1WKLA

Crystal structure of nucleoside diphosphate kinase from thermus thermophilus hb8 in complex with atp and adp
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
137
structure length
137
Chain Sequence
b'MERTFVMIKPDGVRRGLVGEILARFERKGFRIAALKLMQISQELAERHYAEHREKPFFPGLVRFITSGPVVAMVLEGPGVVAEVRKMMGATHPKDALPGTIRGDFATTIDENVIHGSATLEDAQREIALFFRPEELL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords nucleotide diphosphate kinase
publication title Crystal Structure of Nucleoside Diphosphate Kinase from Thermus thermophilus HB8
rcsb
source organism Thermus thermophilus
molecule tags Transferase
total genus 41
structure length 137
sequence length 137
chains with identical sequence B
ec nomenclature ec 2.7.4.6: Nucleoside-diphosphate kinase.
pdb deposition date 2004-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 1wklA00
1NPKA 4ANCA 3FCVA 2DXEA 1B99A 3NGTA 5CAAA 3ZTQA 3NGSA 3B54A 3BBFA 4C6AA 3FCWA 2DXFA 1B4SA 1MN9A 1NSQA 2NCKL 3EVWA 3Q86A 3EM1A 1WKLA 3NGUA 1ZS6A 5C7PA 4HR2A 3JS9A 3VVUA 5BXIA 4ANDA 5CABA 4ENOA 4ANEA 2CWKA 1W7WA 2DXDA 4EK2A 3EVOA 4DZ6A 2B8QA 3ZTOA 3ZTPA 1S59A 1LEOA 3ELHA 1NCLA 1NSPA 1KDNA 1LWXA 1U8WA 3ZTSA 4F36A 2BX6A 3BBCA 4KPCA 3Q89A 2ZUAA 3FBBA 3EICA 1PAEX 1JXVA 3ZTRA 1S5ZA 2HURA 1BUXA 3EVMA 4UOHA 2AZ3A 1WKKA 3WX8A 1NDCA 1NB2A 4W98A 1NSKL 1NDKA 1HHQA 3VGSA 1HLWA 4S0MA 4FKXA 4FKYA 3GP9A 4UOFA 3VVTA 1MN7A 3FBCA 3DKDA 3ENAA 3FKBA 2HVEA 1BE4A 3Q8VA 4WBFA 3BH6B 1NLKL 3B6BA 1HIYA 3FBEA 3VGUA 1NDPA 3EJMA 4DI6A 1XIQA 3BH7B 3VGTA 1NHKL 2DYAA 3DDIA 1XQIA 3FC9A 3NGRA 5IOLA 2AZ1A 3FBFA 2HVDA 1EHWA 1F3FA 3EMTA 4CP5A 3R9LA 3PRVA 3G2XA 4UOGA 1S57A 2DY9A 4DUTA 4O0NA 1NUEA 1NDLA 1PKUA 3Q83A 1K44A 3ETMA 3BBBA 2BEFA 1BHNA 3EE3A 1F6TA 2VU5A 3Q8UA 3PJ9A 3GPAA 4F4AA 3Q8YA 1WKJA 3L7UA 3MPDA 2B8PA 3VGVA 1VYAA 1UCNA
chains in the Genus database with same CATH superfamily
5DDQC 1ZTTA 1YBUA 2E1MC 2BANB 2FVSA 5KFGA 2MQ8A 1RYRA 2DXFA 4CLWA 5I3QA 3OTDA 1ZH5A 1U24A 4C2MA 2IAJA 1WOOA 1JX4A 4EU0A 2R7TA 2M5YA 3NAIA 3FRZA 1KDNA 3DXBA 3MM5A 5JMNA 3DRSB 5DQHA 2O01C 3DMJA 4P72A 1S5ZA 5J2QA 3MD3A 1NH8A 4A8YA 1RTIB 4QOTA 4ICLB 3OFHA 1DZ5A 1WOSA 3D3BJ 1RWVB 2BJ1A 1FD2A 2W7AA 1WC4A 4DL2A 4ZPTR 4C4WA 4ZHRB 4BWJA 2OLWA 3DDIA 5LL6d 4ILRA 2EG2A 2ZHAA 4C98A 2X1BA 4WFZA 2Y9HA 3KNGA 1RI7A 2KRBA 1G4CA 1ULRA 1RT7A 1S0NA 4E98A 2RIJA 3R6LB 1U48A 3CIZA 4IO1A 3M8QA 2FJAB 2IC3A 4DHVA 5KFVA 3S6EA 1QSSA 3IWNC 3OTCA 3P49B 3NGUA 4USMA 2HAIA 3MHYA 2P9EA 3RG6A 3UN2A 1OIAA 2PN6A 2B5JA 3CD7A 4F0HA 3ZTPA 4V19X 1JXEA 4X4NA 4RW8B 4KH1B 2AYEA 1Q53A 2GCFA 2CJXB 4JI1F 4DL4A 2CZ4A 3PX0A 3MMBA 1RDRA 4WCEQ 1IJFB 2OP5A 1FFSB 5DQGA 2AX1A 1X31C 3LW5C 3G96A 1K47A 3NNHA 1S77D 4URGA 3AD9C 4A47A 1QD1A 4LBHA 2Q66A 4C8YA 2HGLA 2VD3A 4AL7A 5IOLA 3DDNA 1NHVA 1JJ2R 1U25A 4QZVB 4QPXA 4MAKA 2IY5B 2QFIA 2BACA 1WNEA 2BQUA 2OGUA 3OUYB 2MMYA 3ZZZA 2ZJRQ 3Q8UA 1P8GA 2XY7A 2WB1D 3ZNJ1 5J2PA 2PA3A 1XNRF 4KQZA 5L8RC 8AT1B 1KQFB 3V6DA 1RT5A 4TU9A 2E1RA 1UW4A 1WELA 4CTAB 1Q8IA 2R4FA 3LUYA 4Y0FA 2QL7B 1ELOA 1I5OB 1QLNA 1AZSB 3CMQA 2AGQA 3MMCA 3M1VA 4YHHF 5L39A 1MMDA 2XC9A 2IM0A 3TX8A 1OQ3A 1M90T 4RNHA 3KJNB 3VAHA 1KVJA 2BJ7A 1VLOA 5K14B 1XMQJ 1RAFB 3GCXP 3TUIC 3KJVB 3CC2S 4NASA 1ZA2B 5SUHA 4Y28C 4RW6A 1G7CB 2Q79A 2ASYA 3U1MA 5L9NA 2E5LF 4LIWA 1UPPA 4LIRA 3M2UA 3H98A 2FJXA 1T02A 1F6TA 1B0TA 4WWSA 4DG1B 3KUGA 3POTA 1WKJA 3P6YC 2GVZA 2K7JA 1M5HA 4DR2F 1VQ4S 3NGTA 3JSRA 4ES2A 4J9SA 3G6YA 2ZOFA 1XMOJ 1SV5A 3H4DA 1G1XA 5KFLA 2VBWA 4GKKF 4DV1F 4CYUA 4DV3J 3BQ2A 2BV3A 2DNPA 2DH7A 2ZZTA 3KOAA 1JJCB 4IYQA 3K5PA 2E5GA 9ATCB 2HNDB 2YX4A 1IKVB 1SVDA 1Y00A 2VG7B 2VHGA 3D66A 3BQ1A 2CJBA 2P6SA 2CZVC 1NDKA 3E2EA 2KG1A 3ITHB 3FBCA 4NRUA 2GVDA 2HMIB 1X5SA 2AYMA 1H74A 3A1YG 3DFEA 3I56S 2MKIA 4OFZA 1JLAB 3QLHA 2AMCB 1JLBB 4BBYA 1GMWA 3MR6A 1NJIT 1JB0C 2VOOA 5D4NA 4X84A 4MH8A 4ILLA 1XJWB 5KG5A 1WF0A 2VU5A 3T6JA 3TP2A 4TNOA 2ROPA 5KFEA 2X51A 1QE1A 3ZZOA 4ED5A 2RDIA 3NGSA 3QIPB 4PXEA 2AV5A 3M8WA 5I3UB 5A8WB 4MKYA 3HHDA 1HQ2A 1FNOA 2P5VA 3OFFA 5C2GA 4Y2MA 5KFKA 2RH3A 4F3QA 2DTJA 1SC3B 1HNXF 3KLGB 3MEEA 3CCUS 5KAKA 2MZRA 3V5RA 2HRYA 3PYGA 2K1RA 5MLCV 2GMLA 3CJSA 2JC1A 1D8YA 4LF9F 4RUAA 4USKA 4USWA 2KFYA 2HRTA 2NREA 4QWBA 4ZVEA 4RWWA 1K0VA 3MMAA 3CJ5A 5F8GA 4WPAA 4PCQA 2H65B 3C16A 2FGCA 5HANA 4CLKA 3QSYB 4M95A 2GFFA 3MUVP 2VBYA 5C24A 5HP1A 3DU6A 3R5AA 2GAGC 1MWYA 2AU0A 4QW8A 4KGXB 3AA9A 1TKZB 2HKEA 3L09A 3HPOA 4HL9A 3I4PA 2CADA 2KHDA 2OAUA 4IOCQ 2NCKL 4DJBA 3WX4A 3GSIA 2Z57B 2XMVA 1RAOA 3ILOA 5L1KA 4ENOA 2HNYB 4OJHA 2CAJA 3IWLA 3RAXA 3M2RB 5KFUA 5KG1A 2AGPA 2OPRA 3IG1B 5A76A 5C25B 2EEYA 2YY3A 2M3DA 4C3LA 4IRDA 3DRYA 2DEIA 3RB4A 2Q6CA 4LBIA 1S1VB 2UUBJ 3Q8VA 2CPIA 3MR5A 1RQ0A 4HTIA 1N5YA 1VISA 4NXMF 2RE1A 2ASLA 3B8HA 5EWFA 5HJYA 1FJGJ 4OJGA 2KB2A 2KTQA 1YWXA 1MMLA 2MJNA 3CO9A 2AJ0A 2BW2A 4J9LA 5CYMA 4O3NA 3O3LA 2DO4A 3AOBA 3IR7B 1ROFA 4CLZA 2XMAA 5K8OA 2YNIB 2RKIA 3HD1A 4EBEA 4DFKA 2JHEA 2PO4A 4EZ6A 3F73A 1IKYB 3D0GE 5LXYA 4FS2A 2CPJA 2OO4A 1YJ9S 3MM7A 2OPPB 2XNRA 1ZOTA 1FRIA 4YFUA 5IZHA 3LAMA 1WEXA 4FBTA 1LWEB 2UUTA 2KJWA 3P4UB 1ZETA 4QJVA 3AD7C 3IXQA 1RHUB 5EUHA 2B3TB 3NBPB 3KJFB 2AEJA 4RNOA 9RUBA 1WHYA 1KRPA 2DIUA 3NOGA 1SKWA 2RRNA 5U47A 4JYAJ 3I31A 3TZZA 3ISNC 4HLBA 3TI0A 1UVIA 2FVPA 2PDAA 4LF2A 4UZCA 2E9TA 3SBMA 3RW6A 2RF2B 3RR8A 3PRVA 1YQHA 3UW1A 3A13A 1N0VC 3G6XA 1UPMB 4RO0A 4OV6A 3VGVA 1O8BA 1HNIA 4OYMA 3IGNA 2XNQA 5D8HB 4NA2A 4B17A 1SIZA 4J37A 4ZVRB 2HVIA 3A3OB 2L9NA 1HBNB 4CO3A 1P1LA 5F8HA 4O44B 2MGZA 1GEHA 4FYWB 3DLHA 1YRXA 2RT3A 1JWWA 1IKXA 3HSJA 1NKEA 1EJ7L 2CQ4A 3IRXB 4CM2A 3BBCA 3S01A 3M7VA 3QZ7A 1V3RA 1S7HA 2VQEJ 1HI8A 2JEJA 4WFAQ 1HR0F 2QN6B 3DI6A 2CRLA 1RSCA 1NMEB 1HBOB 4DV2J 5CZXA 1C0UB 1FE0A 4RUCA 2J0QD 2P2CB 3KK1A 2XTJP 2PMWA 3MWBA 4F3OA 3HI9A 2B9EA 3VQTA 2P6TA 5D77A 1FI4A 4N7TA 4H4MB 4OHXA 4P7VA 2OTLS 2W2NP 2J9EA 1CJUA 3O5TB 4I56A 2V67A 2F3JA 3L95X 4FXDA 3LTOA 5LMNJ 3X1LB 1F9FA 4HHUA 1ZS6A 2V8VA 1DRZA 3VHQA 1FX2A 5CCMA 2XS7A 1L3SA 3CPWR 5D4LA 4DUZF 5KT2A 3UD5A 3HK2A 4ECSA 3IO1A 1X4EA 1HMVB 4RJVA 1DURA 4OZ2A 2KRRA 4ZVTB 1JKHA 3TVZA 1X8DA 1PO6A 1Q8BA 2CQ0A 2Y3YA 3J7ZT 1N5QA 3D1OA 5LSOA 5KFYA 1S12A 3C8YA 2D41A 4DR1J 4KYZA 2R8IA 4J5OA 2FB0A 4UQTA 2CJYB 5HK4A 4ZDNA 4MIBA 4MK9A 2R8JA 2ACYA 4LF5F 1Q5VA 1Z2LA 1TUGB 1FVSA 2C3OA 2IJRA 3ZZUA 1MG7A 3TR5A 3J7YU 4D3HA 4Y00A 3TANA 2DGQA 4GVBB 1VQKS 1Q16B 2F4VF 2J5AA 5EX3A 1TELA 2FJDB 1TVRA 3UNYA 2IAJB 3K5NA 5IT0A 4X4RA 2J6TA 1HWJA 4PR6A 5EHHA 3GZ7A 4KH0B 3HHLA 4W4MA 1HHSA 1S1XA 5KG0A 2MQQA 3MM5B 1X4GA 5E3AA 5IQ6A 3MOZA 5HROB 3H20A 5J2QB 2ADBA 2DNMA 3D0IE 1PC5A 1YIJS 1CULB 3FCHA 4B9LA 2ZZMA 3EZUA 2NSBA 2IVYA 3KUHA 5HI7A 3GR1A 3EJMA 1XR7A 4MFBA 2O66A 5GMEA 3AD8C 2DCUB 3PJXA 2NUUG 4PWWA 3RJMB 2V8DA 5AXMA 1VQ5S 3I5CA 3JSMA 3AOAA 3G2XA 3SSQA 1FF2A 4O0NA 4NLPA 4KHPF 4CLTA 2BJ3A 1VR6A 2DR5A 2FZGB 5AE2A 2KJVA 1UCNA 4IRCA 1IBLF 3M8QB 1RTZA 2IC3B 1IBKF 3NMAA 2BABA 2H3EB 1B4SA 5ETKA 4Z7YA 2QFJA 1NKCA 1X60A 1QTNB 2PIIA 1NK6A 4QWCA 1OPZA 1NCLA 2B5JB 1KWMA 4PQUA 1LWXA 5ADZA 2MYFA 1NK0A 2YWFA 1YI2S 3ZZTA 5A0YB 2FY1A 4JI1J 2AP6A 3MMBB 2H5EA 2VKZG 4O0IA 1U45A 3MPVA 1YSJA 5L1JA 2IRXA 2JLFA 2KYXA 3SQOP 3EZOA 3HT3A 2AJ4A 2ZH7A 3VGTA 1H2VZ 1S9EA 1ITPA 1RWWB 3D7SB 3GYNA 3D1HA 4LF8F 3G6ES 1T03B 3PR4A 2OMOA 2ZH5A 5F3ZA 2VL1A 3PX4A 5KFNA 4B3OB 1XNRJ 4ZIVA 4NCBA 1CJTA 3H5UA 5FDLB 3GLJA 4ZOSA 2GS8A 2ZD1A 3V6DB 1RT5B 2NLWA 2OFHX 4Q8FA 2RS2A 3O44A 4M5JA 1IWGA 4DX6A 1A6LA 1WDDA 3CJKA 3T9ZA 1KN6A 2KXNB 3MMCB 2Z56B 4YHHJ 3KDOA 3M1VB 3DOLA 5HLFA 1UVNA 1UJ4A 5E3QA 2R2TA 4WZMA 2LKZA 2OEJA 2PSZA 4J9NA 4ZLLA 3FSYA 1YBTA 3J7A1 7FDRA 1DAXA 2HHWA 2XYHB 2XMMA 5KT4A 3NEKA 4LSLA 2C3PA 4RW6B 3DLKA 2E5LJ 5GAGI 1U1MA 3W9HA 1Z4UA 3OVAA 2VONA 5CD4A 2DNYA 1FKAF 2ACMA 4DUTA 2N82B 2HHHF 5DJBA 4IG3A 2M4MA 2E7WA 4O23A 1RT4B 4V19J 1UETA 1ZA1B 4F4AA 3J81U 1A0OB 3PYDA 5HMZA 1S6PB 2HQIA 3RTVA 4DR2J 