1WKHA

Acetylornithine aminotransferase from thermus thermophilus hb8
Total Genus 129
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
129
sequence length
387
structure length
387
Chain Sequence
WRALLEAEKTLDSGVYNKHDLLIVRGQGARVWDAEGNEYIDCVGGYGVANLGHGNPEVVEAVKRQAETLMAMPQTLPTPMRGEFYRTLTAILPPELNRVFPVNSGTEANEAALKFARAHTGRKKFVAAMRGFSGRTMGSLSVTWEPKYREPFLPLVEPVEFIPYNDVEALKRAVDEETAAVILEPVQGEGGVRPATPEFLRAAREITQEKGALLILDEIQTGMGRTGKRFAFEHFGIVPDILTLAKALGGGVPLGVAVMREEVARSMPKGGHGTTFGGNPLAMAAGVAAIRYLERTRLWERAAELGPWFMEKLRAIPSPKIREVRGMGLMVGLELKEKAAPYIARLEKEHRVLALQAGPTVIRFLPPLVIEKEDLERVVEAVRAVLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acetylornithine/acetyl-lysine aminotransferase
publication title Acetylornithine aminotransferase from thermus thermophilus HB8
rcsb
source organism Thermus thermophilus
molecule tags Transferase
total genus 129
structure length 387
sequence length 387
chains with identical sequence B
ec nomenclature ec 2.6.1.11: Acetylornithine transaminase.
pdb deposition date 2004-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00202 Aminotran_3 Aminotransferase class-III
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 1wkhA02
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 1wkhA01
4Y0HA 2W7MA 4GRXA 4BA4A 4ZDPA 2ZC0A 2F8JA 2DR1A 5FT8A 3FKDA 2JJHA 3DXWA 1AHEA 3E77A 1AHFA 2AY4A 5FT5A 2VGSA 2DGMA 1FG7A 1GEWA 2W8TA 3K7YA 4DQ6A 2CH2A 3M5UA 1GCKA 1M0OA 2D64A 5F9SA 2C0RA 1GEYA 4ZWMA 1SPAA 4K2BA 2ZUKA 3ASAA 1ASDA 2O1BA 1OATA 3BN1A 3RBLA 3UE8A 3MC6A 3MAFB 3VK4A 3FFRA 2JJGA 2VMRA 1AMRA 1AIBA 2AEVA 1BKGA 2OGEA 2Z61A 4W91A 2VGZA 3EZ1A 1SFFA 1W23A 2YHKA 1WYTA 1EG5A 1EQBA 4AZJA 1CJ0A 9AATA 1N2TA 3I16A 3HLMA 1I48A 2BYJA 4MY5A 2D7YA 1ELQA 3AOWA 3GBXA 2FM1A 1QZ9A 4GEBA 2ZJGA 3K40A 3TATA 2D61A 3PDBB 4W1VA 4CXRA 2QA3A 4DBCA 2CANA 1Y4IA 2VGTA 2Z9WA 3AOVA 4RM1A 5G2PA 4ITXA 4WBTA 2AY3A 3HL2A 1IVRA 2VLHA 3NX3A 1UKJA 5DB5A 4IW7A 1I29A 1DJUA 1GC4A 3IHJA 4WYCA 3DR7A 3EZSA 4IYOB 3USFA 3AEOA 2HOXA 3ELEA 2C7TA 2Q7WA 1D7UA 1AICA 3BCXA 3EIBA 3F0HA 2PO3A 4B98A 1EJIA 1WSTA 2X3LA 1D7SA 1Z3ZA 2VIBA 4WXBA 4Y0DA 4ZSYA 3PA9A 1YIZA 2HUIA 3NRAA 2DGKA 1IAYA 1FC4A 1LK9A 1MLYA 1GBNA 4WLJA 2AY8A 2GMUA 3ISLA 2PB0A 3D6KA 4WB0A 4WD2A 4MKJA 3G0TA 5EUEA 1V2DA 3VK3A 2E7JA 4XJMA 4M2MA 5LH9A 4WXGA 3LVKA 3JWBA 4H51A 4UHMA 1M4NA 4ZDLA 4LC3A 1J32A 1D7VA 3HMUA 1MDOA 2D7ZA 2W7GA 3WLXA 1G4VA 2BI3A 2ZYJA 2WK7A 3A8UX 3L44A 4JEVA 4Q76A 4UQVA 3BV0A 1ASEA 2R0TA 3AV7A 2JGTA 3NUIA 3KGWA 1BT4A 3PD6B 4HVKA 1DJEA 2PB2A 3EIAA 1IJIA 3AEJA 1ARTA 1V2EA 3QM2A 3E2ZA 5E4ZA 3P1TA 3EUCA 3DYDA 1C7NA 1G7WA 3QI6A 3VAXA 1U08A 1ASFA 1ZODA 2W8VA 3FZ6A 5BJ3A 1VP4A 3DC1A 3MC6C 3LVMA 1LC7A 4N0WA 1B5PA 3NNKA 4M2KA 2ZP7A 4A0RA 4A00A 3N0LA 4UOYA 3EI6A 1ASCA 3FVXA 1O61A 3TFTA 2OATA 3JZLA 2R2NA 1C7OA 1TARA 2D66A 2VMWA 3DR4A 3BWOA 1AAMA 1PFFA 4AH3A 2AEUA 1JS3A 3CQ6A 2QMAA 3JU7A 1UU0A 2VLFA 3K28A 3MEBA 1UU2A 1X0MA 3ELPA 2DKBA 3N5MA 1CL1A 4ZM4A 1DGDA 4I8AA 3FRKA 1WYVA 3EI9A 3WCNA 1M6SA 1AKBA 3FQ8A 2E7IA 3UAKA 3R9AA 2ORDA 1SZKA 3WGCA 1I41A 3P6KA 1QISA 4U2HA 4E77A 1TATA 1PG8A 1TOJA 1P3WA 2Z20A 1YAAA 2HORA 4IXZA 3GR9A 4U1TA 5EIGA 1V72A 4HF8A 1IUGA 4A0GA 2YKXA 2BI5A 2W7HA 3UWCA 3FCRA 4JE5A 3NDNA 4ISYA 1AMSA 2BI1A 5G4JA 5C6UA 4M2JA 3RCHA 2AY2A 2QB2A 1O4SA 2HZPA 5G0AA 3F6TA 2R5CB 4XEWA 3FDDA 4KAMA 1S08A 1WKGA 2W8UA 4KXKA 4R5ZA 1AJSA 2W7JA 5EAVA 3I4JA 2VGVA 2VMQA 4WYFA 1BQAA 2BYLA 1B8GA 1C0NA 2WK9A 3BB8A 1CQ8A 3I5TA 3GZDA 1MAPA 2X8UA 3F9TA 1DJ9A 4TMRA 2HUFA 3DRDA 2VMNA 3MADA 4P7YA 5EUNA 2AY1A 3L8AA 2BIEA 4UHOA 3WX9A 4LNJA 4LNLA 4MKKA 4FFCA 1AX4A 1PMOA 4Q31A 3EI8A 1IAXA 1TOGA 2O0RA 4O6ZA 2ZY5A 4JEWA 1B9HA 2DGLA 3HT4A 1YIYA 2BWNA 2BKWA 2JISA 3COGA 1AHXA 3AENB 1QJ3A 1LW5A 3KE3A 3A2BA 1X2AA 2HOZA 1G4XA 3VK2A 1RV3A 1KL2A 2D63A 4CVQA 4F5LA 2W7EA 4N0BA 4OYTA 4A0FA 2YCTA 3BCBA 5EQCA 1H0CA 3GWPA 3GZCA 4R8DA 1DKAA 2AY5A 4W8IA 2NMPA 3AEPA 4MQPA 3FFHA 4W1WA 3DXVA 4PVFA 5JAYA 1WYVB 2ZSMA 3LVLB 1DGEA 1OHVA 1RVYA 1B4XA 4LNMA 2ZY2A 1MLZA 5EIGB 3R4TA 1ARHA 1M32A 3PDXA 4ZAHA 3HQTA 5DX5A 2HUUA 1YJZA 4JE5D 3GETA 3ZRPA 2FNIA 4MGRA 1S06A 4OBVA 4ZWVA 4NOGA 3NYUA 4JEYA 1GC3A 1QGNA 1AHGA 1AJSB 4P3MA 3AELA 5HDMA 3JW9A 4MSOA 4ADBA 4EMYA 1LS3A 3JTXA 3WY7A 1AKCA 2TPLA 2YKVA 3W1IA 4JF0A 3FQ7A 1N31A 1AJRA 1MDZA 2GQNA 4ATPA 3Q8NA 2OQXA 5K8BA 1GD9A 1I43A 5I92A 2AY9A 2CJHA 4ZASA 1V2FA 1DFOA 1GC2A 4F4EA 3VP6A 3W1JA 2ZY4A 4ZDOA 3JWAA 3FDBA 4JEXA 4GE4A 2DKJA 4E3QA 2Z1ZA 4WP0A 1QIRA 1O62A 1WYTB 3EI5A 1H1CA 3WKRA 4OBUA 4E3RA 2V1PA 5M4BA 2X5DA 3AATA 2W7DA 3NU7A 1ORDA 2FNUA 4OMAA 3TCMA 2VMPA 1KMJA 1JG8A 7AATA 4ADDA 4K2IA 1W7MA 5FT6A 5HHYA 2FN6A 2O7CA 1CL2A 2CFBA 2W7FA 4UHNA 5M4DA 5G4IA 1IX8A 1Z7DA 1XEYA 2VMOA 4ZLVA 4BQ0A 2Z9XA 2C81A 4OT8A 4XQ2A 1AY5A 1TOEA 1SZUA 1VJOA 2XBNA 4WYGA 3LV2A 4Q6RA 2W8WA 3E2FA 3PPLA 1YOOA 2CTZA 1LKCA 3E9KA 5DJ9A 2CSTA 4AO9A 4F5HA 2Z67A 2EGYA 1LW4A 3FQAA 1YNUA 1ASMA 3WCOA 1BJNA 1T3IA 2DOUA 3FTBA 3GJUA 2D5YA 2HP1A 3FZ8A 4RKDA 5G09A 3FZ7A 4J5UA 4ADEA 2VMTA 4CBRA 1GDEA 3N75A 2W7IA 2WK8A 4WB0B 2VMXA 4FL0A 3T32A 1CQ6A 5M46A 3RI6A 4RLGA 2VGWA 2D65A 4XAUA 1BJOA 2QB3A 4QGRA 4B9BA 1UU1A 1BS0A 4ZSWA 4F5MA 4F5IA 8AATA 4EB7A 3NYSA 3PIUA 4BA5A 1JF9A 2AY7A 3KGXA 1X29A 1X28A 3PGYA 1AIAA 2GB3A 1AHYA 5FT4A 2BI2A 1ASBA 5AX8A 1ZC9A 2QLRA 3E2ZB 1KKPA 2Z9UA 3PDBA 3B8XA 4J8LA 4TV7A 3ZRQA 4IY7A 1IBJA 2R5EA 4RJ0A 1RV4A 2Z9VA 1D7RA 1OHWA 1N8PA 3CAIA 2G6WA 3HBXA 3FD0A 2OKJA 4R2NA 1AY4A 4IYOA 1C7GA 1SVVA 3AEJC 3B46A 5DJ1A 1TASA 2BIAA 3NU8A 4E1OA 1RVUA 4LW2A 2X5FA 4XJPA 3ATHA 2CINA 3MBBA 5F8VA 5D5SA 1WYUA 3QGUA 1ECXA 1IX7A 2CJGA 1JS6A 4AZKA 4EU1A 4WYEA 4LW4A 4CXQA 3HDOA 4A6RA 1ARIA 3H14A 1M0QA 1M0NA 5D95A 4WYDA 1OXPA 3HVYA 2CY8A 4IXOA 4R5FA 2JJEA 5E3KA 3VOMA 3AEMA 4A0HA 2E54A 4F5KA 1M7YA 3ASBA 1B9IA 4Q75A 3QN6A 3PAAA 4BHDA 2YRRA 2Z1YA 3QPGA 4WYAA 4TN4A 3G8MA 3FSLA 4OC9A 3PD6A 2GSAA 4RITA 5M49A 1QJ5A 4XJLA 1BJOB 1ELUA 1SZSA 3QBOA 2OGAA 4IXSA 3RBFA 3RCHB 2AATA 3BCAA 2V0YA 3DZZA 5E5IA 3NUBA 