1WKHA

Acetylornithine aminotransferase from thermus thermophilus hb8
Total Genus 129
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
129
sequence length
387
structure length
387
Chain Sequence
WRALLEAEKTLDSGVYNKHDLLIVRGQGARVWDAEGNEYIDCVGGYGVANLGHGNPEVVEAVKRQAETLMAMPQTLPTPMRGEFYRTLTAILPPELNRVFPVNSGTEANEAALKFARAHTGRKKFVAAMRGFSGRTMGSLSVTWEPKYREPFLPLVEPVEFIPYNDVEALKRAVDEETAAVILEPVQGEGGVRPATPEFLRAAREITQEKGALLILDEIQTGMGRTGKRFAFEHFGIVPDILTLAKALGGGVPLGVAVMREEVARSMPKGGHGTTFGGNPLAMAAGVAAIRYLERTRLWERAAELGPWFMEKLRAIPSPKIREVRGMGLMVGLELKEKAAPYIARLEKEHRVLALQAGPTVIRFLPPLVIEKEDLERVVEAVRAVLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Acetylornithine aminotransferase from thermus thermophilus HB8
rcsb
source organism Thermus thermophilus
molecule tags Transferase
molecule keywords Acetylornithine/acetyl-lysine aminotransferase
total genus 129
structure length 387
sequence length 387
chains with identical sequence B
ec nomenclature ec 2.6.1.11: Acetylornithine transaminase.
pdb deposition date 2004-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00202 Aminotran_3 Aminotransferase class-III
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 1wkhA02
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 1wkhA01
5IWQA 4DBCA 1AAWA 1GEXA 2W7GA 2AEUA 3NYSA 5FT8A 1QITA 3A9YA 3AENB 1WYTB 2AATA 3R9AA 3RBLA 3DZZA 1DGEA 4UOYA 4A6RA 4ZM4A 1VEFA 3GBXA 2DOUA 1CS1A 3P1TA 3GWPA 3RQ1A 1I48A 3EUCA 4MKJA 3AV7A 4M2MA 1D7UA 4WLHA 4WYEA 1AY8A 1AX4A 4ZM3A 3CQ5A 1GDEA 2R5CA 5BJ4A 2BI3A 2YCPA 4CBSA 2VMQA 4OYTA 2E7UA 4OCAA 5M4BA 1ECXA 3M5UA 1I41A 1BW0A 1MAPA 2BI9A 2QA3A 2VMVA 2BYLA 2Z9VA 4AO4A 3QN6A 3ELPA 3DODA 1IX8A 2R5EA 1BJWA 2JG2A 2VGUA 4OBVA 3RUYA 2FM1A 3AELA 3EI6A 3EZSA 2AY2A 2W7JA 3IHJA 2YRRA 3G8MA 4WYAA 1OATA 2D7ZA 1IX7A 1UU0A 2BWNA 1DJEA 3N75A 4JEYA 5EAVA 4E3RA 2VI8A 4LC3A 3E2ZB 1O62A 1M7YA 3PDBA 5HHYA 3KKIA 1SFFA 2BI5A 2V1PA 3NNKA 1DFOA 3UAKA 4AOAA 1TASA 2HOXA 2Z1ZA 2PB2A 1JS3A 4WLJA 1QJ5A 3ZRRA 1C4KA 3JZLA 3WGBA 1Z7DA 1J32A 3B46A 3I4JA 2HORA 4KYOA 1WKGA 4GE7A 1W23A 1M6SA 4W1VA 2E7IA 2WK8A 2JISA 3FVSA 2VLHA 4Y0IA 2ZY5A 4TN4A 1YIYA 3GJUA 1M0QA 4CBRA 2VMXA 3K7YA 1GEYA 2FQ6A 2ZY3A 3B1CA 3NDNA 1E5EA 2JJFA 1DJ9A 4WXBA 4JEZA 1ASDA 3ECDA 1GCKA 2BWPA 3ISLA 1ARGA 4JEXA 2YRIA 3NUBA 3W1JA 1KL2A 2YKVA 4XK1A 4ZAHA 3FDDA 2Z9WA 1ARSA 2VGZA 3N5MA 2D65A 3FRKA 4Q6RA 2DKJA 2HUUA 3BWOA 3K40A 4K2IA 4ZSWA 4ADCA 5D5SA 4XJMA 1CL2A 3AEJC 1TOJA 3E2YA 4XJPA 3W1IA 3AATA 4W1WA 4JF0A 3AEJA 1JS6A 3HL2A 1YOOA 1YJYA 4P3MA 4WB0A 4GDYA 3WY7A 1WYVA 4F5FA 2X8UA 3FSLA 1BQAA 3DXWA 4PFFA 1IJIA 1H1CA 1LK9A 2BI1A 1S0AA 3A2BA 3OKSA 4LNLA 3BS8A 2XBNA 3E77A 1AHYA 3G0TA 5M4DA 2O0RA 4ZSYA 1LW4A 1SF2A 3D6KA 1AHXA 1ARIA 2ZC0A 3QI6A 1XEYA 2E7JA 2VLFA 1G4VA 3LG0A 2QB3A 3QHXA 1ZOBA 3PD6B 3TFTA 1RVYA 2ORDA 4IXOA 9AATA 1N31A 2QLRA 1B9IA 1ASNA 1DTYA 1CQ7A 3GZDA 4W91A 3ZZJA 1B4XA 2CSTA 1O61A 3CQ6A 1AJSB 4GRXA 1KKPA 1PMOA 2Z20A 4RKCA 3JWAA 1LW5A 1TPLA 4IYOA 4MKKA 3FZ8A 3PDXA 4E77A 5EUEA 1GD9A 2OKKA 3BV0A 3PPLA 3FD0A 1Z3ZA 2CB1A 2X5DA 4RKDA 1ASBA 2FNUA 2FN6A 1MGVA 1SZKA 1PG8A 1ZC9A 2W8WA 3MKJA 2W7DA 1MDOA 3F0HA 3LV2A 1IUGA 2GB3A 3MC6A 3EI8A 3WLXA 4Y0HA 2CY8A 5K8BA 4UQVA 2W7EA 3MAFA 1S07A 2GQNA 1SZUA 3FVXA 3FCRA 5FT6A 2Z61A 1AMAA 2D63A 1V2FA 5M49A 3FTBA 1W7MA 4JF1A 5JAYA 3GZDC 4E1OA 4RJYA 4A00A 2AY8A 4JE5D 3NUIA 4HF8A 2AY6A 1WYUB 4RJ0A 3T32A 4OTLA 1PFFA 2V0YA 2YKXA 1RV4A 2D64A 2R0TA 3DU4A 1AY5A 4R5FA 4UHNA 2HP2A 2C0RA 1V2EA 1PMMA 4ZWVA 4GE4A 3TCMA 2AY1A 1D7VA 2TPLA 1AKBA 4U1TA 1LS3A 1QZ9A 2CJHA 2O1BA 2VGSA 4XQ2A 1BS0A 1OXPA 1EJIA 8AATA 2QBTA 2PO3A 3TQXA 2ZY2A 1CJ0A 2VGVA 2Q7WA 4F5JA 4DGTA 2VGTA 3BCXA 1D2FA 5E4ZA 3B1EA 3JW9A 5FT4A 4BHDA 1X29A 3FDBA 1XI9A 1E5FA 2YOBA 4A0RA 4B98A 4WXFA 4XJLA 4CXQA 1ASEA 1TOKA 2WK9A 1W3UA 4JE5A 1LC7A 3CBFA 2GSAA 3RCHA 4TMRA 4BA4A 4ZWMA 2W7IA 4R8DA 4ZASA 3LVKA 2EZ1A 2OGEA 3DXVA 4WYDA 1AJSA 2CFBA 1QGNA 2X3LA 3HT4A 3IF2A 4OMAA 4ATQA 4ZDLA 2YHKA 4E3QA 4GSAA 1ORDA 4J5UA 1SPAA 4WXGA 1AKCA 3NYUA 1G7XA 1M32A 2E54A 3PD6A 5E3KA 3DR4A 2HUIA 2DR1A 3ASBA 1CQ6A 3DC1A 4J8LA 4K2BA 1OHWA 3GSBA 1C0NA 3GZCA 2VIAA 5DB5A 4JEVA 4F5IA 3QGUA 1G7WA 4CXRA 4IX8A 3PIUA 1W7NA 3ASAA 3QPGA 1WKHA 4HVKA 2VI9A 2QMAA 1TARA 3ACZA 3PAAA 1KKJA 2W7KA 3EZ1A 3GETA 3PJ0A 1IAYA 1AMQA 3FQAA 3JU7A 3WCOA 2OQXA 5G4JA 1TATA 4PFNA 1ASFA 4ZDOA 2C44A 1UKJA 2WKAA 2NMPA 4IXZA 1P3WA 3E9KA 1DKAA 3LVLB 4ITXA 2YKUA 2BKWA 2AY4A 4I8AA 1YAAA 2AEVA 2D7YA 3RI6A 4M2JA 1AMSA 4WD2A 2W8JA 1IAXA 1EG5A 1VJOA 2VMOA 1C7OA 1OHVA 3P6KA 2VYCA 4KAMA 1GC3A 3PA9A 1ZODA 3EI7A 4AO9A 1M0NA 2BHXA 1CZEA 2W8UA 1SZSA 2VMNA 5DX5A 1TOGA 4BA5A 3MADA 2CTZA 1BJOA 1YJSA 5TF5A 3W1HA 4M2KA 1S06A 4IW7A 1AY4A 4MY5A 1IBJA 1KL1A 1WYTA 3AEOA 4Q75A 3FFRA 2BI2A 3QM2A 4Q76A 1V2DA 2EO5A 3PGYA 4F5GA 4A6UA 4ZLVA 1ASMA 5EIGA 1V72A 3A9XA 3WX9A 4NOGA 1ASGA 3USFA 2W8TA 2Z9XA 3B8XA 3E2ZA 5DJ9A 4ZDPA 3RBFA 2X5FA 2FYFA 1ARTA 2XH1A 3A9ZA 4EMYA 3DRDA 2ZSMA 1VP4A 4Y0DA 5EIGB 5HDMA 1OXOA 2DGKA 4WYGA 1YNUA 1N2TA 2CH1A 4A6TA 2ZYJA 4OC9A 4W8IA 3WZFA 5G09A 2R5CB 4N0BA 3F6TA 5E5IA 2EPJA 1CQ8A 4OT8A 1N8PA 3NRAA 5G2PA 3N0LA 3F9TA 2OKJA 1RVUA 5D95A 3EI5A 4F5MA 2W8VA 1T3IA 2FNIA 1Y4IA 1BJOB 2EH6A 1C7NA 1ARHA 1FC4A 2CINA 3H14A 1AAMA 3ZRPA 3FQ7A 2C7TA 7AATA 2YCNA 1AHGA 1JF9A 1O4SA 2YKYA 4PIWA 3ELEA 1CZCA 2Z1YA 2BIGA 3E2FA 2DKBA 1IX6A 3EIAA 4AZJA 2VMZA 3UE8A 3ZRQA 4N0WA 1GC4A 1MDXA 1AHEA 3VK2A 3VK3A 1AIBA 2W7HA 4B9BA 3KGXA 4FL0A 1J04A 3VP6A 4A0FA 3PDBB 1MAQA 2DGLA 1LC8A 1ASAA 1D7RA 2VMYA 3HBXA 1U08A 3L44A 1GBNA 3QBOA 4R5ZA 2W7FA 2AY7A 1QISA 3NTJA 4ISYA 4Q31A 3BWNC 3FVUA 2VMRA 4AZKA 3E6GA 1ELUA 3EIBA 4GE9A 4W1XA 2ZSLA 4ADDA 2D61A 2VMSA 5M46A 1M4NA 1AMRA 2HUFA 5FT5A 4MQRA 1B9HA 4XEWA 5DJ1A 3DYDA 3BCBA 3AOVA 2HP1A 3MAUA 4CVQA 3HQTA 1S08A 4LW2A 2CH2A 3G7QA 4RIZA 1ASCA 1QJ3A 3B1DA 3HDOA 1B5PA 4LW4A 3AEMC 4W5KA 2W7LA 4BMKA 5HXXA 3VK4A 3I5TA 3HVYA 2RFVA 1I29A 1B5OA 3L8AA 2BWOA 4A0GA 2YCTA 1C9CA 3AEMA 4QGRA 5EAAA 1S09A 2HOYA 3RCHB 2CJDA 3NU7A 4P7YA 