5LJ5Y 1FESA 4YY3F 2UU9F 3BYRA 1RAAB 1U1QA 4ELUA 1O51A 1ZZFA 4H54A 4GKKJ 4DV1J 2CWKA 2JVOA 1RU1A 1RBAA 3RB3A 4CYUB 5B7WA 1NRKA 1KOHA 4X65F 4JI5F 4UY85 2ERRA 1RZMA 1TKTA 3DLBA 5ETSA 1JXVA 2XHCA 3TAMA 3EVMA 2UVVA 2W01A 2MY8A 1J5EF 2RJZA 1ZTWA 5LJ3Y 4WK3A 4M5HA 1RWXB 3DNCA 4DS4A 2GVDB 1HIYA 3WC2A 5A8RA 1VGYA 4QPTA 2FTRA 2WBMA 1SJ3P 3PW0A 2BZ2A 3P45B 4RZRA 5J1EA 2ZH2A 2ZBPA 3N9UC 3EGZA 1X4CA 2BYCA 5E3CA 4OX7A 2J7UA 2IBOA 4EO6A 2PA8D 4ZJQA 2I6WA 2YKPA 1QAJA 4ECQA 4MIAA 2DRAA 2C2DA 4ZN1A 2GMJA 3NGKA 2IDEA 3JQMA 1Y3KA 1QE1B 4G1IA 1MU2A 3L3CA 2KO1A 1RWKB 1U1NA 5LT5A 3QT6A 2HEKA 1WKLA 4F2SA 2MZTA 1KVKA 2HWIA 3UD3P 4D3GA 3FZBA 3GB0A 2MHEA 3CSKA 4CH0S 5GAHU 1P9YA 1V5VA 3KUEA 3BSNA 1R8AA 1HNXJ 2HGMA 3FGVA 4P75A 3G6VA 4PWUA 1RHMB 2MJUA 3MEEB 1RHQB 1K8AT 4Y34A 1PILA 4DFMA 2L41A 2K1RB 1UVJA 4FKYA 4LF9J 2YNFB 2JWNA 1JXLA 2W25A 4QU7A 2RB7A 3PHEA 2HW3A 1MROA 3BH7B 2JEGA 5IXUA 1GXTA 1C4AA 1E6VA 2ZWPA 3D0HE 2G13A 2R9LA 3OJUA 1G6BA 1NUEA 2CQCA 3D6HB 5C24B 3Q24A 1IQTA 4PG5A 1SC6A 1K1QA 1RU2A 1BXNA 2M8DB 2OJ3A 1OS5A 2R8GA 4LF6F 3AA8A 3Q8PB 4C3MA 1Q4RA 2HK3A 2ROEA 3WIUA 3ENWA 4ATNA 2QZ8A 1M1HA 3CO0P 2R7VA 2HHPA 4USJC 3VAFA 2Q6BA 2ZFHA 1H0HB 2Y0BB 1ZYQA 3PG9A 4U8VA 1FDNA 4ZPBA 4DQQA 2OPRB 2DD8S 5D4OA 2VDIA 1RA6A 1WC3A 4HH0A 2HZAA 2J76E 4ID8A 2WTFA 1WG4A 3VTIA 4WXWA 2G2ZA 4NXMJ 1PBUA 1OQ6A 2MZSA 4L3KA 1VS3A 1F3FA 4K4WA 2ADCA 1NBEB 1CEZA 1YJWS 3W65A 1PKUA 5CYMB 2GNKA 2FHKA 3M32A 2POKA 1KSPA 3MOJB 3H7HB 4DPYA 1YG0A 3DRRA 1Z2ZA 4NXNJ 3I32A 4CO4A 2PMZD 3MECA 3H90A 4HR2A 2ZVSA 3H8YA 2W9CB 1FX4A 3CJ2A 2CPDA 3HDSA 2XYGB 4DL7A 1LEOA 4UOCA 1VBKA 2QX0A 3T19A 3F41A 3IS9A 3KWMA 3BKTA 3VALA 2VFSA 2W4CA 4EO8A 2WVCA 3SFGA 1N33F 2Z8QA 4OQJA 4DX5A 2YWHA 4CM0A 4O4GA 3J7Z5 3ENAA 4XTTA 2O3DA 2NUHA 2R7SA 1WC0A 3M30A 4ZVUB 3FDSA 4OHVA 5K5MA 2DNKA 1NNDA 4GC7A 2JOQA 4CDIA 1FKPA 5KG6A 4F04B 3TEHB 1TL1B 3KK3B 2D3ZA 2MZJA 4K2JA 1UFKA 2PC6A 3IGVA 3H42A 4RL1A 3PV8A 3LPEA 3HXMA 1LXNA 2XCAA 3NS7B 1S6QA 3F0NA 2FVCA 3RB6A 4PWDB 2AJFE 4LQ9A 3D6TB 3OV7A 4X4UA 2EKYA 3I9V9 1HKAA 2Q43A 3TAPA 2D3UA 4BLGA 4OZ3A 2B7CB 4TY9A 2BQRA 1JQGA 3C6TB 2VB6A 2IA0A 4JOUA 2E1PA 1UMJA 2W7PA 5CYJA 4A4JA 4FF3A 2LA4A 3OQ2A 3VZIA 2GJ2A 4EZ9A 1NSKL 3T5LA 4FKXA 4UOFA 1HR0J 2LQBA 2XGPA 2VZ9A 5CA5A 5DG8A 3M9MB 1CJKA 4X4QA 5D78A 4TYBA 4OI0A 1OWXA 2AJ2A 4K4VA 4ZVSB 5K8MA 4R5PA 2CQGA 3B82A 4X4OA 4TYAA 4RW7B 4EYHB 3OL8A 2KKHA 3KK1B 4F4XA 2W2MP 3PEHA 2E29A 3FZ2A 3TO8A 1ZZNA 3HJFA 3MUTP 1EIYB 1FKOB 1VRQC 3NOCA 3K8WA 2UV8A 3HFVA 4GKJF 4P52A 4OI6A 3C2PA 4CO1A 4F0MA 3MMJA 2YNGA 3EVOA 4YB7A 1T05A 4DPOA 3ENVA 4OI1A 5KFCA 1NSAA 2VIHA 3D1QA 3SSSA 2E1AA 1P1TA 3BB5A 3TAQA 2V8GA 3OSPA 4DUZJ 2U2FA 1WDTA 3DLLQ 1FHTA 3NS6A 3CCTA 3Q8SB 1S1WA 1RAEB 3W62A 3DKDA 2X1AA 3PZPA 3BSAA 1JKHB 1RTJA 1NZAA 3B4DA 3TOQA 2MSTA 3IAS9 2XMWA 5HN0A 4U67Q 2XM3A 3GCWP 2GW8A 2HVDA 2DPJA 2XY6A 2F40A 2ILZA 2KT5A 1SJFA 2R7OA 1RB0A 2G4BA 6FDRA 1RBLA 4LF5J 5B0DA 1VQ7S 4LMZA 3OW2R 2B43A 4URSA 4DR6F 3DRSA 4HDHA 4PG8A 2NXJA 4J9RA 1TKXA 1UL3A 2F4VJ 3HT0A 4MKVA 3QRRA 2PT0A 3H5XA 1TVRB 4R8UA 4ZP7A 3JTNA 4FVMA 2VH7A 4P74A 3PKMA 4ZHRA 2EI5A 1LNQA 2VF3A 1S1XB 1F2HA 3CTRA 5LSLA 4U6PA 1Q0NA 3L4BC 1RT2B 1SUQB 4DCOB 1N36F 5ETTA 5JVHQ 1W2IA 2HZCA 1HNVA 1F0XA 5AXLA 1QVFR 2DKOB 4JI7F 1VQLS 2GIRA 4MFBB 3GSDA 5AT1B 2W4DA 2WRMA 3VF0B 4EGLA 4I2QB 2H5IB 2ZKTA 4EEYA 2HHVA 1X7VA 1KTQA 2LVWA 4KHPJ 3OD2A 1F1BB 1N5VA 3OXLA 1X4AA 2C1EB 1PSDA 5KT7A 4Q43A 2XS2A 1W26A 4RW8A 1UFLA 2VBXA 3R5BA 4DEZA 1IBLJ 2MKKA 4PG4A 1D09B 3J81j 3SFUA 4WKYA 1Y3JA 2FC8A 1TMMA 5HL7Q 1X9MA 4DCPB 3OFGA 1M1GA 1Q8LA 2OPQA 3CJ0A 1VHIA 1IM4A 5K8PA 3CXCR 2FGOA 2X3DA 4HT7A 3W61A 2YXLA 4P73A 4UOHA 1PYTA 3BPDA 2RQKA 2CQ3A 4ECZA 2W4PA 4C3KA 1CVJA 4USTA 2FHJA 2XWYA 1RGVA 2DNOA 3DRPA 4OZ5A 3M8ZA 1S9EB 4DL0C 3D5MA 3TZXA 2VQFF 2F5GA 2VPYB 1AZSA 4WIQA 2E5JA 4MJKA 3FMWA 2HS0A 2HGNA 3HX9A 2YH1A 3QGHA 3RBXA 4ZP9A 4EWTA 1VC5A 3THVA 3GIJA 1CJTB 2B6AB 2ZD1B 5THWA 3GFZA 5C42B 4DV5F 4ED0A 4EMDA 3U1LA 4F7VA 2R8HA 2YQ0A 1ZM3A 2X1GA 4FNIA 1AXQA 2RQ4A 4DDFA 3FBBA 1C1CA 4LR7A 4QWEA 4CH7A 3CCES 2F8MA 5T14A 1G2EA 1FWLA 5HLFB 3DOLB 5H9EK 3MF5A 1KR4A 4ZMMA 2IYGA 3NP5A 2QJ3A 2FVRA 2WONB 4J90A 4HTJA 4DG1A 1FVQA 2AHOB 3PO5A 1K9MT 1J27A 3NLCA 4B3SF 3FNNA 2HS3A 1RTHB 1SIWB 2KL8A 3JQJA 4DU8A 2HFVA 3DLKB 2CJAA 3GONA 3R9LA 4ERDA 2G0JA 5KFIA 3Q83A 2HHHJ 5GMDA 4Q44A 4AE5A 4WJBA 4IG3B 2EFQA 5B0AA 1DFDA 4IFVA 1SKSA 2EPIA 2HNDA 4Q7AA 1U7LA 3EYZA 4I1TA 1C1BA 1WJ9A 2HZVA 4DPXA 1MMNA 4YY3J 2UU9J 4DR5J 1XK8A 3AFGA 4DQRA 5JUMA 3BGRB 2KU7A 4HI2A 4NMXA 4NZ7A 3D6FB 4R0EA 2C42A 3N0VA 2WVFA 3ITHA 1M5KC 2HMIA 2VG5A 3QWPA 4F0KA 3OR2B 4X65J 4JI5J 4AXJA 1REGX 2DCLA 4ZKAA 2H54B 3Q89A 4R25A 4H4KA 1RAGB 2JH3A 1JLAA 1TKTB 3QYYA 4IQXA 1Q7YT 4OI3A 4Y2IA 1J5EJ 3GFYA 5KG2A 3KLIA 2M7SA 5AE3A 1QJHA 3MD1A 1TQLA 3NL0A 1KLMA 4CT8A 1HWUA 3OL6A 3NNCA 4OX9F 1I94F 5A8RB 1U49A 2AX0A 5A8WA 4E0DA 4BCAA 2B9XA 2Y8WA 2ROGA 1KQGB 1K44A 1U1OA 4IG0B 2NSCA 3FRYA 2U1AA 1LWFB 4QW9A 3R8YA 3KTQA 3BSOA 2OSQA 2FJWA 4JI4F 3BPSP 4KB7A 2J9CA 4LSNB 3UPFA 2RU9A 4K4UA 5GAGU 3E8OA 4EBCA 5E3PA 4RX6A 3A8EA 1WC6A 2COLA 1S99A 2V2ZA 2K7KA 1L3TA 1NZ8A 3PFOA 4K50A 1SJQA 4ZCMA 3JSBA 5E2QA 5DG7A 2CIMA 1CPZA 1XTZA 3LF0A 2VC0A 4DL3A 4FS1A 2NXNA 3M8YA 1Y5IB 2ZHBA 3QAUA 4LFBF 4FPIA 4L74A 2DYAA 2EW9A 2AWZA 4K4YA 3NGRA 1CC7A 3UI3A 5M2UA 1XMBA 4Y2KA 3EDQB 2WVEA 1UFWA 1DBDA 2JEFA 5T41A 3M2RA 3SSRA 3TYTA 1RWOB 1T9VA 2V34A 1T94A 4LF7F 4IOAQ 4LF6J 5HQMA 2QRRA 1FRMA 2D74B 2QMUB 1FTRA 5ETRA 3Q22A 4A48A 1U47A 5KFRA 1S1VA 2OSRA 5CYQA 1WC5A 3FJ2A 2M8HA 5DDOC 4DWIA 2Z0GA 4OI4A 5KFQA 1WG5A 1YX2A 3AQPA 2BJDA 4GMKA 5ETQA 1FRXA 5B0FA 3QRQA 4O4RA 1QAYA 4ED2A 1PYSB 3LO3A 3PYEA 2UUWA 3CUNA 4FN5A 2GMHA 1JK9B 1IKYA 1Y0HA 3BKUA 2KM8B 4AD6A 4XPEA 3B4MA 2W2PP 4Q45A 5DM6Q 2EFVA 4Z7CA 2ATCB 3UFCX 5DGAA 2C3YA 2MQOA 3M32B 4X4TA 4N8OA 4BDPA 4RBUA 1LWEA 3M2VA 4N77A 4LJMA 3DCAA 4FBUA 3B54A 5A2QY 4O3OA 4BHQA 3GJTB 3KFWX 2DNRA 2YQ3A 4C0BA 5AJ3F 3TNVA 2BE2A 5H9FK 1RISA 5IM0B 3RZAA 2HPUA 3DN9A 2QV6A 2DGTA 1FTCA 5G4DA 1ZAVA 2LEAA 1IBCB 3IS9B 3GJSB 4JI0J 4C7QA 4ED7A 3I5BA 2W9BA 2CFXA 1N33J 1RACB 2HHUA 5F0WA 2K3IA 4O4GB 3HP6A 1NM2A 2UV8G 3BKFA 1VOMA 3ET6A 3FEZA 2WAQD 3A3NB 2V4JA 1HBNA 3D68A 5IT9U 1KQSR 1BWEA 4O44A 2HNZB 3JYTA 2R2SA 1FKPB 5RUBA 1FJEB 3CVKA 1IN0A 3DLEB 3NKYA 4OLPA 2FC9A 2QE5A 3I87A 4UZBA 2ZJQQ 2XBPA 1S6QB 1S10A 3KHLA 5EWGA 1RUSA 1SKRA 2Q1LA 1DTQB 2FHMA 3BR9A 4KV8A 1RHKB 3KKFA 2MKJA 1OPIA 1HBOA 4PXCA 4F36A 3DOMA 3FEXB 4ZPWR 3GYGA 3SYZA 4DR3F 1Q81T 1D0EA 4DR4F 1WUUA 1N6QB 2RHQB 1S9FA 4L6V3 5F8NA 3P5BP 2XLKA 4CWBA 3VGSA 2FJBB 1EKRA 2HHSA 1O6XA 4FDFA 5DS7A 1OY6A 2AJQA 1ZPVA 1TL3A 1CJKB 2HBZB 1NDPA 1X4DA 2B7BB 1S1UA 1VMBA 3HD2A 2R8KA 1T95A 4LUBA 4R5PB 1RADB 3NWGA 5HVGA 2K06A 2IM1A 4RW9B 3Q8RB 1HBMA 1YVFA 1SL0A 1RAIB 2Z2MA 2BEFA 2V8HA 5CQGA 2FVQA 1NJXA 1FNXH 5KFBA 2BKOA 1WSVA 3R7SB 3MM6A 3FCWA 4WTOB 1X5OA 4GKJJ 1HMVA 2YNGB 4NZ6A 1V6HA 1AB8A 2IIHA 1T05B 2QL9B 1KOOA 4RUHA 2QYCA 2F8HA 1DY3A 3JAMY 4A8XA 2EFNA 2M88A 2KN4A 3W9IA 1Q95G 2LQ9A 2CNKB 3LGNA 2KH9A 3CJRA 1S1WB 3KLFB 4UUXA 4B9SA 1EQMA 1UZDA 1JLGA 3QAEA 1HPZB 1RTJB 2KM8C 2CPXA 2QC3A 4RBVA 5F8IA 2JEIA 3VV2B 1BQMB 2JRSA 4NLUA 2JL9A 2EK6A 5IT9Y 4GVBA 4OYPA 1UWAA 2M9KA 1VFJA 2WZ1A 4WFNQ 4F50A 3GIIA 3EGWB 3QSIA 5D3GB 2C28A 1TFYA 4DR6J 2GQQA 4NZ0A 5HROA 4LRFA 1FEHA 3QGIA 2BMBA 3VAIA 5DETA 1TKXB 3R5JB 1RWUA 4K5SA 1CULA 5AE1A 4U95A 5DQIA 1TP7A 1TL7A 3CCSS 3KG4A 4R8UB 1DJ0A 2UVRA 4DN9A 2AGOA 1E6YB 2DR7A 2WW8A 4F02A 1N52B 3DU5A 4EYIB 2D3OR 4LT6A 3DRXA 4C8MA 2E1CA 4OZNA 4ZS6A 2VJVA 5CHCB 1N36J 2PI5A 4PZVA 3MR3A 1HNVB 4ECYA 2C22A 2RILA 3MZIA 3QFWA 3PDNA 3NMRA 2QA1A 4I0WA 4JI7J 3FBFA 3LWMA 3TVKA 1LW0A 1S79A 3D6MB 4ZJLA 1IKWB 2PGCA 5D6GA 2JVRA 2KHCA 3GE9A 4B3MF 5DLFA 1FFWB 3IBFB 1EARA 2GZOA 2I5JA 5IV4A 4X64F 2LU2A 2EWHA 4A8KA 2F65A 1DARA 1VI7A 4B9UA 2Z2YB 5A0YA 2LYVA 1HI0P 5B0CA 2QLXA 2AT1B 