4Y0IA 1AMQA 3ACZA 2VIAA 3BWNA 3LVJA 3A9ZA 1AKAA 2BWPA 1BJWA 4IX8A 1CQ7A 5G2QA 2YKUA 3II0A 2VI8A 3DODA 3EI7A 2ZY3A 3ECDA 1BW0A 1ZOBA 2VGUA 3B1EA 5EFSA 2HP2A 3E6GA 2WKAA 1KL1A 4JEZA 2BI9A 3A9XA 4GDYA 4W5KA 2C44A 3LWSA 2JJFA 1W7NA 3PJ0A 3BS8A 1TOIA 3LY1A 4EB5A 1YJSA 2ZSLA 4MQRA 1G7XA 3ZRRA 4PFNA 3RUYA 2QBTA 1GEXA 3FVUA 2VMVA 4GSAA 4K2MA 4RIZA 1W7LA 5LHAA 4RAEA 2EPJA 4F5JA 1AMAA 1S0AA 3GZDC 3MKJA 1MGVA 4ZM3A 3BC8A 1ASGA 3H7FA 1O69A 1WYUB 3CQ4A 2XH1A 3TQXA 4MQQA 1DTYA 4WLHA 1W3UA 1ASAA 4BMKA 2VMYA 3GSBA 2EH6A 1C4KA 3OKSA 4EFFA 1OHYA 3NTJA 1LC8A 1MDXA 5J8QA 2W7LA 1M0PA 1E5EA 1KMKA 1ARGA 2YCPA 2R5CA 3B1CA 3WKSA 4ADCA 4XK1A 3TFUA 1SF2A 5HXXA 1QITA 3WZFA 4WXFA 4PIWA 3ZZJA 3DU4A 4OTLA 4F5GA 3CQ5A 2CJDA 2CB1A 4AOAA 2VMSA 1D2FA 3LG0A 4A6TA 1WKHA 2VYCA 3AEMC 4F5FA 1FG3A 4OCAA 4ITGA 1TOKA 2AY6A 1OXOA 2RFVA 4W1XA 3WGBA 1ARSA 4PFFA 5IWQA 4KYOA 1BJ4A 5TF5A 2E7UA 1XI9A 1GC0A 2W7KA 2YKYA 2OKKA 3MAFA 3AENA 3W1HA 2HOYA 1IX6A 1CS1A 2JG2A 2BIGA 1J04A 2BWOA 2GMSA 2EZ1A 1E5FA 2YRIA 4RJYA 4XJOA 4CBSA 2EO5A 3A9YA 3OP7A 2FYFA 1CZEA 3BWNC 3RQ1A 1AY8A 2BHXA 3KKIA 1CZCA 3G7QA 1ASNA 5EUDA 3IF2A 4GE7A 4DGTA 4A6UA 2VMZA 1S09A 2EZ2A 1KKJA 1LC5A 1S07A 3B1DA 5BJ4A 4L0OA 4AO4A 1C9CA 4ATQA 4JF1A 3E2YA 4RKCA 3MAUA 1MAQA 4GE9A 5EAAA 1VEFA 2YCNA 3CBFA 3FVSA 1BQDA 3QHXA 2YOBA 4A72A 3NYTA 1B5OA 1YJYA 2CH1A 1AAWA 1ASLA 1PMMA 2VMUA 3ZZKA 2FQ6A 2W8JA 2VI9A 1TPLA
chains in the Genus database with same CATH superfamily
4Y0HA 2W7MA 4GRXA 4BA4A 4ZDPA 2ZC0A 2F8JA 2DR1A 2WB6A 5FT8A 3FKDA 2JJHA 3DXWA 1AHEA 3E77A 1AHFA 2AY4A 5FT5A 2VGSA 2DGMA 1FG7A 1GEWA 2W8TA 3K7YA 4DQ6A 2CH2A 3M5UA 1GCKA 1M0OA 2D64A 5F9SA 2C0RA 1GEYA 4ZWMA 1SPAA 4K2BA 2ZUKA 3ASAA 1ASDA 2O1BA 1OATA 3BN1A 3RBLA 3UE8A 3MC6A 3MAFB 3VK4A 3FFRA 2JJGA 2VMRA 1AMRA 1AIBA 2AEVA 1BKGA 2OGEA 2Z61A 4W91A 2VGZA 3EZ1A 1SFFA 1W23A 2YHKA 1WYTA 1EG5A 1EQBA 4AZJA 1CJ0A 9AATA 1N2TA 3I16A 3HLMA 1I48A 2BYJA 4MY5A 2D7YA 1ELQA 3AOWA 3GBXA 2FM1A 1QZ9A 4GEBA 2ZJGA 3K40A 3TATA 2D61A 3PDBB 4W1VA 4CXRA 2QA3A 4DBCA 2CANA 1Y4IA 2VGTA 2Z9WA 3AOVA 4RM1A 5G2PA 4ITXA 4WBTA 2AY3A 3HL2A 1IVRA 2VLHA 3NX3A 1UKJA 5DB5A 4IW7A 1I29A 1DJUA 1GC4A 3IHJA 4WYCA 4K05A 3DR7A 3EZSA 4IYOB 3USFA 3AEOA 2HOXA 3ELEA 2C7TA 2Q7WA 1D7UA 1AICA 3BCXA 3EIBA 3F0HA 2PO3A 4B98A 1EJIA 1WSTA 2X3LA 1D7SA 1Z3ZA 2VIBA 4WXBA 4Y0DA 4ZSYA 3PA9A 1YIZA 2HUIA 3NRAA 2DGKA 1IAYA 1FC4A 1LK9A 1MLYA 1GBNA 4WLJA 2AY8A 2GMUA 3ISLA 2PB0A 3D6KA 4WB0A 4WD2A 4MKJA 3G0TA 5EUEA 1V2DA 3VK3A 2E7JA 4XJMA 4M2MA 5LH9A 4WXGA 3LVKA 3JWBA 4H51A 4UHMA 1M4NA 4ZDLA 4LC3A 1J32A 1D7VA 3HMUA 1MDOA 2D7ZA 2W7GA 3WLXA 1G4VA 2BI3A 2ZYJA 2WK7A 3A8UX 3L44A 4JEVA 4Q76A 4UQVA 1KAFA 3BV0A 1ASEA 2R0TA 3AV7A 2JGTA 3NUIA 3KGWA 1BT4A 3PD6B 4HVKA 1DJEA 2PB2A 3EIAA 1IJIA 3AEJA 1ARTA 1V2EA 3QM2A 3E2ZA 5E4ZA 3P1TA 3EUCA 3DYDA 1C7NA 1G7WA 3QI6A 3VAXA 1U08A 1ASFA 1ZODA 2W8VA 3FZ6A 5BJ3A 1VP4A 3DC1A 3MC6C 3LVMA 1LC7A 4N0WA 1B5PA 3NNKA 4M2KA 2G7JA 2ZP7A 4A0RA 4A00A 3N0LA 4UOYA 3EI6A 1ASCA 3FVXA 1O61A 3TFTA 2OATA 3JZLA 2R2NA 1C7OA 1TARA 2D66A 2VMWA 3DR4A 3BWOA 1AAMA 1PFFA 4AH3A 2AEUA 1JS3A 3CQ6A 2QMAA 3JU7A 1UU0A 2VLFA 3K28A 3MEBA 1UU2A 1X0MA 3ELPA 2DKBA 3N5MA 1CL1A 4ZM4A 1DGDA 4I8AA 3FRKA 1WYVA 3EI9A 3WCNA 1M6SA 1AKBA 3FQ8A 2E7IA 3UAKA 3R9AA 2ORDA 1SZKA 3WGCA 1I41A 3P6KA 1QISA 4U2HA 4E77A 1TATA 1PG8A 1TOJA 1P3WA 2Z20A 1YAAA 2HORA 4IXZA 3GR9A 4U1TA 5EIGA 1V72A 4HF8A 1IUGA 4A0GA 2YKXA 2BI5A 2W7HA 3UWCA 3FCRA 4JE5A 3NDNA 4ISYA 3N4XA 1AMSA 2BI1A 5G4JA 5C6UA 4M2JA 3RCHA 2AY2A 2QB2A 1O4SA 2HZPA 5G0AA 3F6TA 2R5CB 4XEWA 3FDDA 4KAMA 1S08A 1WKGA 2W8UA 4KXKA 4R5ZA 1AJSA 2W7JA 5EAVA 3I4JA 2VGVA 2VMQA 4WYFA 1BQAA 2BYLA 1B8GA 1C0NA 2WK9A 3BB8A 1CQ8A 3I5TA 3GZDA 1MAPA 2X8UA 3F9TA 1DJ9A 4TMRA 2HUFA 3DRDA 2VMNA 3MADA 4P7YA 5EUNA 2AY1A 3L8AA 2BIEA 4UHOA 3WX9A 4LNJA 4LNLA 4MKKA 4FFCA 1AX4A 1PMOA 4Q31A 3EI8A 1IAXA 1TOGA 2O0RA 4O6ZA 2ZY5A 4JEWA 1B9HA 2DGLA 3HT4A 1YIYA 2BWNA 2BKWA 2JISA 3COGA 1AHXA 3AENB 1QJ3A 1LW5A 3KE3A 3A2BA 1X2AA 2HOZA 1G4XA 3VK2A 1RV3A 1KL2A 2D63A 4CVQA 4F5LA 2W7EA 2FKIA 4N0BA 4OYTA 4A0FA 2YCTA 3BCBA 5EQCA 1H0CA 3GWPA 3GZCA 4R8DA 1DKAA 2AY5A 4W8IA 2NMPA 3AEPA 4MQPA 3FFHA 4W1WA 3DXVA 4PVFA 5JAYA 1WYVB 2ZSMA 3LVLB 1DGEA 1OHVA 1RVYA 1B4XA 4LNMA 2ZY2A 1MLZA 5EIGB 3R4TA 1ARHA 1M32A 3PDXA 4ZAHA 3HQTA 5DX5A 2HUUA 1YJZA 4JE5D 3GETA 3ZRPA 2FNIA 4MGRA 1S06A 4OBVA 4ZWVA 4NOGA 3NYUA 4JEYA 1GC3A 1QGNA 1AHGA 1AJSB 4P3MA 3AELA 5HDMA 3JW9A 4MSOA 4ADBA 4EMYA 1LS3A 3JTXA 3WY7A 1AKCA 2TPLA 2YKVA 3W1IA 4JF0A 3FQ7A 1N31A 1AJRA 1MDZA 2GQNA 4ATPA 3Q8NA 2OQXA 5K8BA 1GD9A 1I43A 5I92A 2AY9A 2CJHA 4ZASA 1V2FA 1DFOA 1GC2A 4F4EA 3VP6A 3W1JA 2ZY4A 4ZDOA 3JWAA 3FDBA 4JEXA 4GE4A 2DKJA 4E3QA 2Z1ZA 4WP0A 1QIRA 1O62A 1WYTB 3EI5A 1H1CA 3WKRA 4OBUA 4E3RA 2V1PA 5M4BA 2X5DA 3AATA 2W7DA 3NU7A 1ORDA 2FNUA 4OMAA 3TCMA 2VMPA 1KMJA 1JG8A 7AATA 4ADDA 4K2IA 1W7MA 5FT6A 5HHYA 2FN6A 2O7CA 1CL2A 2CFBA 2W7FA 4UHNA 5M4DA 5G4IA 1IX8A 1Z7DA 1XEYA 2VMOA 4ZLVA 4BQ0A 2Z9XA 2C81A 4OT8A 4XQ2A 1AY5A 1TOEA 1SZUA 1VJOA 2XBNA 4WYGA 3LV2A 4Q6RA 2W8WA 3E2FA 3PPLA 1YOOA 2CTZA 1LKCA 3E9KA 5DJ9A 2CSTA 4AO9A 4F5HA 2Z67A 2EGYA 1LW4A 3FQAA 1YNUA 1ASMA 3WCOA 1BJNA 1T3IA 2DOUA 3FTBA 3GJUA 2D5YA 2HP1A 3FZ8A 4RKDA 5G09A 3FZ7A 4J5UA 4ADEA 2VMTA 4CBRA 1GDEA 3N75A 2W7IA 2WK8A 4WB0B 2VMXA 4FL0A 3T32A 1CQ6A 5M46A 3RI6A 4RLGA 2VGWA 2D65A 4XAUA 1BJOA 2QB3A 4QGRA 4B9BA 1UU1A 1BS0A 4ZSWA 4F5MA 4F5IA 2EYQA 8AATA 4EB7A 3NYSA 3PIUA 4BA5A 1JF9A 2AY7A 3KGXA 1X29A 1X28A 3PGYA 1AIAA 2GB3A 1AHYA 5FT4A 2BI2A 1ASBA 5AX8A 1ZC9A 2QLRA 3E2ZB 1KKPA 2Z9UA 3PDBA 3B8XA 4J8LA 4TV7A 3ZRQA 4IY7A 1IBJA 2R5EA 4RJ0A 1RV4A 2Z9VA 1D7RA 1OHWA 1N8PA 3CAIA 2G6WA 3HBXA 3FD0A 2OKJA 4R2NA 3N7NA 1AY4A 2A1VA 3N4RA 4IYOA 1C7GA 1SVVA 3AEJC 3B46A 5DJ1A 1TASA 2BIAA 3NU8A 4E1OA 1RVUA 4LW2A 5KTBA 2X5FA 4XJPA 3ATHA 2CINA 3MBBA 5F8VA 5D5SA 1WYUA 3QGUA 1ECXA 1IX7A 2CJGA 1JS6A 4AZKA 4EU1A 4WYEA 4LW4A 4CXQA 3HDOA 4A6RA 1ARIA 3H14A 1M0QA 1M0NA 5D95A 4WYDA 1OXPA 3HVYA 2CY8A 4IXOA 4R5FA 2JJEA 5E3KA 3VOMA 