PB2 A;  3JWB A;  4ZSW A;  3EI8 A;  4N0W A;  4EU1 A;  5BJ3 A;  3WZF A;  1YJY A;  2OGA A;  4R8D A;  1W7N A;  2V0Y A;  3ZRP A;  5FT5 A;  1AJS A;  1M6S A;  3NUI A;  1BJW A;  1H1C A;  1TOJ A;  2X5F A;  3MC6 A;  4K2B A;  5FT6 A;  2Z9X A;  3NYU A;  4Y0H A;  1LKC A;  2CFB A;  3DXW A;  4GE4 A;  1AJR A;  3GZD C;  4GDY A;  1AHY A;  4RM1 A;  3ECD A;  3KGW A;  4ZAS A;  3G0T A;  4WYF A;  2Z1Y A;  2JJH A;  1W3U A;  3DXV A;  4JE5 D;  3FKD A;  1YIZ A;  1EG5 A;  2AY8 A;  4LNL A;  1DJE A;  1X29 A;  1ZOD A;  2D61 A;  2VIA A;  4R2N A;  5G0A A;  3FZ7 A;  3A9Z A;  1WKH A;  2ZY4 A;  3QPG A;  1TOG A;  1H0C A;  4GE9 A;  1TAT A;  2F8J A;  2VGV A;  2W8J A;  2EO5 A;  1G7X A;  1IX7 A;  4ADB A;  1KKJ A;  1GEX A;  1I43 A;  2DGK A;  2BI1 A;  3N0L A;  2DKJ A;  2JJF A;  2C81 A;  3ASA A;  2ZP7 A;  5E5I A;  5M46 A;  2VMU A;  3EIB A;  2FN6 A;  4RLG A;  3GSB A;  2AY6 A;  3H7F A;  3A9Y A;  1D7V A;  2HOZ A;  1BT4 A;  2VI9 A;  3DR7 A;  3DU4 A;  4E3R A;  4ZM4 A;  1KKP A;  4B9B A;  1AY8 A;  3PIU A;  3PD6 A;  4ZDP A;  1CJ0 A;  2XBN A;  3ZZK A;  5EFS A;  1KMK A;  2VMQ A;  3II0 A;  3CQ5 A;  1GDE A;  1GEW A;  2CJH A;  2VMN A;  4Y0D A;  4CXQ A;  1C9C A;  1YJZ A;  1BJO A;  2VMY A;  4M2K A;  4N0B A;  3KE3 A;  4W91 A;  2BYL A;  4AZK A;  1LS3 A;  2YCN A;  4F4E A;  1AIC A;  2VGW A;  3MEB A;  3EZ1 A;  4EFF A;  1GC3 A;  2DR1 A;  2ZY3 A;  3E2Z A;  3A2B A;  1AKC A;  1IX8 A;  5M49 A;  4OC9 A;  4AH3 A;  4JEX A;  3F6T A;  3HDO A;  2DOU A;  4KYO A;  1QJ3 A;  2AY5 A;  3RCH A;  3WKS A;  2VMV A;  3BWN A;  2ZJG A;  1DGD A;  3B1D A;  3I4J A;  3I5T A;  4J8L A;  2EH6 A;  2W7F A;  3E77 A;  1J04 A;  4MKJ A;  9AAT A;  1O62 A;  2X3L A;  4ZLV A;  1RV3 A;  2BIE A;  5G4J A;  1B5P A;  1FG7 A;  3EI5 A;  1OAT A;  1LC8 A;  3AEM C;  4B98 A;  3MBB A;  3TCM A;  4RJY A;  3RUY A;  3QGU A;  1AMS A;  4MQR A;  1BQD A;  2GMS A;  3WGC A;  1SFF A;  1SF2 A;  3DZZ A;  3NRA A;  1PFF A;  3AOV A;  4ZWV A;  5F9S A;  1DFO A;  1OXP A;  4BHD A;  3JWA A;  4OCA A;  4BMK A;  4JF1 A;  3AOW A;  3QM2 A;  1ZC9 A;  3GZC A;  4PVF A;  3VK3 A;  1Y4I A;  3WKR A;  1ARG A;  4I8A A;  1PMO A;  4BA5 A;  4A0G A;  2JG2 A;  3RCH B;  3CBF A;  1TOE A;  1T3I A;  4W1W A;  3WLX A;  4LW4 A;  2Z20 A;  3I16 A;  3B8X A;  1S06 A;  3E2Z B;  5G2P A;  1MAQ A;  1ZOB A;  3AEL A;  4DQ6 A;  1CQ6 A;  4PFN A;  2JJE A;  2FQ6 A;  4WYD A;  2HP2 A;  3G8M A;  1S0A A;  1CQ8 A;  2W7G A;  3K40 A;  5BJ4 A;  4UQV A;  1BJO B;  1WST A;  2Z9V A;  2BI5 A;  1V72 A;  3UWC A;  1MDO A;  1YAA A;  2D64 A;  1SVV A;  4TV7 A;  4M2M A;  3PD6 B;  1O4S A;  2EZ2 A;  4DBC A;  1QJ5 A;  2ZUK A;  4FFC A;  4E77 A;  5E3K A;  1DGE A;  4OBU A;  1TOK A;  4IW7 A;  2VGZ A;  3FRK A;  4M2J A;  3RI6 A;  4GE7 A;  4OTL A;  2C0R A;  1BJN A;  1IX6 A;  4F5G A;  3P1T A;  1GCK A;  2D63 A;  3DC1 A;  2DGL A;  2E7U A;  2NMP A;  1QIT A;  4WYE A;  4EMY A;  3BCB A;  4JF0 A;  5E4Z A;  4R5Z A;  2O7C A;  2OGE A;  5DJ9 A;  3EI9 A;  1XEY A;  3FQA A;  2EGY A;  2FYF A;  4WD2 A;  3GZD A;  3TFU A;  2VMS A;  2AY3 A;  3LVJ A;  5EQC A;  3P6K