3AENA 1D7SA 4WYCA 3NYTA 2ZJGA 1YJZA 3LWSA 3TATA 2C81A 5LH9A 2EGYA 5J8QA 3II0A 5BJ3A 3TFUA 1EQBA 4F4EA 4KXKA 1IVRA 2BIAA 1M0OA 3MEBA 4DQ6A 4MGRA 3VOMA 4F5KA 5G4IA 2D66A 3WGCA 1MLZA 3BB8A 2QB2A 3OP7A 4IY7A 4H51A 2F8JA 3NX3A 4JEWA 3I16A 5AX8A 5F8VA 1M0PA 3Q8NA 3VAXA 3UWCA 2AY3A 4RAEA 3EI9A 4EFFA 4RITA 2Z67A 4FFCA 4BQ0A 4ADEA 3FKDA 2JGTA 2GMUA 2EZ2A 1WYUA 4RM1A 5C6UA 4OBUA 3CAIA 2VMTA 1MLYA 4R2NA 4UHMA 2W7MA 3FZ7A 4F5HA 3MBBA 4O6ZA 3BC8A 3COGA 4ATPA 3WKRA 2JJEA 3MAFB 5LHAA 3BWNA 4MSOA 4WB0B 1AJRA 3H7FA 2GMSA 2CJGA 4XAUA 2JJGA 4LNJA 4AH3A 1GC2A 4MQPA 1JG8A 4TV7A 5EFSA 3KE3A 4WYFA 3WCNA 5G2QA 2G6WA 1OHYA 4EU1A 4L0OA 1C7GA 1LC5A 1SVVA 3KGWA 2VMPA 2BYJA 1AICA 4MQQA 1BJNA 1YIZA 5F9SA 2VMUA 2WK7A 3A8UX 1G4XA 1WSTA 4IYOB 3LVMA 1MDZA 1FG7A 2ZP7A 1BT4A 2VMWA 1BJ4A 1ELQA 3HLMA 3JWBA 1BKGA 1I43A 1UU1A 1FG3A 1X0MA 3NU8A 2OATA 5I92A 4U2HA 4XJOA 4ADBA 1DJUA 1GC0A 2VGWA 2AY5A 2R2NA 1BQDA 2HOZA 1RV3A 4RLGA 3WKSA 2ZY4A 1ASLA 2VIBA 3BN1A 1W7LA 4IXSA 4WBTA 5EUNA 5EUDA 3FZ6A 1TOIA 1B8GA 1X2AA 3AEPA 1CL1A 2ZUKA 3JTXA 1WYVB 2AY9A 2BIEA 3BCAA 4ITGA 3ZZKA 4GEBA 4EB5A 2PB0A 2D5YA 3K28A 1GEWA 1LKCA 4LNMA 2HZPA 2OGAA 4UHOA 3AOWA 1AHFA 1H0CA 4F5LA 1QIRA 2Z9UA 3FQ8A 5G0AA 4EB7A 2DGMA 3DR7A 1AKAA 1O69A 3LVJA 4A0HA 3LY1A 3FFHA 4PVFA 3MC6C 3GR9A 2CANA 1UU2A 3CQ4A 2JJHA 3R4TA 5EQCA 2O7CA 1DGDA 1X28A 1AIAA 3ATHA 1TOEA 4A72A 1KMKA 1KMJA 4WP0A 3HMUA 4K2MA
chains in the Genus database with same CATH superfamily
5IWQA 4DBCA 1AAWA 1GEXA 2W7GA 2AEUA 3NYSA 5FT8A 1QITA 3A9YA 3AENB 1WYTB 2AATA 3R9AA 3RBLA 3DZZA 1DGEA 4UOYA 4A6RA 4ZM4A 1VEFA 3GBXA 2DOUA 1CS1A 3P1TA 3GWPA 3RQ1A 1I48A 3EUCA 4MKJA 3AV7A 4M2MA 1D7UA 4WLHA 4WYEA 1AY8A 1AX4A 4ZM3A 3CQ5A 2EYQA 1GDEA 2R5CA 5BJ4A 2BI3A 2YCPA 4CBSA 2VMQA 4OYTA 2E7UA 4OCAA 5M4BA 1ECXA 3M5UA 1I41A 1BW0A 1MAPA 2BI9A 2QA3A 2VMVA 2BYLA 2Z9VA 4AO4A 3QN6A 3ELPA 3DODA 1IX8A 2R5EA 1BJWA 2JG2A 2VGUA 4OBVA 3RUYA 2FM1A 3AELA 3EI6A 3EZSA 2AY2A 2W7JA 3IHJA 2YRRA 3G8MA 4WYAA 1OATA 2D7ZA 1IX7A 1UU0A 2BWNA 1DJEA 3N75A 4JEYA 5EAVA 4E3RA 2VI8A 4LC3A 3E2ZB 1O62A 1M7YA 3PDBA 5HHYA 3KKIA 1SFFA 2BI5A 2V1PA 3NNKA 1DFOA 3UAKA 4AOAA 1TASA 2HOXA 2Z1ZA 2PB2A 1JS3A 4WLJA 1QJ5A 3ZRRA 1C4KA 3JZLA 3WGBA 1Z7DA 1J32A 3B46A 3I4JA 2HORA 4KYOA 1WKGA 4GE7A 1W23A 1M6SA 4W1VA 2E7IA 2WK8A 2JISA 3FVSA 2VLHA 4Y0IA 2ZY5A 4TN4A 1YIYA 3GJUA 1M0QA 4CBRA 2VMXA 3K7YA 1GEYA 2FQ6A 2ZY3A 3B1CA 3NDNA 1E5EA 2JJFA 1DJ9A 4WXBA 4JEZA 1ASDA 3ECDA 1GCKA 2BWPA 3ISLA 1ARGA 4JEXA 2YRIA 3NUBA 3W1JA 1KL2A 2YKVA 4XK1A 4ZAHA 3FDDA 2Z9WA 1ARSA 2VGZA 3N5MA 2D65A 3FRKA 4Q6RA 2DKJA 2HUUA 3BWOA 3K40A 4K2IA 4ZSWA 4ADCA 5D5SA 4XJMA 1CL2A 3AEJC 1TOJA 3E2YA 4XJPA 3W1IA 3AATA 4W1WA 4JF0A 3AEJA 1JS6A 3HL2A 1YOOA 1YJYA 4P3MA 4WB0A 3N4SA 4GDYA 3WY7A 1WYVA 4F5FA 2X8UA 3FSLA 1BQAA 3DXWA 4PFFA 1IJIA 1H1CA 1LK9A 2BI1A 1S0AA 3A2BA 3OKSA 4LNLA 3BS8A 2XBNA 3E77A 1AHYA 3G0TA 5M4DA 2O0RA 4ZSYA 1LW4A 1SF2A 3D6KA 1AHXA 1ARIA 2ZC0A 3QI6A 1XEYA 2E7JA 2VLFA 1G4VA 3LG0A 2QB3A 3QHXA 1ZOBA 3PD6B 3TFTA 1RVYA 2ORDA 4IXOA 9AATA 1N31A 2QLRA 1B9IA 1ASNA 1DTYA 1CQ7A 2A1VA 3GZDA 4W91A 3ZZJA 1B4XA 2CSTA 1O61A 3CQ6A 1AJSB 4GRXA 1KKPA 1PMOA 2Z20A 4RKCA 3JWAA 1LW5A 1TPLA 4IYOA 4MKKA 3FZ8A 3PDXA 4E77A 5EUEA 1GD9A 2OKKA 3BV0A 3PPLA 3FD0A 1Z3ZA 2CB1A 2X5DA 4RKDA 1ASBA 2FNUA 2FN6A 1MGVA 1SZKA 1PG8A 1ZC9A 2W8WA 3MKJA 2W7DA 1MDOA 3F0HA 3LV2A 1IUGA 2GB3A 3MC6A 3EI8A 3WLXA 4Y0HA 2CY8A 5K8BA 4UQVA 2W7EA 3MAFA 1S07A 2GQNA 1SZUA 3FVXA 3FCRA 5FT6A 2Z61A 1AMAA 2D63A 1V2FA 5M49A 3FTBA 1W7MA 4JF1A 5JAYA 3GZDC 4E1OA 4RJYA 4A00A 2AY8A 4JE5D 3NUIA 4HF8A 2AY6A 1WYUB 4RJ0A 3T32A 4OTLA 1PFFA 2V0YA 2YKXA 1RV4A 2D64A 2R0TA 3DU4A 1AY5A 4R5FA 4UHNA 2HP2A 2C0RA 1V2EA 1PMMA 4ZWVA 4GE4A 3TCMA 2AY1A 1D7VA 2TPLA 1AKBA 4U1TA 1LS3A 1QZ9A 2CJHA 2O1BA 2VGSA 4XQ2A 1BS0A 1OXPA 1EJIA 8AATA 2QBTA 2PO3A 3TQXA 2ZY2A 1CJ0A 2VGVA 2Q7WA 4F5JA 4DGTA 2VGTA 3BCXA 1D2FA 5E4ZA 3B1EA 3JW9A 5FT4A 4BHDA 1X29A 3FDBA 1XI9A 1E5FA 2YOBA 4A0RA 4B98A 4WXFA 4XJLA 4CXQA 1ASEA 1TOKA 2WK9A 1W3UA 4JE5A 1LC7A 3CBFA 2GSAA 3RCHA 4TMRA 4BA4A 4ZWMA 2W7IA 4R8DA 4ZASA 3LVKA 2EZ1A 2OGEA 3DXVA 4WYDA 1AJSA 2CFBA 1QGNA 2X3LA 3HT4A 3IF2A 4OMAA 4ATQA 4ZDLA 2YHKA 4E3QA 4GSAA 1ORDA 4J5UA 1SPAA 4WXGA 1AKCA 3NYUA 1G7XA 1M32A 2E54A 3PD6A 5E3KA 3DR4A 2HUIA 2KFPA 2DR1A 3ASBA 1CQ6A 3DC1A 4J8LA 4K2BA 1OHWA 3GSBA 1C0NA 3GZCA 2VIAA 5DB5A 4JEVA 4F5IA 3QGUA 1G7WA 4CXRA 4IX8A 3PIUA 1W7NA 3ASAA 3QPGA 1WKHA 4HVKA 2VI9A 2QMAA 1TARA 3ACZA 3PAAA 1KKJA 5KTBA 2W7KA 3EZ1A 3GETA 3PJ0A 1IAYA 1AMQA 3FQAA 3JU7A 3WCOA 2OQXA 5G4JA 1TATA 4PFNA 1ASFA 4ZDOA 2C44A 1UKJA 2WKAA 2NMPA 4IXZA 1P3WA 3E9KA 1DKAA 3LVLB 4ITXA 2YKUA 2BKWA 2AY4A 4I8AA 1YAAA 2AEVA 2D7YA 3RI6A 4M2JA 1AMSA 4WD2A 2W8JA 1IAXA 1EG5A 1VJOA 2VMOA 1C7OA 1OHVA 3P6KA 2VYCA 4KAMA 1GC3A 3PA9A 4H63Q 1ZODA 3EI7A 4AO9A 1M0NA 2BHXA 1CZEA 3N7NA 2W8UA 1SZSA 2VMNA 5DX5A 1TOGA 4BA5A 3MADA 2CTZA 1BJOA 1YJSA 5TF5A 3W1HA 4M2KA 1S06A 4IW7A 1AY4A 4MY5A 1IBJA 1KL1A 1WYTA 3AEOA 4Q75A 3FFRA 2BI2A 3QM2A 4Q76A 1V2DA 2EO5A 3PGYA 4F5GA 4A6UA 4ZLVA 1ASMA 5EIGA 1V72A 3A9XA 3WX9A 4NOGA 1ASGA 3USFA 2W8TA 2Z9XA 3B8XA 3E2ZA 5DJ9A 4ZDPA 3RBFA 2X5FA 2FYFA 1ARTA 2XH1A 3A9ZA 4EMYA 3DRDA 2ZSMA 1VP4A 4Y0DA 5EIGB 5HDMA 1OXOA 2DGKA 2WB6A 4WYGA 1YNUA 1N2TA 2CH1A 3H9XA 4A6TA 2ZYJA 4OC9A 4W8IA 3WZFA 5G09A 2R5CB 4N0BA 3F6TA 5E5IA 2EPJA 1CQ8A 4OT8A 1N8PA 3NRAA 5G2PA 3N0LA 3F9TA 2OKJA 1RVUA 5D95A 3EI5A 4F5MA 2W8VA 1T3IA 2FNIA 1Y4IA 1BJOB 2EH6A 1C7NA 1ARHA 1FC4A 2CINA 3H14A 1AAMA 3ZRPA 3FQ7A 2C7TA 7AATA 2YCNA 1AHGA 1JF9A 1O4SA 2YKYA 4PIWA 3ELEA 1CZCA 2Z1YA 2BIGA 3E2FA 2DKBA 1IX6A 3EIAA 4AZJA 2VMZA 3UE8A 3ZRQA 4N0WA 1GC4A 1MDXA 1AHEA 3VK2A 3VK3A 1AIBA 2W7HA 4B9BA 3KGXA 4FL0A 1J04A 3VP6A 4A0FA 3PDBB 1MAQA 2DGLA 1LC8A 1ASAA 1D7RA 2VMYA 3HBXA 1U08A 2QSRA 3L44A 1GBNA 3QBOA 4R5ZA 2W7FA 2AY7A 1QISA 3NTJA 4ISYA 4Q31A 3BWNC 3FVUA 2VMRA 4AZKA 3E6GA 1ELUA 3EIBA 4GE9A 4W1XA 2ZSLA 4ADDA 2D61A 2VMSA 5M46A 1M4NA 1AMRA 2HUFA 5FT5A 4MQRA 1B9HA 4XEWA 5DJ1A 3DYDA 3BCBA 1KAFA 3AOVA 2HP1A 