3AEMA 4A0HA 2E54A 4F5KA 1M7YA 2KFPA 3ASBA 1B9IA 4Q75A 3QN6A 3PAAA 4BHDA 2YRRA 2Z1YA 3QPGA 4WYAA 4TN4A 3G8MA 3FSLA 4OC9A 3PD6A 2GSAA 4RITA 5M49A 1QJ5A 4XJLA 1BJOB 1ELUA 3H9XA 1SZSA 3QBOA 2OGAA 4IXSA 3RBFA 3RCHB 2AATA 3BCAA 2V0YA 3DZZA 5E5IA 3NUBA 4Y0IA 1AMQA 3ACZA 2VIAA 3BWNA 3LVJA 3A9ZA 1AKAA 2BWPA 1BJWA 4IX8A 1CQ7A 5G2QA 2YKUA 3II0A 2VI8A 3DODA 3EI7A 2ZY3A 3ECDA 1BW0A 3N4SA 2QSRA 1ZOBA 2VGUA 3B1EA 5EFSA 2HP2A 3E6GA 2WKAA 1KL1A 4JEZA 2BI9A 3A9XA 4GDYA 4W5KA 2C44A 3LWSA 2JJFA 1W7NA 3PJ0A 3BS8A 1TOIA 3LY1A 4EB5A 1YJSA 2ZSLA 4MQRA 1G7XA 3ZRRA 4PFNA 3RUYA 2QBTA 1GEXA 3FVUA 2VMVA 4GSAA 4K2MA 4RIZA 1W7LA 5LHAA 4RAEA 2EPJA 4F5JA 1AMAA 1S0AA 3GZDC 3MKJA 1MGVA 4ZM3A 3BC8A 1ASGA 3H7FA 1O69A 1WYUB 3CQ4A 2XH1A 3TQXA 4MQQA 1DTYA 4WLHA 1W3UA 1ASAA 4BMKA 2VMYA 3GSBA 2EH6A 1C4KA 3OKSA 4EFFA 1OHYA 3NTJA 1LC8A 1MDXA 5J8QA 2W7LA 1M0PA 1E5EA 1KMKA 1ARGA 2YCPA 2R5CA 3B1CA 3WKSA 4ADCA 4XK1A 3TFUA 1SF2A 5HXXA 1QITA 3WZFA 4WXFA 4PIWA 3ZZJA 3DU4A 4OTLA 4F5GA 3CQ5A 2CJDA 2CB1A 4AOAA 2VMSA 1D2FA 3LG0A 4A6TA 1WKHA 2VYCA 3AEMC 4F5FA 1FG3A 4OCAA 4ITGA 1TOKA 2AY6A 1OXOA 2RFVA 4W1XA 3WGBA 1ARSA 4PFFA 5IWQA 4KYOA 1BJ4A 5TF5A 2E7UA 1XI9A 1GC0A 2W7KA 2YKYA 2OKKA 3MAFA 3AENA 3W1HA 2HOYA 1IX6A 1CS1A 2JG2A 2BIGA 1J04A 2BWOA 2GMSA 2EZ1A 1E5FA 2YRIA 4RJYA 4XJOA 4CBSA 2EO5A 3A9YA 3OP7A 2FYFA 1CZEA 3BWNC 3RQ1A 1AY8A 2BHXA 3KKIA 1CZCA 3G7QA 1ASNA 5EUDA 3IF2A 4GE7A 4DGTA 4A6UA 2VMZA 1S09A 2EZ2A 1KKJA 1LC5A 1S07A 3B1DA 5BJ4A 4L0OA 4AO4A 1C9CA 4ATQA 4JF1A 3E2YA 4RKCA 3MAUA 1MAQA 4GE9A 5EAAA 1VEFA 2YCNA 3CBFA 3FVSA 1BQDA 3QHXA 2YOBA 4A72A 3NYTA 1B5OA 1YJYA 2CH1A 1AAWA 1ASLA 1PMMA 2VMUA 3ZZKA 4H63Q 2FQ6A 2W8JA 2VI9A 1TPLA
chains in the Genus database with same CATH topology
4Y0HA 2W7MA 4GRXA 4BA4A 4ZDPA 2ZC0A 2F8JA 2DR1A 2WB6A 5FT8A 3FKDA 2JJHA 3DXWA 1AHEA 3E77A 1AHFA 2AY4A 5FT5A 2VGSA 2DGMA 1FG7A 1GEWA 2W8TA 3K7YA 4DQ6A 2CH2A 3M5UA 1GCKA 1M0OA 2D64A 5F9SA 2C0RA 1GEYA 4ZWMA 1SPAA 4K2BA 2ZUKA 3ASAA 1ASDA 2O1BA 1OATA 3BN1A 3RBLA 3UE8A 3MC6A 3MAFB 3VK4A 3FFRA 2JJGA 2VMRA 1AMRA 1AIBA 2AEVA 1BKGA 2OGEA 2Z61A 4W91A 2VGZA 3EZ1A 1SFFA 1W23A 2YHKA 1WYTA 1EG5A 1EQBA 4AZJA 1CJ0A 9AATA 1N2TA 3I16A 3HLMA 1I48A 2BYJA 4MY5A 2D7YA 1ELQA 3AOWA 3GBXA 2FM1A 1QZ9A 4GEBA 2ZJGA 3K40A 3TATA 2D61A 3PDBB 4W1VA 4CXRA 2QA3A 4DBCA 2CANA 1Y4IA 2VGTA 2Z9WA 3AOVA 4RM1A 5G2PA 4ITXA 4WBTA 2AY3A 3HL2A 1IVRA 2VLHA 3NX3A 1UKJA 5DB5A 4IW7A 1I29A 1DJUA 1GC4A 3IHJA 4WYCA 4K05A 3DR7A 3EZSA 4IYOB 3USFA 3AEOA 2HOXA 3ELEA 2C7TA 2Q7WA 1D7UA 1AICA 3BCXA 3EIBA 3F0HA 2PO3A 4B98A 1EJIA 1WSTA 2X3LA 1D7SA 1Z3ZA 2VIBA 4WXBA 4Y0DA 4ZSYA 3PA9A 1YIZA 2HUIA 3NRAA 2DGKA 1IAYA 1FC4A 1LK9A 1MLYA 1GBNA 4WLJA 2AY8A 2GMUA 3ISLA 2PB0A 3D6KA 4WB0A 4WD2A 4MKJA 3G0TA 5EUEA 1V2DA 3VK3A 2E7JA 4XJMA 4M2MA 5LH9A 4WXGA 3LVKA 3JWBA 4H51A 4UHMA 1M4NA 4ZDLA 4LC3A 1J32A 1D7VA 3HMUA 1MDOA 2D7ZA 2W7GA 3WLXA 1G4VA 2BI3A 2ZYJA 2WK7A 3A8UX 3L44A 4JEVA 4Q76A 4UQVA 3BV0A 1ASEA 2R0TA 3AV7A 2JGTA 3NUIA 3KGWA 1BT4A 3PD6B 4HVKA 1DJEA 2PB2A 3EIAA 1IJIA 3AEJA 1ARTA 1V2EA 3QM2A 3E2ZA 5E4ZA 3P1TA 3EUCA 3DYDA 1C7NA 1G7WA 3QI6A 3VAXA 1U08A 1ASFA 1ZODA 2W8VA 3FZ6A 5BJ3A 1VP4A 3DC1A 3MC6C 3LVMA 1LC7A 4N0WA 1B5PA 3NNKA 4M2KA 2G7JA 2ZP7A 4A0RA 4A00A 3N0LA 4UOYA 3EI6A 1ASCA 3FVXA 1O61A 3TFTA 2OATA 3JZLA 2R2NA 1C7OA 1TARA 2D66A 2VMWA 3DR4A 3BWOA 1AAMA 1PFFA 4AH3A 2AEUA 1JS3A 3CQ6A 2QMAA 3JU7A 1UU0A 2VLFA 3K28A 3MEBA 1UU2A 1X0MA 3ELPA 2DKBA 3N5MA 1CL1A 4ZM4A 1DGDA 4I8AA 3FRKA 1WYVA 3EI9A 3WCNA 1M6SA 1AKBA 3FQ8A 2E7IA 3UAKA 3R9AA 2ORDA 1SZKA 3WGCA 1I41A 3P6KA 1QISA 4U2HA 4E77A 1TATA 1PG8A 1TOJA 1P3WA 2Z20A 1YAAA 2HORA 4IXZA 3GR9A 4U1TA 5EIGA 1V72A 4HF8A 1IUGA 4A0GA 2YKXA 2BI5A 2W7HA 3UWCA 3FCRA 4JE5A 3NDNA 4ISYA 3N4XA 1AMSA 2BI1A 5G4JA 5C6UA 4M2JA 3RCHA 2AY2A 2QB2A 1O4SA 2HZPA 5G0AA 3F6TA 2R5CB 4XEWA 3FDDA 4KAMA 1S08A 1WKGA 2W8UA 4KXKA 4R5ZA 1AJSA 2W7JA 5EAVA 3I4JA 2VGVA 2VMQA 4WYFA 1BQAA 2BYLA 1B8GA 1C0NA 2WK9A 3BB8A 1CQ8A 3I5TA 3GZDA 1MAPA 2X8UA 3F9TA 1DJ9A 4TMRA 2HUFA 3DRDA 2VMNA 3MADA 4P7YA 5EUNA 2AY1A 3L8AA 2BIEA 4UHOA 3WX9A 4LNJA 4LNLA 4MKKA 4FFCA 1AX4A 1PMOA 4Q31A 3EI8A 1IAXA 1TOGA 2O0RA 4O6ZA 2ZY5A 4JEWA 1B9HA 2DGLA 3HT4A 1YIYA 2BWNA 2BKWA 2JISA 3COGA 1AHXA 3AENB 1QJ3A 1LW5A 3KE3A 3A2BA 1X2AA 2HOZA 1G4XA 3VK2A 1RV3A 1KL2A 2D63A 4CVQA 4F5LA 2W7EA 2FKIA 4N0BA 4OYTA 4A0FA 2YCTA 3BCBA 5EQCA 1H0CA 3GWPA 3GZCA 4R8DA 1DKAA 2AY5A 4W8IA 2NMPA 3AEPA 4MQPA 3FFHA 4W1WA 3DXVA 4PVFA 5JAYA 1WYVB 2ZSMA 3LVLB 1DGEA 1OHVA 1RVYA 1B4XA 4LNMA 2ZY2A 1MLZA 5EIGB 3R4TA 1ARHA 1M32A 3PDXA 4ZAHA 3HQTA 5DX5A 2HUUA 1YJZA 4JE5D 3GETA 3ZRPA 2FNIA 4MGRA 1S06A 4OBVA 4ZWVA 4NOGA 3NYUA 4JEYA 1GC3A 1QGNA 1AHGA 1AJSB 4P3MA 3AELA 5HDMA 3JW9A 4MSOA 4ADBA 4EMYA 1LS3A 3JTXA 3WY7A 1AKCA 2TPLA 2YKVA 3W1IA 4JF0A 3FQ7A 1N31A 1AJRA 1MDZA 2GQNA 4ATPA 3Q8NA 2OQXA 5K8BA 1GD9A 1I43A 5I92A 2AY9A 2CJHA 4ZASA 1V2FA 1DFOA 1GC2A 4F4EA 3VP6A 3W1JA 2ZY4A 4ZDOA 3JWAA 3FDBA 4JEXA 4GE4A 2DKJA 4E3QA 2Z1ZA 4WP0A 1QIRA 1O62A 1WYTB 3EI5A 1H1CA 3WKRA 4OBUA 4E3RA 2V1PA 5M4BA 2X5DA 3AATA 2W7DA 3NU7A 1ORDA 2FNUA 4OMAA 3TCMA 2VMPA 1KMJA 1JG8A 7AATA 4ADDA 4K2IA 1W7MA 5FT6A 5HHYA 2FN6A 2O7CA 1CL2A 2CFBA 2W7FA 4UHNA 5M4DA 5G4IA 1IX8A 1Z7DA 1XEYA 2VMOA 4ZLVA 4BQ0A 2Z9XA 2C81A 4OT8A 4XQ2A 1AY5A 1TOEA 1SZUA 1VJOA 2XBNA 4WYGA 3LV2A 4Q6RA 2W8WA 3E2FA 3PPLA 1YOOA 2CTZA 1LKCA 3E9KA 5DJ9A 2CSTA 4AO9A 4F5HA 2Z67A 2EGYA 1LW4A 3FQAA 1YNUA 1ASMA 3WCOA 1BJNA 1T3IA 2DOUA 3FTBA 3GJUA 2D5YA 2HP1A 3FZ8A 4RKDA 5G09A 3FZ7A 4J5UA 4ADEA 2VMTA 4CBRA 1GDEA 3N75A 2W7IA 2WK8A 4WB0B 2VMXA 4FL0A 3T32A 1CQ6A 5M46A 3RI6A 4RLGA 2VGWA 2D65A 4XAUA 1BJOA 2QB3A 4QGRA 4B9BA 1UU1A 1BS0A 4ZSWA 4F5MA 4F5IA 2EYQA 8AATA 4EB7A 3NYSA 3PIUA 4BA5A 1JF9A 2AY7A 3KGXA 1X29A 1X28A 3PGYA 1AIAA 2GB3A 1AHYA 5FT4A 2BI2A 1ASBA 5AX8A 1ZC9A 2QLRA 3E2ZB 1KKPA 2Z9UA 3PDBA 3B8XA 4J8LA 4TV7A 3ZRQA 4IY7A 1IBJA 2R5EA 4RJ0A 1RV4A 2Z9VA 1D7RA 1OHWA 1N8PA 3CAIA 2G6WA 3HBXA 3FD0A 2OKJA 4R2NA 3N7NA 1AY4A 2A1VA 3N4RA 4IYOA 1C7GA 1SVVA 3AEJC 3B46A 