A;  3PDX A;  1ARI A;  8AAT A;  4BA4 A;  2X8U A;  1AY5 A;  2QB2 A;  3PA9 A;  4L0O A;  3LV2 A;  1LW4 A;  1QIS A;  2YKY A;  3T32 A;  1B8G A;  1RV4 A;  5FT4 A;  1RVU A;  1BJ4 A;  3GR9 A;  3BN1 A;  3AEJ C;  3GBX A;  2BKW A;  1QGN A;  1PG8 A;  3L44 A;  3FDD A;  4NOG A;  2D5Y A;  2VI8 A;  3R9A A;  1N31 A;  3UAK A;  2QBT A;  4J5U A;  2E7I A;  1S09 A;  2AY1 A;  2WKA A;  3NTJ A;  2YRI A;  3ACZ A;  2VGS A;  4P3M A;  3NX3 A;  1B9H A;  4AZJ A;  1AJS B;  3ZZJ A;  2VYC A;  2BYJ A;  5EAV A;  4MKK A;  2O1B A;  4EB7 A;  4Y0I A;  4A72 A;  1AHG A;  1G4X A;  2HZP A;  4UHN A;  5F8V A;  4KXK A;  3EZS A;  2CY8 A;  3CQ4 A;  1LK9 A;  4F5M A;  3LY1 A;  4RJ0 A;  4IY7 A;  3MAF A;  3Q8N A;  3FQ7 A;  4K2M A;  3ASB A;  3W1I A;  1IJI A;  1W23 A;  3IHJ A;  2HOY A;  1ARS A;  3MAD A;  1BW0 A;  1GBN A;  4A6R A;  1D7U A;  1ASD A;  2OQX A;  1I41 A;  1CL2 A;  4HVK A;  3B46 A;  2BIG A;  2DKB A;  2CAN A;  3E6G A;  5G4I A;  2BWP A;  3CQ6 A;  5EIG B;  4RAE A;  1S08 A;  2JJG A;  4XAU A;  1WYT A;  1P3W A;  3E9K A;  4ADE A;  1B9I A;  1WYU A;  3PGY A;  2W8U A;  3QN6 A;  3VK4 A;  4WLH A;  1WKG A;  4GRX A;  4F5F A;  1Z7D A;  2C7T A;  1UKJ A;  2W7L A;  3F0H A;  1M4N A;  3B1C A;  5M4B A;  1FG3 A;  2YKU A;  4RIT A;  4ZAH A;  3FTB A;  3TQX A;  1IVR A;  4WLJ A;  4WYG A;  1VJO A;  3LWS A;  2DGM A;  4ITG A;  4TN4 A;  3WGB A;  2RFV A;  2VMP A;  1DJU A;  3AEJ A;  1C4K A;  4H51 A;  2VIB A;  4EB5 A;  1ASN A;  1CZE A;  3MKJ A;  4MY5 A;  1AIB A;  2X5D A;  3OP7 A;  2QLR A;  2Z1Z A;  3BC8 A;  1MLY A;  2VGU A;  5TF5 A;  3K7Y A;  4E1O A;  1X28 A;  1LC5 A;  3A9X A;  4GSA A;  1SZU A;  2AAT A;  3FD0 A;  5AX8 A;  2PB0 A;  4W1X A;  2AEV A;  1ORD A;  2EZ1 A;  3AEP A;  1S07 A;  2E7J A;  5FT8 A;  1TPL A;  5EUD A;  3VAX A;  1ASB A;  1GEY A;  3FZ8 A;  2D7Y A;  3NUB A;  2R2N A;  3H14 A;  1JG8 A;  2VMW A;  2W8T A;  2YHK A;  3CAI A;  1YJS A;  2VMR A;  3E2F A;  3NYT A;  2ZSL A;  1I48 A;  4Q31 A;  4XEW A;  1MAP A;  3UE8 A;  2BI9 A;  5G2Q A;  3NNK A;  4XJO A;  1LW5 A;  2CJD A;  1D7S A;  2D66 A;  1WYV B;  2VMO A;  3DOD A;  2ZYJ A;  1YOO A;  4A0R A;  2HUI A;  1ASA A;  1SPA A;  3FSL A;  5EUE A;  3BCX A;  2AY9 A;  3RBL A;  2ZY5 A;  1AAW A;  1FC4 A;  4WXB A;  1BS0 A;  3EI6 A;  3EIA A;  3FQ8 A;  1M7Y A;  1AIA A;  3USF A;  3ZRQ A;  1J32 A;  4F5H A;  4JEV A;  1JS6 A;  1VP4 A;  1X0M A;  1JF9 A;  3KGX A;  4IXO A;  3DRD A;  3JU7 A;  1MLZ A;  1AKA A;  1KL1 A;  2JGT A;  3E2Y A;  4RIZ A;  1AMR A;  1GC0 A;  2D65 A;  3N75 A;  1ARH A;  4ATP A;  4ZM3 A;  1B4X A;  3VK2 A;  2GB3 A;  4IYO A; 
#chains in the Genus database with same CATH topology