3RB0A 4H4OA 4F25A 2BW7A 2C2KB 3CDEA 2YWKA 1S72S 1H7WA 5KFTA 2NPFA 4P2MA 2OPQB 4A8OA 1VQ6S 1TK5A 4NLRA 1FFGB 3AB4B 4CT9A 4G1QA 1NPPA 3ZTRA 3AOCA 1CQNA 4WZQA 5LOQA 4J7CA 4URQU 3V6KA 1HQUB 4YS2A 2AIRB 2MQPA 4AT1B 1T9UA 5EDWA 3QT5A 3FSIA 1ZM9A 5ETLA 3GWCA 1T03A 2OEMA 3CMAS 4B3OA 1NHKL 3K17A 2XZDB 2A0FB 3QGGA 2DGXA 3G8QA 1JLQB 3KNAA 5FDLA 2OIHA 2W8LA 2B51A 3DRPB 2A6MA 3LWLA 2D3O1 2VQFJ 1DQAA 1AYEA 2XHWA 2DT9A 1KHWA 3HKWA 2E7XA 3V4MA 2VICA 3MEDA 4YP3A 1UA0A 1HNZF 4CZCA 2YWWA 4WP8A 2MKCA 3CD0A 2OKQA 5H9EJ 5IS2A 4DV5J 4A8WA 4A8FA 4FYXB 4FYDA 3CW2C 1LK7A 3LGHA 4USVA 3OBIA 4GRSA 2NR0A 1C1CB 2VBZA 1VHFA 4TU8A 5K20B 1GTHA 3A8KA 3CD5A 2J0XA 3KHHA 1RT4A 2EK1A 1Q79A 3WIVA 1BMQB 1S6PA 1D8ZA 5GAHI 4B3SJ 3V6HA 4AXIA 4IH6A 2P9CA 1YRUA 4DR7F 1KP6A 1BHNA 4QIFA 3QATA 3THTA 4C48A 2HHTA 3KK2A 2GQCA 1EP4B 2FHJD 2Z2LA 3UDVA 1T9XA 1I6JA 3ZTQA 4IFVB 2E5IA 3I82A 4KSEB 4USUA 1ZAWA 4AFFA 2ZH6A 1C1BB 1R8BA 3KLEB 5CABA 3P8BB 4IH7A 1TFWA 3GV5B 3TW0A 1VBXA 3HSGA 2WCXA 2ZEJA 4QWDA 2VPXB 4ZLNA 2DB1A 3GMGA 2VG5B 5B09A 2OEKA 1S4EA 4XDDA 3TJ8A 2WOMB 3IA0A 2AKWB 3CF5Q 4DS5A 3OLAA 2CVEA 3E3XA 3AAWB 4M8LA 4I64A 4BC9A 1GXUA 2QL5B 4M63A 3WC0A 2GO8A 3KLIB 2LP4A 1Y9OA 3DLJA 1UTAA 1B64A 1UKUA 4DSEA 4KT0C 4OJ3A 5IWAF 1KLMB 1NEEA 1WC1A 1KKHA 4OX9J 2FJVA 1I94J 2MTLA 2YX1A 2NXCA 4NYPA 4C0HA 4EUVA 5HAOA 3DGPA 2DIVA 4AQYF 3U7JA 1IJEB 4IR1A 4DXLA 2XQCA 2AW0A 3HFZB 2HFNA 3FUYA 3MCOA 4OI2A 5J2MB 2NS1B 1Y5NB 4JI4J 1M5VC 4DLEA 4CRJA 3MCNA 2YNFA 3ZTOA 3UNGC 4IOBA 3ZFVA 4G1PA 2BE7D 3L9ZA 1N4LA 3E01A 8ATCB 1M1KT 3M8PA 2K3KA 2F9JA 1KS2A 2CJKA 4CLFA 1B3TA 3K58A 1HBUB 1WF2A 1XNQF 2V2VA 5E0OA 2YVSA 5HATA 3C46A 1VK3A 1U0SA 3QT8A 3MPWA 4ZPCA 3R2CJ 1AA1B 3T1YF 4LFBJ 2CQIA 2MDAA 5ETVA 4M5GA 3LGMA 1K1SA 3QZ8A 2O67A 3ISND 3CCVS 2KI2A 2P9GA 5JXSA 4NEZA 2EC2A 3BM7A 2JLGA 1FDDA 2NQPA 3QPIA 2NZ4A 2GIQA 5ITHA 4F67A 4I7FA 2W2QP 2VC1A 1OYEA 2A1BA 4LF7J 4HI1A 2LMIA 5HSPA 4C9DA 4NA3A 4WE1B 4HEA9 3C66A 5CD4H 3TZYA 4FVCA 2EVZA 1HD0A 4M5KA 4X62F 4LR8A 1LQ9A 2BJ9A 3W2VA 4JBCA 2A2CA 3S7RA 5CYQB 1QM9A 1YTYA 1RHRB 6FD1A 1TAQA 2FQQB 3SCLE 4ZA1A 4M94A 2CJ9A 4JI3F 4QIGA 2R3VA 5HMXA 1VIXA 1S0MA 4F4ZA 4WF9Q 2DBBA 4PG7A 4NYOA 4F26A 4C8OA 4J9MA 2LA6A 4WU3A 4IFYB 4DI6A 1JMTA 5BYRA 5DLGA 2HLUA 4NXNF 4M5DB 3ILIA 1U2FA 1VRTA 1PBAA 3EDRB 4PYDA 3ZNUA 3FSXA 2Z58B 3IR6B 2PI4A 2W9CA 2RUSA 4CIOA 4DV6J 1TK8A 3PM9A 2FY8A 4MK7A 4JV5F 1GQEA 3HZEA 3G9CA 3GIRA 3EZ5A 2J8AA 3MDFA 5E3RA 2FLNA 3M2VB 1XEZA 2NZCA 3VQSA 1GAOA 4A8SA 3RAMA 1U02A 1I51B 1HW9A 1N88A 5AJ3J 1W7WA 1Q78A 2BE2B 4N41A 5KFJA 3H25A 1TK0A 4H4KC 4I67A 3I55S 3OR1B 2XI2A 4OHWA 2XO6A 3G8SA 2NXEA 5IQQA 1TL1A 3KK3A 2ZDPA 2W9BB 1MN7A 2N7YA 2L08A 3W64A 3W3SA 5A6WA 3M4XA 3MEKA 1CS4A 1R6YA 3ET6B 4PWDA 4ETZA 2RS8A 3PNIA 3UQSA 2NXUA 2V4JB 4KHMA 3BDPA 4MYUA 3JYTB 1PAUB 3R3TA 4I2PB 3U1NA 4RR5A 3C6TA 2ZKUA 4AUKA 1RAJA 2B8PA 2OELA 1IBMF 4ANCA 3MFHA 1YBAA 1H6KX 4LSZB 1FCAA 2D69A 1FWPA 3ZZPA 2B9WA 1FO1A 2HIYA 2RMLA 1VQNS 2MY7A 2DH9A 2PFDA 4ZVGA 3R27A 3CCZA 2EFPA 3VVUA 1HWLA 3TJ9A 4C8LA 2I8EA 4FXWA 4EK2A 1R3NA 4KV8B 1RXOB 1WWHA 3ZTSA 3PY8A 2JZ5A 2KVQE 1NK5A 3DOMB 4DR3J 2DPIA 4DR4J 4RW7A 1VCTA 5B0EA 1XBWA 3C19A 4K8RA 4CH1A 2GAHC 4S0MA 4P2XA 1HWKA 5ETOA 1FKOA 1HHTP 3IFEA 5HMWA 5E7OB 1TL3B 1GX6A 1N34F 4Y2AA 1N5SA 4DZDA 3NY0A 5AXNA 2P8IA 1Q5YA 4FXVA 2LXFA 1S1UB 5IC4B 1S4FA 4KFBA 4O3PA 3V4IA 3JTOA 4Y3CA 1HBMB 4OYOA 4YN3B 2C2EA 2PEBA 3MCSA 4QYZK 2BBEA 5J2NA 3GIMA 1QUVA 2HWHA 2HBQB 1WTFA 5B0GA 4TKTA 4ECXA 3MM6B 1R8CA 2ZUGA 4M5NA 1T3OA 3DHXA 1J5OB 4U8YA 2W7OA 3MUMP 4AL5A 1S59A 5DZ6A 1R0AA 1CBKA 2BOPA 1KEKA 2HBYB 2J9DA 3CCJS 3RBEA 4JI2F 1YJRA 5K8NA 3PCOB 4ED1A 2HURA 4Q5VA 3OVSA 2BM1A 4ILMA 4UW2A 3GP9A 1UJ5A 2VDHA 1ZBTA 2YKAA 3QIDA 2G0IA 4K4ZA 3NCQA 1JLGB 2HAFA 3MM9A 3BN4A 3W1YC 2G9OA 2NPIA 4NL5A 2PE8A 1EX8A 1F2GA 2MKHA 1SQEA 3EGNA 4DQPA 2HLTA 3LOUA 2ZM6F 1UVMA 4WP3A 2HQ3A 1LOUA 6AT1B 4RNNA 3FK4A 1KQKA 1KNZA 3BGOP 1D9DA 4QIVA 3DLGB 1RT2A 2XSJB 1SUQA 2H51B 3KG0A 4YEAA 2W8KA 5GMKa 3S8SA 4YR3A 2UUCF 4CO5A 2BXJA 4CLLA 1NSPA 5KFAA 1TL7B 1FE4A 5HBMA 2YKMB 2IRYA 4ZVPB 3R7BB 3PACA 4LQ3A 1YRTA 5BYSA 4I2QA 3K5LA 2RAQA 5H1SV 4KY3A 3VVTA 4HVZA 3K89A 3TUJC 3BO4A 3O6QA 3K59A 4U96A 2C2NA 4I68A 1MSWD 3V2UC 3EMTA 4YR0A 1LW0B 2A3JA 3ZZ0A 3DOKA 5E41A 4B3MJ 3RYLA 3HMJG 1NKBA 3R1HA 4J9UE 2DXEA 4B9TA 4X64J 2I5JB 3M6XA 4TXSA 4ZPVR 3H40A 2CDQA 3SV3A 4AL6A 4V1Ak 5C2CA 4Q0BB 3BSCA 4DSJA 4XK8C 1H98A 1N32F 2YKNB 1FJCA 5M2PA 4ZVOB 4NCGA 4H4OB 3BO2A 4RNMA 2IHR1 2OHDA 3AT1B 1H38A 1CQMA 1U8SA 3RU0A 1RYSA 4FF2A 3T5HA 3D9BA 1OJ4A 4G1QB 4W98A 5KFWA 5FD1A 2VG6B 1Y10A 5L38A 3NCRA 1ZM2A 3R1LA 4NEYA 3BS9A 5KOXA 4N5SA 4RNFA 2I2YA 2JJ4D 5I4MA 3OHAA 1DLOA 5F41A 4HHHA 1SQGA 2DHGA 5KG7A 2B6AA 2DNLA 2YBVA 3CGIA 3A8JA 5C42A 1V9OA 3THPA 3H2VE 4DQSA 3M8RA 5C7PA 4ED8A 3HVRA 1Y4ZB 3FQKA 1NU4A 2B9YA 5KFXA 4QQBA 1F9HA 3MXHP 1HNZJ 2XMJA 4IR9A 3MEDB 2HQFA 3SIPB 4LRCA 4OZLA 1WSRA 2DXDA 2YKOA 4W92B 2J6UA 4TU7A 2A2DA 2B4OA 2WONA 3OL9A 2FHOB 5FJ4A 3PIPQ 4EI2A 5KFFA 3R5CA 3L7PA 1RTHA 3G87A 2ZDOA 2LEBA 1S0VA 1PJ6A 1UEKA 4JI6F 3QWUA 3R5GA 3EWGA 4PQAA 3PR5B 2SXLA 4OYZA 1VJWA 1VRUA 2WW4A 2V68A 4LFCF 4N56A 3J80Y 2CVIA 4DR5F 3BGRA 1T9YA 4UOGA 2KG0A 2DHHA 5SZTA 4DR7J 1Q7LB 1R0CB 2BR0A 1T0TV 4WFYA 3OR2A 3IBCB 4KC5A 3HCXA 1SB6A 3IM9A 2WBRA 3KK2B 3QJPA 2DEJA 1U6ZA 4N8NA 3DYAA 4J9VA 5JVGQ 3SCIE 4ZCLA 4Q8EA 1FERA 3T6BA 5L1LA 2G2YA 2OPSA 3KLVA 4TY8B 2UXBF 4UQGA 2ZC3A 2LDYA 4Y2CA 3H5SA 2YH0A 3LAKA 4TN2A 1HD1A 1N0UA 3V81A 1T3NA 4ZP8A 4DF4A 1MNEA 4C11B 4IG0A 1TV6A 1LWFA 4DL6A 1RT3A 2DGUA 1RT1B 2HG4A 1SC1B 5IWAJ 4LSNA 1SH3A 4CLSA 5LMUF 4DCJB 3UCUP 2RSQA 2WSFC 2H4WB 3DM2B 5F8JA 4DV0F 1Q1KA 3I0SB 4AQYJ 4KBIA 2BE9B 3DGPB 2C2RA 2GX8A 3KLHA 3KHGA 2MQMA 3OXGA 2B56A 3OHBA 1TR0A 1SJ1A 3IWXA 3PO4A 4PUOB 4G65A 1PYOB 5BXIA 4Y6IA 3HHNB 2LCWA 2DGWA 1TTHB 1REVB 3K8VA 2GGPB 1U0HA 3JQKA 3D3CJ 2RQCA 3E01B 4B9VA 1IR1A 3M8PB 3PHTA 4P6QA 4WTYA 1NDCA 3N5BA 4BC7A 1WOPA 4X66F 4ZP6A 3HKZD 2R42A 1X4HA 5LSRA 1XNQJ 3PJWA 2LLZA 2H4YB 4RU9A 2ZH9A 2EG1A 3T1YJ 2CDRB 3O8WA 1PCAA 1MWQA 4RLEA 2AZ1A 3LP0A 1X4BA 2ZBQA 1GMWD 2QMXA 4GC6A 4LRBA 1IQZA 4J9OA 4XDCA 3CULA 4DV7F 2HHXA 4KGKA 4QR1A 2C2MB 2V9KA 4I7FB 1NJWA 2NYIA 4NLXA 3OPKA 3EPGA 4DU7A 3MAAA 4OIXA 1FEEA 1DHMA 3UCGA 1KC8T 4X62J 1CJVA 1OMSA 1P9QC 2JX2A 2E7VA 3W2VB 4PKDB 2XSFA 3HVTB 3WX8A 3OFEA 1J2VA 3BN7A 3MEGB 3GR0A 1RKJA 4JI3J 2ZVIA 4LREA 1JLFB 2MKSA 4KKOB 2R7RA 3SI8A 3HLUA 4PAAA 2DR9A 3N6MA 3ILLA 2DR6A 3OSNA 5F3TA 1VRTB 2Y8YA 5IM0A 1KONA 2QLBB 3J7AN 5LXRA 3MR2A 2D9OA 4HH1A 4JV5J 3AJ1A 3BGUA 4GO5X 3BREA 5HO4A 1VC0A 3BBFA 2AYGA 4A8MP 1AW0A 2MLYA 1MN9A 1FJ7A 3CIMA 4JI0F 2C2ZB 2MZ1A 4JV1A 4ED3A 2HFSA 1FK9A 4NYZA 4ZIWA 1OY9A 2DK2A 1SQFA 2IBKA 4TLQA 1WHWA 1TMJA 2CPHA 3OVBA 4ZN3A 1H2TZ 1NH7A 5E5NA 2VA2A 3MCMA 2V4QA 2CQHA 1RCXB 2IPOB 2LQJA 2HNZA 4KR0B 3LALA 3M9OB 1HLWA 4WK1A 3P5TL 2HQDA 4YDXA 3UDLA 2HYIB 4RW4B 3DLEA 4DFPA 1EQ0A 2HRUA 1R43A 4UY8T 3BQ0A 3P96A 2C3UA 2VA3A 1CS4B 2GIFA 2XY5A 4J9PA 1X5PA 2X7IA 4K5RA 3LH2S 1WD6A 2BUNA 2Q3PA 1DTQA 2GHVC 2IRUA 2MEWA 5GAEI 1IBMJ 2LFVA 3LP1A 5BJRA 3SDEA 3ETOA 1URNA 1N6QA 2H5JB 4NWBA 4B02A 5GADI 2XG8A 4P2FA 4HACA 4Q2MA 4DX8H 1S9GB 2G0CA 3G4SS 3SXLA 4L72B 2MHNA 3N6NA 3QFHA 1RTDB 3MI7X 3DDKA 3JSYA 4IRKA 4F3MA 2ZE2B 4CO0A 2RU3A 2V4RA 5KOWA 1QUPA 4WXOA 1WKKA 3HO1A 3ZZRA 4RW9A 5DG9A 2FLOA 3MFIA 2AF6A 3TQEA 5ETNA 2MKYA 2OUGA 1V5IB 2BRLA 2OI2A 4MIWA 1U26A 1BQNB 1Y5LB 1TL4A 3BH6B 4ZCIA 1T9WA 5IFMA 4QYZJ 1V3ZA 1QVGR 1N34J 5DRKA 1URRA 2W1BA 2FDNA 4FNHA 2XS5A 1VQ9S 4KFBB 1GMVA 2YPZA 4YOEA 3SQGA 3V4IB 1BLUA 3PJ9A 2CYYA 2HBRB 1VQSA 3L7UA 5I3PA 5J2NB 2GV1A 1VQMS 2WVBA 4MTPA 3OLBA 2RQMA 3F56A 3W8PA 1QAXA 1UW9A 3H4BA 2QA4G 1K73T 3AJDA 1L5UA 3KLFA 3R6GB 3CNQP 2KDOA 1R0AB 1HPZA 4DSFA 2ZBCA 4ECUA 2N3LA 5JJBA 3VR1A 4B9MA 4JI2J 3CDWA 1BQMA 3A4TA 3MAHA 1DQ8A 3FQLA 1IR0A 2V8PA 2J7KA 1UJ6A 3QQCD 3VWSA 2HVZA 4DF8A 4XIUA 3VAKA 