5DJ1A 1TASA 2BIAA 3NU8A 4E1OA 1RVUA 4LW2A 5KTBA 2X5FA 4XJPA 3ATHA 2CINA 3MBBA 5F8VA 5D5SA 1WYUA 3QGUA 1ECXA 1IX7A 2CJGA 1JS6A 4AZKA 4EU1A 4WYEA 4LW4A 4CXQA 3HDOA 4A6RA 1ARIA 3H14A 1M0QA 1M0NA 5D95A 4WYDA 1OXPA 3HVYA 2CY8A 4IXOA 4R5FA 2JJEA 5E3KA 3VOMA 3AEMA 4A0HA 2E54A 4F5KA 1M7YA 2KFPA 3ASBA 1B9IA 4Q75A 3QN6A 3PAAA 4BHDA 2YRRA 2Z1YA 3QPGA 4WYAA 4TN4A 3G8MA 3FSLA 4OC9A 3PD6A 2GSAA 4RITA 5M49A 1QJ5A 4XJLA 1BJOB 1ELUA 3H9XA 1SZSA 3QBOA 2OGAA 4IXSA 3RBFA 3RCHB 2AATA 3BCAA 2V0YA 3DZZA 5E5IA 3NUBA 4Y0IA 1AMQA 3ACZA 2VIAA 3BWNA 3LVJA 3A9ZA 1AKAA 2BWPA 1BJWA 4IX8A 1CQ7A 5G2QA 2YKUA 3II0A 2VI8A 3DODA 3EI7A 2ZY3A 3ECDA 1BW0A 3N4SA 2QSRA 1ZOBA 2VGUA 3B1EA 5EFSA 2HP2A 3E6GA 2WKAA 1KL1A 4JEZA 2BI9A 3A9XA 4GDYA 4W5KA 2C44A 3LWSA 2JJFA 1W7NA 3PJ0A 3BS8A 1TOIA 3LY1A 4EB5A 1YJSA 2ZSLA 4MQRA 1G7XA 3ZRRA 4PFNA 3RUYA 2QBTA 1GEXA 3FVUA 2VMVA 4GSAA 4K2MA 4RIZA 1W7LA 5LHAA 4RAEA 2EPJA 4F5JA 1AMAA 1S0AA 3GZDC 3MKJA 1MGVA 4ZM3A 3BC8A 1ASGA 3H7FA 1O69A 1WYUB 3CQ4A 2XH1A 3TQXA 4MQQA 1DTYA 4WLHA 1W3UA 1ASAA 4BMKA 2VMYA 3GSBA 2EH6A 1C4KA 3OKSA 4EFFA 1OHYA 3NTJA 1LC8A 1MDXA 5J8QA 2W7LA 1M0PA 1E5EA 1KMKA 1ARGA 2YCPA 2R5CA 3B1CA 3WKSA 4ADCA 4XK1A 3TFUA 1SF2A 5HXXA 1QITA 3WZFA 4WXFA 4PIWA 3ZZJA 3DU4A 4OTLA 4F5GA 3CQ5A 2CJDA 2CB1A 4AOAA 2VMSA 1D2FA 3LG0A 4A6TA 1WKHA 2VYCA 3AEMC 4F5FA 1FG3A 4OCAA 4ITGA 1TOKA 2AY6A 1OXOA 2RFVA 4W1XA 3WGBA 1ARSA 4PFFA 5IWQA 4KYOA 1BJ4A 5TF5A 2E7UA 1XI9A 1GC0A 2W7KA 2YKYA 2OKKA 3MAFA 3AENA 3W1HA 2HOYA 1IX6A 1CS1A 2JG2A 2BIGA 1J04A 2BWOA 2GMSA 2EZ1A 1E5FA 2YRIA 4RJYA 4XJOA 4CBSA 2EO5A 3A9YA 3OP7A 2FYFA 1CZEA 3BWNC 3RQ1A 1AY8A 2BHXA 3KKIA 1CZCA 3G7QA 1ASNA 5EUDA 3IF2A 4GE7A 4DGTA 4A6UA 2VMZA 1S09A 2EZ2A 1KKJA 1LC5A 1S07A 3B1DA 5BJ4A 4L0OA 4AO4A 1C9CA 4ATQA 4JF1A 3E2YA 4RKCA 3MAUA 1MAQA 4GE9A 5EAAA 1VEFA 2YCNA 3CBFA 3FVSA 1BQDA 3QHXA 2YOBA 4A72A 3NYTA 1B5OA 1YJYA 2CH1A 1AAWA 1ASLA 1PMMA 2VMUA 3ZZKA 4H63Q 2FQ6A 2W8JA 2VI9A 1TPLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Y0H A;  2W7M A;  4GRX A;  4BA4 A;  4ZDP A;  2ZC0 A;  2F8J A;  2DR1 A;  5FT8 A;  3FKD A;  2JJH A;  3DXW A;  1AHE A;  3E77 A;  1AHF A;  2AY4 A;  5FT5 A;  2VGS A;  2DGM A;  1FG7 A;  1GEW A;  2W8T A;  3K7Y A;  4DQ6 A;  2CH2 A;  3M5U A;  1GCK A;  1M0O A;  2D64 A;  5F9S A;  2C0R A;  1GEY A;  4ZWM A;  1SPA A;  4K2B A;  2ZUK A;  3ASA A;  1ASD A;  2O1B A;  1OAT A;  3BN1 A;  3RBL A;  3UE8 A;  3MC6 A;  3MAF B;  3VK4 A;  3FFR A;  2JJG A;  2VMR A;  1AMR A;  1AIB A;  2AEV A;  1BKG A;  2OGE A;  2Z61 A;  4W91 A;  2VGZ A;  3EZ1 A;  1SFF A;  1W23 A;  2YHK A;  1WYT A;  1EG5 A;  1EQB A;  4AZJ A;  1CJ0 A;  9AAT A;  1N2T A;  3I16 A;  3HLM A;  1I48 A;  2BYJ A;  4MY5 A;  2D7Y A;  1ELQ A;  3AOW A;  3GBX A;  2FM1 A;  1QZ9 A;  4GEB A;  2ZJG A;  3K40 A;  3TAT A;  2D61 A;  3PDB B;  4W1V A;  4CXR A;  2QA3 A;  4DBC A;  2CAN A;  1Y4I A;  2VGT A;  2Z9W A;  3AOV A;  4RM1 A;  5G2P A;  4ITX A;  4WBT A;  2AY3 A;  3HL2 A;  1IVR A;  2VLH A;  3NX3 A;  1UKJ A;  5DB5 A;  4IW7 A;  1I29 A;  1DJU A;  1GC4 A;  3IHJ A;  4WYC A;  3DR7 A;  3EZS A;  4IYO B;  3USF A;  3AEO A;  2HOX A;  3ELE A;  2C7T A;  2Q7W A;  1D7U A;  1AIC A;  3BCX A;  3EIB A;  3F0H A;  2PO3 A;  4B98 A;  1EJI A;  1WST A;  2X3L A;  1D7S A;  1Z3Z A;  2VIB A;  4WXB A;  4Y0D A;  4ZSY A;  3PA9 A;  1YIZ A;  2HUI A;  3NRA A;  2DGK A;  1IAY A;  1FC4 A;  1LK9 A;  1MLY A;  1GBN A;  4WLJ A;  2AY8 A;  2GMU A;  3ISL A;  2PB0 A;  3D6K A;  4WB0 A;  4WD2 A;  4MKJ A;  3G0T A;  5EUE A;  1V2D A;  3VK3 A;  2E7J A;  4XJM A;  4M2M A;  5LH9 A;  4WXG A;  3LVK A;  3JWB A;  4H51 A;  4UHM A;  1M4N A;  4ZDL A;  4LC3 A;  1J32 A;  1D7V A;  3HMU A;  1MDO A;  2D7Z A;  2W7G A;  3WLX A;  1G4V A;  2BI3 A;  2ZYJ A;  2WK7 A;  3A8U X;  3L44 A;  4JEV A;  4Q76 A;  4UQV A;  3BV0 A;  1ASE A;  2R0T A;  3AV7 A;  2JGT A;  3NUI A;  3KGW A;  1BT4 A;  3PD6 B;  4HVK A;  1DJE A;  2PB2 A;  3EIA A;  1IJI A;  3AEJ A;  1ART A;  1V2E A;  3QM2 A;  3E2Z A;  5E4Z A;  3P1T A;  3EUC A;  3DYD A;  1C7N A;  1G7W A;  3QI6 A;  3VAX A;  1U08 A;  1ASF A;  1ZOD A;  2W8V A;  3FZ6 A;  5BJ3 A;  1VP4 A;  3DC1 A;  3MC6 C;  3LVM A;  1LC7 A;  4N0W A;  1B5P A;  3NNK A;  4M2K A;  2ZP7 A;  4A0R A;  4A00 A;  3N0L A;  4UOY A;  3EI6 A;  1ASC A;  3FVX A;  1O61 A;  3TFT A;  2OAT A;  3JZL A;  2R2N A;  1C7O A;  1TAR A;  2D66 A;  2VMW A;  3DR4 A;  3BWO A;  1AAM A;  1PFF A;  4AH3 A;  2AEU A;  1JS3 A;  3CQ6 A;  2QMA A;  3JU7 A;  1UU0 A;  2VLF A;  3K28 A;  3MEB A;  1UU2 A;  1X0M A;  3ELP A;  2DKB A;  3N5M A;  1CL1 A;  4ZM4 A;  1DGD A;  4I8A A;  3FRK A;  1WYV A;  3EI9 A;  3WCN A;  1M6S A;  1AKB A;  3FQ8 A;  2E7I A;  3UAK A;  3R9A A;  2ORD A;  1SZK A;  3WGC A;  1I41 A;  3P6K A;  1QIS A;  4U2H A;  4E77 A;  1TAT A;  1PG8 A;  1TOJ A;  1P3W A;  2Z20 A;  1YAA A;  2HOR A;  4IXZ A;  3GR9 A;  4U1T A;  5EIG A;  1V72 A;  4HF8 A;  1IUG A;  4A0G A;  2YKX A;  2BI5 A;  2W7H A;  3UWC A;  3FCR A;  4JE5 A;  3NDN A;  4ISY A;  1AMS A;  2BI1 A;  5G4J A;  5C6U A;  4M2J A;  3RCH A;  2AY2 A;  2QB2 A;  1O4S A;  2HZP A;  5G0A A;  3F6T A;  2R5C B;  4XEW A;  3FDD A;  4KAM A;  1S08 A;  1WKG A;  2W8U A;  4KXK A;  4R5Z A;  1AJS A;  2W7J A;  5EAV A;  3I4J A;  2VGV A;  2VMQ A;  4WYF A;  1BQA A;  2BYL A;  1B8G A;  1C0N A;  2WK9 A;  3BB8 A;  1CQ8 A;  3I5T A;  3GZD A;  1MAP A;  2X8U A;  3F9T A;  1DJ9 A;  4TMR A;  2HUF A;  3DRD A;  2VMN A;  3MAD A;  4P7Y A;  5EUN A;  2AY1 A;  3L8A A;  2BIE A;  4UHO A;  3WX9 A;  4LNJ A;  4LNL A;  4MKK A;  4FFC A;  1AX4 A;  1PMO A;  4Q31 A;  3EI8 A;  1IAX A;  1TOG A;  2O0R A;  4O6Z A;  2ZY5 A;  4JEW A;  1B9H A;  2DGL A;  3HT4 A;  1YIY A;  2BWN A;  2BKW A;  2JIS A;  3COG A;  1AHX A;  3AEN B;  1QJ3 A;  1LW5 A;  3KE3 A;  3A2B A;  1X2A A;  2HOZ A;  1G4X A;  3VK2 A;  1RV3 A;  1KL2 A;  2D63 A;  4CVQ A;  4F5L A;  2W7E A;  4N0B A;  4OYT A;  4A0F A;  2YCT A;  3BCB A;  5EQC A;  1H0C A;  3GWP A;  3GZC A;  4R8D A;  1DKA A;  2AY5 A;  4W8I A;  2NMP A;  3AEP A;  4MQP A;  3FFH A;  4W1W A;  3DXV