 2ZY2 A;  3NU8 A;  4ISY A;  1MDX A;  1U08 A;  2FKI A;  1UU1 A;  2W7J A;  4LNM A;  2BWN A;  3HMU A;  4A6T A;  2AY2 A;  4A0F A;  1C7G A;  2WK9 A;  2QB3 A;  4ZWM A;  1JS3 A;  2R0T A;  2VLH A;  5HDM A;  4QGR A;  1M0O A;  2CTZ A;  1E5F A;  2WK8 A;  4WB0 A;  3HVY A;  3WY7 A;  2GQN A;  3FCR A;  3LG0 A;  3VOM A;  5J8Q A;  1IAX A;  1ASM A;  1GC2 A;  4AO4 A;  3BB8 A;  2Z9W A;  7AAT A;  1KAF A;  3BS8 A;  4KAM A;  4A0H A;  2HOX A;  3AEO A;  1PMM A;  1SZK A;  4XJL A;  2R5C B;  4IXZ A;  2CB1 A;  4U2H A;  4F5J A;  3PDB A;  2W8V A;  3NU7 A;  4XK1 A;  4WXF A;  2W7H A;  4F5I A;  3WCN A;  5I92 A;  1OHV A;  1B5O A;  3COG A;  1O61 A;  1OHW A;  4LC3 A;  3AV7 A;  1D2F A;  2Z67 A;  4OMA A;  3AEN B;  4E3Q A;  3HL2 A;  4HF8 A;  2EPJ A;  4JE5 A;  3HT4 A;  3MAU A;  1ART A;  2CST A;  5DB5 A;  1VEF A;  1BQA A;  3DR4 A;  3MC6 C;  4JEY A;  2W7M A;  1AMA A;  2FNU A;  3ISL A;  3JW9 A;  2CIN A;  4CVQ A;  2GSA A;  1EQB A;  4K2I A;  2W7K A;  1V2D A;  4RKD A;  4IXS A;  4ZDO A;  3GWP A;  1IBJ A;  3D6K A;  2YRR A;  3L8A A;  4O6Z A;  4OT8 A;  3FVS A;  4ZSY A;  3R4T A;  5LHA A;  2BIA A;  2YOB A;  3AEN A;  3QBO A;  4Q6R A;  3AEM A;  3TFT A;  2ZC0 A;  3PPL A;  4CBS A;  2FM1 A;  3B1E A;  1M0P A;  1O69 A;  2AY7 A;  3PDB B;  4OYT A;  3RQ1 A;  3VP6 A;  1DTY A;  1OHY A;  2D7Z A;  1AAM A;  4FL0 A;  1BKG A;  2R5C A;  2VMX A;  3HLM A;  4WYC A;  4WP0 A;  5JAY A;  1MGV A;  3LVK A;  4MGR A;  1C7O A;  2CH2 A;  2CJG A;  1W7M A;  2YKX A;  3N4R A;  4PFF A;  4A00 A;  5LH9 A;  1ASE A;  1RVY A;  4WB0 B;  3FDB A;  1AHX A;  1IUG A;  3WCO A;  5K8B A;  1AHE A;  5D95 A;  4XQ2 A;  4F5K A;  3PAA A;  1QZ9 A;  1V2E A;  2XH1 A;  4LNJ A;  4UHO A;  2HUU A;  1M32 A;  1M0Q A;  4F5L A;  3HBX A;  2OKK A;  2WK7 A;  3BWO A;  4AO9 A;  1ASC A;  1DKA A;  4IYO B;  3PJ0 A;  3JZL A;  5D5S A;  5DX5 A;  4ITX A;  4ZDL A;  2VLF A;  3BV0 A;  3NYS A;  1AKB A;  3G7Q A;  4CBR A;  4LW2 A;  2V1P A;  4TMR A;  3ELP A;  4MQQ A;  3ELE A;  3K28 A;  3F9T A;  4UHM A;  3GJU A;  2QA3 A;  1ASG A;  1ECX A;  1UU2 A;  4BQ0 A;  4K05 A;  1DJ9 A;  3ATH A;  2VGT A;  1M0N A;  1QIR A;  1LC7 A;  3QI6 A;  1WYV A;  3FFR A;  1IAY A;  1YNU A;  3FZ6 A;  4PIW A;  1E5E A;  4MSO A;  5DJ1 A;  1ASF A;  1YIY A;  3A8U X;  2C44 A;  2W7I A;  2BI3 A;  4ADD A;  4W5K A;  1AHF A;  1D7R A;  1KMJ A;  3BWN C;  5KTB A;  4GEB A;  3AAT A;  4OBV A;  3M5U A;  3N7N A;  1GD9 A;  1UU0 A;  2PO3 A;  4WBT A;  1AX4 A;  2JIS A;  2YKV A;  5M4D A;  4ATQ A;  4DGT A;  2W8W A;  4UOY A;  2WB6 A;  3DYD A;  3JTX A;  1AMQ A;  2ZSM A;  4XJP A;  1ELU A;  1CZC A;  4U1T A;  2YCP A;  5HHY A;  1W7L A;  1G7W A;  4P7Y A;  2G6W A;  3HQT A;  3IF2 A;  3OKS A;  2W7E A;  3LVM A;  3W1H A;  2Z9U A;  1XI9 A;  2CH1 A;  3LVL B;  1SZS A;  3FVU A;  4R5F A;  3N4S A;  1KL2 A;  4Q75 A;  1CS1 A;  3NDN A;  1OXO A;  2TPL A;  2Z61 A;  1TOI A;  2AY4 A;  3EI7 A;  2OKJ A;  1ELQ A;  3KKI A;  1CL1 A;  1TAS A;  2BWO A;  3N5M A;  5EAA A;  3ZRR A;  1TAR A;  1V2F A;  1Z3Z A;  4A6U A;  1WYU B;  3WX9 A;  1X2A A;  1C0N A;  2HUF A;  5EUN A;  1WYT B;  1ASL A;  2HP1 A;  2OAT A;  3RBF A;  5EIG A;  1MDZ A;  4JEW A;  3TAT A;  2ORD A;  4IX8 A;  1C7N A;  3N4X A;  4W1V A;  2AEU A;  1N2T A;  4XJM A;  1N8P A;  1G4V A;  2E54 A;  1EJI A;  1GC4 A;  2O0R A;  2Q7W A;  2VMT A;  3BCA A;  2R5E A;  4ADC A;  4CXR A;  2VMZ A;  4Q76 A;  2BI2 A;  3QHX A;  2GMU A;  4JEZ A;  3MAF B;  2FNI A;  3GET A;  4W8I A;  5HXX A;  1I29 A;  1CQ7 A;  5C6U A;  3W1J A;  