3UR0A 2J9DE 4ELVA 5D3GA 3D2WA 3C14A 3CDBA 4ZCKA 1VC6A 2R7XA 3B78A 2XZTB 1WHVA 3LP2B 3MM9B 1GXLA 2VFVA 1R8PA 3MM8A 5FLXU 4LF4F 3TA2A 1C0TA 4NLVA 3BF4A 3ZXWA 2ZM6J 1RT6A 3Q8YA 3MPDA 1LWCB 4Y65A 3G82B 4IQMA 2CQ2A 2NYHA 4KRWA 1EZZB 2IVFB 3FMBA 2QO3A 3KDNA 3HSDA 4HKQA 1E6YA 1N5TA 5CZVA 2V69A 2AD9A 2KFZA 4C8ZA 2F63A 2X1FA 1GNKA 4NI2B 2UUCJ 1JLEB 3KJQB 2J8SA 1U8WA 1L3VA 2BX6A 4F8RA 4LFAF 3KMSA 1QAIA 2UXDF 5HBMB 1HI1A 3QBCA 1IKWA 4L75A 1EETA 2IJFA 1XC9A 5A8KA 3NNAA 2PFFB 4ITSA 4Z2XA 1U6BA 1PIEA 2GC8A 2GO9A 2QMWA 2ZWOA 3NCPA 2V63A 3PYFA 3UR3C 1U1KA 5KFSA 3O2IA 3MURP 2QGFB 4NLDA 1EKSA 1I1GA 2I1RA 1AUDA 2O5DA 4DMZA 2DY9A 3GYXB 3DOKB 4RPFA 3UCZP 1SKUB 2MQNA 5CAAA 3G71S 1LV5A 3K2YA 3M05A 3D28A 3W66A 1AROP 3EM1A 3N28A 1HW8A 1HQUA 4IDKB 1YHQS 1N32J 2QG9B 1I3OB 3PW7A 1UWBB 2UVWA 1YGYA 3ELHA 2ALZA 4NCGB 1R7IA 4G6VB 1GK8A 2DY1A 2B4VA 2XMKA 3HHLD 2HS4A 2DO0A 2W24A 3HVWA 1XN9A 1RLDA 1JLQA 3TZWA 2XB2D 5IC6B 4JB8B 1HHQA 1AFJA 3PW4A 1FWKA 3PKYA 4WYLA 3BDEA 3T3FA 4ZK7M 3C15A 2J6SA 3R2DJ 2Y0SD 2KXHA 1YJNS 1UP1A 4KGMA 3PX6A 3EXYA 2MXYA 3T1HF 1U2CA 4E8UA 2PD1A 3CEDA 1LK5A 3DMJB 3IM8A 1XQIA 1GFWB 4PPDA 1PG5B 4HYKA 4K4TA 2BKPA 4YB5A 5KFPA 2BKNA 5AXKA 1DLOB 2YKQA 3HSZA 2JLEA 5FLXY 1F5AA 4L76A 1YITS 4LF1A 5D0HA 4CNZA 1BD6A 5D0GA 1SJ4P 3E51A 4C8KA 4JI8F 3W5YA 1FRKA 1S1TA 2FPHX 2BRKA 2M70A 4U7UD 4A46A 1JIHA 3T5JA 1VJQA 1M0SA 2DRBA 4U7UK 2HK2A 5F9NA 1T7PA 4DZ6A 2WSEC 1RT7B 4OZJA 1Y11A 5ETPA 3VCDA 2CXEA 4RKUC 2CZ9A 4PG6A 2V5HG 2Y1IA 2DGOA 4RUBA 1X5TA 4JP8A 2A18A 2AZ3A 1S6OA 2AJ1A 3NAHA 2B0GA 3TVYA 4B9NA 3M6WA 2XMTA 4JI6J 3KYLA 1S6UA 3GV8B 5T7LA 2LQ8A 3KHRA 3K5OA 1XR5A 1IUJA 3R97A 2ILYA 3AHPA 1LW2A 1EP4A 1VRUB 5KFDA 1SL2A 1S7IA 3AB2B 3BYPA 2MPUA 2KYZA 4LFCJ 3HVAA 5D4PA 2ZNYA 1LFPA 5F0UA 1U1RA 1D1UA 4QCLA 3G8TA 4U7CA 4L73A 3KLEA 3BV8A 4QIWD 1YJVA 2RNEA 3K0JA 3GPAA 1R31A 3CCLS 2WOMA 2F9DA 3DYAB 3MPYA 3X3UA 2OPSB 2UXBJ 4B3RF 3BEGB 1T8EA 2KXFA 5J2PB 2RRAA 1MW7A 4XPCA 4DUYF 1AFIA 1BWVA 5KG4A 5I42A 3QGPA 2XMUA 1X0PA 2W9AA 1L3KA 4PRFA 4HHJA 3CCRS 4WU2A 5M2RA 2IM2A 2ZHOA 3M6UA 1WACA 3QJLA 3V81B 2HVEA 3CE8A 4KGVB 1HNWF 4CLYA 3EUNA 5J1NA 5HQLA 1TV6B 3FC9A 4PYAA 5A2QU 5J2MA 5D0RA 1JNRB 1RT3B 3OL7A 1EHWA 4OYAA 2XYPB 5LMUJ 1HYSA 1WORA 5EX0A 4MK8A 3AXMA 4DV0J 1JJHA 1A7GE 1Y7PA 4PXBA 1M5PC 3VAMA 2AQ4A 1OSCA 3KLHB 1NB7A 1H2UX 4OV1A 3ZC4A 3M2UB 2HFZA 4NLWA 3TA1A 1U4BA 4NLSA 3N4WA 4QBUA 1HBUA 2XCPA 4MKAA 2B8QA 1XWLA 3A12A 3POTB 3I4HX 2IYIA 2GVZB 2D7SA 3NWRA 2WVDA 4NLGA 2DHXA 1U0HB 1SV5B 2UUAF 4ZVQB 1YJTA 3TARA 2HSEB 1JLCA 3L7OA 2FLPA 4X66J 2Y1JA 2CQDA 3T41A 3IBWA 2MZQA 1FT8A 2VFUA 2CJQA 1VBYA 1XERA 3VAJA 4CLPA 1K0TA 3CJ3A 3TWZA 2HQGA 2A6OA 4DV4F 4WE1A 3LP0B 1VK8A 1U2RA 1YLXA 2MLXA 2WHOA 4LRDA 4K0KF 2DVIA 4WYWA 4DV7J 1KLNA 3S1TA 4YDDB 1Q8KA 1CC8A 3QLHB 5HVHA 3GU0A 3N79A 2KZMA 1VDHA 1IR2A 2QYGA 5KFZA 2FYXA 4KPYA 3LPYA 2H1YA 3FFIA 4ZPDA 3MAAB 3H2UB 4ES1A 4WKRA 4Q2LA 2ZH8A 4I4BA 2IM3A 4G3IA 1CJVB 2CPFA 3G86A 2VOPA 4IO9Q 3DXSX 4ZVFA 4IFYA 1NK7A 5F9LA 4QR0A 4M5DA 4I6YA 2CWXA 2W2OP 1T9TA 3CJTA 4OZ1A 3TUZC 4FF1A 5HVFA 3SCJE 4ED4A 4ZVHA 1BE4A 4WBFA 4DV6F 4ECWA 3LA0A 5F8LA 2LQ5A 2MSSA 1RAHB 2RD5C 5GVQA 1FA0A 2CNLB 2QLFB 2ALYB 1N48A 1OY8A 4EBDA 2EBGA 3UVJA 2H48B 3ENQA 3FCVA 3RBDA 3MMAB 1SL1A 3OR1A 3JAMU 5HMYA 2CG8A 3C16B 3EGVA 1M5SA 4O3SA 2LU1A 1KTVA 4WFXA 2Y1LB 3TUPA 5HP1B 1WI6A 2FZCB 5A6PA 2DNGA 1FK9B 3J81Y 2GHWA 3W2WA 2CQPA 3KXDA 2LXUA 5KT3A 2ZOMA 1HFEL 3BGLA 3I0RA 2GJFA 4OX8A 4P10A 2ZBRA 5KFMA 2ATLA 3PTWA 1QY7A 2G2OA 1L3UA 4I2PA 3PFEA 1NLKL 1MWZA 1UEVA 1SH2A 4OYWA 4PXDA 1N54B 3OTEA 3PRDA 2UVUA 4FP9A 1FDAA 4NE9C 2V9WA 3CJQA 4NPOA 4CP5A 2IA6A 1HQEA 3BGFA 2LEPA 3IAM9 3CC7S 2N7CA 4DPWA 1GH8A 3NGDA 1RJJA 5LM7E 4OYIA 4M5IA 3UDEA 1N5YB 3PIOQ 1AT1B 4DQIA 4C6AA 1NSQA 3LP1B 3SDEB 1B0PA 1ZM4A 3IRWP 3OJSA 2R2UA 4DPTA 1VIOA 2CPZA 4X4VA 4HACB 5G0RA 8RUCA 2KT3A 4XO0A 2RKIB 4UT4A 4E2FB 2CG4A 4XAKA 1EB0A 2QSFA 3SCKE 2ZJPQ 4A8QA 2E5HA 2RRBA 3MM7B 3W5XA 3W63A 4UF4A 4YQWA 3C3LA 2IMOA 4OZ0A 3SEOA 4DFJA 3MGJA 1RKIA 4NCAA 4KJIA 3QO9A 3QRPA 4MMOA 2HQCA 5MAOA 2YX7A 1KFDA 1W25A 2OTJS 3RRGA 1BQXA 1V3SA 4CO2A 1YDLA 4K4SA 2DGSA 3H59A 1NK8A 4CLUA 1SI9A 1R8HA 5ETMA 1NDLA 1FXRA 1J5OA 2IJNA 3SQGB 3AY0A 1UVLA 3IC1A 2KFNA 2LDIA 4F4YA 1LFWA 3A8IA 2ASJA 1YJUA 3M6VA 1OYDA 1DTTA 3D4JA 5EGYA 4P9SA 1FDBA 4LBPA 1FXDA 1NAQA 3T9NA 1HNIB 3GFXA 5GAEU 3PW2A 2YTCA 2ZUAA 1PAEX 2F7VA 4DSIA 1CLFA 2I9SA 4LR9A 2MGZB 1LKZA 2V50A 2DNQA 5GADU 4KO0A 4RU2A 3AQOA 2YNHA 1IKXB 3ADAC 3CCWA 1NPRA 2Z4PA 3B6BA 2EFOA 1YZ7A 2V0NA 4B3TF 1RWNB 2GQ2A 3C14B 4I6WA 4GVLA 4M5LA 4DN0A 4NLOA 3CT9A 4ECTA 3DLGA 3Q0AA 4LF4J 2XSJA 3OXFA 4OYBA 3MM8B 3EX7B 2AEFA 4IKAA 3EE3A 1C0TB 3DI6B 4KAIA 3RW7A 3RAQA 3CC4S 1RT6B 2DR8A 3C6UA 1VQOS 3NXZA 2GA7A 4ID5A 2YKMA 2YQ1A 2EXUA 5BR8F 4YB1P 1GMUA 3ICLA 1RA7A 4USIA 2ZZNA 5DM7Q 2JC0A 2EKNA 3WDOA 1S97A 1SH0A 1CJUB 2R2RA 1RLCL 4KPCA 3RGIA 3WZ0A 1G3OA 2UXCF 4LFAJ 3IMQJ 1X9SA 2APOA 1RP5A 1UZHA 2ZH1A 2UXDJ 5KT5A 4ETXA 3OTBA 2CNOB 1X0FA 3OTOF 2QTWA 4F2RA 2BDPA 2N4DA 1CSJA 1SC4B 2UP1A 1EETB 1Q86T 3CMES 4ES3A 3WQPA 5A8KB 1N56A 4ZLPA 5B0BA 3CCMS 1ACMB 2ZBIA 1KBRA 3UD4P 2JFDA 3NG8A 4PABA 1UEUA 4MYTA 4Q0BA 3MTJA 2I38A 4LVOP 2YKNA 3BBBA 3M8SA 3V6JA 1M5OC 5CH7B 3Q23A 2IMWP 2BANA 4C0OC 4PPZA 2DGVA 4LRAA 2CA9A 1NHUA 3UE2A 3ONQA 3BO3A 1GT8A 2AEMA 3UDCA 4KGZB 3IP0A 4CI0B 5J1PA 2N4CA 2EBEA 2VG6A 2KZZA 4TQSA 3BR8A 2UZAA 1VQYA 2ZNZA 3ISZA 1C4CA 1R0BG 3MPUB 3JB9k 1RTIA 3OT9A 3RRKA 4ICLA 1WG1A 3I9ZA 2IFXA 3I5AA 5FIIA 5L1IA 1VLYA 3C15B 2M52A 1OO0B 2C2OB 1C2PA 3HHLB 3T1HJ 1D3WA 2WK4A 2DNZA 2F8EX 3LQVA 1FRHA 1APSA 4FYVB 4PEOA 1FNMA 4KE5A 3DC2A 2Y1RI 2QA2A 2DHSA 3AH6A 1PJ7A 5DDRC 1RHJB 4O3RA 1YJ7A 4JI8J 3QMQA 1D9FA 1S1TB 2H9ZA 2BA9A 2E44A 1H3DA 2ZH3A 1CG2A 3JSMB 1IM6A 5KFHA 4DBQA 2DISA 2RUGA 2V94A 2R7UA 2FJEB 4EFAC 2AYBA 1X4FA 4QIEA 3P3DA 4LVNP 2XGQA 1IBKJ 3A3PB 1R27B 1KHVA 3QT7A 4P71A 3UN3A 2DNHA 4WIIA 2VASA 2HFUA 1SXLA 1YZ6A 2YWEA 2Z30B 3GV7B 2FZKB 1H72C 5T7LB 3US5A 4PQUB 5L9XA 1JJ4A 2L3MA 3TA0A 3ZZYA 2V2KA 1LW2B 2V2QA 2BM0A 3GJRB 1WEYA 3OUYA 3SV4A 3GFHA 4TY8A 1XR6A 3GJQB 3KMQA 3GG0A 1VQPS 4Z37A 1B99A 3ZO7A 2A10A 3I6PA 4CTAA 1ZAXA 1PC4A 3JXOA 3JS9A 4LF8J 3K57A 2ZOGA 4U9RA 4OYXA 4B3RJ 1T11A 3W7BA 1HA1A 4C11A 2MB0B 1OSDA 2IDLA 4YMEA 4J91A 1O0PA 4DUYJ 5I42B 1VQ8S 1RT1A 3AODA 1RCOB 3CWJA 1ZPWX 5IT4A 2QT7A 5K14A 3CJKB 2VV5A 3KJVA 2K2PA 4X4PA 1XMQF 3DM2A 2BVZA 3TEGA 3N6LA 1TU0B 3I0SA 4N76A 1HNWJ 1FD8A 3MAQA 4B08A 3K7RA 2X3GA 2L9DA 4K2XA 4JUZA 3H2LA 2WB4A 4ZPAA 1SBRA 1RBOB 3BJYA 4PUOA 1VBZA 2K8GA 3NRBA 1HL6A 2XWXA 3HHEA 3EPIA 1DQ9A 3U27A 1HYSB 1REVA 1MLAA 1BC6A 2QLJB 3Q2TC 2EFGA 2GGPA 2ASDA 2CQBA 4LSLB 1XMOF 1P27B 1WHXA 3TX0A 2G1DA 4AYBD 3HF5A 1NJZA 2QIFA 1BY9A 4DV3F 2G1HA 4ANDA 1TUVA 4QR2A 2FLLA 3CDAA 3JTPA 4F4WA 4OJ1A 4NRTA 2DH8A 2ZH4A 1IXKA 4CNYA 1IKVA 2VG7A 5KG3A 3GILA 2VKRA 2MLZA 4ZLJA 4P7TA 2XZWA 1P6TA 2UUAJ 1SCJB 5D15A 1QSYA 1NB2A 3FVYA 1JLCB 1QDUB 1TUWA 2WSCC 3HHLC 1RWMB 4X4SA 1NJYA 3CJ8A 4KTQA 2E9ZA 3FBEA 2JFKA 1IWAA 3GQCA 1JLBA 4DV4J 1UAWA 4ZITA 3TAMB 1R89A 3RRHA 3I96A 4K4XA 1UVKA 3Q8QB 3NS5A 4OLOA 3WHIA 2FD2A 4RWXA 2DJWA 3TRGA 2D9PA 4JV2A 4K0KJ 4NOHA 2HWTA 4QYRA 3PRBA 4C8NA 1B7FA 3QIPA 3HFKA 2I0XA 3N5FA 2XEXA 1PGZA 3HVTA 5I3UA 4KIAA 4ER8A 4NMLA 4DLGA 1F3VA 5J1EB 3GG1A 2CUYA 3MEGA 2ZC4A 4NLTA 4TVAB 3K5MA 1QSLA 3FFIB 4ANEA 3LANA 1JLFA 4KKOA 2GHPA 2JSXA 1TL5A 4M1KA 4OL8A 2V6AA 3KLGA 5B08A 2FIUA 1GTEA 2CKWA 2DITA 3BZQA 2N3OA 1U09A 1MU2B 2PMHA 1ICEB 1SJRA 5DDPC 1RABB 3HJVA 1S48A 1B70B 2EC0A 2YWGA 4IH5A 2VODA 5CCLA 3VAGA 2J7WA 4P2SA 4ALZA 5D0EA 2DNNA 5H9FJ 4DOZA 1XIQA 4HT5A 1S49A 4FZVA 3UO0A 5F8MA 1WTBA 1YKWA 4K7QA 5HQ8A 1YK9A 1HARA 2CNNB 2DHAA 1S57A 2QEXS 3R5DA 2VFTA 4BS2A 1WI8A 4M5MA 1TKZA 5KFOA 3EXCX 4MKBA 3UVJB 2BQ3A 1MROB 4OMFG 1E6VB 1TKDA 2XO7A 5CXTA 2HNYA 4F4KA 2XULA 3FEYB 1H73A 2E66A 4RW4A 1WF1A 2RVJA 2LXIA 3IG1A 2VPZB 