A;  4PVF A;  5JAY A;  1WYV B;  2ZSM A;  3LVL B;  1DGE A;  1OHV A;  1RVY A;  1B4X A;  4LNM A;  2ZY2 A;  1MLZ A;  5EIG B;  3R4T A;  1ARH A;  1M32 A;  3PDX A;  4ZAH A;  3HQT A;  5DX5 A;  2HUU A;  1YJZ A;  4JE5 D;  3GET A;  3ZRP A;  2FNI A;  4MGR A;  1S06 A;  4OBV A;  4ZWV A;  4NOG A;  3NYU A;  4JEY A;  1GC3 A;  1QGN A;  1AHG A;  1AJS B;  4P3M A;  3AEL A;  5HDM A;  3JW9 A;  4MSO A;  4ADB A;  4EMY A;  1LS3 A;  3JTX A;  3WY7 A;  1AKC A;  2TPL A;  2YKV A;  3W1I A;  4JF0 A;  3FQ7 A;  1N31 A;  1AJR A;  1MDZ A;  2GQN A;  4ATP A;  3Q8N A;  2OQX A;  5K8B A;  1GD9 A;  1I43 A;  5I92 A;  2AY9 A;  2CJH A;  4ZAS A;  1V2F A;  1DFO A;  1GC2 A;  4F4E A;  3VP6 A;  3W1J A;  2ZY4 A;  4ZDO A;  3JWA A;  3FDB A;  4JEX A;  4GE4 A;  2DKJ A;  4E3Q A;  2Z1Z A;  4WP0 A;  1QIR A;  1O62 A;  1WYT B;  3EI5 A;  1H1C A;  3WKR A;  4OBU A;  4E3R A;  2V1P A;  5M4B A;  2X5D A;  3AAT A;  2W7D A;  3NU7 A;  1ORD A;  2FNU A;  4OMA A;  3TCM A;  2VMP A;  1KMJ A;  1JG8 A;  7AAT A;  4ADD A;  4K2I A;  1W7M A;  5FT6 A;  5HHY A;  2FN6 A;  2O7C A;  1CL2 A;  2CFB A;  2W7F A;  4UHN A;  5M4D A;  5G4I A;  1IX8 A;  1Z7D A;  1XEY A;  2VMO A;  4ZLV A;  4BQ0 A;  2Z9X A;  2C81 A;  4OT8 A;  4XQ2 A;  1AY5 A;  1TOE A;  1SZU A;  1VJO A;  2XBN A;  4WYG A;  3LV2 A;  4Q6R A;  2W8W A;  3E2F A;  3PPL A;  1YOO A;  2CTZ A;  1LKC A;  3E9K A;  5DJ9 A;  2CST A;  4AO9 A;  4F5H A;  2Z67 A;  2EGY A;  1LW4 A;  3FQA A;  1YNU A;  1ASM A;  3WCO A;  1BJN A;  1T3I A;  2DOU A;  3FTB A;  3GJU A;  2D5Y A;  2HP1 A;  3FZ8 A;  4RKD A;  5G09 A;  3FZ7 A;  4J5U A;  4ADE A;  2VMT A;  4CBR A;  1GDE A;  3N75 A;  2W7I A;  2WK8 A;  4WB0 B;  2VMX A;  4FL0 A;  3T32 A;  1CQ6 A;  5M46 A;  3RI6 A;  4RLG A;  2VGW A;  2D65 A;  4XAU A;  1BJO A;  2QB3 A;  4QGR A;  4B9B A;  1UU1 A;  1BS0 A;  4ZSW A;  4F5M A;  4F5I A;  8AAT A;  4EB7 A;  3NYS A;  3PIU A;  4BA5 A;  1JF9 A;  2AY7 A;  3KGX A;  1X29 A;  1X28 A;  3PGY A;  1AIA A;  2GB3 A;  1AHY A;  5FT4 A;  2BI2 A;  1ASB A;  5AX8 A;  1ZC9 A;  2QLR A;  3E2Z B;  1KKP A;  2Z9U A;  3PDB A;  3B8X A;  4J8L A;  4TV7 A;  3ZRQ A;  4IY7 A;  1IBJ A;  2R5E A;  4RJ0 A;  1RV4 A;  2Z9V A;  1D7R A;  1OHW A;  1N8P A;  3CAI A;  2G6W A;  3HBX A;  3FD0 A;  2OKJ A;  4R2N A;  1AY4 A;  4IYO A;  1C7G A;  1SVV A;  3AEJ C;  3B46 A;  5DJ1 A;  1TAS A;  2BIA A;  3NU8 A;  4E1O A;  1RVU A;  4LW2 A;  2X5F A;  4XJP A;  3ATH A;  2CIN A;  3MBB A;  5F8V A;  5D5S A;  1WYU A;  3QGU A;  1ECX A;  1IX7 A;  2CJG A;  1JS6 A;  4AZK A;  4EU1 A;  4WYE A;  4LW4 A;  4CXQ A;  3HDO A;  4A6R A;  1ARI A;  3H14 A;  1M0Q A;  1M0N A;  5D95 A;  4WYD A;  1OXP A;  3HVY A;  2CY8 A;  4IXO A;  4R5F A;  2JJE A;  5E3K A;  3VOM A;  3AEM A;  4A0H A;  2E54 A;  4F5K A;  1M7Y A;  3ASB A;  1B9I A;  4Q75 A;  3QN6 A;  3PAA A;  4BHD A;  2YRR A;  2Z1Y A;  3QPG A;  4WYA A;  4TN4 A;  3G8M A;  3FSL A;  4OC9 A;  3PD6 A;  2GSA A;  4RIT A;  5M49 A;  1QJ5 A;  4XJL A;  1BJO B;  1ELU A;  1SZS A;  3QBO A;  2OGA A;  4IXS A;  3RBF A;  3RCH B;  2AAT A;  3BCA A;  2V0Y A;  3DZZ A;  5E5I A;  3NUB A;  4Y0I A;  1AMQ A;  3ACZ A;  2VIA A;  3BWN A;  3LVJ A;  3A9Z A;  1AKA A;  2BWP A;  1BJW A;  4IX8 A;  1CQ7 A;  5G2Q A;  2YKU A;  3II0 A;  2VI8 A;  3DOD A;  3EI7 A;  2ZY3 A;  3ECD A;  1BW0 A;  1ZOB A;  2VGU A;  3B1E A;  5EFS A;  2HP2 A;  3E6G A;  2WKA A;  1KL1 A;  4JEZ A;  2BI9 A;  3A9X A;  4GDY A;  4W5K A;  2C44 A;  3LWS A;  2JJF A;  1W7N A;  3PJ0 A;  3BS8 A;  1TOI A;  3LY1 A;  4EB5 A;  1YJS A;  2ZSL A;  4MQR A;  1G7X A;  3ZRR A;  4PFN A;  3RUY A;  2QBT A;  1GEX A;  3FVU A;  2VMV A;  4GSA A;  4K2M A;  4RIZ A;  1W7L A;  5LHA A;  4RAE A;  2EPJ A;  4F5J A;  1AMA A;  1S0A A;  3GZD C;  3MKJ A;  1MGV A;  4ZM3 A;  3BC8 A;  1ASG A;  3H7F A;  1O69 A;  1WYU B;  3CQ4 A;  2XH1 A;  3TQX A;  4MQQ A;  1DTY A;  4WLH A;  1W3U A;  1ASA A;  4BMK A;  2VMY A;  3GSB A;  2EH6 A;  1C4K A;  3OKS A;  4EFF A;  1OHY A;  3NTJ A;  1LC8 A;  1MDX A;  5J8Q A;  2W7L A;  1M0P A;  1E5E A;  1KMK A;  1ARG A;  2YCP A;  2R5C A;  3B1C A;  3WKS A;  4ADC A;  4XK1 A;  3TFU A;  1SF2 A;  5HXX A;  1QIT A;  3WZF A;  4WXF A;  4PIW A;  3ZZJ A;  3DU4 A;  4OTL A;  4F5G A;  3CQ5 A;  2CJD A;  2CB1 A;  4AOA A;  2VMS A;  1D2F A;  3LG0 A;  4A6T A;  1WKH A;  2VYC A;  3AEM C;  4F5F A;  1FG3 A;  4OCA A;  4ITG A;  1TOK A;  2AY6 A;  1OXO A;  2RFV A;  4W1X A;  3WGB A;  1ARS A;  4PFF A;  5IWQ A;  4KYO A;  1BJ4 A;  5TF5 A;  2E7U A;  1XI9 A;  1GC0 A;  2W7K A;  2YKY A;  2OKK A;  3MAF A;  3AEN A;  3W1H A;  2HOY A;  1IX6 A;  1CS1 A;  2JG2 A;  2BIG A;  1J04 A;  2BWO A;  2GMS A;  2EZ1 A;  1E5F A;  2YRI A;  4RJY A;  4XJO A;  4CBS A;  2EO5 A;  3A9Y A;  3OP7 A;  2FYF A;  1CZE A;  3BWN C;  3RQ1 A;  1AY8 A;  2BHX A;  3KKI A;  1CZC A;  3G7Q A;  1ASN A;  5EUD A;  3IF2 A;  4GE7 A;  4DGT A;  4A6U A;  2VMZ A;  1S09 A;  2EZ2 A;  1KKJ A;  1LC5 A;  1S07 A;  3B1D A;  5BJ4 A;  4L0O A;  4AO4 A;  1C9C A;  4ATQ A;  4JF1 A;  3E2Y A;  4RKC A;  3MAU A;  1MAQ A;  4GE9 A;  5EAA A;  1VEF A;  2YCN A;  3CBF A;  3FVS A;  1BQD A;  3QHX A;  2YOB A;  4A72 A;  3NYT A;  1B5O A;  1YJY A;  2CH1 A;  1AAW A;  1ASL A;  1PMM A;  2VMU A;  3ZZK A;  2FQ6 A;  2W8J A;  2VI9 A;  1TPL A; 
#chains in the Genus database with same CATH topology