4WXG A;  2BHX A;  2W7D A;  5G09 A;  2QMA A;  3FFH A;  4WYA A;  2YCT A;  4MQP A;  4AOA A;  5IWQ A;  4RKC A;  3EUC A;  1AY4 A;  3FVX A;  2HOR A;  2PB2 A;  3JWB A;  4ZSW A;  3EI8 A;  4N0W A;  4EU1 A;  5BJ3 A;  3WZF A;  1YJY A;  2OGA A;  4R8D A;  1W7N A;  2V0Y A;  3ZRP A;  5FT5 A;  1AJS A;  1M6S A;  3NUI A;  1BJW A;  1H1C A;  1TOJ A;  2X5F A;  3MC6 A;  4K2B A;  5FT6 A;  2Z9X A;  3NYU A;  4Y0H A;  1LKC A;  2CFB A;  3DXW A;  4GE4 A;  1AJR A;  3GZD C;  4GDY A;  1AHY A;  4RM1 A;  3ECD A;  3KGW A;  4ZAS A;  3G0T A;  4WYF A;  2Z1Y A;  2JJH A;  1W3U A;  3DXV A;  4JE5 D;  3FKD A;  1YIZ A;  1EG5 A;  2AY8 A;  4LNL A;  1DJE A;  1X29 A;  1ZOD A;  2D61 A;  2VIA A;  4R2N A;  5G0A A;  3FZ7 A;  3A9Z A;  1WKH A;  2ZY4 A;  3QPG A;  1TOG A;  4H63 Q;  1H0C A;  4GE9 A;  1TAT A;  2F8J A;  2VGV A;  2W8J A;  2EO5 A;  1G7X A;  1IX7 A;  4ADB A;  1KKJ A;  1GEX A;  1I43 A;  2DGK A;  2BI1 A;  3N0L A;  2DKJ A;  2JJF A;  2C81 A;  3ASA A;  2ZP7 A;  5E5I A;  5M46 A;  2VMU A;  3EIB A;  2FN6 A;  4RLG A;  3GSB A;  2AY6 A;  3H7F A;  3A9Y A;  1D7V A;  2HOZ A;  1BT4 A;  2VI9 A;  3DR7 A;  3DU4 A;  4E3R A;  4ZM4 A;  1KKP A;  4B9B A;  1AY8 A;  3PIU A;  3PD6 A;  4ZDP A;  1CJ0 A;  2XBN A;  3ZZK A;  2EYQ A;  5EFS A;  1KMK A;  2VMQ A;  3II0 A;  3CQ5 A;  1GDE A;  1GEW A;  2CJH A;  2VMN A;  4Y0D A;  4CXQ A;  1C9C A;  1YJZ A;  1BJO A;  2VMY A;  4M2K A;  4N0B A;  3KE3 A;  4W91 A;  2BYL A;  4AZK A;  1LS3 A;  2YCN A;  4F4E A;  1AIC A;  2KFP A;  2VGW A;  3MEB A;  3EZ1 A;  4EFF A;  1GC3 A;  2DR1 A;  2ZY3 A;  3E2Z A;  3A2B A;  1AKC A;  1IX8 A;  5M49 A;  4OC9 A;  3H9X A;  4AH3 A;  4JEX A;  3F6T A;  3HDO A;  2DOU A;  4KYO A;  1QJ3 A;  2AY5 A;  3RCH A;  3WKS A;  2VMV A;  3BWN A;  2ZJG A;  1DGD A;  3B1D A;  3I4J A;  3I5T A;  4J8L A;  2EH6 A;  2W7F A;  3E77 A;  1J04 A;  4MKJ A;  9AAT A;  1O62 A;  2X3L A;  4ZLV A;  1RV3 A;  2BIE A;  5G4J A;  1B5P A;  1FG7 A;  3EI5 A;  1OAT A;  1LC8 A;  3AEM C;  4B98 A;  3MBB A;  3TCM A;  4RJY A;  3RUY A;  3QGU A;  1AMS A;  4MQR A;  1BQD A;  2GMS A;  3WGC A;  1SFF A;  1SF2 A;  3DZZ A;  3NRA A;  1PFF A;  3AOV A;  4ZWV A;  5F9S A;  1DFO A;  1OXP A;  4BHD A;  3JWA A;  4OCA A;  4BMK A;  4JF1 A;  2G7J A;  3AOW A;  3QM2 A;  1ZC9 A;  3GZC A;  4PVF A;  3VK3 A;  1Y4I A;  3WKR A;  1ARG A;  4I8A A;  1PMO A;  4BA5 A;  4A0G A;  2JG2 A;  3RCH B;  3CBF A;  1TOE A;  1T3I A;  4W1W A;  3WLX A;  4LW4 A;  2Z20 A;  3I16 A;  3B8X A;  1S06 A;  3E2Z B;  5G2P A;  1MAQ A;  1ZOB A;  3AEL A;  4DQ6 A;  1CQ6 A;  4PFN A;  2JJE A;  2FQ6 A;  4WYD A;  2HP2 A;  3G8M A;  1S0A A;  1CQ8 A;  2W7G A;  3K40 A;  5BJ4 A;  4UQV A;  1BJO B;  1WST A;  2Z9V A;  2BI5 A;  1V72 A;  3UWC A;  1MDO A;  1YAA A;  2D64 A;  1SVV A;  4TV7 A;  4M2M A;  3PD6 B;  1O4S A;  2EZ2 A;  4DBC A;  1QJ5 A;  2ZUK A;  4FFC A;  4E77 A;  5E3K A;  1DGE A;  4OBU A;  1TOK A;  4IW7 A;  2VGZ A;  3FRK A;  4M2J A;  3RI6 A;  4GE7 A;  4OTL A;  2C0R A;  1BJN A;  1IX6 A;  4F5G A;  3P1T A;  1GCK A;  2D63 A;  3DC1 A;  2DGL A;  2E7U A;  2NMP A;  1QIT A;  4WYE