3MAUA 4CVQA 3HQTA 1S08A 4LW2A 2CH2A 3G7QA 4RIZA 1ASCA 1QJ3A 3B1DA 3HDOA 1B5PA 4LW4A 3AEMC 4W5KA 2W7LA 4BMKA 5HXXA 3VK4A 3I5TA 3HVYA 2RFVA 1I29A 1B5OA 3L8AA 2BWOA 4A0GA 2YCTA 1C9CA 3AEMA 4QGRA 5EAAA 1S09A 2HOYA 3RCHB 2CJDA 3NU7A 4P7YA 3N4RA 3AENA 1D7SA 4WYCA 3NYTA 2ZJGA 1YJZA 3LWSA 3TATA 2C81A 5LH9A 2EGYA 5J8QA 3II0A 5BJ3A 3TFUA 1EQBA 4F4EA 4KXKA 1IVRA 2BIAA 1M0OA 3MEBA 4DQ6A 4MGRA 3VOMA 4F5KA 5G4IA 2D66A 3N4XA 3WGCA 1MLZA 3BB8A 4K05A 2QB2A 3OP7A 4IY7A 4H51A 2F8JA 3NX3A 4JEWA 3I16A 5AX8A 5F8VA 1M0PA 3Q8NA 3VAXA 3UWCA 2AY3A 4RAEA 3EI9A 4EFFA 4RITA 2Z67A 4FFCA 4BQ0A 2FKIA 4ADEA 3FKDA 2JGTA 2GMUA 2EZ2A 1WYUA 4RM1A 5C6UA 4OBUA 3CAIA 2VMTA 1MLYA 4R2NA 4UHMA 2W7MA 3FZ7A 4F5HA 3MBBA 4O6ZA 3BC8A 3COGA 4ATPA 3WKRA 2JJEA 3MAFB 5LHAA 3BWNA 4MSOA 4WB0B 1AJRA 3H7FA 2GMSA 2CJGA 4XAUA 2JJGA 4LNJA 4AH3A 1GC2A 4MQPA 1JG8A 4TV7A 5EFSA 3KE3A 4WYFA 3WCNA 5G2QA 2G6WA 1OHYA 4EU1A 4L0OA 1C7GA 1LC5A 1SVVA 3KGWA 2VMPA 2BYJA 1AICA 4MQQA 1BJNA 1YIZA 5F9SA 2VMUA 2WK7A 3A8UX 1G4XA 1WSTA 4IYOB 3LVMA 1MDZA 1FG7A 2ZP7A 1BT4A 2VMWA 1BJ4A 1ELQA 3HLMA 3JWBA 1BKGA 1I43A 1UU1A 1FG3A 1X0MA 3NU8A 2OATA 5I92A 4U2HA 4XJOA 4ADBA 1DJUA 1GC0A 2VGWA 2AY5A 2R2NA 1BQDA 2HOZA 1RV3A 4RLGA 3WKSA 2ZY4A 1ASLA 2VIBA 3BN1A 1W7LA 4IXSA 4WBTA 5EUNA 5EUDA 3FZ6A 1TOIA 1B8GA 1X2AA 3AEPA 1CL1A 2ZUKA 3JTXA 1WYVB 2AY9A 2BIEA 3BCAA 4ITGA 3ZZKA 4GEBA 4EB5A 2PB0A 2D5YA 3K28A 1GEWA 1LKCA 4LNMA 2HZPA 2OGAA 4UHOA 3AOWA 1AHFA 1H0CA 4F5LA 1QIRA 2Z9UA 3FQ8A 5G0AA 4EB7A 2DGMA 3DR7A 1AKAA 1O69A 2G7JA 3LVJA 4A0HA 3LY1A 3FFHA 4PVFA 3MC6C 3GR9A 2CANA 1UU2A 3CQ4A 2JJHA 3R4TA 5EQCA 2O7CA 1DGDA 1X28A 1AIAA 3ATHA 1TOEA 4A72A 1KMKA 1KMJA 4WP0A 3HMUA 4K2MA
chains in the Genus database with same CATH topology
5IWQA 4DBCA 1AAWA 1GEXA 2W7GA 2AEUA 3NYSA 5FT8A 1QITA 3A9YA 3AENB 1WYTB 2AATA 3R9AA 3RBLA 3DZZA 1DGEA 4UOYA 4A6RA 4ZM4A 1VEFA 3GBXA 2DOUA 1CS1A 3P1TA 3GWPA 3RQ1A 1I48A 3EUCA 4MKJA 3AV7A 4M2MA 1D7UA 4WLHA 4WYEA 1AY8A 1AX4A 4ZM3A 3CQ5A 2EYQA 1GDEA 2R5CA 5BJ4A 2BI3A 2YCPA 4CBSA 2VMQA 4OYTA 2E7UA 4OCAA 5M4BA 1ECXA 3M5UA 1I41A 1BW0A 1MAPA 2BI9A 2QA3A 2VMVA 2BYLA 2Z9VA 4AO4A 3QN6A 3ELPA 3DODA 1IX8A 2R5EA 1BJWA 2JG2A 2VGUA 4OBVA 3RUYA 2FM1A 3AELA 3EI6A 3EZSA 2AY2A 2W7JA 3IHJA 2YRRA 3G8MA 4WYAA 1OATA 2D7ZA 1IX7A 1UU0A 2BWNA 1DJEA 3N75A 4JEYA 5EAVA 4E3RA 2VI8A 4LC3A 3E2ZB 1O62A 1M7YA 3PDBA 5HHYA 3KKIA 1SFFA 2BI5A 2V1PA 3NNKA 1DFOA 3UAKA 4AOAA 1TASA 2HOXA 2Z1ZA 2PB2A 1JS3A 4WLJA 1QJ5A 3ZRRA 1C4KA 3JZLA 3WGBA 1Z7DA 1J32A 3B46A 3I4JA 2HORA 4KYOA 1WKGA 4GE7A 1W23A 1M6SA 4W1VA 2E7IA 2WK8A 2JISA 3FVSA 2VLHA 4Y0IA 2ZY5A 4TN4A 1YIYA 3GJUA 1M0QA 4CBRA 2VMXA 3K7YA 1GEYA 2FQ6A 2ZY3A 3B1CA 3NDNA 1E5EA 2JJFA 1DJ9A 4WXBA 4JEZA 1ASDA 3ECDA 1GCKA 2BWPA 3ISLA 1ARGA 4JEXA 2YRIA 3NUBA 3W1JA 1KL2A 2YKVA 4XK1A 4ZAHA 3FDDA 2Z9WA 1ARSA 2VGZA 3N5MA 2D65A 3FRKA 4Q6RA 2DKJA 2HUUA 3BWOA 3K40A 4K2IA 4ZSWA 4ADCA 5D5SA 4XJMA 1CL2A 3AEJC 1TOJA 3E2YA 4XJPA 3W1IA 3AATA 4W1WA 4JF0A 3AEJA 1JS6A 3HL2A 1YOOA 1YJYA 4P3MA 4WB0A 3N4SA 4GDYA 3WY7A 1WYVA 4F5FA 2X8UA 3FSLA 1BQAA 3DXWA 4PFFA 1IJIA 1H1CA 1LK9A 2BI1A 1S0AA 3A2BA 3OKSA 4LNLA 3BS8A 2XBNA 3E77A 1AHYA 3G0TA 5M4DA 2O0RA 4ZSYA 1LW4A 1SF2A 3D6KA 1AHXA 1ARIA 2ZC0A 3QI6A 1XEYA 2E7JA 2VLFA 1G4VA 3LG0A 2QB3A 3QHXA 1ZOBA 3PD6B 3TFTA 1RVYA 2ORDA 4IXOA 9AATA 1N31A 2QLRA 1B9IA 1ASNA 1DTYA 1CQ7A 2A1VA 3GZDA 4W91A 3ZZJA 1B4XA 2CSTA 1O61A 3CQ6A 1AJSB 4GRXA 1KKPA 1PMOA 2Z20A 4RKCA 3JWAA 1LW5A 1TPLA 4IYOA 4MKKA 3FZ8A 3PDXA 4E77A 5EUEA 1GD9A 2OKKA 3BV0A 3PPLA 3FD0A 1Z3ZA 2CB1A 2X5DA 4RKDA 1ASBA 2FNUA 2FN6A 1MGVA 1SZKA 1PG8A 1ZC9A 2W8WA 3MKJA 2W7DA 1MDOA 3F0HA 3LV2A 1IUGA 2GB3A 3MC6A 3EI8A 3WLXA 4Y0HA 2CY8A 5K8BA 4UQVA 2W7EA 3MAFA 1S07A 2GQNA 1SZUA 3FVXA 3FCRA 5FT6A 2Z61A 1AMAA 2D63A 1V2FA 5M49A 3FTBA 1W7MA 4JF1A 5JAYA 3GZDC 4E1OA 4RJYA 4A00A 2AY8A 4JE5D 3NUIA 4HF8A 2AY6A 1WYUB 4RJ0A 3T32A 4OTLA 1PFFA 2V0YA 2YKXA 1RV4A 2D64A 2R0TA 3DU4A 1AY5A 4R5FA 4UHNA 2HP2A 2C0RA 1V2EA 1PMMA 4ZWVA 4GE4A 3TCMA 2AY1A 1D7VA 2TPLA 1AKBA 4U1TA 1LS3A 1QZ9A 2CJHA 2O1BA 2VGSA 4XQ2A 1BS0A 1OXPA 1EJIA 8AATA 2QBTA 2PO3A 3TQXA 2ZY2A 1CJ0A 2VGVA 2Q7WA 4F5JA 4DGTA 2VGTA 3BCXA 1D2FA 5E4ZA 3B1EA 3JW9A 5FT4A 4BHDA 1X29A 3FDBA 1XI9A 1E5FA 2YOBA 4A0RA 4B98A 4WXFA 4XJLA 4CXQA 1ASEA 1TOKA 2WK9A 1W3UA 4JE5A 1LC7A 3CBFA 2GSAA 3RCHA 4TMRA 4BA4A 4ZWMA 2W7IA 4R8DA 4ZASA 3LVKA 2EZ1A 2OGEA 3DXVA 4WYDA 1AJSA 2CFBA 1QGNA 2X3LA 3HT4A 3IF2A 4OMAA 4ATQA 4ZDLA 2YHKA 4E3QA 4GSAA 1ORDA 4J5UA 1SPAA 4WXGA 1AKCA 3NYUA 1G7XA 1M32A 2E54A 3PD6A 5E3KA 3DR4A 2HUIA 2KFPA 2DR1A 3ASBA 1CQ6A 3DC1A 4J8LA 4K2BA 1OHWA 3GSBA 1C0NA 3GZCA 2VIAA 5DB5A 4JEVA 4F5IA 3QGUA 1G7WA 4CXRA 4IX8A 3PIUA 1W7NA 3ASAA 3QPGA 1WKHA 4HVKA 2VI9A 2QMAA 1TARA 3ACZA 3PAAA 1KKJA 5KTBA 2W7KA 3EZ1A 3GETA 3PJ0A 1IAYA 1AMQA 3FQAA 3JU7A 3WCOA 2OQXA 5G4JA 1TATA 4PFNA 1ASFA 4ZDOA 2C44A 1UKJA 2WKAA 2NMPA 4IXZA 1P3WA 3E9KA 1DKAA 3LVLB 4ITXA 2YKUA 2BKWA 2AY4A 4I8AA 1YAAA 2AEVA 2D7YA 3RI6A 4M2JA 1AMSA 4WD2A 2W8JA 1IAXA 1EG5A 1VJOA 2VMOA 1C7OA 1OHVA 3P6KA 2VYCA 4KAMA 1GC3A 3PA9A 4H63Q 1ZODA 3EI7A 4AO9A 1M0NA 2BHXA 1CZEA 3N7NA 2W8UA 1SZSA 2VMNA 5DX5A 1TOGA 4BA5A 3MADA 2CTZA 1BJOA 1YJSA 5TF5A 3W1HA 4M2KA 1S06A 4IW7A 1AY4A 4MY5A 1IBJA 1KL1A 1WYTA 3AEOA 4Q75A 3FFRA 2BI2A 3QM2A 4Q76A 1V2DA 2EO5A 3PGYA 4F5GA 4A6UA 4ZLVA 1ASMA 5EIGA 1V72A 3A9XA 3WX9A 4NOGA 1ASGA 3USFA 2W8TA 2Z9XA 3B8XA 3E2ZA 5DJ9A 4ZDPA 3RBFA 2X5FA 2FYFA 1ARTA 2XH1A 3A9ZA 4EMYA 3DRDA 2ZSMA 1VP4A 4Y0DA 5EIGB 5HDMA 1OXOA 2DGKA 2WB6A 4WYGA 1YNUA 1N2TA 2CH1A 3H9XA 4A6TA 2ZYJA 4OC9A 4W8IA 3WZFA 5G09A 2R5CB 4N0BA 3F6TA 5E5IA 2EPJA 1CQ8A 4OT8A 1N8PA 3NRAA 5G2PA 3N0LA 3F9TA 2OKJA 1RVUA 5D95A 3EI5A 4F5MA 2W8VA 1T3IA 2FNIA 1Y4IA 1BJOB 2EH6A 1C7NA 1ARHA 1FC4A 2CINA 3H14A 1AAMA 3ZRPA 3FQ7A 2C7TA 7AATA 2YCNA 1AHGA 1JF9A 1O4SA 2YKYA 4PIWA 3ELEA 1CZCA 2Z1YA 2BIGA 3E2FA 2DKBA 1IX6A 3EIAA 4AZJA 2VMZA 3UE8A 3ZRQA 4N0WA 1GC4A 1MDXA 1AHEA 3VK2A 3VK3A 1AIBA 2W7HA 4B9BA 3KGXA 4FL0A 1J04A 3VP6A 4A0FA 3PDBB 1MAQA 2DGLA 1LC8A 