 4Y0H A;  2W7M A;  4GRX A;  4BA4 A;  4ZDP A;  2ZC0 A;  2F8J A;  2DR1 A;  2WB6 A;  5FT8 A;  3FKD A;  2JJH A;  3DXW A;  1AHE A;  3E77 A;  1AHF A;  2AY4 A;  5FT5 A;  2VGS A;  2DGM A;  1FG7 A;  1GEW A;  2W8T A;  3K7Y A;  4DQ6 A;  2CH2 A;  3M5U A;  1GCK A;  1M0O A;  2D64 A;  5F9S A;  2C0R A;  1GEY A;  4ZWM A;  1SPA A;  4K2B A;  2ZUK A;  3ASA A;  1ASD A;  2O1B A;  1OAT A;  3BN1 A;  3RBL A;  3UE8 A;  3MC6 A;  3MAF B;  3VK4 A;  3FFR A;  2JJG A;  2VMR A;  1AMR A;  1AIB A;  2AEV A;  1BKG A;  2OGE A;  2Z61 A;  4W91 A;  2VGZ A;  3EZ1 A;  1SFF A;  1W23 A;  2YHK A;  1WYT A;  1EG5 A;  1EQB A;  4AZJ A;  1CJ0 A;  9AAT A;  1N2T A;  3I16 A;  3HLM A;  1I48 A;  2BYJ A;  4MY5 A;  2D7Y A;  1ELQ A;  3AOW A;  3GBX A;  2FM1 A;  1QZ9 A;  4GEB A;  2ZJG A;  3K40 A;  3TAT A;  2D61 A;  3PDB B;  4W1V A;  4CXR A;  2QA3 A;  4DBC A;  2CAN A;  1Y4I A;  2VGT A;  2Z9W A;  3AOV A;  4RM1 A;  5G2P A;  4ITX A;  4WBT A;  2AY3 A;  3HL2 A;  1IVR A;  2VLH A;  3NX3 A;  1UKJ A;  5DB5 A;  4IW7 A;  1I29 A;  1DJU A;  1GC4 A;  3IHJ A;  4WYC A;  4K05 A;  3DR7 A;  3EZS A;  4IYO B;  3USF A;  3AEO A;  2HOX A;  3ELE A;  2C7T A;  2Q7W A;  1D7U A;  1AIC A;  3BCX A;  3EIB A;  3F0H A;  2PO3 A;  4B98 A;  1EJI A;  1WST A;  2X3L A;  1D7S A;  1Z3Z A;  2VIB A;  4WXB A;  4Y0D A;  4ZSY A;  3PA9 A;  1YIZ A;  2HUI A;  3NRA A;  2DGK A;  1IAY A;  1FC4 A;  1LK9 A;  1MLY A;  1GBN A;  4WLJ A;  2AY8 A;  2GMU A;  3ISL A;  2PB0 A;  3D6K A;  4WB0 A;  4WD2 A;  4MKJ A;  3G0T A;  5EUE A;  1V2D A;  3VK3 A;  2E7J A;  4XJM A;  4M2M A;  5LH9 A;  4WXG A;  3LVK A;  3JWB A;  4H51 A;  4UHM A;  1M4N A;  4ZDL A;  4LC3 A;  1J32 A;  1D7V A;  3HMU A;  1MDO A;  2D7Z A;  2W7G A;  3WLX A;  1G4V A;  2BI3 A;  2ZYJ A;  2WK7 A;  3A8U X;  3L44 A;  4JEV A;  4Q76 A;  4UQV A;  1KAF A;  3BV0 A;  1ASE A;  2R0T A;  3AV7 A;  2JGT A;  3NUI A;  3KGW A;  1BT4 A;  3PD6 B;  4HVK A;  1DJE A;  2PB2 A;  3EIA A;  1IJI A;  3AEJ A;  1ART A;  1V2E A;  3QM2 A;  3E2Z A;  5E4Z A;  3P1T A;  3EUC A;  3DYD A;  1C7N A;  1G7W A;  3QI6 A;  3VAX A;  1U08 A;  1ASF A;  1ZOD A;  2W8V A;  3FZ6 A;  5BJ3 A;  1VP4 A;  3DC1 A;  3MC6 C;  3LVM A;  1LC7 A;  4N0W A;  1B5P A;  3NNK A;  4M2K A;  2G7J A;  2ZP7 A;  4A0R A;  4A00 A;  3N0L A;  4UOY A;  3EI6 A;  1ASC A;  3FVX A;  1O61 A;  3TFT A;  2OAT A;  3JZL A;  2R2N A;  1C7O A;  1TAR A;  2D66 A;  2VMW A;  3DR4 A;  3BWO A;  1AAM A;  1PFF A;  4AH3 A;  2AEU A;  1JS3 A;  3CQ6 A;  2QMA A;  3JU7 A;  1UU0 A;  2VLF A;  3K28 A;  3MEB A;  1UU2 A;  1X0M A;  3ELP A;  2DKB A;  3N5M A;  1CL1 A;  4ZM4 A;  1DGD A;  4I8A A;  3FRK A;  1WYV A;  3EI9 A;  3WCN A;  1M6S A;  1AKB A;  3FQ8 A;  2E7I A;  3UAK A;  3R9A A;  2ORD A;  1SZK A;  3WGC A;  1I41 A;  3P6K A;  1QIS A;  4U2H A;  4E77 A;  1TAT A;  1PG8 A;  1TOJ A;  1P3W A;  2Z20 A;  1YAA A;  2HOR A;  4IXZ A;  3GR9 A;  4U1T A;  5EIG A;  1V72 A;  4HF8 A;  1IUG A;  4A0G A;  2YKX A;  2BI5 A;  2W7H A;  3UWC A;  3FCR A;  4JE5 A;  3NDN A;  4ISY A;  3N4X A;  1AMS A;  2BI1 A;  5G4J A;  5C6U A;  4M2J A;  3RCH A;  2AY2 A;  2QB2 A;  1O4S A;  2HZP A;  5G0A A;  3F6T A;  2R5C B;  4XEW A;  3FDD A;  4KAM A;  1S08 A;  1WKG A;  2W8U A;  4KXK A;  4R5Z A;  1AJS A;  2W7J A;  5EAV A;  3I4J A;  2VGV A;  2VMQ A;  4WYF A;  1BQA A;  2BYL A;  1B8G A;  1C0N A;  2WK9 A;  3BB8 A;  1CQ8 A;  3I5T A;  3GZD A;  1MAP A;  2X8U A;  3F9T A;  1DJ9 A;  4TMR A;  2HUF A;  3DRD A;  2VMN A;  3MAD A;  4P7Y A;  5EUN A;  2AY1 A;  3L8A A;  2BIE A;  4UHO A;  3WX9 A;  4LNJ A;  4LNL A;  4MKK A;  4FFC A;  1AX4 A;  1PMO A;  4Q31 A;  3EI8 A;  1IAX A;  1TOG A;  2O0R A;  4O6Z A;  2ZY5 A;  4JEW A;  1B9H A;  2DGL A;  3HT4 A;  1YIY A;  2BWN A;  2BKW A;  2JIS A;  3COG A;  1AHX A;  3AEN B;  1QJ3 A;  1LW5 A;  3KE3 A;  3A2B A;  1X2A A;  2HOZ A;  1G4X A;  3VK2 A;  1RV3 A;  1KL2 A;  2D63 A;  4CVQ A;  4F5L A;  2W7E A;  2FKI A;  4N0B A;  4OYT A;  4A0F A;  2YCT A;  3BCB A;  5EQC A;  1H0C A;  3GWP A;  3GZC A;  4R8D A;  1DKA A;  2AY5 A;  4W8I A;  2NMP A;  3AEP A;  4MQP A;  3FFH A;  4W1W A;  3DXV A;  4PVF A;  5JAY A;  1WYV B;  2ZSM A;  3LVL B;  1DGE A;  1OHV A;  1RVY A;  1B4X A;  4LNM A;  2ZY2 A;  1MLZ A;  5EIG B;  3R4T A;  1ARH A;  1M32 A;  3PDX A;  4ZAH A;  3HQT A;  5DX5 A;  2HUU A;  1YJZ A;  4JE5 D;  3GET A;  3ZRP A;  2FNI A;  4MGR A;  1S06 A;  4OBV A;  4ZWV A;  4NOG A;  3NYU A;  4JEY A;  1GC3 A;  1QGN A;  1AHG A;  1AJS B;  4P3M A;  3AEL A;  5HDM A;  3JW9 A;  4MSO A;  4ADB A;  4EMY A;  1LS3 A;  3JTX A;  3WY7 A;  1AKC A;  2TPL A;  2YKV A;  3W1I A;  4JF0 A;  3FQ7 A;  1N31 A;  1AJR A;  1MDZ A;  2GQN A;  4ATP A;  3Q8N A;  2OQX A;  5K8B A;  1GD9 A;  1I43 A;  5I92 A;  2AY9 A;  2CJH A;  4ZAS A;  1V2F A;  1DFO A;  1GC2 A;  4F4E A;  3VP6 A;  3W1J A;  2ZY4 A;  4ZDO A;  3JWA A;  3FDB A;  4JEX A;  4GE4 A;  2DKJ A;  4E3Q A;  2Z1Z A;  4WP0 A;  1QIR A;  1O62 A;  1WYT B;  3EI5 A;  1H1C A;  3WKR A;  4OBU A;  4E3R A;  2V1P A;  5M4B A;  2X5D A;  3AAT A;  2W7D A;  3NU7 A;  1ORD A;  2FNU A;  4OMA A;  3TCM A;  2VMP A;  1KMJ A;  1JG8 A;  7AAT A;  4ADD A;  4K2I A;  1W7M A;  5FT6 A;  5HHY A;  2FN6 A;  2O7C A;  1CL2 A;  2CFB A;  2W7F A;  4UHN A;  5M4D A;  5G4I A;  1IX8 A;  1Z7D A;  1XEY A;  2VMO A;  4ZLV A;  4BQ0 A;  2Z9X A;  2C81 A;  4OT8 A;  4XQ2 A;  1AY5 A;  1TOE A;  1SZU A;  1VJO A;  2XBN A;  4WYG A;  3LV2 A;  4Q6R A;  2W8W A;  3E2F A;  3PPL A;  1YOO A;  2CTZ A;  1LKC A;  3E9K A;  5DJ9 A;  2CST A;  4AO9 A;  4F5H A;  2Z67 A;  2EGY A;  1LW4 A;  3FQA A;  1YNU A;  1ASM A;  3WCO A;  1BJN A;  1T3I A;  2DOU A;  3FTB A;  3GJU A;  2D5Y A;  2HP1 A;  3FZ8 A;  4RKD A;  5G09 A;  3FZ7 A;  4J5U A;  4ADE A;  2VMT A;  4CBR A;  1GDE A;  3N75 A;  2W7I A;  2WK8 A;  4WB0 B;  2VMX A;  4FL0 A;  3T32 A;  1CQ6 A;  5M46 A;  3RI6 A;  4RLG A;  2VGW A;  2D65 A;  4XAU A;  1BJO A;  2QB3 A;  4QGR A;  4B9B A;  1UU1 A;  1BS0 A;  4ZSW A;  4F5M A;  4F5I A;  2EYQ A;  8AAT A;  4EB7 A;  3NYS A;  3PIU A;  4BA5 A;  1JF9 A;  2AY7 A;  3KGX A;  1X29 A;  1X28 A;  3PGY A;  1AIA A;  2GB3 A;  1AHY A;  5FT4 A;  2BI2 A;  1ASB A;  5AX8 A;  1ZC9 A;  2QLR A;  3E2Z B;  1KKP A;  2Z9U A;  3PDB A;  3B8X A;  4J8L A;  4TV7 A;  3ZRQ A;  4IY7 A;  1IBJ A;  2R5E A;  4RJ0 A;  1RV4 A;  2Z9V A;  1D7R A;  1OHW A;  1N8P A;  3CAI A;  2G6W A;  3HBX A;  3FD0 A;  2OKJ A;  4R2N A;  3N7N A;  1AY4 A;  2A1V A;  3N4R A;  4IYO A;  1C7G A;  1SVV A;  3AEJ C;  3B46 A;  5DJ1 A;  1TAS A;  2BIA A;  3NU8 A;  4E1O A;  1RVU A;  4LW2 A;  5KTB A;  2X5F A;  4XJP A;  3ATH A;  2CIN A;  3MBB A;  5F8V A;  5D5S A;  1WYU A;  3QGU A;  1ECX A;  1IX7 A;  2CJG A;  1JS6 A;  4AZK A;  4EU1 A;  4WYE A;  4LW4 A;  4CXQ A;  3HDO A;  4A6R A;  1ARI A;  3H14 A;  1M0Q A;  1M0N A;  5D95 A;  4WYD A;  1OXP A;  3HVY A;  2CY8 A;  4IXO A;  4R5F