5C25A 2FUG9 7FD1A 3W2WB 1SPBP 1F60B 3QNWB 2HVHA 3SMZA 4W90B 3I0RB 2QLWA 3RUBL 1F5BA 3PW5A 1TZ0A 3SZ2A 4ED6A 2UUBF 2CQ1A 2DRDA 2HHQA 1Q82T 3IR5B 3HULA 1H7XA 5L46A 2KT2A 2JDJA 4OX6A 3QJJA 2J0WA 1FJGF 4CQ1A 4DSKA 4TQRA 4YR2A 4NLYA 2XI3A 4USHA 3M9NB 1O5JA 2QSWA 2B4PA 1UA1A 1Z1ZA 1HQEB 4WP9A 3T5KA 1NK9A 2YNIA 1S9GA 2BJEA 4N47A 4OHZA 4J9KA 1RTDA 4NX9A 4QWAA 2ZE2A 1NO8A 1U6FA 5DGBA 2XLJA 3PEJA 2E9RX 3KG1A 1NK4A 4YUDA 2OPPA 3EVWA 1EAYC 1R6VA 2VPWB 4FYYB 1B7YB 3D54A 3W5ZA 1BQNA 4K59A 4FF4A 5DZ7A 1FRLA 2F1FA 4MT1A 1TAUA 4ECVA 3TQ1A 5G0RB 2ZITA 3DRRB 3CD6S 3UWTA 3NBPA 1BGXT 2GJIA 5E33A 3MR7A 3WBZA 3PXGa 3T1AA 3DHWC 2QA4S 3GTYX 4DL5A 2LECA 3MECB 5BYQA 3N01A 4OHYA 3FKBA 1QTMA 4JYAF 3TJAA 3R7NB 2M0GB 2KVIA 3VGUA 2HFOA 2HIQA 3ILJA 2CPYA 3QO9B 2RF2A 4JV0A 2VUGA 4BWMA 3CB4A 4WFBQ 2RHSB 1JNZB 4FPRA 2BOAA 3ETMA 2BJ8A 4TLRA 3H5YA 2R7WA 3M30B 1NPKA 1RE1B 4C97A 3HM9A 4YB6A 4NA1A 5EN1A 2Z2ZA 1U1LA 5DO2A 1DTTB 1KVIA 4UTGA 4I69A 4UUWA 3AJ2A 5K9FA 2O1PA 3CJ4A 3IRXA 4RBTA 2L9WA 1X9WA 2L48A 2J0SD 4HDGA 1U1PA 3EICA 1A9NB 2VQEF 4KHRA 3W60A 2YPYA 1S0OA 3D67A 1RK8A 3LP2A 1FXLA 2IVMA 5HJXA 5IV3A 4R0JA 4J9QA 4DSLA 4KO0B 4DV2F 1C0UA 3UN5A 1KFSA 2YNHB 3O1LA 1LWCA 3MTKA 3G82A 4QU6A 1GX5A 2R7QA 4B3TJ 3J7YI 2XLIA 1HWIA 3GIKA 1IVZA 4NLQA 2OFGX 1KD1T 1NXIA 1PJ5A 3RR7A 4H4MA 2C3MA 2F4FA 3AXKA 2OD6A 4ZJOA 1FRJA 5KT6A 3HZGA 4NI2A 1VYAA 1JLEA 1F9EB 4IUFA 3HHKA 5LMNF 2CPEA 1F5CA 3C6UB 2JNJA 4ID5B 1B0VA 3Q86A 2PEHA 5BR8J 4X2BA 4ELTA 2RDJA 1RWPB 5C5JA 2ABYA 2B4UA 1N8RT 2RDDA 2D1CA 2UXCJ 1S76D 4L3NA 2M2BA 1BUXA 3W8GA 3RBZA 1D9AA 4I6AA 3J80U 3F44A 3OTOJ 5EWEA 5KTQA 4O3QA 1AUSL 3Q2SC 1LXJA 4DPUA 3CDUA 4GO7X 3VZHA 4ECRA 4DX7A 4CCHA 3ULHA 2VFRA 4DR1F 2OD4A 1WEZA 2OMLA 3U02A 3H0PA 2OH2A 2VJUA 4IDKA 3PVXA 7AT1B 3W9JA 2MQLA 3IN5A 3DGVA 1W2BR 1UWBA 3CCQS
chains in the Genus database with same CATH topology
1NPKA 4ANCA 3FCVA 2DXEA 1B99A 3NGTA 5CAAA 3ZTQA 3NGSA 3B54A 3BBFA 4C6AA 3FCWA 2DXFA 1B4SA 1MN9A 1NSQA 2NCKL 3EVWA 3Q86A 3EM1A 1WKLA 3NGUA 1ZS6A 5C7PA 4HR2A 3JS9A 3VVUA 5BXIA 4ANDA 5CABA 4ENOA 4ANEA 2CWKA 1W7WA 2DXDA 4EK2A 3EVOA 4DZ6A 2B8QA 3ZTOA 3ZTPA 1S59A 1LEOA 3ELHA 1NCLA 1NSPA 1KDNA 1LWXA 1U8WA 3ZTSA 4F36A 2BX6A 3BBCA 4KPCA 3Q89A 2ZUAA 3FBBA 3EICA 1PAEX 1JXVA 3ZTRA 1S5ZA 2HURA 1BUXA 3EVMA 4UOHA 2AZ3A 1WKKA 3WX8A 1NDCA 1NB2A 4W98A 1NSKL 1NDKA 1HHQA 3VGSA 1HLWA 4S0MA 4FKXA 4FKYA 3GP9A 4UOFA 3VVTA 1MN7A 3FBCA 3DKDA 3ENAA 3FKBA 2HVEA 1BE4A 3Q8VA 4WBFA 3BH6B 1NLKL 3B6BA 1HIYA 3FBEA 3VGUA 1NDPA 3EJMA 4DI6A 1XIQA 3BH7B 3VGTA 1NHKL 2DYAA 3DDIA 1XQIA 3FC9A 3NGRA 5IOLA 2AZ1A 3FBFA 2HVDA 1EHWA 1F3FA 3EMTA 4CP5A 3R9LA 3PRVA 3G2XA 4UOGA 1S57A 2DY9A 4DUTA 4O0NA 1NUEA 1NDLA 1PKUA 3Q83A 1K44A 3ETMA 3BBBA 2BEFA 1BHNA 3EE3A 1F6TA 2VU5A 3Q8UA 3PJ9A 3GPAA 4F4AA 3Q8YA 1WKJA 3L7UA 3MPDA 2B8PA 3VGVA 1VYAA 1UCNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NPK A;  4ANC A;  3FCV A;  2DXE A;  1B99 A;  3NGT A;  5CAA A;  3ZTQ A;  3NGS A;  3B54 A;  3BBF A;  4C6A A;  3FCW A;  2DXF A;  1B4S A;  1MN9 A;  1NSQ A;  2NCK L;  3EVW A;  3Q86 A;  3EM1 A;  1WKL A;  3NGU A;  1ZS6 A;  5C7P A;  4HR2 A;  3JS9 A;  3VVU A;  5BXI A;  4AND A;  5CAB A;  4ENO A;  4ANE A;  2CWK A;  1W7W A;  2DXD A;  4EK2 A;  3EVO A;  4DZ6 A;  2B8Q A;  3ZTO A;  3ZTP A;  1S59 A;  1LEO A;  3ELH A;  1NCL A;  1NSP A;  1KDN A;  1LWX A;  1U8W A;  3ZTS A;  4F36 A;  2BX6 A;  3BBC A;  4KPC A;  3Q89 A;  2ZUA A;  3FBB A;  3EIC A;  1PAE X;  1JXV A;  3ZTR A;  1S5Z A;  2HUR A;  1BUX A;  3EVM A;  4UOH A;  2AZ3 A;  1WKK A;  3WX8 A;  1NDC A;  1NB2 A;  4W98 A;  1NSK L;  1NDK A;  1HHQ A;  3VGS A;  1HLW A;  4S0M A;  4FKX A;  4FKY A;  3GP9 A;  4UOF A;  3VVT A;  1MN7 A;  3FBC A;  3DKD A;  3ENA A;  3FKB A;  2HVE A;  1BE4 A;  3Q8V A;  4WBF A;  3BH6 B;  1NLK L;  3B6B A;  1HIY A;  3FBE A;  3VGU A;  1NDP A;  3EJM A;  4DI6 A;  1XIQ A;  3BH7 B;  3VGT A;  1NHK L;  2DYA A;  3DDI A;  1XQI A;  3FC9 A;  3NGR A;  5IOL A;  2AZ1 A;  3FBF A;  2HVD A;  1EHW A;  1F3F A;  3EMT A;  4CP5 A;  3R9L A;  3PRV A;  3G2X A;  4UOG A;  1S57 A;  2DY9 A;  4DUT A;  4O0N A;  1NUE A;  1NDL A;  1PKU A;  3Q83 A;  1K44 A;  3ETM A;  3BBB A;  2BEF A;  1BHN A;  3EE3 A;  1F6T A;  2VU5 A;  3Q8U A;  3PJ9 A;  3GPA A;  4F4A A;  3Q8Y A;  1WKJ A;  3L7U A;  3MPD A;  2B8P A;  3VGV A;  1VYA A;  1UCN A; 
#chains in the Genus database with same CATH topology
 5DDQ C;  1ZTT A;  1YBU A;  2E1M C;  2BAN B;  2FVS A;  5KFG A;  2MQ8 A;  1RYR A;  2DXF A;  4CLW A;  5I3Q A;  3OTD A;  1ZH5 A;  1U24 A;  4C2M A;  2IAJ A;  1WOO A;  1JX4 A;  4EU0 A;  2R7T A;  2M5Y A;  3NAI A;  3FRZ A;  1KDN A;  3DXB A;  3MM5 A;  5JMN A;  3DRS B;  5DQH A;  2O01 C;  3DMJ A;  4P72 A;  1S5Z A;  5J2Q A;  3MD3 A;  1NH8 A;  4A8Y A;  1RTI B;  4QOT A;  4ICL B;  3OFH A;  1DZ5 A;  1WOS A;  3D3B J;  1RWV B;  2BJ1 A;  1FD2 A;  2W7A A;  1WC4 A;  4DL2 A;  4ZPT R;  4C4W A;  4ZHR B;  4BWJ A;  2OLW A;  3DDI A;  5LL6 d;  4ILR A;  2EG2 A;  2ZHA A;  4C98 A;  2X1B A;  4WFZ A;  2Y9H A;  3KNG A;  1RI7 A;  2KRB A;  1G4C A;  1ULR A;  1RT7 A;  1S0N A;  4E98 A;  2RIJ A;  3R6L B;  1U48 A;  3CIZ A;  4IO1 A;  3M8Q A;  2FJA B;  2IC3 A;  4DHV A;  5KFV A;  3S6E A;  1QSS A;  3IWN C;  3OTC A;  3P49 B;  3NGU A;  4USM A;  2HAI A;  3MHY A;  2P9E A;  3RG6 A;  3UN2 A;  1OIA A;  2PN6 A;  2B5J A;  3CD7 A;  4F0H A;  3ZTP A;  4V19 X;  1JXE A;  4X4N A;  4RW8 B;  4KH1 B;  2AYE A;  1Q53 A;  2GCF A;  2CJX B;  4JI1 F;  4DL4 A;  2CZ4 A;  3PX0 A;  3MMB A;  1RDR A;  4WCE Q;  1IJF B;  2OP5 A;  1FFS B;  5DQG A;  2AX1 A;  1X31 C;  3LW5 C;  3G96 A;  1K47 A;  3NNH A;  1S77 D;  4URG A;  3AD9 C;  4A47 A;  1QD1 A;  4LBH A;  2Q66 A;  4C8Y A;  2HGL A;  2VD3 A;  4AL7 A;  5IOL A;  3DDN A;  1NHV A;  1JJ2 R;  1U25 A;  4QZV B;  4QPX A;  4MAK A;  2IY5 B;  2QFI A;  2BAC A;  1WNE A;  2BQU A;  2OGU A;  3OUY B;  2MMY A;  3ZZZ A;  2ZJR Q;  3Q8U A;  1P8G A;  2XY7 A;  2WB1 D;  3ZNJ 1;  5J2P A;  2PA3 A;  1XNR F;  4KQZ A;  5L8R C;  8AT1 B;  1KQF B;  3V6D A;  1RT5 A;  4TU9 A;  2E1R A;  1UW4 A;  1WEL A;  4CTA B;  1Q8I A;  2R4F A;  3LUY A;  4Y0F A;  2QL7 B;  1ELO A;  1I5O B;  1QLN A;  1AZS B;  3CMQ A;  2AGQ A;  3MMC A;  3M1V A;  4YHH F;  5L39 A;  1MMD A;  2XC9 A;  2IM0 A;  3TX8 A;  1OQ3 A;  1M90 T;  4RNH A;  3KJN B;  3VAH A;  1KVJ A;  2BJ7 A;  1VLO A;  5K14 B;  1XMQ J;  1RAF B;  3GCX P;  3TUI C;  3KJV B;  3CC2 S;  4NAS A;  1ZA2 B;  5SUH A;  4Y28 C;  4RW6 A;  1G7C B;  2Q79 A;  2ASY A;  3U1M A;  5L9N A;  2E5L F;  4LIW A;  1UPP A;  4LIR A;  3M2U A;  3H98 A;  2FJX A;  1T02 A;  1F6T A;  1B0T A;  4WWS A;  4DG1 B;  3KUG A;  3POT A;  1WKJ A;  3P6Y C;  2GVZ A;  2K7J A;  1M5H A;  4DR2 F;  1VQ4 S;  3NGT A;  3JSR A;  4ES2 A;  4J9S A;  3G6Y A;  2ZOF A;  1XMO J;  1SV5 A;  3H4D A;  1G1X A;  5KFL A;  2VBW A;  4GKK F;  4DV1 F;  4CYU A;  4DV3 J;  3BQ2 A;  2BV3 A;  2DNP A;  2DH7 A;  2ZZT A;  3KOA A;  1JJC B;  4IYQ A;  3K5P A;  2E5G A;  9ATC B;  2HND B;  2YX4 A;  1IKV B;  1SVD A;  1Y00 A;  2VG7 B;  2VHG A;  3D66 A;  3BQ1 A;  2CJB A;  2P6S A;  2CZV C;  1NDK A;  3E2E A;  2KG1 A;  3ITH B;  3FBC A;  4NRU A;  2GVD A;  2HMI B;  1X5S A;  2AYM A;  1H74 A;  3A1Y G;  3DFE A;  3I56 S;  2MKI A;  4OFZ A;  1JLA B;  3QLH A;  2AMC B;  1JLB B;  4BBY A;  1GMW A;  3MR6 A;  1NJI T;  1JB0 C;  2VOO A;  5D4N A;  4X84 A;  4MH8 A;  4ILL A;  1XJW B;  5KG5 A;  1WF0 A;  2VU5 A;  3T6J A;  3TP2 A;  4TNO A;  2ROP A;  5KFE A;  2X51 A;  1QE1 A;  3ZZO A;  4ED5 A;  2RDI A;  3NGS A;  3QIP B;  4PXE A;  2AV5 A;  3M8W A;  5I3U B;  5A8W B;  4MKY A;  3HHD A;  1HQ2 A;  1FNO A;  2P5V A;  3OFF A;  5C2G A;  4Y2M A;  5KFK A;  2RH3 A;  4F3Q A;  2DTJ A;  1SC3 B;  1HNX F;  3KLG B;  3MEE A;  3CCU S;  5KAK A;  2MZR A;  3V5R A;  2HRY A;  3PYG A;  2K1R A;  5MLC V;  2GML A;  3CJS A;  2JC1 A;  1D8Y A;  4LF9 F;  4RUA A;  4USK A;  4USW A;  2KFY A;  2HRT A;  2NRE A;  4QWB A;  