1ASAA 1D7RA 2VMYA 3HBXA 1U08A 2QSRA 3L44A 1GBNA 3QBOA 4R5ZA 2W7FA 2AY7A 1QISA 3NTJA 4ISYA 4Q31A 3BWNC 3FVUA 2VMRA 4AZKA 3E6GA 1ELUA 3EIBA 4GE9A 4W1XA 2ZSLA 4ADDA 2D61A 2VMSA 5M46A 1M4NA 1AMRA 2HUFA 5FT5A 4MQRA 1B9HA 4XEWA 5DJ1A 3DYDA 3BCBA 3AOVA 2HP1A 3MAUA 4CVQA 3HQTA 1S08A 4LW2A 2CH2A 3G7QA 4RIZA 1ASCA 1QJ3A 3B1DA 3HDOA 1B5PA 4LW4A 3AEMC 4W5KA 2W7LA 4BMKA 5HXXA 3VK4A 3I5TA 3HVYA 2RFVA 1I29A 1B5OA 3L8AA 2BWOA 4A0GA 2YCTA 1C9CA 3AEMA 4QGRA 5EAAA 1S09A 2HOYA 3RCHB 2CJDA 3NU7A 4P7YA 3N4RA 3AENA 1D7SA 4WYCA 3NYTA 2ZJGA 1YJZA 3LWSA 3TATA 2C81A 5LH9A 2EGYA 5J8QA 3II0A 5BJ3A 3TFUA 1EQBA 4F4EA 4KXKA 1IVRA 2BIAA 1M0OA 3MEBA 4DQ6A 4MGRA 3VOMA 4F5KA 5G4IA 2D66A 3N4XA 3WGCA 1MLZA 3BB8A 4K05A 2QB2A 3OP7A 4IY7A 4H51A 2F8JA 3NX3A 4JEWA 3I16A 5AX8A 5F8VA 1M0PA 3Q8NA 3VAXA 3UWCA 2AY3A 4RAEA 3EI9A 4EFFA 4RITA 2Z67A 4FFCA 4BQ0A 2FKIA 4ADEA 3FKDA 2JGTA 2GMUA 2EZ2A 1WYUA 4RM1A 5C6UA 4OBUA 3CAIA 2VMTA 1MLYA 4R2NA 4UHMA 2W7MA 3FZ7A 4F5HA 3MBBA 4O6ZA 3BC8A 3COGA 4ATPA 3WKRA 2JJEA 3MAFB 5LHAA 3BWNA 4MSOA 4WB0B 1AJRA 3H7FA 2GMSA 2CJGA 4XAUA 2JJGA 4LNJA 4AH3A 1GC2A 4MQPA 1JG8A 4TV7A 5EFSA 3KE3A 4WYFA 3WCNA 5G2QA 2G6WA 1OHYA 4EU1A 4L0OA 1C7GA 1LC5A 1SVVA 3KGWA 2VMPA 2BYJA 1AICA 4MQQA 1BJNA 1YIZA 5F9SA 2VMUA 2WK7A 3A8UX 1G4XA 1WSTA 4IYOB 3LVMA 1MDZA 1FG7A 2ZP7A 1BT4A 2VMWA 1BJ4A 1ELQA 3HLMA 3JWBA 1BKGA 1I43A 1UU1A 1FG3A 1X0MA 3NU8A 2OATA 5I92A 4U2HA 4XJOA 4ADBA 1DJUA 1GC0A 2VGWA 2AY5A 2R2NA 1BQDA 2HOZA 1RV3A 4RLGA 3WKSA 2ZY4A 1ASLA 2VIBA 3BN1A 1W7LA 4IXSA 4WBTA 5EUNA 5EUDA 3FZ6A 1TOIA 1B8GA 1X2AA 3AEPA 1CL1A 2ZUKA 3JTXA 1WYVB 2AY9A 2BIEA 3BCAA 4ITGA 3ZZKA 4GEBA 4EB5A 2PB0A 2D5YA 3K28A 1GEWA 1LKCA 4LNMA 2HZPA 2OGAA 4UHOA 3AOWA 1AHFA 1H0CA 4F5LA 1QIRA 2Z9UA 3FQ8A 5G0AA 4EB7A 2DGMA 3DR7A 1AKAA 1O69A 2G7JA 3LVJA 4A0HA 3LY1A 3FFHA 4PVFA 3MC6C 3GR9A 2CANA 1UU2A 3CQ4A 2JJHA 3R4TA 5EQCA 2O7CA 1DGDA 1X28A 1AIAA 3ATHA 1TOEA 4A72A 1KMKA 1KMJA 4WP0A 3HMUA 4K2MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IWQ A;  4DBC A;  1AAW A;  1GEX A;  2W7G A;  2AEU A;  3NYS A;  5FT8 A;  1QIT A;  3A9Y A;  3AEN B;  1WYT B;  2AAT A;  3R9A A;  3RBL A;  3DZZ A;  1DGE A;  4UOY A;  4A6R A;  4ZM4 A;  1VEF A;  3GBX A;  2DOU A;  1CS1 A;  3P1T A;  3GWP A;  3RQ1 A;  1I48 A;  3EUC A;  4MKJ A;  3AV7 A;  4M2M A;  1D7U A;  4WLH A;  4WYE A;  1AY8 A;  1AX4 A;  4ZM3 A;  3CQ5 A;  1GDE A;  2R5C A;  5BJ4 A;  2BI3 A;  2YCP A;  4CBS A;  2VMQ A;  4OYT A;  2E7U A;  4OCA A;  5M4B A;  1ECX A;  3M5U A;  1I41 A;  1BW0 A;  1MAP A;  2BI9 A;  2QA3 A;  2VMV A;  2BYL A;  2Z9V A;  4AO4 A;  3QN6 A;  3ELP A;  3DOD A;  1IX8 A;  2R5E A;  1BJW A;  2JG2 A;  2VGU A;  4OBV A;  3RUY A;  2FM1 A;  3AEL A;  3EI6 A;  3EZS A;  2AY2 A;  2W7J A;  3IHJ A;  2YRR A;  3G8M A;  4WYA A;  1OAT A;  2D7Z A;  1IX7 A;  1UU0 A;  2BWN A;  1DJE A;  3N75 A;  4JEY A;  5EAV A;  4E3R A;  2VI8 A;  4LC3 A;  3E2Z B;  1O62 A;  1M7Y A;  3PDB A;  5HHY A;  3KKI A;  1SFF A;  2BI5 A;  2V1P A;  3NNK A;  1DFO A;  3UAK A;  4AOA A;  1TAS A;  2HOX A;  2Z1Z A;  2PB2 A;  1JS3 A;  4WLJ A;  1QJ5 A;  3ZRR A;  1C4K A;  3JZL A;  3WGB A;  1Z7D A;  1J32 A;  3B46 A;  3I4J A;  2HOR A;  4KYO A;  1WKG A;  4GE7 A;  1W23 A;  1M6S A;  4W1V A;  2E7I A;  2WK8 A;  2JIS A;  3FVS A;  2VLH A;  4Y0I A;  2ZY5 A;  4TN4 A;  1YIY A;  3GJU A;  1M0Q A;  4CBR A;  2VMX A;  3K7Y A;  1GEY A;  2FQ6 A;  2ZY3 A;  3B1C A;  3NDN A;  1E5E A;  2JJF A;  1DJ9 A;  4WXB A;  4JEZ A;  1ASD A;  3ECD A;  1GCK A;  2BWP A;  3ISL A;  1ARG A;  4JEX A;  2YRI A;  3NUB A;  3W1J A;  1KL2 A;  2YKV A;  4XK1 A;  4ZAH A;  3FDD A;  2Z9W A;  1ARS A;  2VGZ A;  3N5M A;  2D65 A;  3FRK A;  4Q6R A;  2DKJ A;  2HUU A;  3BWO A;  3K40 A;  4K2I A;  4ZSW A;  4ADC A;  5D5S A;  4XJM A;  1CL2 A;  3AEJ C;  1TOJ A;  3E2Y A;  4XJP A;  3W1I A;  3AAT A;  4W1W A;  4JF0 A;  3AEJ A;  1JS6 A;  3HL2 A;  1YOO A;  1YJY A;  4P3M A;  4WB0 A;  4GDY A;  3WY7 A;  1WYV A;  4F5F A;  2X8U A;  3FSL A;  1BQA A;  3DXW A;  4PFF A;  1IJI A;  1H1C A;  1LK9 A;  2BI1 A;  1S0A A;  3A2B A;  3OKS A;  4LNL A;  3BS8 A;  2XBN A;  3E77 A;  1AHY A;  3G0T A;  5M4D A;  2O0R A;  4ZSY A;  1LW4 A;  1SF2 A;  3D6K A;  1AHX A;  1ARI A;  2ZC0 A;  3QI6 A;  1XEY A;  2E7J A;  2VLF A;  1G4V A;  3LG0 A;  2QB3 A;  3QHX A;  1ZOB A;  3PD6 B;  3TFT A;  1RVY A;  2ORD A;  4IXO A;  9AAT A;  1N31 A;  2QLR A;  1B9I A;  1ASN A;  1DTY A;  1CQ7 A;  3GZD A;  4W91 A;  3ZZJ A;  1B4X A;  2CST A;  1O61 A;  3CQ6 A;  1AJS B;  4GRX A;  1KKP A;  1PMO A;  2Z20 A;  4RKC A;  3JWA A;  1LW5 A;  1TPL A;  4IYO A;  4MKK A;  3FZ8 A;  3PDX A;  4E77 A;  5EUE A;  1GD9 A;  2OKK A;  3BV0 A;  3PPL A;  3FD0 A;  1Z3Z A;  2CB1 A;  2X5D A;  4RKD A;  1ASB A;  2FNU A;  2FN6 A;  1MGV A;  1SZK A;  1PG8 A;  1ZC9 A;  2W8W A;  3MKJ A;  2W7D A;  1MDO A;  3F0H A;  3LV2 A;  1IUG A;  2GB3 A;  3MC6 A;  3EI8 A;  3WLX A;  4Y0H A;  2CY8 A;  5K8B A;  4UQV A;  2W7E A;  3MAF A;  1S07 A;  2GQN A;  1SZU A;  3FVX A;  3FCR A;  5FT6 A;  2Z61 A;  1AMA A;  2D63 A;  1V2F A;  5M49 A;  3FTB A;  1W7M A;  4JF1 A;  5JAY A;  3GZD C;  4E1O A;  4RJY A;  4A00 A;  2AY8 A;  4JE5 D;  3NUI A;  4HF8 A;  2AY6 A;  1WYU B;  4RJ0 A;  3T32 A;  4OTL A;  1PFF A;  2V0Y A;  2YKX A;  1RV4 A;  2D64 A;  2R0T A;  3DU4 A;  1AY5 A;  4R5F A;  4UHN A;  2HP2 A;  2C0R A;  1V2E A;  1PMM A;  4ZWV A;  4GE4 A;  3TCM A;  2AY1 A;  1D7V A;  2TPL A;  1AKB A;  4U1T A;  1LS3 A;  1QZ9 A;  2CJH A;  2O1B A;  2VGS A;  4XQ2 A;  1BS0 A;  1OXP A;  1EJI A;  8AAT A;  2QBT A;  2PO3 A;  3TQX A;  2ZY2 A;  1CJ0 A;  2VGV A;  2Q7W A;  4F5J A;  4DGT A;  2VGT A;  3BCX A;  1D2F A;  5E4Z A;  3B1E A;  3JW9 A;  5FT4 A;  4BHD A;  1X29 A;  3FDB A;  1XI9 A;  1E5F A;  2YOB A;  4A0R A;  4B98 A;  4WXF A;  4XJL A;  4CXQ A;  1ASE A;  1TOK A;  2WK9 A;  1W3U A;  4JE5 A;  1LC7 A;  3CBF A;  2GSA A;  3RCH A;  4TMR A;  4BA4 A;  4ZWM A;  2W7I A;  4R8D A;  4ZAS A;  3LVK A;  2EZ1 A;  2OGE A;  3DXV A;  4WYD A;  1AJS A;  2CFB A;  1QGN A;  2X3L A;  3HT4 A;  3IF2 A;  4OMA