A;  4EMY A;  3BCB A;  4JF0 A;  5E4Z A;  4R5Z A;  2O7C A;  2OGE A;  5DJ9 A;  3EI9 A;  1XEY A;  3FQA A;  2EGY A;  2FYF A;  4WD2 A;  3GZD A;  3TFU A;  2VMS A;  2AY3 A;  3LVJ A;  5EQC A;  3P6K A;  3PDX A;  1ARI A;  8AAT A;  4BA4 A;  2X8U A;  1AY5 A;  2QB2 A;  3PA9 A;  4L0O A;  3LV2 A;  1LW4 A;  1QIS A;  2YKY A;  3T32 A;  1B8G A;  1RV4 A;  5FT4 A;  1RVU A;  1BJ4 A;  3GR9 A;  3BN1 A;  3AEJ C;  3GBX A;  2BKW A;  1QGN A;  1PG8 A;  3L44 A;  3FDD A;  4NOG A;  2D5Y A;  2VI8 A;  3R9A A;  1N31 A;  3UAK A;  2QBT A;  4J5U A;  2E7I A;  1S09 A;  2AY1 A;  2WKA A;  3NTJ A;  2YRI A;  3ACZ A;  2VGS A;  4P3M A;  3NX3 A;  1B9H A;  4AZJ A;  1AJS B;  3ZZJ A;  2VYC A;  2BYJ A;  5EAV A;  4MKK A;  2O1B A;  4EB7 A;  4Y0I A;  4A72 A;  1AHG A;  1G4X A;  2HZP A;  4UHN A;  5F8V A;  4KXK A;  3EZS A;  2CY8 A;  3CQ4 A;  1LK9 A;  4F5M A;  3LY1 A;  4RJ0 A;  4IY7 A;  3MAF A;  3Q8N A;  3FQ7 A;  4K2M A;  3ASB A;  3W1I A;  1IJI A;  1W23 A;  3IHJ A;  2HOY A;  1ARS A;  3MAD A;  1BW0 A;  1GBN A;  4A6R A;  1D7U A;  1ASD A;  2OQX A;  1I41 A;  1CL2 A;  4HVK A;  3B46 A;  2BIG A;  2DKB A;  2CAN A;  3E6G A;  5G4I A;  2BWP A;  3CQ6 A;  5EIG B;  4RAE A;  1S08 A;  2JJG A;  4XAU A;  1WYT A;  1P3W A;  3E9K A;  4ADE A;  1B9I A;  1WYU A;  3PGY A;  2W8U A;  3QN6 A;  3VK4 A;  4WLH A;  1WKG A;  4GRX A;  4F5F A;  1Z7D A;  2C7T A;  1UKJ A;  2W7L A;  3F0H A;  1M4N A;  3B1C A;  5M4B A;  1FG3 A;  2YKU A;  4RIT A;  4ZAH A;  3FTB A;  3TQX A;  1IVR A;  4WLJ A;  4WYG A;  1VJO A;  3LWS A;  2DGM A;  4ITG A;  4TN4 A;  3WGB A;  2RFV A;  2VMP A;  1DJU A;  3AEJ A;  1C4K A;  4H51 A;  2VIB A;  4EB5 A;  1ASN A;  1CZE A;  3MKJ A;  4MY5 A;  1AIB A;  2X5D A;  3OP7 A;  2QLR A;  2Z1Z A;  3BC8 A;  1MLY A;  2VGU A;  5TF5 A;  3K7Y A;  4E1O A;  1X28 A;  1LC5 A;  3A9X A;  4GSA A;  1SZU A;  2AAT A;  3FD0 A;  5AX8 A;  2PB0 A;  4W1X A;  2AEV A;  1ORD A;  2EZ1 A;  3AEP A;  1S07 A;  2E7J A;  5FT8 A;  1TPL A;  5EUD A;  3VAX A;  1ASB A;  1GEY A;  3FZ8 A;  2D7Y A;  3NUB A;  2R2N A;  3H14 A;  1JG8 A;  2VMW A;  2W8T A;  2YHK A;  3CAI A;  1YJS A;  2VMR A;  3E2F A;  3NYT A;  2ZSL A;  1I48 A;  4Q31 A;  4XEW A;  1MAP A;  3UE8 A;  2BI9 A;  5G2Q A;  3NNK A;  4XJO A;  1LW5 A;  2CJD A;  1D7S A;  2D66 A;  1WYV B;  2VMO A;  3DOD A;  2ZYJ A;  1YOO A;  4A0R A;  2HUI A;  1ASA A;  1SPA A;  3FSL A;  5EUE A;  3BCX A;  2AY9 A;  3RBL A;  2ZY5 A;  1AAW A;  1FC4 A;  4WXB A;  1BS0 A;  3EI6 A;  3EIA A;  3FQ8 A;  1M7Y A;  1AIA A;  3USF A;  3ZRQ A;  1J32 A;  4F5H A;  4JEV A;  2A1V A;  1JS6 A;  1VP4 A;  1X0M A;  1JF9 A;  3KGX A;  4IXO A;  3DRD A;  3JU7 A;  1MLZ A;  1AKA A;  1KL1 A;  2JGT A;  3E2Y A;  4RIZ A;  1AMR A;  2QSR A;  1GC0 A;  2D65 A;  3N75 A;  1ARH A;  4ATP A;  4ZM3 A;  1B4X A;  3VK2 A;  2GB3 A;  4IYO A; 
#chains in the Genus database with same CATH homology