4ZVE A;  4RWW A;  1K0V A;  3MMA A;  3CJ5 A;  5F8G A;  4WPA A;  4PCQ A;  2H65 B;  3C16 A;  2FGC A;  5HAN A;  4CLK A;  3QSY B;  4M95 A;  2GFF A;  3MUV P;  2VBY A;  5C24 A;  5HP1 A;  3DU6 A;  3R5A A;  2GAG C;  1MWY A;  2AU0 A;  4QW8 A;  4KGX B;  3AA9 A;  1TKZ B;  2HKE A;  3L09 A;  3HPO A;  4HL9 A;  3I4P A;  2CAD A;  2KHD A;  2OAU A;  4IOC Q;  2NCK L;  4DJB A;  3WX4 A;  3GSI A;  2Z57 B;  2XMV A;  1RAO A;  3ILO A;  5L1K A;  4ENO A;  2HNY B;  4OJH A;  2CAJ A;  3IWL A;  3RAX A;  3M2R B;  5KFU A;  5KG1 A;  2AGP A;  2OPR A;  3IG1 B;  5A76 A;  5C25 B;  2EEY A;  2YY3 A;  2M3D A;  4C3L A;  4IRD A;  3DRY A;  2DEI A;  3RB4 A;  2Q6C A;  4LBI A;  1S1V B;  2UUB J;  3Q8V A;  2CPI A;  3MR5 A;  1RQ0 A;  4HTI A;  1N5Y A;  1VIS A;  4NXM F;  2RE1 A;  2ASL A;  3B8H A;  5EWF A;  5HJY A;  1FJG J;  4OJG A;  2KB2 A;  2KTQ A;  1YWX A;  1MML A;  2MJN A;  3CO9 A;  2AJ0 A;  2BW2 A;  4J9L A;  5CYM A;  4O3N A;  3O3L A;  2DO4 A;  3AOB A;  3IR7 B;  1ROF A;  4CLZ A;  2XMA A;  5K8O A;  2YNI B;  2RKI A;  3HD1 A;  4EBE A;  4DFK A;  2JHE A;  2PO4 A;  4EZ6 A;  3F73 A;  1IKY B;  3D0G E;  5LXY A;  4FS2 A;  2CPJ A;  2OO4 A;  1YJ9 S;  3MM7 A;  2OPP B;  2XNR A;  1ZOT A;  1FRI A;  4YFU A;  5IZH A;  3LAM A;  1WEX A;  4FBT A;  1LWE B;  2UUT A;  2KJW A;  3P4U B;  1ZET A;  4QJV A;  3AD7 C;  3IXQ A;  1RHU B;  5EUH A;  2B3T B;  3NBP B;  3KJF B;  2AEJ A;  4RNO A;  9RUB A;  1WHY A;  1KRP A;  2DIU A;  3NOG A;  1SKW A;  2RRN A;  5U47 A;  4JYA J;  3I31 A;  3TZZ A;  3ISN C;  4HLB A;  3TI0 A;  1UVI A;  2FVP A;  2PDA A;  4LF2 A;  4UZC A;  2E9T A;  3SBM A;  3RW6 A;  2RF2 B;  3RR8 A;  3PRV A;  1YQH A;  3UW1 A;  3A13 A;  1N0V C;  3G6X A;  1UPM B;  4RO0 A;  4OV6 A;  3VGV A;  1O8B A;  1HNI A;  4OYM A;  3IGN A;  2XNQ A;  5D8H B;  4NA2 A;  4B17 A;  1SIZ A;  4J37 A;  4ZVR B;  2HVI A;  3A3O B;  2L9N A;  1HBN B;  4CO3 A;  1P1L A;  5F8H A;  4O44 B;  2MGZ A;  1GEH A;  4FYW B;  3DLH A;  1YRX A;  2RT3 A;  1JWW A;  1IKX A;  3HSJ A;  1NKE A;  1EJ7 L;  2CQ4 A;  3IRX B;  4CM2 A;  3BBC A;  3S01 A;  3M7V A;  3QZ7 A;  1V3R A;  1S7H A;  2VQE J;  1HI8 A;  2JEJ A;  4WFA Q;  1HR0 F;  2QN6 B;  3DI6 A;  2CRL A;  1RSC A;  1NME B;  1HBO B;  4DV2 J;  5CZX A;  1C0U B;  1FE0 A;  4RUC A;  2J0Q D;  2P2C B;  3KK1 A;  2XTJ P;  2PMW A;  3MWB A;  4F3O A;  3HI9 A;  2B9E A;  3VQT A;  2P6T A;  5D77 A;  1FI4 A;  4N7T A;  4H4M B;  4OHX A;  4P7V A;  2OTL S;  2W2N P;  2J9E A;  1CJU A;  3O5T B;  4I56 A;  2V67 A;  2F3J A;  3L95 X;  4FXD A;  3LTO A;  5LMN J;  3X1L B;  1F9F A;  4HHU A;  1ZS6 A;  2V8V A;  1DRZ A;  3VHQ A;  1FX2 A;  5CCM A;  2XS7 A;  1L3S A;  3CPW R;  5D4L A;  4DUZ F;  5KT2 A;  3UD5 A;  3HK2 A;  4ECS A;  3IO1 A;  1X4E A;  1HMV B;  4RJV A;  1DUR A;  4OZ2 A;  2KRR A;  4ZVT B;  1JKH A;  3TVZ A;  1X8D A;  1PO6 A;  1Q8B A;  2CQ0 A;  2Y3Y A;  3J7Z T;  1N5Q A;  3D1O A;  5LSO A;  5KFY A;  1S12 A;  3C8Y A;  2D41 A;  4DR1 J;  4KYZ A;  2R8I A;  4J5O A;  2FB0 A;  4UQT A;  2CJY B;  5HK4 A;  4ZDN A;  4MIB A;  4MK9 A;  2R8J A;  2ACY A;  4LF5 F;  1Q5V A;  1Z2L A;  1TUG B;  1FVS A;  2C3O A;  2IJR A;  3ZZU A;  1MG7 A;  3TR5 A;  3J7Y U;  4D3H A;  4Y00 A;  3TAN A;  2DGQ A;  4GVB B;  1VQK S;  1Q16 B;  2F4V F;  2J5A A;  5EX3 A;  1TEL A;  2FJD B;  1TVR A;  3UNY A;  2IAJ B;  3K5N A;  5IT0 A;  4X4R A;  2J6T A;  1HWJ A;  4PR6 A;  5EHH A;  3GZ7 A;  4KH0 B;  3HHL A;  4W4M A;  1HHS A;  1S1X A;  5KG0 A;  2MQQ A;  3MM5 B;  1X4G A;  5E3A A;  5IQ6 A;  3MOZ A;  5HRO B;  3H20 A;  5J2Q B;  2ADB A;  2DNM A;  3D0I E;  1PC5 A;  1YIJ S;  1CUL B;  3FCH A;  4B9L A;  2ZZM A;  3EZU A;  2NSB A;  2IVY A;  3KUH A;  5HI7 A;  3GR1 A;  3EJM A;  1XR7 A;  4MFB A;  2O66 A;  5GME A;  3AD8 C;  2DCU B;  3PJX A;  2NUU G;  4PWW A;  3RJM B;  2V8D A;  5AXM A;  1VQ5 S;  3I5C A;  3JSM A;  3AOA A;  3G2X A;  3SSQ A;  1FF2 A;  4O0N A;  4NLP A;  4KHP F;  4CLT A;  2BJ3 A;  1VR6 A;  2DR5 A;  2FZG B;  5AE2 A;  2KJV A;  1UCN A;  4IRC A;  1IBL F;  3M8Q B;  1RTZ A;  2IC3 B;  1IBK F;  3NMA A;  2BAB A;  2H3E B;  1B4S A;  5ETK A;  4Z7Y A;  2QFJ A;  1NKC A;  1X60 A;  1QTN B;  2PII A;  1NK6 A;  4QWC A;  1OPZ A;  1NCL A;  2B5J B;  1KWM A;  4PQU A;  1LWX A;  5ADZ A;  2MYF A;  1NK0 A;  2YWF A;  1YI2 S;  3ZZT A;  5A0Y B;  2FY1 A;  4JI1 J;  2AP6 A;  3MMB B;  2H5E A;  2VKZ G;  4O0I A;  1U45 A;  3MPV A;  1YSJ A;  5L1J A;  2IRX A;  2JLF A;  2KYX A;  3SQO P;  3EZO A;  3HT3 A;  2AJ4 A;  2ZH7 A;  3VGT A;  1H2V Z;  1S9E A;  1ITP A;  1RWW B;  3D7S B;  3GYN A;  3D1H A;  4LF8 F;  3G6E S;  1T03 B;  3PR4 A;  2OMO A;  2ZH5 A;  5F3Z A;  2VL1 A;  3PX4 A;  5KFN A;  4B3O B;  1XNR J;  4ZIV A;  4NCB A;  1CJT A;  3H5U A;  5FDL B;  3GLJ A;  4ZOS A;  2GS8 A;  2ZD1 A;  3V6D B;  1RT5 B;  2NLW A;  2OFH X;  4Q8F A;  2RS2 A;  3O44 A;  4M5J A;  1IWG A;  4DX6 A;  1A6L A;  1WDD A;  3CJK A;  3T9Z A;  1KN6 A;  2KXN B;  3MMC B;  2Z56 B;  4YHH J;  3KDO A;  3M1V B;  3DOL A;  5HLF A;  1UVN A;  1UJ4 A;  5E3Q A;  2R2T A;  4WZM A;  2LKZ A;  2OEJ A;  2PSZ A;  4J9N A;  4ZLL A;  3FSY A;  1YBT A;  3J7A 1;  7FDR A;  1DAX A;  2HHW A;  2XYH B;  2XMM A;  5KT4 A;  3NEK A;  4LSL A;  2C3P A;  4RW6 B;  3DLK A;  2E5L J;  5GAG I;  1U1M A;  3W9H A;  1Z4U A;  3OVA A;  2VON A;  5CD4 A;  2DNY A;  1FKA F;  2ACM A;  4DUT A;  2N82 B;  2HHH F;  5DJB A;  4IG3 A;  2M4M A;  2E7W A;  4O23 A;  1RT4 B;  4V19 J;  1UET A;  1ZA1 B;  4F4A A;  3J81 U;  1A0O B;  3PYD A;  5HMZ A;  1S6P B;  2HQI A;  3RTV A;  4DR2 J;  5LJ5 Y;  1FES A;  4YY3 F;  2UU9 F;  3BYR A;  1RAA B;  1U1Q A;  4ELU A;  1O51 A;  1ZZF A;  4H54 A;  4GKK J;  4DV1 J;  2CWK A;  2JVO A;  1RU1 A;  1RBA A;  3RB3 A;  4CYU B;  5B7W A;  1NRK A;  1KOH A;  4X65 F;  4JI5 F;  4UY8 5;  2ERR A;  1RZM A;  1TKT A;  3DLB A;  5ETS A;  1JXV A;  2XHC A;  3TAM A;  3EVM A;  2UVV A;  2W01 A;  2MY8 A;  1J5E F;  2RJZ A;  1ZTW A;  5LJ3 Y;  4WK3 A;  4M5H A;  1RWX B;  3DNC A;  4DS4 A;  2GVD B;  1HIY A;  3WC2 A;  5A8R A;  1VGY A;  4QPT A;  2FTR A;  2WBM A;  1SJ3 P;  3PW0 A;  2BZ2 A;  3P45 B;  4RZR A;  5J1E A;  2ZH2 A;  2ZBP A;  3N9U C;  3EGZ A;  1X4C A;  2BYC A;  5E3C A;  4OX7 A;  2J7U A;  2IBO A;  4EO6 A;  2PA8 D;  4ZJQ A;  2I6W A;  2YKP A;  1QAJ A;  4ECQ A;  4MIA A;  2DRA A;  2C2D A;  4ZN1 A;  2GMJ A;  3NGK A;  2IDE A;  3JQM A;  1Y3K A;  1QE1 B;  4G1I A;  1MU2 A;  3L3C A;  2KO1 A;  1RWK B;  1U1N A;  5LT5 A;  3QT6 A;  2HEK A;  1WKL A;  4F2S A;  2MZT A;  1KVK A;  2HWI A;  3UD3 P;  4D3G A;  3FZB A;  3GB0 A;  2MHE A;  3CSK A;  4CH0 S;  5GAH U;  1P9Y A;  1V5V A;  3KUE A;  3BSN A;  1R8A A;  1HNX J;  2HGM A;  3FGV A;  4P75 A;  3G6V A;  4PWU A;  1RHM B;  2MJU A;  3MEE B;  1RHQ B;  1K8A T;  4Y34 A;  1PIL A;  4DFM A;  2L41 A;  2K1R B;  1UVJ A;  4FKY A;  4LF9 J;  2YNF B;  2JWN A;  1JXL A;  2W25 A;  4QU7 A;  2RB7 A;  3PHE A;  2HW3 A;  1MRO A;  3BH7 B;  2JEG A;  5IXU A;  1GXT A;  1C4A A;  1E6V A;  2ZWP A;  3D0H E;  2G13 A;  2R9L A;  3OJU A;  1G6B A;  1NUE A;  2CQC A;  3D6H B;  5C24 B;  3Q24 A;  1IQT A;  4PG5 A;  1SC6 A;  1K1Q A;  1RU2 A;  1BXN A;  2M8D B;  2OJ3 A;  1OS5 A;  2R8G A;  4LF6 F;  3AA8 A;  3Q8P B;  4C3M A;  1Q4R A;  2HK3 A;  2ROE A;  3WIU A;  3ENW A;  4ATN A;  2QZ8 A;  1M1H A;  3CO0 P;  2R7V A;  2HHP A;  4USJ C;  3VAF A;  2Q6B A;  2ZFH A;  1H0H B;  2Y0B B;  1ZYQ A;  3PG9 A;  4U8V A;  1FDN A;  4ZPB A;  4DQQ A;  2OPR B;  2DD8 S;  5D4O A;  2VDI A;  1RA6 A;  1WC3 A;  4HH0 A;  2HZA A;  2J76 E;  4ID8 A;  2WTF A;  1WG4 A;  3VTI A;  4WXW A;  2G2Z A;  4NXM J;  1PBU A;  1OQ6 A;  2MZS A;  4L3K A;  1VS3 A;  1F3F A;  4K4W A;  2ADC A;  1NBE B;  1CEZ A;  1YJW S;  3W65 A;  1PKU A;  5CYM B;  2GNK A;  2FHK A;  3M32 A;  2POK A;  1KSP A;  3MOJ B;  3H7H B;  4DPY A;  1YG0 A;  3DRR A;  1Z2Z A;  4NXN J;  3I32 A;  4CO4 A;  2PMZ D;  3MEC A;  3H90 A;  4HR2 A;  2ZVS A;  3H8Y A;  2W9C B;  1FX4 A;  3CJ2 A;  2CPD A;  3HDS A;  2XYG B;  4DL7 A;  