A;  4ATQ A;  4ZDL A;  2YHK A;  4E3Q A;  4GSA A;  1ORD A;  4J5U A;  1SPA A;  4WXG A;  1AKC A;  3NYU A;  1G7X A;  1M32 A;  2E54 A;  3PD6 A;  5E3K A;  3DR4 A;  2HUI A;  2DR1 A;  3ASB A;  1CQ6 A;  3DC1 A;  4J8L A;  4K2B A;  1OHW A;  3GSB A;  1C0N A;  3GZC A;  2VIA A;  5DB5 A;  4JEV A;  4F5I A;  3QGU A;  1G7W A;  4CXR A;  4IX8 A;  3PIU A;  1W7N A;  3ASA A;  3QPG A;  1WKH A;  4HVK A;  2VI9 A;  2QMA A;  1TAR A;  3ACZ A;  3PAA A;  1KKJ A;  2W7K A;  3EZ1 A;  3GET A;  3PJ0 A;  1IAY A;  1AMQ A;  3FQA A;  3JU7 A;  3WCO A;  2OQX A;  5G4J A;  1TAT A;  4PFN A;  1ASF A;  4ZDO A;  2C44 A;  1UKJ A;  2WKA A;  2NMP A;  4IXZ A;  1P3W A;  3E9K A;  1DKA A;  3LVL B;  4ITX A;  2YKU A;  2BKW A;  2AY4 A;  4I8A A;  1YAA A;  2AEV A;  2D7Y A;  3RI6 A;  4M2J A;  1AMS A;  4WD2 A;  2W8J A;  1IAX A;  1EG5 A;  1VJO A;  2VMO A;  1C7O A;  1OHV A;  3P6K A;  2VYC A;  4KAM A;  1GC3 A;  3PA9 A;  1ZOD A;  3EI7 A;  4AO9 A;  1M0N A;  2BHX A;  1CZE A;  2W8U A;  1SZS A;  2VMN A;  5DX5 A;  1TOG A;  4BA5 A;  3MAD A;  2CTZ A;  1BJO A;  1YJS A;  5TF5 A;  3W1H A;  4M2K A;  1S06 A;  4IW7 A;  1AY4 A;  4MY5 A;  1IBJ A;  1KL1 A;  1WYT A;  3AEO A;  4Q75 A;  3FFR A;  2BI2 A;  3QM2 A;  4Q76 A;  1V2D A;  2EO5 A;  3PGY A;  4F5G A;  4A6U A;  4ZLV A;  1ASM A;  5EIG A;  1V72 A;  3A9X A;  3WX9 A;  4NOG A;  1ASG A;  3USF A;  2W8T A;  2Z9X A;  3B8X A;  3E2Z A;  5DJ9 A;  4ZDP A;  3RBF A;  2X5F A;  2FYF A;  1ART A;  2XH1 A;  3A9Z A;  4EMY A;  3DRD A;  2ZSM A;  1VP4 A;  4Y0D A;  5EIG B;  5HDM A;  1OXO A;  2DGK A;  4WYG A;  1YNU A;  1N2T A;  2CH1 A;  4A6T A;  2ZYJ A;  4OC9 A;  4W8I A;  3WZF A;  5G09 A;  2R5C B;  4N0B A;  3F6T A;  5E5I A;  2EPJ A;  1CQ8 A;  4OT8 A;  1N8P A;  3NRA A;  5G2P A;  3N0L A;  3F9T A;  2OKJ A;  1RVU A;  5D95 A;  3EI5 A;  4F5M A;  2W8V A;  1T3I A;  2FNI A;  1Y4I A;  1BJO B;  2EH6 A;  1C7N A;  1ARH A;  1FC4 A;  2CIN A;  3H14 A;  1AAM A;  3ZRP A;  3FQ7 A;  2C7T A;  7AAT A;  2YCN A;  1AHG A;  1JF9 A;  1O4S A;  2YKY A;  4PIW A;  3ELE A;  1CZC A;  2Z1Y A;  2BIG A;  3E2F A;  2DKB A;  1IX6 A;  3EIA A;  4AZJ A;  2VMZ A;  3UE8 A;  3ZRQ A;  4N0W A;  1GC4 A;  1MDX A;  1AHE A;  3VK2 A;  3VK3 A;  1AIB A;  2W7H A;  4B9B A;  3KGX A;  4FL0 A;  1J04 A;  3VP6 A;  4A0F A;  3PDB B;  1MAQ A;  2DGL A;  1LC8 A;  1ASA A;  1D7R A;  2VMY A;  3HBX A;  1U08 A;  3L44 A;  1GBN A;  3QBO A;  4R5Z A;  2W7F A;  2AY7 A;  1QIS A;  3NTJ A;  4ISY A;  4Q31 A;  3BWN C;  3FVU A;  2VMR A;  4AZK A;  3E6G A;  1ELU A;  3EIB A;  4GE9 A;  4W1X A;  2ZSL A;  4ADD A;  2D61 A;  2VMS A;  5M46 A;  1M4N A;  1AMR A;  2HUF A;  5FT5 A;  4MQR A;  1B9H A;  4XEW A;  5DJ1 A;  3DYD A;  3BCB A;  3AOV A;  2HP1 A;  3MAU A;  4CVQ A;  3HQT A;  1S08 A;  4LW2 A;  2CH2 A;  3G7Q A;  4RIZ A;  1ASC A;  1QJ3 A;  3B1D A;  3HDO A;  1B5P A;  4LW4 A;  3AEM C;  4W5K A;  2W7L A;  4BMK A;  5HXX A;  3VK4 A;  3I5T A;  3HVY A;  2RFV A;  1I29 A;  1B5O A;  3L8A A;  2BWO A;  4A0G A;  2YCT A;  1C9C A;  3AEM A;  4QGR A;  5EAA A;  1S09 A;  2HOY A;  3RCH B;  2CJD A;  3NU7 A;  4P7Y A;  3AEN A;  1D7S A;  4WYC A;  3NYT A;  2ZJG A;  1YJZ A;  3LWS A;  3TAT A;  2C81 A;  5LH9 A;  2EGY A;  5J8Q A;  3II0 A;  5BJ3 A;  3TFU A;  1EQB A;  4F4E A;  4KXK A;  1IVR A;  2BIA A;  1M0O A;  3MEB A;  4DQ6 A;  4MGR A;  3VOM A;  4F5K A;  5G4I A;  2D66 A;  3WGC A;  1MLZ A;  3BB8 A;  2QB2 A;  3OP7 A;  4IY7 A;  4H51 A;  2F8J A;  3NX3 A;  4JEW A;  3I16 A;  5AX8 A;  5F8V A;  1M0P A;  3Q8N A;  3VAX A;  3UWC A;  2AY3 A;  4RAE A;  3EI9 A;  4EFF A;  4RIT A;  2Z67 A;  4FFC A;  4BQ0 A;  4ADE A;  3FKD A;  2JGT A;  2GMU A;  2EZ2 A;  1WYU A;  4RM1 A;  5C6U A;  4OBU A;  3CAI A;  2VMT A;  1MLY A;  4R2N A;  4UHM A;  2W7M A;  3FZ7 A;  4F5H A;  3MBB A;  4O6Z A;  3BC8 A;  3COG A;  4ATP A;  3WKR A;  2JJE A;  3MAF B;  5LHA A;  3BWN A;  4MSO A;  4WB0 B;  1AJR A;  3H7F A;  2GMS A;  2CJG A;  4XAU A;  2JJG A;  4LNJ A;  4AH3 A;  1GC2 A;  4MQP A;  1JG8 A;  4TV7 A;  5EFS A;  3KE3 A;  4WYF A;  3WCN A;  5G2Q A;  2G6W A;  1OHY A;  4EU1 A;  4L0O A;  1C7G A;  1LC5 A;  1SVV A;  3KGW A;  2VMP A;  2BYJ A;  1AIC A;  4MQQ A;  1BJN A;  1YIZ A;  5F9S A;  2VMU A;  2WK7 A;  3A8U X;  1G4X A;  1WST A;  4IYO B;  3LVM A;  1MDZ A;  1FG7 A;  2ZP7 A;  1BT4 A;  2VMW A;  1BJ4 A;  1ELQ A;  3HLM A;  3JWB A;  1BKG A;  1I43 A;  1UU1 A;  1FG3 A;  1X0M A;  3NU8 A;  2OAT A;  5I92 A;  4U2H A;  4XJO A;  4ADB A;  1DJU A;  1GC0 A;  2VGW A;  2AY5 A;  2R2N A;  1BQD A;  2HOZ A;  1RV3 A;  4RLG A;  3WKS A;  2ZY4 A;  1ASL A;  2VIB A;  3BN1 A;  1W7L A;  4IXS A;  4WBT A;  5EUN A;  5EUD A;  3FZ6 A;  1TOI A;  1B8G A;  1X2A A;  3AEP A;  1CL1 A;  2ZUK A;  3JTX A;  1WYV B;  2AY9 A;  2BIE A;  3BCA A;  4ITG A;  3ZZK A;  4GEB A;  4EB5 A;  2PB0 A;  2D5Y A;  3K28 A;  1GEW A;  1LKC A;  4LNM A;  2HZP A;  2OGA A;  4UHO A;  3AOW A;  1AHF A;  1H0C A;  4F5L A;  1QIR A;  2Z9U A;  3FQ8 A;  5G0A A;  4EB7 A;  2DGM A;  3DR7 A;  1AKA A;  1O69 A;  3LVJ A;  4A0H A;  3LY1 A;  3FFH A;  4PVF A;  3MC6 C;  3GR9 A;  2CAN A;  1UU2 A;  3CQ4 A;  2JJH A;  3R4T A;  5EQC A;  2O7C A;  1DGD A;  1X28 A;  1AIA A;  3ATH A;  1TOE A;  4A72 A;  1KMK A;  1KMJ A;  4WP0 A;  3HMU A;  4K2M A; 
#chains in the Genus database with same CATH topology