A;  2JJE A;  5E3K A;  3VOM A;  3AEM A;  4A0H A;  2E54 A;  4F5K A;  1M7Y A;  2KFP A;  3ASB A;  1B9I A;  4Q75 A;  3QN6 A;  3PAA A;  4BHD A;  2YRR A;  2Z1Y A;  3QPG A;  4WYA A;  4TN4 A;  3G8M A;  3FSL A;  4OC9 A;  3PD6 A;  2GSA A;  4RIT A;  5M49 A;  1QJ5 A;  4XJL A;  1BJO B;  1ELU A;  3H9X A;  1SZS A;  3QBO A;  2OGA A;  4IXS A;  3RBF A;  3RCH B;  2AAT A;  3BCA A;  2V0Y A;  3DZZ A;  5E5I A;  3NUB A;  4Y0I A;  1AMQ A;  3ACZ A;  2VIA A;  3BWN A;  3LVJ A;  3A9Z A;  1AKA A;  2BWP A;  1BJW A;  4IX8 A;  1CQ7 A;  5G2Q A;  2YKU A;  3II0 A;  2VI8 A;  3DOD A;  3EI7 A;  2ZY3 A;  3ECD A;  1BW0 A;  3N4S A;  2QSR A;  1ZOB A;  2VGU A;  3B1E A;  5EFS A;  2HP2 A;  3E6G A;  2WKA A;  1KL1 A;  4JEZ A;  2BI9 A;  3A9X A;  4GDY A;  4W5K A;  2C44 A;  3LWS A;  2JJF A;  1W7N A;  3PJ0 A;  3BS8 A;  1TOI A;  3LY1 A;  4EB5 A;  1YJS A;  2ZSL A;  4MQR A;  1G7X A;  3ZRR A;  4PFN A;  3RUY A;  2QBT A;  1GEX A;  3FVU A;  2VMV A;  4GSA A;  4K2M A;  4RIZ A;  1W7L A;  5LHA A;  4RAE A;  2EPJ A;  4F5J A;  1AMA A;  1S0A A;  3GZD C;  3MKJ A;  1MGV A;  4ZM3 A;  3BC8 A;  1ASG A;  3H7F A;  1O69 A;  1WYU B;  3CQ4 A;  2XH1 A;  3TQX A;  4MQQ A;  1DTY A;  4WLH A;  1W3U A;  1ASA A;  4BMK A;  2VMY A;  3GSB A;  2EH6 A;  1C4K A;  3OKS A;  4EFF A;  1OHY A;  3NTJ A;  1LC8 A;  1MDX A;  5J8Q A;  2W7L A;  1M0P A;  1E5E A;  1KMK A;  1ARG A;  2YCP A;  2R5C A;  3B1C A;  3WKS A;  4ADC A;  4XK1 A;  3TFU A;  1SF2 A;  5HXX A;  1QIT A;  3WZF A;  4WXF A;  4PIW A;  3ZZJ A;  3DU4 A;  4OTL A;  4F5G A;  3CQ5 A;  2CJD A;  2CB1 A;  4AOA A;  2VMS A;  1D2F A;  3LG0 A;  4A6T A;  1WKH A;  2VYC A;  3AEM C;  4F5F A;  1FG3 A;  4OCA A;  4ITG A;  1TOK A;  2AY6 A;  1OXO A;  2RFV A;  4W1X A;  3WGB A;  1ARS A;  4PFF A;  5IWQ A;  4KYO A;  1BJ4 A;  5TF5 A;  2E7U A;  1XI9 A;  1GC0 A;  2W7K A;  2YKY A;  2OKK A;  3MAF A;  3AEN A;  3W1H A;  2HOY A;  1IX6 A;  1CS1 A;  2JG2 A;  2BIG A;  1J04 A;  2BWO A;  2GMS A;  2EZ1 A;  1E5F A;  2YRI A;  4RJY A;  4XJO A;  4CBS A;  2EO5 A;  3A9Y A;  3OP7 A;  2FYF A;  1CZE A;  3BWN C;  3RQ1 A;  1AY8 A;  2BHX A;  3KKI A;  1CZC A;  3G7Q A;  1ASN A;  5EUD A;  3IF2 A;  4GE7 A;  4DGT A;  4A6U A;  2VMZ A;  1S09 A;  2EZ2 A;  1KKJ A;  1LC5 A;  1S07 A;  3B1D A;  5BJ4 A;  4L0O A;  4AO4 A;  1C9C A;  4ATQ A;  4JF1 A;  3E2Y A;  4RKC A;  3MAU A;  1MAQ A;  4GE9 A;  5EAA A;  1VEF A;  2YCN A;  3CBF A;  3FVS A;  1BQD A;  3QHX A;  2YOB A;  4A72 A;  3NYT A;  1B5O A;  1YJY A;  2CH1 A;  1AAW A;  1ASL A;  1PMM A;  2VMU A;  3ZZK A;  4H63 Q;  2FQ6 A;  2W8J A;  2VI9 A;  1TPL A; 
#chains in the Genus database with same CATH homology
 4Y0H A;  2W7M A;  4GRX A;  4BA4 A;  4ZDP A;  2ZC0 A;  2F8J A;  2DR1 A;  2WB6 A;  5FT8 A;  3FKD A;  2JJH A;  3DXW A;  1AHE A;  3E77 A;  1AHF A;  2AY4 A;  5FT5 A;  2VGS A;  2DGM A;  1FG7 A;  1GEW A;  2W8T A;  3K7Y A;  4DQ6 A;  2CH2 A;  3M5U A;  1GCK A;  1M0O A;  2D64 A;  5F9S A;  2C0R A;  1GEY A;  4ZWM A;  1SPA A;  4K2B A;  2ZUK A;  3ASA A;  1ASD A;  2O1B A;  1OAT A;  3BN1 A;  3RBL A;  3UE8 A;  3MC6 A;  3MAF B;  3VK4 A;  3FFR A;  2JJG A;  2VMR A;  1AMR A;  1AIB A;  2AEV A;  1BKG A;  2OGE A;  2Z61 A;  4W91 A;  2VGZ A;  3EZ1 A;  1SFF A;  1W23 A;  2YHK A;  1WYT A;  1EG5 A;  1EQB A;  4AZJ A;  1CJ0 A;  9AAT A;  1N2T A;  3I16 A;  3HLM A;  1I48 A;  2BYJ A;  4MY5 A;  2D7Y A;  1ELQ A;  3AOW A;  3GBX A;  2FM1 A;  1QZ9 A;  4GEB A;  2ZJG A;  3K40 A;  3TAT A;  2D61 A;  3PDB B;  4W1V A;  4CXR A;  2QA3 A;  4DBC A;  2CAN A;  1Y4I A;  2VGT A;  2Z9W A;  3AOV A;  4RM1 A;  5G2P A;  4ITX A;  4WBT A;  2AY3 A;  3HL2 A;  1IVR A;  2VLH A;  3NX3 A;  1UKJ A;  5DB5 A;  4IW7 A;  1I29 A;  1DJU A;  1GC4 A;  3IHJ A;  4WYC A;  4K05 A;  3DR7 A;  3EZS A;  4IYO B;  3USF A;  3AEO A;  2HOX A;  3ELE A;  2C7T A;  2Q7W A;  1D7U A;  1AIC A;  3BCX A;  3EIB A;  3F0H A;  2PO3 A;  4B98 A;  1EJI A;  1WST A;  2X3L A;  1D7S A;  1Z3Z A;  2VIB A;  4WXB A;  4Y0D A;  4ZSY A;  3PA9 A;  1YIZ A;  2HUI A;  3NRA A;  2DGK A;  1IAY A;  1FC4 A;  1LK9 A;  1MLY A;  1GBN A;  4WLJ A;  2AY8 A;  2GMU A;  3ISL A;  2PB0 A;  3D6K A;  4WB0 A;  4WD2 A;  4MKJ A;  3G0T A;  5EUE A;  1V2D A;  3VK3 A;  2E7J A;  4XJM A;  4M2M A;  5LH9 A;  4WXG A;  3LVK A;  3JWB A;  4H51 A;  4UHM A;  1M4N A;  4ZDL A;  4LC3 A;  1J32 A;  1D7V A;  3HMU A;  1MDO A;  2D7Z A;  2W7G A;  3WLX A;  1G4V A;  2BI3 A;  2ZYJ A;  2WK7 A;  3A8U X;  3L44 A;  4JEV A;  4Q76 A;  4UQV A;  3BV0 A;  1ASE A;  2R0T A;  3AV7 A;  2JGT A;  3NUI A;  3KGW A;  1BT4 A;  3PD6 B;  4HVK A;  1DJE A;  2PB2 A;  3EIA A;  1IJI A;  3AEJ A;  1ART A;  1V2E A;  3QM2 A;  3E2Z A;  5E4Z A;  3P1T A;  3EUC A;  3DYD A;  1C7N A;  1G7W A;  3QI6 A;  3VAX A;  1U08 A;  1ASF A;  1ZOD A;  2W8V A;  3FZ6 A;  5BJ3 A;  1VP4 A;  3DC1 A;  3MC6 C;  3LVM A;  1LC7 A;  4N0W A;  1B5P A;  3NNK A;  4M2K A;  2G7J A;  2ZP7 A;  4A0R A;  4A00 A;  3N0L A;  4UOY A;  3EI6 A;  1ASC A;  3FVX A;  1O61 A;  3TFT A;  2OAT A;  3JZL A;  2R2N A;  1C7O A;  1TAR A;  2D66 A;  2VMW A;  3DR4 A;  3BWO A;  1AAM A;  1PFF A;  4AH3 A;  2AEU A;  1JS3 A;  3CQ6 A;  2QMA A;  3JU7 A;  1UU0 A;  2VLF A;  3K28 A;  3MEB A;  1UU2 A;  1X0M A;  3ELP A;  2DKB A;  3N5M A;  1CL1 A;  4ZM4 A;  1DGD A;  4I8A A;  3FRK A;  1WYV A;  3EI9 A;  3WCN A;  1M6S A;  1AKB A;  3FQ8 A;  2E7I A;  3UAK A;  3R9A A;  2ORD A;  1SZK A;  3WGC A;  1I41 A;  3P6K A;  1QIS A;  4U2H A;  4E77 A;  1TAT A;  1PG8 A;  1TOJ A;  1P3W A;  2Z20 A;  1YAA A;  2HOR A;  4IXZ A;  3GR9 A;  4U1T A;  5EIG A;  1V72 A;  4HF8 A;  1IUG A;  4A0G A;  2YKX A;  2BI5 A;  2W7H A;  3UWC A;  3FCR A;  4JE5 A;  3NDN A;  4ISY A;  3N4X A;  1AMS A;  2BI1 A;  5G4J A;  5C6U A;  4M2J A;  3RCH A;  2AY2 A;  2QB2 A;  1O4S A;  2HZP A;  5G0A A;  3F6T A;  2R5C B;  4XEW A;  3FDD A;  4KAM A;  1S08 A;  1WKG A;  2W8U A;  4KXK A;  4R5Z A;  1AJS A;  2W7J A;  5EAV A;  3I4J A;  2VGV A;  2VMQ A;  4WYF A;  1BQA A;  2BYL A;  1B8G A;  1C0N A;  2WK9 A;  3BB8 A;  1CQ8 A;  3I5T A;  3GZD A;  1MAP A;  2X8U A;  3F9T A;  1DJ9 