1LEO A;  4UOC A;  1VBK A;  2QX0 A;  3T19 A;  3F41 A;  3IS9 A;  3KWM A;  3BKT A;  3VAL A;  2VFS A;  2W4C A;  4EO8 A;  2WVC A;  3SFG A;  1N33 F;  2Z8Q A;  4OQJ A;  4DX5 A;  2YWH A;  4CM0 A;  4O4G A;  3J7Z 5;  3ENA A;  4XTT A;  2O3D A;  2NUH A;  2R7S A;  1WC0 A;  3M30 A;  4ZVU B;  3FDS A;  4OHV A;  5K5M A;  2DNK A;  1NND A;  4GC7 A;  2JOQ A;  4CDI A;  1FKP A;  5KG6 A;  4F04 B;  3TEH B;  1TL1 B;  3KK3 B;  2D3Z A;  2MZJ A;  4K2J A;  1UFK A;  2PC6 A;  3IGV A;  3H42 A;  4RL1 A;  3PV8 A;  3LPE A;  3HXM A;  1LXN A;  2XCA A;  3NS7 B;  1S6Q A;  3F0N A;  2FVC A;  3RB6 A;  4PWD B;  2AJF E;  4LQ9 A;  3D6T B;  3OV7 A;  4X4U A;  2EKY A;  3I9V 9;  1HKA A;  2Q43 A;  3TAP A;  2D3U A;  4BLG A;  4OZ3 A;  2B7C B;  4TY9 A;  2BQR A;  1JQG A;  3C6T B;  2VB6 A;  2IA0 A;  4JOU A;  2E1P A;  1UMJ A;  2W7P A;  5CYJ A;  4A4J A;  4FF3 A;  2LA4 A;  3OQ2 A;  3VZI A;  2GJ2 A;  4EZ9 A;  1NSK L;  3T5L A;  4FKX A;  4UOF A;  1HR0 J;  2LQB A;  2XGP A;  2VZ9 A;  5CA5 A;  5DG8 A;  3M9M B;  1CJK A;  4X4Q A;  5D78 A;  4TYB A;  4OI0 A;  1OWX A;  2AJ2 A;  4K4V A;  4ZVS B;  5K8M A;  4R5P A;  2CQG A;  3B82 A;  4X4O A;  4TYA A;  4RW7 B;  4EYH B;  3OL8 A;  2KKH A;  3KK1 B;  4F4X A;  2W2M P;  3PEH A;  2E29 A;  3FZ2 A;  3TO8 A;  1ZZN A;  3HJF A;  3MUT P;  1EIY B;  1FKO B;  1VRQ C;  3NOC A;  3K8W A;  2UV8 A;  3HFV A;  4GKJ F;  4P52 A;  4OI6 A;  3C2P A;  4CO1 A;  4F0M A;  3MMJ A;  2YNG A;  3EVO A;  4YB7 A;  1T05 A;  4DPO A;  3ENV A;  4OI1 A;  5KFC A;  1NSA A;  2VIH A;  3D1Q A;  3SSS A;  2E1A A;  1P1T A;  3BB5 A;  3TAQ A;  2V8G A;  3OSP A;  4DUZ J;  2U2F A;  1WDT A;  3DLL Q;  1FHT A;  3NS6 A;  3CCT A;  3Q8S B;  1S1W A;  1RAE B;  3W62 A;  3DKD A;  2X1A A;  3PZP A;  3BSA A;  1JKH B;  1RTJ A;  1NZA A;  3B4D A;  3TOQ A;  2MST A;  3IAS 9;  2XMW A;  5HN0 A;  4U67 Q;  2XM3 A;  3GCW P;  2GW8 A;  2HVD A;  2DPJ A;  2XY6 A;  2F40 A;  2ILZ A;  2KT5 A;  1SJF A;  2R7O A;  1RB0 A;  2G4B A;  6FDR A;  1RBL A;  4LF5 J;  5B0D A;  1VQ7 S;  4LMZ A;  3OW2 R;  2B43 A;  4URS A;  4DR6 F;  3DRS A;  4HDH A;  4PG8 A;  2NXJ A;  4J9R A;  1TKX A;  1UL3 A;  2F4V J;  3HT0 A;  4MKV A;  3QRR A;  2PT0 A;  3H5X A;  1TVR B;  4R8U A;  4ZP7 A;  3JTN A;  4FVM A;  2VH7 A;  4P74 A;  3PKM A;  4ZHR A;  2EI5 A;  1LNQ A;  2VF3 A;  1S1X B;  1F2H A;  3CTR A;  5LSL A;  4U6P A;  1Q0N A;  3L4B C;  1RT2 B;  1SUQ B;  4DCO B;  1N36 F;  5ETT A;  5JVH Q;  1W2I A;  2HZC A;  1HNV A;  1F0X A;  5AXL A;  1QVF R;  2DKO B;  4JI7 F;  1VQL S;  2GIR A;  4MFB B;  3GSD A;  5AT1 B;  2W4D A;  2WRM A;  3VF0 B;  4EGL A;  4I2Q B;  2H5I B;  2ZKT A;  4EEY A;  2HHV A;  1X7V A;  1KTQ A;  2LVW A;  4KHP J;  3OD2 A;  1F1B B;  1N5V A;  3OXL A;  1X4A A;  2C1E B;  1PSD A;  5KT7 A;  4Q43 A;  2XS2 A;  1W26 A;  4RW8 A;  1UFL A;  2VBX A;  3R5B A;  4DEZ A;  1IBL J;  2MKK A;  4PG4 A;  1D09 B;  3J81 j;  3SFU A;  4WKY A;  1Y3J A;  2FC8 A;  1TMM A;  5HL7 Q;  1X9M A;  4DCP B;  3OFG A;  1M1G A;  1Q8L A;  2OPQ A;  3CJ0 A;  1VHI A;  1IM4 A;  5K8P A;  3CXC R;  2FGO A;  2X3D A;  4HT7 A;  3W61 A;  2YXL A;  4P73 A;  4UOH A;  1PYT A;  3BPD A;  2RQK A;  2CQ3 A;  4ECZ A;  2W4P A;  4C3K A;  1CVJ A;  4UST A;  2FHJ A;  2XWY A;  1RGV A;  2DNO A;  3DRP A;  4OZ5 A;  3M8Z A;  1S9E B;  4DL0 C;  3D5M A;  3TZX A;  2VQF F;  2F5G A;  2VPY B;  1AZS A;  4WIQ A;  2E5J A;  4MJK A;  3FMW A;  2HS0 A;  2HGN A;  3HX9 A;  2YH1 A;  3QGH A;  3RBX A;  4ZP9 A;  4EWT A;  1VC5 A;  3THV A;  3GIJ A;  1CJT B;  2B6A B;  2ZD1 B;  5THW A;  3GFZ A;  5C42 B;  4DV5 F;  4ED0 A;  4EMD A;  3U1L A;  4F7V A;  2R8H A;  2YQ0 A;  1ZM3 A;  2X1G A;  4FNI A;  1AXQ A;  2RQ4 A;  4DDF A;  3FBB A;  1C1C A;  4LR7 A;  4QWE A;  4CH7 A;  3CCE S;  2F8M A;  5T14 A;  1G2E A;  1FWL A;  5HLF B;  3DOL B;  5H9E K;  3MF5 A;  1KR4 A;  4ZMM A;  2IYG A;  3NP5 A;  2QJ3 A;  2FVR A;  2WON B;  4J90 A;  4HTJ A;  4DG1 A;  1FVQ A;  2AHO B;  3PO5 A;  1K9M T;  1J27 A;  3NLC A;  4B3S F;  3FNN A;  2HS3 A;  1RTH B;  1SIW B;  2KL8 A;  3JQJ A;  4DU8 A;  2HFV A;  3DLK B;  2CJA A;  3GON A;  3R9L A;  4ERD A;  2G0J A;  5KFI A;  3Q83 A;  2HHH J;  5GMD A;  4Q44 A;  4AE5 A;  4WJB A;  4IG3 B;  2EFQ A;  5B0A A;  1DFD A;  4IFV A;  1SKS A;  2EPI A;  2HND A;  4Q7A A;  1U7L A;  3EYZ A;  4I1T A;  1C1B A;  1WJ9 A;  2HZV A;  4DPX A;  1MMN A;  4YY3 J;  2UU9 J;  4DR5 J;  1XK8 A;  3AFG A;  4DQR A;  5JUM A;  3BGR B;  2KU7 A;  4HI2 A;  4NMX A;  4NZ7 A;  3D6F B;  4R0E A;  2C42 A;  3N0V A;  2WVF A;  3ITH A;  1M5K C;  2HMI A;  2VG5 A;  3QWP A;  4F0K A;  3OR2 B;  4X65 J;  4JI5 J;  4AXJ A;  1REG X;  2DCL A;  4ZKA A;  2H54 B;  3Q89 A;  4R25 A;  4H4K A;  1RAG B;  2JH3 A;  1JLA A;  1TKT B;  3QYY A;  4IQX A;  1Q7Y T;  4OI3 A;  4Y2I A;  1J5E J;  3GFY A;  5KG2 A;  3KLI A;  2M7S A;  5AE3 A;  1QJH A;  3MD1 A;  1TQL A;  3NL0 A;  1KLM A;  4CT8 A;  1HWU A;  3OL6 A;  3NNC A;  4OX9 F;  1I94 F;  5A8R B;  1U49 A;  2AX0 A;  5A8W A;  4E0D A;  4BCA A;  2B9X A;  2Y8W A;  2ROG A;  1KQG B;  1K44 A;  1U1O A;  4IG0 B;  2NSC A;  3FRY A;  2U1A A;  1LWF B;  4QW9 A;  3R8Y A;  3KTQ A;  3BSO A;  2OSQ A;  2FJW A;  4JI4 F;  3BPS P;  4KB7 A;  2J9C A;  4LSN B;  3UPF A;  2RU9 A;  4K4U A;  5GAG U;  3E8O A;  4EBC A;  5E3P A;  4RX6 A;  3A8E A;  1WC6 A;  2COL A;  1S99 A;  2V2Z A;  2K7K A;  1L3T A;  1NZ8 A;  3PFO A;  4K50 A;  1SJQ A;  4ZCM A;  3JSB A;  5E2Q A;  5DG7 A;  2CIM A;  1CPZ A;  1XTZ A;  3LF0 A;  2VC0 A;  4DL3 A;  4FS1 A;  2NXN A;  3M8Y A;  1Y5I B;  2ZHB A;  3QAU A;  4LFB F;  4FPI A;  4L74 A;  2DYA A;  2EW9 A;  2AWZ A;  4K4Y A;  3NGR A;  1CC7 A;  3UI3 A;  5M2U A;  1XMB A;  4Y2K A;  3EDQ B;  2WVE A;  1UFW A;  1DBD A;  2JEF A;  5T41 A;  3M2R A;  3SSR A;  3TYT A;  1RWO B;  1T9V A;  2V34 A;  1T94 A;  4LF7 F;  4IOA Q;  4LF6 J;  5HQM A;  2QRR A;  1FRM A;  2D74 B;  2QMU B;  1FTR A;  5ETR A;  3Q22 A;  4A48 A;  1U47 A;  5KFR A;  1S1V A;  2OSR A;  5CYQ A;  1WC5 A;  3FJ2 A;  2M8H A;  5DDO C;  4DWI A;  2Z0G A;  4OI4 A;  5KFQ A;  1WG5 A;  1YX2 A;  3AQP A;  2BJD A;  4GMK A;  5ETQ A;  1FRX A;  5B0F A;  3QRQ A;  4O4R A;  1QAY A;  4ED2 A;  1PYS B;  3LO3 A;  3PYE A;  2UUW A;  3CUN A;  4FN5 A;  2GMH A;  1JK9 B;  1IKY A;  1Y0H A;  3BKU A;  2KM8 B;  4AD6 A;  4XPE A;  3B4M A;  2W2P P;  4Q45 A;  5DM6 Q;  2EFV A;  4Z7C A;  2ATC B;  3UFC X;  5DGA A;  2C3Y A;  2MQO A;  3M32 B;  4X4T A;  4N8O A;  4BDP A;  4RBU A;  1LWE A;  3M2V A;  4N77 A;  4LJM A;  3DCA A;  4FBU A;  3B54 A;  5A2Q Y;  4O3O A;  4BHQ A;  3GJT B;  3KFW X;  2DNR A;  2YQ3 A;  4C0B A;  5AJ3 F;  3TNV A;  2BE2 A;  5H9F K;  1RIS A;  5IM0 B;  3RZA A;  2HPU A;  3DN9 A;  2QV6 A;  2DGT A;  1FTC A;  5G4D A;  1ZAV A;  2LEA A;  1IBC B;  3IS9 B;  3GJS B;  4JI0 J;  4C7Q A;  4ED7 A;  3I5B A;  2W9B A;  2CFX A;  1N33 J;  1RAC B;  2HHU A;  5F0W A;  2K3I A;  4O4G B;  3HP6 A;  1NM2 A;  2UV8 G;  3BKF A;  1VOM A;  3ET6 A;  3FEZ A;  2WAQ D;  3A3N B;  2V4J A;  1HBN A;  3D68 A;  5IT9 U;  1KQS R;  1BWE A;  4O44 A;  2HNZ B;  3JYT A;  2R2S A;  1FKP B;  5RUB A;  1FJE B;  3CVK A;  1IN0 A;  3DLE B;  3NKY A;  4OLP A;  2FC9 A;  2QE5 A;  3I87 A;  4UZB A;  2ZJQ Q;  2XBP A;  1S6Q B;  1S10 A;  3KHL A;  5EWG A;  1RUS A;  1SKR A;  2Q1L A;  1DTQ B;  2FHM A;  3BR9 A;  4KV8 A;  1RHK B;  3KKF A;  2MKJ A;  1OPI A;  1HBO A;  4PXC A;  4F36 A;  3DOM A;  3FEX B;  4ZPW R;  3GYG A;  3SYZ A;  4DR3 F;  1Q81 T;  1D0E A;  4DR4 F;  1WUU A;  1N6Q B;  2RHQ B;  1S9F A;  4L6V 3;  5F8N A;  3P5B P;  2XLK A;  4CWB A;  3VGS A;  2FJB B;  1EKR A;  2HHS A;  1O6X A;  4FDF A;  5DS7 A;  1OY6 A;  2AJQ A;  1ZPV A;  1TL3 A;  1CJK B;  2HBZ B;  1NDP A;  1X4D A;  2B7B B;  1S1U A;  1VMB A;  3HD2 A;  2R8K A;  1T95 A;  4LUB A;  4R5P B;  1RAD B;  3NWG A;  5HVG A;  2K06 A;  2IM1 A;  4RW9 B;  3Q8R B;  1HBM A;  1YVF A;  1SL0 A;  1RAI B;  2Z2M A;  2BEF A;  2V8H A;  5CQG A;  2FVQ A;  1NJX A;  1FNX H;  5KFB A;  2BKO A;  1WSV A;  3R7S B;  