 5IWQ A;  4DBC A;  1AAW A;  1GEX A;  2W7G A;  2AEU A;  3NYS A;  5FT8 A;  1QIT A;  3A9Y A;  3AEN B;  1WYT B;  2AAT A;  3R9A A;  3RBL A;  3DZZ A;  1DGE A;  4UOY A;  4A6R A;  4ZM4 A;  1VEF A;  3GBX A;  2DOU A;  1CS1 A;  3P1T A;  3GWP A;  3RQ1 A;  1I48 A;  3EUC A;  4MKJ A;  3AV7 A;  4M2M A;  1D7U A;  4WLH A;  4WYE A;  1AY8 A;  1AX4 A;  4ZM3 A;  3CQ5 A;  2EYQ A;  1GDE A;  2R5C A;  5BJ4 A;  2BI3 A;  2YCP A;  4CBS A;  2VMQ A;  4OYT A;  2E7U A;  4OCA A;  5M4B A;  1ECX A;  3M5U A;  1I41 A;  1BW0 A;  1MAP A;  2BI9 A;  2QA3 A;  2VMV A;  2BYL A;  2Z9V A;  4AO4 A;  3QN6 A;  3ELP A;  3DOD A;  1IX8 A;  2R5E A;  1BJW A;  2JG2 A;  2VGU A;  4OBV A;  3RUY A;  2FM1 A;  3AEL A;  3EI6 A;  3EZS A;  2AY2 A;  2W7J A;  3IHJ A;  2YRR A;  3G8M A;  4WYA A;  1OAT A;  2D7Z A;  1IX7 A;  1UU0 A;  2BWN A;  1DJE A;  3N75 A;  4JEY A;  5EAV A;  4E3R A;  2VI8 A;  4LC3 A;  3E2Z B;  1O62 A;  1M7Y A;  3PDB A;  5HHY A;  3KKI A;  1SFF A;  2BI5 A;  2V1P A;  3NNK A;  1DFO A;  3UAK A;  4AOA A;  1TAS A;  2HOX A;  2Z1Z A;  2PB2 A;  1JS3 A;  4WLJ A;  1QJ5 A;  3ZRR A;  1C4K A;  3JZL A;  3WGB A;  1Z7D A;  1J32 A;  3B46 A;  3I4J A;  2HOR A;  4KYO A;  1WKG A;  4GE7 A;  1W23 A;  1M6S A;  4W1V A;  2E7I A;  2WK8 A;  2JIS A;  3FVS A;  2VLH A;  4Y0I A;  2ZY5 A;  4TN4 A;  1YIY A;  3GJU A;  1M0Q A;  4CBR A;  2VMX A;  3K7Y A;  1GEY A;  2FQ6 A;  2ZY3 A;  3B1C A;  3NDN A;  1E5E A;  2JJF A;  1DJ9 A;  4WXB A;  4JEZ A;  1ASD A;  3ECD A;  1GCK A;  2BWP A;  3ISL A;  1ARG A;  4JEX A;  2YRI A;  3NUB A;  3W1J A;  1KL2 A;  2YKV A;  4XK1 A;  4ZAH A;  3FDD A;  2Z9W A;  1ARS A;  2VGZ A;  3N5M A;  2D65 A;  3FRK A;  4Q6R A;  2DKJ A;  2HUU A;  3BWO A;  3K40 A;  4K2I A;  4ZSW A;  4ADC A;  5D5S A;  4XJM A;  1CL2 A;  3AEJ C;  1TOJ A;  3E2Y A;  4XJP A;  3W1I A;  3AAT A;  4W1W A;  4JF0 A;  3AEJ A;  1JS6 A;  3HL2 A;  1YOO A;  1YJY A;  4P3M A;  4WB0 A;  3N4S A;  4GDY A;  3WY7 A;  1WYV A;  4F5F A;  2X8U A;  3FSL A;  1BQA A;  3DXW A;  4PFF A;  1IJI A;  1H1C A;  1LK9 A;  2BI1 A;  1S0A A;  3A2B A;  3OKS A;  4LNL A;  3BS8 A;  2XBN A;  3E77 A;  1AHY A;  3G0T A;  5M4D A;  2O0R A;  4ZSY A;  1LW4 A;  1SF2 A;  3D6K A;  1AHX A;  1ARI A;  2ZC0 A;  3QI6 A;  1XEY A;  2E7J A;  2VLF A;  1G4V A;  3LG0 A;  2QB3 A;  3QHX A;  1ZOB A;  3PD6 B;  3TFT A;  1RVY A;  2ORD A;  4IXO A;  9AAT A;  1N31 A;  2QLR A;  1B9I A;  1ASN A;  1DTY A;  1CQ7 A;  2A1V A;  3GZD A;  4W91 A;  3ZZJ A;  1B4X A;  2CST A;  1O61 A;  3CQ6 A;  1AJS B;  4GRX A;  1KKP A;  1PMO A;  2Z20 A;  4RKC A;  3JWA A;  1LW5 A;  1TPL A;  4IYO A;  4MKK A;  3FZ8 A;  3PDX A;  4E77 A;  5EUE A;  1GD9 A;  2OKK A;  3BV0 A;  3PPL A;  3FD0 A;  1Z3Z A;  2CB1 A;  2X5D A;  4RKD A;  1ASB A;  2FNU A;  2FN6 A;  1MGV A;  1SZK A;  1PG8 A;  1ZC9 A;  2W8W A;  3MKJ A;  2W7D A;  1MDO A;  3F0H A;  3LV2 A;  1IUG A;  2GB3 A;  3MC6 A;  3EI8 A;  3WLX A;  4Y0H A;  2CY8 A;  5K8B A;  4UQV A;  2W7E A;  3MAF A;  1S07 A;  2GQN A;  1SZU A;  3FVX A;  3FCR A;  5FT6 A;  2Z61 A;  1AMA A;  2D63 A;  1V2F A;  5M49 A;  3FTB A;  1W7M A;  4JF1 A;  5JAY A;  3GZD C;  4E1O A;  4RJY A;  4A00 A;  2AY8 A;  4JE5 D;  3NUI A;  4HF8 A;  2AY6 A;  1WYU B;  4RJ0 A;  3T32 A;  4OTL A;  1PFF A;  2V0Y A;  2YKX A;  1RV4 A;  2D64 A;  2R0T A;  3DU4 A;  1AY5 A;  4R5F A;  4UHN A;  2HP2 A;  2C0R A;  1V2E A;  1PMM A;  4ZWV A;  4GE4 A;  3TCM A;  2AY1 A;  1D7V A;  2TPL A;  1AKB A;  4U1T A;  1LS3 A;  1QZ9 A;  2CJH A;  2O1B A;  2VGS A;  4XQ2 A;  1BS0 A;  1OXP A;  1EJI A;  8AAT A;  2QBT A;  2PO3 A;  3TQX A;  2ZY2 A;  1CJ0 A;  2VGV A;  2Q7W A;  4F5J A;  4DGT A;  2VGT A;  3BCX A;  1D2F A;  5E4Z A;  3B1E A;  3JW9 A;  5FT4 A;  4BHD A;  1X29 A;  3FDB A;  1XI9 A;  1E5F A;  2YOB A;  4A0R A;  4B98 A;  4WXF A;  4XJL A;  4CXQ A;  1ASE A;  1TOK A;  2WK9 A;  1W3U A;  4JE5 A;  1LC7 A;  3CBF A;  2GSA A;  3RCH A;  4TMR A;  4BA4 A;  4ZWM A;  2W7I A;  4R8D A;  4ZAS A;  3LVK A;  2EZ1 A;  2OGE A;  3DXV A;  4WYD A;  1AJS A;  2CFB A;  1QGN A;  2X3L A;  3HT4 A;  3IF2 A;  4OMA A;  4ATQ A;  4ZDL A;  2YHK A;  4E3Q A;  4GSA A;  1ORD A;  4J5U A;  1SPA A;  4WXG A;  1AKC A;  3NYU A;  1G7X A;  1M32 A;  2E54 A;  3PD6 A;  5E3K A;  3DR4 A;  2HUI A;  2KFP A;  2DR1 A;  3ASB A;  1CQ6 A;  3DC1 A;  4J8L A;  4K2B A;  1OHW A;  3GSB A;  1C0N A;  3GZC A;  2VIA A;  5DB5 A;  4JEV A;  4F5I A;  3QGU A;  1G7W A;  4CXR A;  4IX8 A;  3PIU A;  1W7N A;  3ASA A;  3QPG A;  1WKH A;  4HVK A;  2VI9 A;  2QMA A;  1TAR A;  3ACZ A;  3PAA A;  1KKJ A;  5KTB A;  2W7K A;  3EZ1 A;  3GET A;  3PJ0 A;  1IAY A;  1AMQ A;  3FQA A;  3JU7 A;  3WCO A;  2OQX A;  5G4J A;  1TAT A;  4PFN A;  1ASF A;  4ZDO A;  2C44 A;  1UKJ A;  2WKA A;  2NMP A;  4IXZ A;  1P3W A;  3E9K A;  1DKA A;  3LVL B;  4ITX A;  2YKU A;  2BKW A;  2AY4 A;  4I8A A;  1YAA A;  2AEV A;  2D7Y A;  3RI6 A;  4M2J A;  1AMS A;  4WD2 A;  2W8J A;  1IAX A;  1EG5 A;  1VJO A;  2VMO A;  1C7O A;  1OHV A;  3P6K A;  2VYC A;  4KAM A;  1GC3 A;  3PA9 A;  4H63 Q;  1ZOD A;  3EI7 A;  4AO9 A;  1M0N A;  2BHX A;  1CZE A;  3N7N A;  2W8U A;  1SZS A;  2VMN A;  5DX5 A;  1TOG A;  4BA5 A;  3MAD A;  2CTZ A;  1BJO A;  1YJS A;  5TF5 A;  3W1H A;  4M2K A;  1S06 A;  4IW7 A;  1AY4 A;  4MY5 A;  1IBJ A;  1KL1 A;  1WYT A;  3AEO A;  4Q75 A;  3FFR A;  2BI2 A;  3QM2 A;  4Q76 A;  1V2D A;  2EO5 A;  3PGY A;  4F5G A;  4A6U A;  4ZLV A;  1ASM A;  5EIG A;  1V72 A;  3A9X A;  3WX9 A;  4NOG A;  1ASG A;  3USF A;  2W8T A;  2Z9X A;  3B8X A;  3E2Z A;  5DJ9 A;  4ZDP A;  3RBF A;  2X5F A;  2FYF A;  1ART A;  2XH1 A;  3A9Z A;  4EMY A;  3DRD A;  2ZSM A;  1VP4 A;  4Y0D A;  5EIG B;  5HDM A;  1OXO A;  2DGK A;  2WB6 A;  4WYG A;  1YNU A;  1N2T A;  2CH1 A;  3H9X A;  4A6T A;  2ZYJ A;  4OC9 A;  4W8I A;  3WZF A;  5G09 A;  2R5C B;  4N0B A;  3F6T A;  5E5I A;  2EPJ A;  1CQ8 A;  4OT8 A;  1N8P A;  3NRA A;  5G2P A;  3N0L A;  3F9T A;  2OKJ A;  1RVU A;  5D95 A;  3EI5 A;  4F5M A;  2W8V A;  1T3I A;  2FNI A;  1Y4I A;  1BJO B;  2EH6 A;  1C7N A;  1ARH A;  1FC4 A;  2CIN A;  3H14 A;  1AAM A;  3ZRP A;  3FQ7 A;  2C7T A;  7AAT A;  2YCN A;  1AHG A;  1JF9 A;  1O4S A;  2YKY A;  4PIW A;  3ELE A;  1CZC A;  2Z1Y A;  2BIG A;  3E2F A;  2DKB A;  1IX6 A;  3EIA A;  4AZJ A;  2VMZ A;  3UE8 A;  3ZRQ A;  4N0W A;  1GC4 A;  1MDX A;  1AHE A;  3VK2 A;  3VK3 A;  1AIB A;  2W7H A;  4B9B A;  3KGX A;  4FL0 A;  1J04 A;  3VP6 A;  4A0F A;  3PDB B;  1MAQ A;  2DGL A;  1LC8 A;  1ASA A;  1D7R A;  2VMY A;  3HBX A;  1U08 A;  2QSR A;  3L44 A;  1GBN A;  3QBO A;  4R5Z A;  2W7F A;  2AY7 A;  1QIS A;  3NTJ A;  4ISY A;  4Q31 A;  3BWN C;  3FVU A;  2VMR A;  4AZK A;  3E6G A;  1ELU A;  3EIB A;  4GE9 A;  4W1X A;  2ZSL A;  4ADD A;  2D61 A;  2VMS A;  5M46 A;  1M4N A;  1AMR A;  2HUF A;  5FT5 A;  4MQR A;  1B9H A;  4XEW A;  5DJ1 A;  3DYD A;  3BCB