 2ZY2 A;  3NU8 A;  4ISY A;  1MDX A;  1U08 A;  2FKI A;  1UU1 A;  2W7J A;  4LNM A;  2BWN A;  3HMU A;  4A6T A;  2AY2 A;  4A0F A;  1C7G A;  2WK9 A;  2QB3 A;  4ZWM A;  1JS3 A;  2R0T A;  2VLH A;  5HDM A;  4QGR A;  1M0O A;  2CTZ A;  1E5F A;  2WK8 A;  4WB0 A;  3HVY A;  3WY7 A;  2GQN A;  3FCR A;  3LG0 A;  3VOM A;  5J8Q A;  1IAX A;  1ASM A;  1GC2 A;  4AO4 A;  3BB8 A;  2Z9W A;  7AAT A;  3BS8 A;  4KAM A;  4A0H A;  2HOX A;  3AEO A;  1PMM A;  1SZK A;  4XJL A;  2R5C B;  4IXZ A;  2CB1 A;  4U2H A;  4F5J A;  3PDB A;  2W8V A;  3NU7 A;  4XK1 A;  4WXF A;  2W7H A;  4F5I A;  3WCN A;  5I92 A;  1OHV A;  1B5O A;  3COG A;  1O61 A;  1OHW A;  4LC3 A;  3AV7 A;  1D2F A;  2Z67 A;  4OMA A;  3AEN B;  4E3Q A;  3HL2 A;  4HF8 A;  2EPJ A;  4JE5 A;  3HT4 A;  3MAU A;  1ART A;  2CST A;  5DB5 A;  1VEF A;  1BQA A;  3DR4 A;  3MC6 C;  4JEY A;  2W7M A;  1AMA A;  2FNU A;  3ISL A;  3JW9 A;  2CIN A;  4CVQ A;  2GSA A;  1EQB A;  4K2I A;  2W7K A;  1V2D A;  4RKD A;  4IXS A;  4ZDO A;  3GWP A;  1IBJ A;  3D6K A;  2YRR A;  3L8A A;  4O6Z A;  4OT8 A;  3FVS A;  4ZSY A;  3R4T A;  5LHA A;  2BIA A;  2YOB A;  3AEN A;  3QBO A;  4Q6R A;  3AEM A;  3TFT A;  2ZC0 A;  3PPL A;  4CBS A;  2FM1 A;  3B1E A;  1M0P A;  1O69 A;  2AY7 A;  3PDB B;  4OYT A;  3RQ1 A;  3VP6 A;  1DTY A;  1OHY A;  2D7Z A;  1AAM A;  4FL0 A;  1BKG A;  2R5C A;  2VMX A;  3HLM A;  4WYC A;  4WP0 A;  5JAY A;  1MGV A;  3LVK A;  4MGR A;  1C7O A;  2CH2 A;  2CJG A;  1W7M A;  2YKX A;  3N4R A;  4PFF A;  4A00 A;  5LH9 A;  1ASE A;  1RVY A;  4WB0 B;  3FDB A;  1AHX A;  1IUG A;  3WCO A;  5K8B A;  1AHE A;  5D95 A;  4XQ2 A;  4F5K A;  3PAA A;  1QZ9 A;  1V2E A;  2XH1 A;  4LNJ A;  4UHO A;  2HUU A;  1M32 A;  1M0Q A;  4F5L A;  3HBX A;  2OKK A;  2WK7 A;  3BWO A;  4AO9 A;  1ASC A;  1DKA A;  4IYO B;  3PJ0 A;  3JZL A;  5D5S A;  5DX5 A;  4ITX A;  4ZDL A;  2VLF A;  3BV0 A;  3NYS A;  1AKB A;  3G7Q A;  4CBR A;  4LW2 A;  2V1P A;  4TMR A;  3ELP A;  4MQQ A;  3ELE A;  3K28 A;  3F9T A;  4UHM A;  3GJU A;  2QA3 A;  1ASG A;  1ECX A;  1UU2 A;  4BQ0 A;  4K05 A;  1DJ9 A;  3ATH A;  2VGT A;  1M0N A;  1QIR A;  1LC7 A;  3QI6 A;  1WYV A;  3FFR A;  1IAY A;  1YNU A;  3FZ6 A;  4PIW A;  1E5E A;  4MSO A;  5DJ1 A;  1ASF A;  1YIY A;  3A8U X;  2C44 A;  2W7I A;  2BI3 A;  4ADD A;  4W5K A;  1AHF A;  1D7R A;  1KMJ A;  3BWN C;  5KTB A;  4GEB A;  3AAT A;  4OBV A;  3M5U A;  3N7N A;  1GD9 A;  1UU0 A;  2PO3 A;  4WBT A;  1AX4 A;  2JIS A;  2YKV A;  5M4D A;  4ATQ A;  4DGT A;  2W8W A;  4UOY A;  2WB6 A;  3DYD A;  3JTX A;  1AMQ A;  2ZSM A;  4XJP A;  1ELU A;  1CZC A;  4U1T A;  2YCP A;  5HHY A;  1W7L A;  1G7W A;  4P7Y A;  2G6W A;  3HQT A;  3IF2 A;  3OKS A;  2W7E A;  3LVM A;  3W1H A;  2Z9U A;  1XI9 A;  2CH1 A;  3LVL B;  1SZS A;  3FVU A;  4R5F A;  3N4S A;  1KL2 A;  4Q75 A;  1CS1 A;  3NDN A;  1OXO A;  2TPL A;  2Z61 A;  1TOI A;  2AY4 A;  3EI7 A;  2OKJ A;  1ELQ A;  3KKI A;  1CL1 A;  1TAS A;  2BWO A;  3N5M A;  5EAA A;  3ZRR A;  1TAR A;  1V2F A;  1Z3Z A;  4A6U A;  1WYU B;  3WX9 A;  1X2A A;  1C0N A;  2HUF A;  5EUN A;  1WYT B;  1ASL A;  2HP1 A;  2OAT A;  3RBF A;  5EIG A;  1MDZ A;  4JEW A;  3TAT A;  2ORD A;  4IX8 A;  1C7N A;  3N4X A;  4W1V A;  2AEU A;  1N2T A;  4XJM A;  1N8P A;  1G4V A;  2E54 A;  1EJI A;  1GC4 A;  