A;  4TMR A;  2HUF A;  3DRD A;  2VMN A;  3MAD A;  4P7Y A;  5EUN A;  2AY1 A;  3L8A A;  2BIE A;  4UHO A;  3WX9 A;  4LNJ A;  4LNL A;  4MKK A;  4FFC A;  1AX4 A;  1PMO A;  4Q31 A;  3EI8 A;  1IAX A;  1TOG A;  2O0R A;  4O6Z A;  2ZY5 A;  4JEW A;  1B9H A;  2DGL A;  3HT4 A;  1YIY A;  2BWN A;  2BKW A;  2JIS A;  3COG A;  1AHX A;  3AEN B;  1QJ3 A;  1LW5 A;  3KE3 A;  3A2B A;  1X2A A;  2HOZ A;  1G4X A;  3VK2 A;  1RV3 A;  1KL2 A;  2D63 A;  4CVQ A;  4F5L A;  2W7E A;  2FKI A;  4N0B A;  4OYT A;  4A0F A;  2YCT A;  3BCB A;  5EQC A;  1H0C A;  3GWP A;  3GZC A;  4R8D A;  1DKA A;  2AY5 A;  4W8I A;  2NMP A;  3AEP A;  4MQP A;  3FFH A;  4W1W A;  3DXV A;  4PVF A;  5JAY A;  1WYV B;  2ZSM A;  3LVL B;  1DGE A;  1OHV A;  1RVY A;  1B4X A;  4LNM A;  2ZY2 A;  1MLZ A;  5EIG B;  3R4T A;  1ARH A;  1M32 A;  3PDX A;  4ZAH A;  3HQT A;  5DX5 A;  2HUU A;  1YJZ A;  4JE5 D;  3GET A;  3ZRP A;  2FNI A;  4MGR A;  1S06 A;  4OBV A;  4ZWV A;  4NOG A;  3NYU A;  4JEY A;  1GC3 A;  1QGN A;  1AHG A;  1AJS B;  4P3M A;  3AEL A;  5HDM A;  3JW9 A;  4MSO A;  4ADB A;  4EMY A;  1LS3 A;  3JTX A;  3WY7 A;  1AKC A;  2TPL A;  2YKV A;  3W1I A;  4JF0 A;  3FQ7 A;  1N31 A;  1AJR A;  1MDZ A;  2GQN A;  4ATP A;  3Q8N A;  2OQX A;  5K8B A;  1GD9 A;  1I43 A;  5I92 A;  2AY9 A;  2CJH A;  4ZAS A;  1V2F A;  1DFO A;  1GC2 A;  4F4E A;  3VP6 A;  3W1J A;  2ZY4 A;  4ZDO A;  3JWA A;  3FDB A;  4JEX A;  4GE4 A;  2DKJ A;  4E3Q A;  2Z1Z A;  4WP0 A;  1QIR A;  1O62 A;  1WYT B;  3EI5 A;  1H1C A;  3WKR A;  4OBU A;  4E3R A;  2V1P A;  5M4B A;  2X5D A;  3AAT A;  2W7D A;  3NU7 A;  1ORD A;  2FNU A;  4OMA A;  3TCM A;  2VMP A;  1KMJ A;  1JG8 A;  7AAT A;  4ADD A;  4K2I A;  1W7M A;  5FT6 A;  5HHY A;  2FN6 A;  2O7C A;  1CL2 A;  2CFB A;  2W7F A;  4UHN A;  5M4D A;  5G4I A;  1IX8 A;  1Z7D A;  1XEY A;  2VMO A;  4ZLV A;  4BQ0 A;  2Z9X A;  2C81 A;  4OT8 A;  4XQ2 A;  1AY5 A;  1TOE A;  1SZU A;  1VJO A;  2XBN A;  4WYG A;  3LV2 A;  4Q6R A;  2W8W A;  3E2F A;  3PPL A;  1YOO A;  2CTZ A;  1LKC A;  3E9K A;  5DJ9 A;  2CST A;  4AO9 A;  4F5H A;  2Z67 A;  2EGY A;  1LW4 A;  3FQA A;  1YNU A;  1ASM A;  3WCO A;  1BJN A;  1T3I A;  2DOU A;  3FTB A;  3GJU A;  2D5Y A;  2HP1 A;  3FZ8 A;  4RKD A;  5G09 A;  3FZ7 A;  4J5U A;  4ADE A;  2VMT A;  4CBR A;  1GDE A;  3N75 A;  2W7I A;  2WK8 A;  4WB0 B;  2VMX A;  4FL0 A;  3T32 A;  1CQ6 A;  5M46 A;  3RI6 A;  4RLG A;  2VGW A;  2D65 A;  4XAU A;  1BJO A;  2QB3 A;  4QGR A;  4B9B A;  1UU1 A;  1BS0 A;  4ZSW A;  4F5M A;  4F5I A;  2EYQ A;  8AAT A;  4EB7 A;  3NYS A;  3PIU A;  4BA5 A;  1JF9 A;  2AY7 A;  3KGX A;  1X29 A;  1X28 A;  3PGY A;  1AIA A;  2GB3 A;  1AHY A;  5FT4 A;  2BI2 A;  1ASB A;  5AX8 A;  1ZC9 A;  2QLR A;  3E2Z B;  1KKP A;  2Z9U A;  3PDB A;  3B8X A;  4J8L A;  4TV7 A;  3ZRQ A;  4IY7 A;  1IBJ A;  2R5E A;  4RJ0 A;  1RV4 A;  2Z9V A;  1D7R A;  1OHW A;  1N8P A;  3CAI A;  2G6W A;  3HBX A;  3FD0 A;  2OKJ A;  4R2N A;  3N7N A;  1AY4 A;  2A1V A;  3N4R A;  4IYO A;  1C7G A;  1SVV A;  3AEJ C;  3B46 A;  5DJ1 A;  1TAS A;  2BIA A;  3NU8 A;  4E1O A;  1RVU A;  4LW2 A;  5KTB A;  2X5F A;  4XJP A;  3ATH A;  2CIN A;  3MBB A;  5F8V A;  5D5S A;  1WYU A;  3QGU A;  1ECX A;  1IX7 A;  2CJG A;  1JS6 A;  4AZK A;  4EU1 A;  4WYE A;  4LW4 A;  4CXQ A;  3HDO A;  4A6R A;  1ARI A;  3H14 A;  1M0Q A;  1M0N A;  5D95 A;  4WYD A;  1OXP A;  3HVY A;  2CY8 A;  4IXO A;  4R5F A;  2JJE A;  5E3K A;  3VOM A;  3AEM A;  4A0H A;  2E54 A;  4F5K A;  1M7Y A;  2KFP A;  3ASB A;  1B9I A;  4Q75 A;  3QN6 A;  3PAA A;  4BHD A;  2YRR A;  2Z1Y A;  3QPG A;  4WYA A;  4TN4 A;  3G8M A;  3FSL A;  4OC9 A;  3PD6 A;  2GSA A;  4RIT A;  5M49 A;  1QJ5 A;  4XJL A;  1BJO B;  1ELU A;  3H9X A;  1SZS A;  3QBO A;  2OGA A;  4IXS A;  3RBF A;  3RCH B;  2AAT A;  3BCA A;  2V0Y A;  3DZZ A;  5E5I A;  3NUB A;  4Y0I A;  1AMQ A;  3ACZ A;  2VIA A;  3BWN A;  3LVJ A;  3A9Z A;  1AKA A;  2BWP A;  1BJW A;  4IX8 A;  1CQ7 A;  5G2Q A;  2YKU A;  3II0 A;  2VI8 A;  3DOD A;  3EI7 A;  2ZY3 A;  3ECD A;  1BW0 A;  3N4S A;  2QSR A;  1ZOB A;  2VGU A;  3B1E A;  5EFS A;  2HP2 A;  3E6G A;  2WKA A;  1KL1 A;  4JEZ A;  2BI9 A;  3A9X A;  4GDY A;  4W5K A;  2C44 A;  3LWS A;  2JJF A;  1W7N A;  3PJ0 A;  3BS8 A;  1TOI A;  3LY1 A;  4EB5 A;  1YJS A;  2ZSL A;  4MQR A;  1G7X A;  3ZRR A;  4PFN A;  3RUY A;  2QBT A;  1GEX A;  3FVU A;  2VMV A;  4GSA A;  4K2M A;  4RIZ A;  1W7L A;  5LHA A;  4RAE A;  2EPJ A;  4F5J A;  1AMA A;  1S0A A;  3GZD C;  3MKJ A;  1MGV A;  4ZM3 A;  3BC8 A;  1ASG A;  3H7F A;  1O69 A;  1WYU B;  3CQ4 A;  2XH1 A;  3TQX A;  4MQQ A;  1DTY A;  4WLH A;  1W3U A;  1ASA A;  4BMK A;  2VMY A;  3GSB A;  2EH6 A;  1C4K A;  3OKS A;  4EFF A;  1OHY A;  3NTJ A;  1LC8 A;  1MDX A;  5J8Q A;  2W7L A;  1M0P A;  1E5E A;  1KMK A;  1ARG A;  2YCP A;  2R5C A;  3B1C A;  3WKS A;  4ADC A;  4XK1 A;  3TFU A;  1SF2 A;  5HXX A;  1QIT A;  3WZF A;  4WXF A;  4PIW A;  3ZZJ A;  3DU4 A;  4OTL A;  4F5G A;  3CQ5 A;  2CJD A;  2CB1 A;  4AOA A;  2VMS A;  1D2F A;  3LG0 A;  4A6T A;  1WKH A;  2VYC A;  3AEM C;  4F5F A;  1FG3 A;  4OCA A;  4ITG A;  1TOK A;  2AY6 A;  1OXO A;  2RFV A;  4W1X A;  3WGB A;  1ARS A;  4PFF A;  5IWQ A;  4KYO A;  1BJ4 A;  5TF5 A;  2E7U A;  1XI9 A;  1GC0 A;  2W7K A;  2YKY A;  2OKK A;  3MAF A;  3AEN A;  3W1H A;  2HOY A;  1IX6 A;  1CS1 A;  2JG2 A;  2BIG A;  1J04 A;  2BWO A;  2GMS A;  2EZ1 A;  1E5F A;  2YRI A;  4RJY A;  4XJO A;  4CBS A;  2EO5 A;  3A9Y A;  3OP7 A;  2FYF A;  1CZE A;  3BWN C;  3RQ1 A;  1AY8 A;  2BHX A;  3KKI A;  1CZC A;  3G7Q A;  1ASN A;  5EUD A;  3IF2 A;  4GE7 A;  4DGT A;  4A6U A;  2VMZ A;  1S09 A;  2EZ2 A;  1KKJ A;  1LC5 A;  1S07 A;  3B1D A;  5BJ4 A;  4L0O A;  4AO4 A;  1C9C A;  4ATQ A;  4JF1 A;  3E2Y A;  4RKC A;  3MAU A;  1MAQ A;  4GE9 A;  5EAA A;  1VEF A;  2YCN A;  3CBF A;  3FVS A;  1BQD A;  3QHX A;  2YOB A;  4A72 A;  3NYT A;  1B5O A;  1YJY A;  2CH1 A;  1AAW A;  1ASL A;  1PMM A;  2VMU A;  3ZZK A;  4H63 Q;  2FQ6 A;  2W8J A;  2VI9 A;  1TPL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...