A;  1KAF A;  3AOV A;  2HP1 A;  3MAU A;  4CVQ A;  3HQT A;  1S08 A;  4LW2 A;  2CH2 A;  3G7Q A;  4RIZ A;  1ASC A;  1QJ3 A;  3B1D A;  3HDO A;  1B5P A;  4LW4 A;  3AEM C;  4W5K A;  2W7L A;  4BMK A;  5HXX A;  3VK4 A;  3I5T A;  3HVY A;  2RFV A;  1I29 A;  1B5O A;  3L8A A;  2BWO A;  4A0G A;  2YCT A;  1C9C A;  3AEM A;  4QGR A;  5EAA A;  1S09 A;  2HOY A;  3RCH B;  2CJD A;  3NU7 A;  4P7Y A;  3N4R A;  3AEN A;  1D7S A;  4WYC A;  3NYT A;  2ZJG A;  1YJZ A;  3LWS A;  3TAT A;  2C81 A;  5LH9 A;  2EGY A;  5J8Q A;  3II0 A;  5BJ3 A;  3TFU A;  1EQB A;  4F4E A;  4KXK A;  1IVR A;  2BIA A;  1M0O A;  3MEB A;  4DQ6 A;  4MGR A;  3VOM A;  4F5K A;  5G4I A;  2D66 A;  3N4X A;  3WGC A;  1MLZ A;  3BB8 A;  4K05 A;  2QB2 A;  3OP7 A;  4IY7 A;  4H51 A;  2F8J A;  3NX3 A;  4JEW A;  3I16 A;  5AX8 A;  5F8V A;  1M0P A;  3Q8N A;  3VAX A;  3UWC A;  2AY3 A;  4RAE A;  3EI9 A;  4EFF A;  4RIT A;  2Z67 A;  4FFC A;  4BQ0 A;  2FKI A;  4ADE A;  3FKD A;  2JGT A;  2GMU A;  2EZ2 A;  1WYU A;  4RM1 A;  5C6U A;  4OBU A;  3CAI A;  2VMT A;  1MLY A;  4R2N A;  4UHM A;  2W7M A;  3FZ7 A;  4F5H A;  3MBB A;  4O6Z A;  3BC8 A;  3COG A;  4ATP A;  3WKR A;  2JJE A;  3MAF B;  5LHA A;  3BWN A;  4MSO A;  4WB0 B;  1AJR A;  3H7F A;  2GMS A;  2CJG A;  4XAU A;  2JJG A;  4LNJ A;  4AH3 A;  1GC2 A;  4MQP A;  1JG8 A;  4TV7 A;  5EFS A;  3KE3 A;  4WYF A;  3WCN A;  5G2Q A;  2G6W A;  1OHY A;  4EU1 A;  4L0O A;  1C7G A;  1LC5 A;  1SVV A;  3KGW A;  2VMP A;  2BYJ A;  1AIC A;  4MQQ A;  1BJN A;  1YIZ A;  5F9S A;  2VMU A;  2WK7 A;  3A8U X;  1G4X A;  1WST A;  4IYO B;  3LVM A;  1MDZ A;  1FG7 A;  2ZP7 A;  1BT4 A;  2VMW A;  1BJ4 A;  1ELQ A;  3HLM A;  3JWB A;  1BKG A;  1I43 A;  1UU1 A;  1FG3 A;  1X0M A;  3NU8 A;  2OAT A;  5I92 A;  4U2H A;  4XJO A;  4ADB A;  1DJU A;  1GC0 A;  2VGW A;  2AY5 A;  2R2N A;  1BQD A;  2HOZ A;  1RV3 A;  4RLG A;  3WKS A;  2ZY4 A;  1ASL A;  2VIB A;  3BN1 A;  1W7L A;  4IXS A;  4WBT A;  5EUN A;  5EUD A;  3FZ6 A;  1TOI A;  1B8G A;  1X2A A;  3AEP A;  1CL1 A;  2ZUK A;  3JTX A;  1WYV B;  2AY9 A;  2BIE A;  3BCA A;  4ITG A;  3ZZK A;  4GEB A;  4EB5 A;  2PB0 A;  2D5Y A;  3K28 A;  1GEW A;  1LKC A;  4LNM A;  2HZP A;  2OGA A;  4UHO A;  3AOW A;  1AHF A;  1H0C A;  4F5L A;  1QIR A;  2Z9U A;  3FQ8 A;  5G0A A;  4EB7 A;  2DGM A;  3DR7 A;  1AKA A;  1O69 A;  2G7J A;  3LVJ A;  4A0H A;  3LY1 A;  3FFH A;  4PVF A;  3MC6 C;  3GR9 A;  2CAN A;  1UU2 A;  3CQ4 A;  2JJH A;  3R4T A;  5EQC A;  2O7C A;  1DGD A;  1X28 A;  1AIA A;  3ATH A;  1TOE A;  4A72 A;  1KMK A;  1KMJ A;  4WP0 A;  3HMU A;  4K2M A; 
#chains in the Genus database with same CATH homology
 5IWQ A;  4DBC A;  1AAW A;  1GEX A;  2W7G A;  2AEU A;  3NYS A;  5FT8 A;  1QIT A;  3A9Y A;  3AEN B;  1WYT B;  2AAT A;  3R9A A;  3RBL A;  3DZZ A;  1DGE A;  4UOY A;  4A6R A;  4ZM4 A;  1VEF A;  3GBX A;  2DOU A;  1CS1 A;  3P1T A;  3GWP A;  3RQ1 A;  1I48 A;  3EUC A;  4MKJ A;  3AV7 A;  4M2M A;  1D7U A;  4WLH A;  4WYE A;  1AY8 A;  1AX4 A;  4ZM3 A;  3CQ5 A;  2EYQ A;  1GDE A;  2R5C A;  5BJ4 A;  2BI3 A;  2YCP A;  4CBS A;  2VMQ A;  4OYT A;  2E7U A;  4OCA A;  5M4B A;  1ECX A;  3M5U A;  1I41 A;  1BW0 A;  1MAP A;  2BI9 A;  2QA3 A;  2VMV A;  2BYL A;  2Z9V A;  4AO4 A;  3QN6 A;  3ELP A;  3DOD A;  1IX8 A;  2R5E A;  1BJW A;  2JG2 A;  2VGU A;  4OBV A;  3RUY A;  2FM1 A;  3AEL A;  3EI6 A;  3EZS A;  2AY2 A;  2W7J A;  3IHJ A;  2YRR A;  3G8M A;  4WYA A;  1OAT A;  2D7Z A;  1IX7 A;  1UU0 A;  2BWN A;  1DJE A;  3N75 A;  4JEY A;  5EAV A;  4E3R A;  2VI8 A;  4LC3 A;  3E2Z B;  1O62 A;  1M7Y A;  3PDB A;  5HHY A;  3KKI A;  1SFF A;  2BI5 A;  2V1P A;  3NNK A;  1DFO A;  3UAK A;  4AOA A;  1TAS A;  2HOX A;  2Z1Z A;  2PB2 A;  1JS3 A;  4WLJ A;  1QJ5 A;  3ZRR A;  1C4K A;  3JZL A;  3WGB A;  1Z7D A;  1J32 A;  3B46 A;  3I4J A;  2HOR A;  4KYO A;  1WKG A;  4GE7 A;  1W23 A;  1M6S A;  4W1V A;  2E7I A;  2WK8 A;  2JIS A;  3FVS A;  2VLH A;  4Y0I A;  2ZY5 A;  4TN4 A;  1YIY A;  3GJU A;  1M0Q A;  4CBR A;  2VMX A;  3K7Y A;  1GEY A;  2FQ6 A;  2ZY3 A;  3B1C A;  3NDN A;  1E5E A;  2JJF A;  1DJ9 A;  4WXB A;  4JEZ A;  1ASD A;  3ECD A;  1GCK A;  2BWP A;  3ISL A;  1ARG A;  4JEX A;  2YRI A;  3NUB A;  3W1J A;  1KL2 A;  2YKV A;  4XK1 A;  4ZAH A;  3FDD A;  2Z9W A;  1ARS A;  2VGZ A;  3N5M A;  2D65 A;  3FRK A;  4Q6R A;  2DKJ A;  2HUU A;  3BWO A;  3K40 A;  4K2I A;  4ZSW A;  4ADC A;  5D5S A;  4XJM A;  1CL2 A;  3AEJ C;  1TOJ A;  3E2Y A;  4XJP A;  3W1I A;  3AAT A;  4W1W A;  4JF0 A;  3AEJ A;  1JS6 A;  3HL2 A;  1YOO A;  1YJY A;  4P3M A;  4WB0 A;  3N4S A;  4GDY A;  3WY7 A;  1WYV A;  4F5F A;  2X8U A;  3FSL A;  1BQA A;  3DXW A;  4PFF A;  1IJI A;  1H1C A;  1LK9 A;  2BI1 A;  1S0A A;  3A2B A;  3OKS A;  4LNL A;  3BS8 A;  2XBN A;  3E77 A;  1AHY A;  3G0T A;  5M4D A;  2O0R A;  4ZSY A;  1LW4 A;  1SF2 A;  3D6K A;  1AHX A;  1ARI A;  2ZC0 A;  3QI6 A;  1XEY A;  2E7J A;  2VLF A;  1G4V A;  3LG0 A;  2QB3 A;  3QHX A;  1ZOB A;  3PD6 B;  3TFT A;  1RVY A;  2ORD A;  4IXO A;  9AAT A;  1N31 A;  2QLR A;  1B9I A;  1ASN A;  1DTY A;  1CQ7 A;  2A1V A;  3GZD A;  4W91 A;  3ZZJ A;  1B4X A;  2CST A;  1O61 A;  3CQ6 A;  1AJS B;  4GRX A;  1KKP A;  1PMO A;  2Z20 A;  4RKC A;  3JWA A;  1LW5 A;  1TPL A;  4IYO A;  4MKK A;  3FZ8 A;  3PDX A;  4E77 A;  5EUE A;  1GD9 A;  2OKK A;  3BV0 A;  3PPL A;  3FD0 A;  1Z3Z A;  2CB1 A;  2X5D A;  4RKD A;  1ASB A;  2FNU A;  2FN6 A;  1MGV A;  1SZK A;  1PG8 A;  1ZC9 A;  2W8W A;  3MKJ A;  2W7D A;  1MDO A;  3F0H A;  3LV2 A;  1IUG A;  2GB3 A;  3MC6 A;  3EI8 A;  3WLX A;  4Y0H A;  2CY8 A;  5K8B A;  4UQV A;  2W7E A;  3MAF A;  1S07 A;  2GQN A;  1SZU A;  3FVX A;  3FCR A;  5FT6 A;  2Z61 A;  1AMA A;  2D63 A;  1V2F A;  5M49 A;  3FTB A;  1W7M A;  4JF1 A;  5JAY A;  3GZD C;  4E1O A;  4RJY A;  4A00 A;  2AY8 A;  4JE5 D;  3NUI A;  4HF8 A;  2AY6 A;  1WYU B;  4RJ0 A;  3T32 A;  4OTL A;  1PFF A;  2V0Y A;  2YKX A;  1RV4 A;  2D64 A;  2R0T A;  3DU4 A;  1AY5 A;  4R5F A;  4UHN A;  2HP2 A;  2C0R A;  1V2E A;  1PMM A;  4ZWV A;  4GE4 A;  3TCM A;  2AY1 