2O0R A;  2Q7W A;  2VMT A;  3BCA A;  2R5E A;  4ADC A;  4CXR A;  2VMZ A;  4Q76 A;  2BI2 A;  3QHX A;  2GMU A;  4JEZ A;  3MAF B;  2FNI A;  3GET A;  4W8I A;  5HXX A;  1I29 A;  1CQ7 A;  5C6U A;  3W1J A;  4WXG A;  2BHX A;  2W7D A;  5G09 A;  2QMA A;  3FFH A;  4WYA A;  2YCT A;  4MQP A;  4AOA A;  5IWQ A;  4RKC A;  3EUC A;  1AY4 A;  3FVX A;  2HOR A;  2PB2 A;  3JWB A;  4ZSW A;  3EI8 A;  4N0W A;  4EU1 A;  5BJ3 A;  3WZF A;  1YJY A;  2OGA A;  4R8D A;  1W7N A;  2V0Y A;  3ZRP A;  5FT5 A;  1AJS A;  1M6S A;  3NUI A;  1BJW A;  1H1C A;  1TOJ A;  2X5F A;  3MC6 A;  4K2B A;  5FT6 A;  2Z9X A;  3NYU A;  4Y0H A;  1LKC A;  2CFB A;  3DXW A;  4GE4 A;  1AJR A;  3GZD C;  4GDY A;  1AHY A;  4RM1 A;  3ECD A;  3KGW A;  4ZAS A;  3G0T A;  4WYF A;  2Z1Y A;  2JJH A;  1W3U A;  3DXV A;  4JE5 D;  3FKD A;  1YIZ A;  1EG5 A;  2AY8 A;  4LNL A;  1DJE A;  1X29 A;  1ZOD A;  2D61 A;  2VIA A;  4R2N A;  5G0A A;  3FZ7 A;  3A9Z A;  1WKH A;  2ZY4 A;  3QPG A;  1TOG A;  4H63 Q;  1H0C A;  4GE9 A;  1TAT A;  2F8J A;  2VGV A;  2W8J A;  2EO5 A;  1G7X A;  1IX7 A;  4ADB A;  1KKJ A;  1GEX A;  1I43 A;  2DGK A;  2BI1 A;  3N0L A;  2DKJ A;  2JJF A;  2C81 A;  3ASA A;  2ZP7 A;  5E5I A;  5M46 A;  2VMU A;  3EIB A;  2FN6 A;  4RLG A;  3GSB A;  2AY6 A;  3H7F A;  3A9Y A;  1D7V A;  2HOZ A;  1BT4 A;  2VI9 A;  3DR7 A;  3DU4 A;  4E3R A;  4ZM4 A;  1KKP A;  4B9B A;  1AY8 A;  3PIU A;  3PD6 A;  4ZDP A;  1CJ0 A;  2XBN A;  3ZZK A;  2EYQ A;  5EFS A;  1KMK A;  2VMQ A;  3II0 A;  3CQ5 A;  1GDE A;  1GEW A;  2CJH A;  2VMN A;  4Y0D A;  4CXQ A;  1C9C A;  1YJZ A;  1BJO A;  2VMY A;  4M2K A;  4N0B A;  3KE3 A;  4W91 A;  2BYL A;  4AZK A;  1LS3 A;  2YCN A;  4F4E A;  1AIC A;  2KFP A;  2VGW A;  3MEB A;  3EZ1 A;  4EFF A;  1GC3 A;  2DR1 A;  2ZY3 A;  3E2Z A;  3A2B A;  1AKC A;  1IX8 A;  5M49 A;  4OC9 A;  3H9X A;  4AH3 A;  4JEX A;  3F6T A;  3HDO A;  2DOU A;  4KYO A;  1QJ3 A;  2AY5 A;  3RCH A;  3WKS A;  2VMV A;  3BWN A;  2ZJG A;  1DGD A;  3B1D A;  3I4J A;  3I5T A;  4J8L A;  2EH6 A;  2W7F A;  3E77 A;  1J04 A;  4MKJ A;  9AAT A;  1O62 A;  2X3L A;  4ZLV A;  1RV3 A;  2BIE A;  5G4J A;  1B5P A;  1FG7 A;  3EI5 A;  1OAT A;  1LC8 A;  3AEM C;  4B98 A;  3MBB A;  3TCM A;  4RJY A;  3RUY A;  3QGU A;  1AMS A;  4MQR A;  1BQD A;  2GMS A;  3WGC A;  1SFF A;  1SF2 A;  3DZZ A;  3NRA A;  1PFF A;  3AOV A;  4ZWV A;  5F9S A;  1DFO A;  1OXP A;  4BHD A;  3JWA A;  4OCA A;  4BMK A;  4JF1 A;  2G7J A;  3AOW A;  3QM2 A;  1ZC9 A;  3GZC A;  4PVF A;  3VK3 A;  1Y4I A;  3WKR A;  1ARG A;  4I8A A;  1PMO A;  4BA5 A;  4A0G A;  2JG2 A;  3RCH B;  3CBF A;  1TOE A;  1T3I A;  4W1W A;  3WLX A;  4LW4 A;  2Z20 A;  3I16 A;  3B8X A;  1S06 A;  3E2Z B;  5G2P A;  1MAQ A;  1ZOB A;  3AEL A;  4DQ6 A;  1CQ6 A;  4PFN A;  2JJE A;  2FQ6 A;  4WYD A;  2HP2 A;  3G8M A;  1S0A A;  1CQ8 A;  2W7G A;  3K40 A;  5BJ4 A;  4UQV A;  1BJO B;  1WST A;  2Z9V A;  2BI5 A;  1V72 A;  3UWC A;  1MDO A;  1YAA A;  2D64 A;  1SVV A;  4TV7 A;  4M2M A;  3PD6 B;  1O4S A;  2EZ2 A;  4DBC A;  1QJ5 A;  2ZUK A;  4FFC A;  4E77 A;  5E3K A;  1DGE