A;  1D7V A;  2TPL A;  1AKB A;  4U1T A;  1LS3 A;  1QZ9 A;  2CJH A;  2O1B A;  2VGS A;  4XQ2 A;  1BS0 A;  1OXP A;  1EJI A;  8AAT A;  2QBT A;  2PO3 A;  3TQX A;  2ZY2 A;  1CJ0 A;  2VGV A;  2Q7W A;  4F5J A;  4DGT A;  2VGT A;  3BCX A;  1D2F A;  5E4Z A;  3B1E A;  3JW9 A;  5FT4 A;  4BHD A;  1X29 A;  3FDB A;  1XI9 A;  1E5F A;  2YOB A;  4A0R A;  4B98 A;  4WXF A;  4XJL A;  4CXQ A;  1ASE A;  1TOK A;  2WK9 A;  1W3U A;  4JE5 A;  1LC7 A;  3CBF A;  2GSA A;  3RCH A;  4TMR A;  4BA4 A;  4ZWM A;  2W7I A;  4R8D A;  4ZAS A;  3LVK A;  2EZ1 A;  2OGE A;  3DXV A;  4WYD A;  1AJS A;  2CFB A;  1QGN A;  2X3L A;  3HT4 A;  3IF2 A;  4OMA A;  4ATQ A;  4ZDL A;  2YHK A;  4E3Q A;  4GSA A;  1ORD A;  4J5U A;  1SPA A;  4WXG A;  1AKC A;  3NYU A;  1G7X A;  1M32 A;  2E54 A;  3PD6 A;  5E3K A;  3DR4 A;  2HUI A;  2KFP A;  2DR1 A;  3ASB A;  1CQ6 A;  3DC1 A;  4J8L A;  4K2B A;  1OHW A;  3GSB A;  1C0N A;  3GZC A;  2VIA A;  5DB5 A;  4JEV A;  4F5I A;  3QGU A;  1G7W A;  4CXR A;  4IX8 A;  3PIU A;  1W7N A;  3ASA A;  3QPG A;  1WKH A;  4HVK A;  2VI9 A;  2QMA A;  1TAR A;  3ACZ A;  3PAA A;  1KKJ A;  5KTB A;  2W7K A;  3EZ1 A;  3GET A;  3PJ0 A;  1IAY A;  1AMQ A;  3FQA A;  3JU7 A;  3WCO A;  2OQX A;  5G4J A;  1TAT A;  4PFN A;  1ASF A;  4ZDO A;  2C44 A;  1UKJ A;  2WKA A;  2NMP A;  4IXZ A;  1P3W A;  3E9K A;  1DKA A;  3LVL B;  4ITX A;  2YKU A;  2BKW A;  2AY4 A;  4I8A A;  1YAA A;  2AEV A;  2D7Y A;  3RI6 A;  4M2J A;  1AMS A;  4WD2 A;  2W8J A;  1IAX A;  1EG5 A;  1VJO A;  2VMO A;  1C7O A;  1OHV A;  3P6K A;  2VYC A;  4KAM A;  1GC3 A;  3PA9 A;  4H63 Q;  1ZOD A;  3EI7 A;  4AO9 A;  1M0N A;  2BHX A;  1CZE A;  3N7N A;  2W8U A;  1SZS A;  2VMN A;  5DX5 A;  1TOG A;  4BA5 A;  3MAD A;  2CTZ A;  1BJO A;  1YJS A;  5TF5 A;  3W1H A;  4M2K A;  1S06 A;  4IW7 A;  1AY4 A;  4MY5 A;  1IBJ A;  1KL1 A;  1WYT A;  3AEO A;  4Q75 A;  3FFR A;  2BI2 A;  3QM2 A;  4Q76 A;  1V2D A;  2EO5 A;  3PGY A;  4F5G A;  4A6U A;  4ZLV A;  1ASM A;  5EIG A;  1V72 A;  3A9X A;  3WX9 A;  4NOG A;  1ASG A;  3USF A;  2W8T A;  2Z9X A;  3B8X A;  3E2Z A;  5DJ9 A;  4ZDP A;  3RBF A;  2X5F A;  2FYF A;  1ART A;  2XH1 A;  3A9Z A;  4EMY A;  3DRD A;  2ZSM A;  1VP4 A;  4Y0D A;  5EIG B;  5HDM A;  1OXO A;  2DGK A;  2WB6 A;  4WYG A;  1YNU A;  1N2T A;  2CH1 A;  3H9X A;  4A6T A;  2ZYJ A;  4OC9 A;  4W8I A;  3WZF A;  5G09 A;  2R5C B;  4N0B A;  3F6T A;  5E5I A;  2EPJ A;  1CQ8 A;  4OT8 A;  1N8P A;  3NRA A;  5G2P A;  3N0L A;  3F9T A;  2OKJ A;  1RVU A;  5D95 A;  3EI5 A;  4F5M A;  2W8V A;  1T3I A;  2FNI A;  1Y4I A;  1BJO B;  2EH6 A;  1C7N A;  1ARH A;  1FC4 A;  2CIN A;  3H14 A;  1AAM A;  3ZRP A;  3FQ7 A;  2C7T A;  7AAT A;  2YCN A;  1AHG A;  1JF9 A;  1O4S A;  2YKY A;  4PIW A;  3ELE A;  1CZC A;  2Z1Y A;  2BIG A;  3E2F A;  2DKB A;  1IX6 A;  3EIA A;  4AZJ A;  2VMZ A;  3UE8 A;  3ZRQ A;  4N0W A;  1GC4 A;  1MDX A;  1AHE A;  3VK2 A;  3VK3 A;  1AIB A;  2W7H A;  4B9B A;  3KGX A;  4FL0 A;  1J04 A;  3VP6 A;  4A0F A;  3PDB B;  1MAQ A;  2DGL A;  1LC8 A;  1ASA A;  1D7R A;  2VMY A;  3HBX A;  1U08 A;  2QSR A;  3L44 A;  1GBN A;  3QBO A;  4R5Z A;  2W7F A;  2AY7 A;  1QIS A;  3NTJ A;  4ISY A;  4Q31 A;  3BWN C;  3FVU A;  2VMR A;  4AZK A;  3E6G A;  1ELU A;  3EIB A;  4GE9 A;  4W1X A;  2ZSL A;  4ADD A;  2D61 A;  2VMS A;  5M46 A;  1M4N A;  1AMR A;  2HUF A;  5FT5 A;  4MQR A;  1B9H A;  4XEW A;  5DJ1 A;  3DYD A;  3BCB A;  3AOV A;  2HP1 A;  3MAU A;  4CVQ A;  3HQT A;  1S08 A;  4LW2 A;  2CH2 A;  3G7Q A;  4RIZ A;  1ASC A;  1QJ3 A;  3B1D A;  3HDO A;  1B5P A;  4LW4 A;  3AEM C;  4W5K A;  2W7L A;  4BMK A;  5HXX A;  3VK4 A;  3I5T A;  3HVY A;  2RFV A;  1I29 A;  1B5O A;  3L8A A;  2BWO A;  4A0G A;  2YCT A;  1C9C A;  3AEM A;  4QGR A;  5EAA A;  1S09 A;  2HOY A;  3RCH B;  2CJD A;  3NU7 A;  4P7Y A;  3N4R A;  3AEN A;  1D7S A;  4WYC A;  3NYT A;  2ZJG A;  1YJZ A;  3LWS A;  3TAT A;  2C81 A;  5LH9 A;  2EGY A;  5J8Q A;  3II0 A;  5BJ3 A;  3TFU A;  1EQB A;  4F4E A;  4KXK A;  1IVR A;  2BIA A;  1M0O A;  3MEB A;  4DQ6 A;  4MGR A;  3VOM A;  4F5K A;  5G4I A;  2D66 A;  3N4X A;  3WGC A;  1MLZ A;  3BB8 A;  4K05 A;  2QB2 A;  3OP7 A;  4IY7 A;  4H51 A;  2F8J A;  3NX3 A;  4JEW A;  3I16 A;  5AX8 A;  5F8V A;  1M0P A;  3Q8N A;  3VAX A;  3UWC A;  2AY3 A;  4RAE A;  3EI9 A;  4EFF A;  4RIT A;  2Z67 A;  4FFC A;  4BQ0 A;  2FKI A;  4ADE A;  3FKD A;  2JGT A;  2GMU A;  2EZ2 A;  1WYU A;  4RM1 A;  5C6U A;  4OBU A;  3CAI A;  2VMT A;  1MLY A;  4R2N A;  4UHM A;  2W7M A;  3FZ7 A;  4F5H A;  3MBB A;  4O6Z A;  3BC8 A;  3COG A;  4ATP A;  3WKR A;  2JJE A;  3MAF B;  5LHA A;  3BWN A;  4MSO A;  4WB0 B;  1AJR A;  3H7F A;  2GMS A;  2CJG A;  4XAU A;  2JJG A;  4LNJ A;  4AH3 A;  1GC2 A;  4MQP A;  1JG8 A;  4TV7 A;  5EFS A;  3KE3 A;  4WYF A;  3WCN A;  5G2Q A;  2G6W A;  1OHY A;  4EU1 A;  4L0O A;  1C7G A;  1LC5 A;  1SVV A;  3KGW A;  2VMP A;  2BYJ A;  1AIC A;  4MQQ A;  1BJN A;  1YIZ A;  5F9S A;  2VMU A;  2WK7 A;  3A8U X;  1G4X A;  1WST A;  4IYO B;  3LVM A;  1MDZ A;  1FG7 A;  2ZP7 A;  1BT4 A;  2VMW A;  1BJ4 A;  1ELQ A;  3HLM A;  3JWB A;  1BKG A;  1I43 A;  1UU1 A;  1FG3 A;  1X0M A;  3NU8 A;  2OAT A;  5I92 A;  4U2H A;  4XJO A;  4ADB A;  1DJU A;  1GC0 A;  2VGW A;  2AY5 A;  2R2N A;  1BQD A;  2HOZ A;  1RV3 A;  4RLG A;  3WKS A;  2ZY4 A;  1ASL A;  2VIB A;  3BN1 A;  1W7L A;  4IXS A;  4WBT A;  5EUN A;  5EUD A;  3FZ6 A;  1TOI A;  1B8G A;  1X2A A;  3AEP A;  1CL1 A;  2ZUK A;  3JTX A;  1WYV B;  2AY9 A;  2BIE A;  3BCA A;  4ITG A;  3ZZK A;  4GEB A;  4EB5 A;  2PB0 A;  2D5Y A;  3K28 A;  1GEW A;  1LKC A;  4LNM A;  2HZP A;  2OGA A;  4UHO A;  3AOW A;  1AHF A;  1H0C A;  4F5L A;  1QIR A;  2Z9U A;  3FQ8 A;  5G0A A;  4EB7 A;  2DGM A;  3DR7 A;  1AKA A;  1O69 A;  2G7J A;  3LVJ A;  4A0H A;  3LY1 A;  3FFH A;  4PVF A;  3MC6 C;  3GR9 A;  2CAN A;  1UU2 A;  3CQ4 A;  2JJH A;  3R4T A;  5EQC A;  2O7C A;  1DGD A;  1X28 A;  1AIA A;  3ATH A;  1TOE A;  4A72 A;  1KMK A;  1KMJ A;  4WP0 A;  3HMU A;  4K2M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...