A;  4OBU A;  1TOK A;  4IW7 A;  2VGZ A;  3FRK A;  4M2J A;  3RI6 A;  4GE7 A;  4OTL A;  2C0R A;  1BJN A;  1IX6 A;  4F5G A;  3P1T A;  1GCK A;  2D63 A;  3DC1 A;  2DGL A;  2E7U A;  2NMP A;  1QIT A;  4WYE A;  4EMY A;  3BCB A;  4JF0 A;  5E4Z A;  4R5Z A;  2O7C A;  2OGE A;  5DJ9 A;  3EI9 A;  1XEY A;  3FQA A;  2EGY A;  2FYF A;  4WD2 A;  3GZD A;  3TFU A;  2VMS A;  2AY3 A;  3LVJ A;  5EQC A;  3P6K A;  3PDX A;  1ARI A;  8AAT A;  4BA4 A;  2X8U A;  1AY5 A;  2QB2 A;  3PA9 A;  4L0O A;  3LV2 A;  1LW4 A;  1QIS A;  2YKY A;  3T32 A;  1B8G A;  1RV4 A;  5FT4 A;  1RVU A;  1BJ4 A;  3GR9 A;  3BN1 A;  3AEJ C;  3GBX A;  2BKW A;  1QGN A;  1PG8 A;  3L44 A;  3FDD A;  4NOG A;  2D5Y A;  2VI8 A;  3R9A A;  1N31 A;  3UAK A;  2QBT A;  4J5U A;  2E7I A;  1S09 A;  2AY1 A;  2WKA A;  3NTJ A;  2YRI A;  3ACZ A;  2VGS A;  4P3M A;  3NX3 A;  1B9H A;  4AZJ A;  1AJS B;  3ZZJ A;  2VYC A;  2BYJ A;  5EAV A;  4MKK A;  2O1B A;  4EB7 A;  4Y0I A;  4A72 A;  1AHG A;  1G4X A;  2HZP A;  4UHN A;  5F8V A;  4KXK A;  3EZS A;  2CY8 A;  3CQ4 A;  1LK9 A;  4F5M A;  3LY1 A;  4RJ0 A;  4IY7 A;  3MAF A;  3Q8N A;  3FQ7 A;  4K2M A;  3ASB A;  3W1I A;  1IJI A;  1W23 A;  3IHJ A;  2HOY A;  1ARS A;  3MAD A;  1BW0 A;  1GBN A;  4A6R A;  1D7U A;  1ASD A;  2OQX A;  1I41 A;  1CL2 A;  4HVK A;  3B46 A;  2BIG A;  2DKB A;  2CAN A;  3E6G A;  5G4I A;  2BWP A;  3CQ6 A;  5EIG B;  4RAE A;  1S08 A;  2JJG A;  4XAU A;  1WYT A;  1P3W A;  3E9K A;  4ADE A;  1B9I A;  1WYU A;  3PGY A;  2W8U A;  3QN6 A;  3VK4 A;  4WLH A;  1WKG A;  4GRX A;  4F5F A;  1Z7D A;  2C7T A;  1UKJ A;  2W7L A;  3F0H A;  1M4N A;  3B1C A;  5M4B A;  1FG3 A;  2YKU A;  4RIT A;  4ZAH A;  3FTB A;  3TQX A;  1IVR A;  4WLJ A;  4WYG A;  1VJO A;  3LWS A;  2DGM A;  4ITG A;  4TN4 A;  3WGB A;  2RFV A;  2VMP A;  1DJU A;  3AEJ A;  1C4K A;  4H51 A;  2VIB A;  4EB5 A;  1ASN A;  1CZE A;  3MKJ A;  4MY5 A;  1AIB A;  2X5D A;  3OP7 A;  2QLR A;  2Z1Z A;  3BC8 A;  1MLY A;  2VGU A;  5TF5 A;  3K7Y A;  4E1O A;  1X28 A;  1LC5 A;  3A9X A;  4GSA A;  1SZU A;  2AAT A;  3FD0 A;  5AX8 A;  2PB0 A;  4W1X A;  2AEV A;  1ORD A;  2EZ1 A;  3AEP A;  1S07 A;  2E7J A;  5FT8 A;  1TPL A;  5EUD A;  3VAX A;  1ASB A;  1GEY A;  3FZ8 A;  2D7Y A;  3NUB A;  2R2N A;  3H14 A;  1JG8 A;  2VMW A;  2W8T A;  2YHK A;  3CAI A;  1YJS A;  2VMR A;  3E2F A;  3NYT A;  2ZSL A;  1I48 A;  4Q31 A;  4XEW A;  1MAP A;  3UE8 A;  2BI9 A;  5G2Q A;  3NNK A;  4XJO A;  1LW5 A;  2CJD A;  1D7S A;  2D66 A;  1WYV B;  2VMO A;  3DOD A;  2ZYJ A;  1YOO A;  4A0R A;  2HUI A;  1ASA A;  1SPA A;  3FSL A;  5EUE A;  3BCX A;  2AY9 A;  3RBL A;  2ZY5 A;  1AAW A;  1FC4 A;  4WXB A;  1BS0 A;  3EI6 A;  3EIA A;  3FQ8 A;  1M7Y A;  1AIA A;  3USF A;  3ZRQ A;  1J32 A;  4F5H A;  4JEV A;  2A1V A;  1JS6 A;  1VP4 A;  1X0M A;  1JF9 A;  3KGX A;  4IXO A;  3DRD A;  3JU7 A;  1MLZ A;  1AKA A;  1KL1 A;  2JGT A;  3E2Y A;  4RIZ A;  1AMR A;  2QSR A;  1GC0 A;  2D65 A;  3N75 A;  1ARH A;  4ATP A;  4ZM3 A;  1B4X A;  3VK2 A;  2GB3 A;  4IYO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...