3MM6 A;  3FCW A;  4WTO B;  1X5O A;  4GKJ J;  1HMV A;  2YNG B;  4NZ6 A;  1V6H A;  1AB8 A;  2IIH A;  1T05 B;  2QL9 B;  1KOO A;  4RUH A;  2QYC A;  2F8H A;  1DY3 A;  3JAM Y;  4A8X A;  2EFN A;  2M88 A;  2KN4 A;  3W9I A;  1Q95 G;  2LQ9 A;  2CNK B;  3LGN A;  2KH9 A;  3CJR A;  1S1W B;  3KLF B;  4UUX A;  4B9S A;  1EQM A;  1UZD A;  1JLG A;  3QAE A;  1HPZ B;  1RTJ B;  2KM8 C;  2CPX A;  2QC3 A;  4RBV A;  5F8I A;  2JEI A;  3VV2 B;  1BQM B;  2JRS A;  4NLU A;  2JL9 A;  2EK6 A;  5IT9 Y;  4GVB A;  4OYP A;  1UWA A;  2M9K A;  1VFJ A;  2WZ1 A;  4WFN Q;  4F50 A;  3GII A;  3EGW B;  3QSI A;  5D3G B;  2C28 A;  1TFY A;  4DR6 J;  2GQQ A;  4NZ0 A;  5HRO A;  4LRF A;  1FEH A;  3QGI A;  2BMB A;  3VAI A;  5DET A;  1TKX B;  3R5J B;  1RWU A;  4K5S A;  1CUL A;  5AE1 A;  4U95 A;  5DQI A;  1TP7 A;  1TL7 A;  3CCS S;  3KG4 A;  4R8U B;  1DJ0 A;  2UVR A;  4DN9 A;  2AGO A;  1E6Y B;  2DR7 A;  2WW8 A;  4F02 A;  1N52 B;  3DU5 A;  4EYI B;  2D3O R;  4LT6 A;  3DRX A;  4C8M A;  2E1C A;  4OZN A;  4ZS6 A;  2VJV A;  5CHC B;  1N36 J;  2PI5 A;  4PZV A;  3MR3 A;  1HNV B;  4ECY A;  2C22 A;  2RIL A;  3MZI A;  3QFW A;  3PDN A;  3NMR A;  2QA1 A;  4I0W A;  4JI7 J;  3FBF A;  3LWM A;  3TVK A;  1LW0 A;  1S79 A;  3D6M B;  4ZJL A;  1IKW B;  2PGC A;  5D6G A;  2JVR A;  2KHC A;  3GE9 A;  4B3M F;  5DLF A;  1FFW B;  3IBF B;  1EAR A;  2GZO A;  2I5J A;  5IV4 A;  4X64 F;  2LU2 A;  2EWH A;  4A8K A;  2F65 A;  1DAR A;  1VI7 A;  4B9U A;  2Z2Y B;  5A0Y A;  2LYV A;  1HI0 P;  5B0C A;  2QLX A;  2AT1 B;  3RB0 A;  4H4O A;  4F25 A;  2BW7 A;  2C2K B;  3CDE A;  2YWK A;  1S72 S;  1H7W A;  5KFT A;  2NPF A;  4P2M A;  2OPQ B;  4A8O A;  1VQ6 S;  1TK5 A;  4NLR A;  1FFG B;  3AB4 B;  4CT9 A;  4G1Q A;  1NPP A;  3ZTR A;  3AOC A;  1CQN A;  4WZQ A;  5LOQ A;  4J7C A;  4URQ U;  3V6K A;  1HQU B;  4YS2 A;  2AIR B;  2MQP A;  4AT1 B;  1T9U A;  5EDW A;  3QT5 A;  3FSI A;  1ZM9 A;  5ETL A;  3GWC A;  1T03 A;  2OEM A;  3CMA S;  4B3O A;  1NHK L;  3K17 A;  2XZD B;  2A0F B;  3QGG A;  2DGX A;  3G8Q A;  1JLQ B;  3KNA A;  5FDL A;  2OIH A;  2W8L A;  2B51 A;  3DRP B;  2A6M A;  3LWL A;  2D3O 1;  2VQF J;  1DQA A;  1AYE A;  2XHW A;  2DT9 A;  1KHW A;  3HKW A;  2E7X A;  3V4M A;  2VIC A;  3MED A;  4YP3 A;  1UA0 A;  1HNZ F;  4CZC A;  2YWW A;  4WP8 A;  2MKC A;  3CD0 A;  2OKQ A;  5H9E J;  5IS2 A;  4DV5 J;  4A8W A;  4A8F A;  4FYX B;  4FYD A;  3CW2 C;  1LK7 A;  3LGH A;  4USV A;  3OBI A;  4GRS A;  2NR0 A;  1C1C B;  2VBZ A;  1VHF A;  4TU8 A;  5K20 B;  1GTH A;  3A8K A;  3CD5 A;  2J0X A;  3KHH A;  1RT4 A;  2EK1 A;  1Q79 A;  3WIV A;  1BMQ B;  1S6P A;  1D8Z A;  5GAH I;  4B3S J;  3V6H A;  4AXI A;  4IH6 A;  2P9C A;  1YRU A;  4DR7 F;  1KP6 A;  1BHN A;  4QIF A;  3QAT A;  3THT A;  4C48 A;  2HHT A;  3KK2 A;  2GQC A;  1EP4 B;  2FHJ D;  2Z2L A;  3UDV A;  1T9X A;  1I6J A;  3ZTQ A;  4IFV B;  2E5I A;  3I82 A;  4KSE B;  4USU A;  1ZAW A;  4AFF A;  2ZH6 A;  1C1B B;  1R8B A;  3KLE B;  5CAB A;  3P8B B;  4IH7 A;  1TFW A;  3GV5 B;  3TW0 A;  1VBX A;  3HSG A;  2WCX A;  2ZEJ A;  4QWD A;  2VPX B;  4ZLN A;  2DB1 A;  3GMG A;  2VG5 B;  5B09 A;  2OEK A;  1S4E A;  4XDD A;  3TJ8 A;  2WOM B;  3IA0 A;  2AKW B;  3CF5 Q;  4DS5 A;  3OLA A;  2CVE A;  3E3X A;  3AAW B;  4M8L A;  4I64 A;  4BC9 A;  1GXU A;  2QL5 B;  4M63 A;  3WC0 A;  2GO8 A;  3KLI B;  2LP4 A;  1Y9O A;  3DLJ A;  1UTA A;  1B64 A;  1UKU A;  4DSE A;  4KT0 C;  4OJ3 A;  5IWA F;  1KLM B;  1NEE A;  1WC1 A;  1KKH A;  4OX9 J;  2FJV A;  1I94 J;  2MTL A;  2YX1 A;  2NXC A;  4NYP A;  4C0H A;  4EUV A;  5HAO A;  3DGP A;  2DIV A;  4AQY F;  3U7J A;  1IJE B;  4IR1 A;  4DXL A;  2XQC A;  2AW0 A;  3HFZ B;  2HFN A;  3FUY A;  3MCO A;  4OI2 A;  5J2M B;  2NS1 B;  1Y5N B;  4JI4 J;  1M5V C;  4DLE A;  4CRJ A;  3MCN A;  2YNF A;  3ZTO A;  3UNG C;  4IOB A;  3ZFV A;  4G1P A;  2BE7 D;  3L9Z A;  1N4L A;  3E01 A;  8ATC B;  1M1K T;  3M8P A;  2K3K A;  2F9J A;  1KS2 A;  2CJK A;  4CLF A;  1B3T A;  3K58 A;  1HBU B;  1WF2 A;  1XNQ F;  2V2V A;  5E0O A;  2YVS A;  5HAT A;  3C46 A;  1VK3 A;  1U0S A;  3QT8 A;  3MPW A;  4ZPC A;  3R2C J;  1AA1 B;  3T1Y F;  4LFB J;  2CQI A;  2MDA A;  5ETV A;  4M5G A;  3LGM A;  1K1S A;  3QZ8 A;  2O67 A;  3ISN D;  3CCV S;  2KI2 A;  2P9G A;  5JXS A;  4NEZ A;  2EC2 A;  3BM7 A;  2JLG A;  1FDD A;  2NQP A;  3QPI A;  2NZ4 A;  2GIQ A;  5ITH A;  4F67 A;  4I7F A;  2W2Q P;  2VC1 A;  1OYE A;  2A1B A;  4LF7 J;  4HI1 A;  2LMI A;  5HSP A;  4C9D A;  4NA3 A;  4WE1 B;  4HEA 9;  3C66 A;  5CD4 H;  3TZY A;  4FVC A;  2EVZ A;  1HD0 A;  4M5K A;  4X62 F;  4LR8 A;  1LQ9 A;  2BJ9 A;  3W2V A;  4JBC A;  2A2C A;  3S7R A;  5CYQ B;  1QM9 A;  1YTY A;  1RHR B;  6FD1 A;  1TAQ A;  2FQQ B;  3SCL E;  4ZA1 A;  4M94 A;  2CJ9 A;  4JI3 F;  4QIG A;  2R3V A;  5HMX A;  1VIX A;  1S0M A;  4F4Z A;  4WF9 Q;  2DBB A;  4PG7 A;  4NYO A;  4F26 A;  4C8O A;  4J9M A;  2LA6 A;  4WU3 A;  4IFY B;  4DI6 A;  1JMT A;  5BYR A;  5DLG A;  2HLU A;  4NXN F;  4M5D B;  3ILI A;  1U2F A;  1VRT A;  1PBA A;  3EDR B;  4PYD A;  3ZNU A;  3FSX A;  2Z58 B;  3IR6 B;  2PI4 A;  2W9C A;  2RUS A;  4CIO A;  4DV6 J;  1TK8 A;  3PM9 A;  2FY8 A;  4MK7 A;  4JV5 F;  1GQE A;  3HZE A;  3G9C A;  3GIR A;  3EZ5 A;  2J8A A;  3MDF A;  5E3R A;  2FLN A;  3M2V B;  1XEZ A;  2NZC A;  3VQS A;  1GAO A;  4A8S A;  3RAM A;  1U02 A;  1I51 B;  1HW9 A;  1N88 A;  5AJ3 J;  1W7W A;  1Q78 A;  2BE2 B;  4N41 A;  5KFJ A;  3H25 A;  1TK0 A;  4H4K C;  4I67 A;  3I55 S;  3OR1 B;  2XI2 A;  4OHW A;  2XO6 A;  3G8S A;  2NXE A;  5IQQ A;  1TL1 A;  3KK3 A;  2ZDP A;  2W9B B;  1MN7 A;  2N7Y A;  2L08 A;  3W64 A;  3W3S A;  5A6W A;  3M4X A;  3MEK A;  1CS4 A;  1R6Y A;  3ET6 B;  4PWD A;  4ETZ A;  2RS8 A;  3PNI A;  3UQS A;  2NXU A;  2V4J B;  4KHM A;  3BDP A;  4MYU A;  3JYT B;  1PAU B;  3R3T A;  4I2P B;  3U1N A;  4RR5 A;  3C6T A;  2ZKU A;  4AUK A;  1RAJ A;  2B8P A;  2OEL A;  1IBM F;  4ANC A;  3MFH A;  1YBA A;  1H6K X;  4LSZ B;  1FCA A;  2D69 A;  1FWP A;  3ZZP A;  2B9W A;  1FO1 A;  2HIY A;  2RML A;  1VQN S;  2MY7 A;  2DH9 A;  2PFD A;  4ZVG A;  3R27 A;  3CCZ A;  2EFP A;  3VVU A;  1HWL A;  3TJ9 A;  4C8L A;  2I8E A;  4FXW A;  4EK2 A;  1R3N A;  4KV8 B;  1RXO B;  1WWH A;  3ZTS A;  3PY8 A;  2JZ5 A;  2KVQ E;  1NK5 A;  3DOM B;  4DR3 J;  2DPI A;  4DR4 J;  4RW7 A;  1VCT A;  5B0E A;  1XBW A;  3C19 A;  4K8R A;  4CH1 A;  2GAH C;  4S0M A;  4P2X A;  1HWK A;  5ETO A;  1FKO A;  1HHT P;  3IFE A;  5HMW A;  5E7O B;  1TL3 B;  1GX6 A;  1N34 F;  4Y2A A;  1N5S A;  4DZD A;  3NY0 A;  5AXN A;  2P8I A;  1Q5Y A;  4FXV A;  2LXF A;  1S1U B;  5IC4 B;  1S4F A;  4KFB A;  4O3P A;  3V4I A;  3JTO A;  4Y3C A;  1HBM B;  4OYO A;  4YN3 B;  2C2E A;  2PEB A;  3MCS A;  4QYZ K;  2BBE A;  5J2N A;  3GIM A;  1QUV A;  2HWH A;  2HBQ B;  1WTF A;  5B0G A;  4TKT A;  4ECX A;  3MM6 B;  1R8C A;  2ZUG A;  4M5N A;  1T3O A;  3DHX A;  1J5O B;  4U8Y A;  2W7O A;  3MUM P;  4AL5 A;  1S59 A;  5DZ6 A;  1R0A A;  1CBK A;  2BOP A;  1KEK A;  2HBY B;  2J9D A;  3CCJ S;  3RBE A;  4JI2 F;  1YJR A;  5K8N A;  3PCO B;  4ED1 A;  2HUR A;  4Q5V A;  3OVS A;  2BM1 A;  4ILM A;  4UW2 A;  3GP9 A;  1UJ5 A;  2VDH A;  1ZBT A;  2YKA A;  3QID A;  2G0I A;  4K4Z A;  3NCQ A;  1JLG B;  2HAF A;  3MM9 A;  3BN4 A;  3W1Y C;  2G9O A;  2NPI A;  4NL5 A;  2PE8 A;  1EX8 A;  1F2G A;  2MKH A;  1SQE A;  3EGN A;  4DQP A;  2HLT A;  3LOU A;  2ZM6 F;  1UVM A;  4WP3 A;  2HQ3 A;  1LOU A;  6AT1 B;  4RNN A;  3FK4 A;  1KQK A;  1KNZ A;  3BGO P;  1D9D A;  4QIV A;  3DLG B;  1RT2 A;  2XSJ B;  1SUQ A;  2H51 B;  3KG0 A;  4YEA A;  2W8K A;  5GMK a;  3S8S A;  4YR3 A;  2UUC F;  4CO5 A;  2BXJ A;  4CLL A;  1NSP A;  5KFA A;  1TL7 B;  1FE4 A;  5HBM A;  2YKM B;  2IRY A;  4ZVP B;  3R7B B;  3PAC A;  4LQ3 A;  1YRT A;  5BYS A;  4I2Q A;  3K5L A;  2RAQ A;  5H1S V;  4KY3 A;  3VVT A;  4HVZ A;  3K89 A;  3TUJ C;  3BO4 A;  3O6Q A;  3K59 A;  4U96 A;  2C2N A;  4I68 A;  1MSW D;  3V2U C;  3EMT A;  4YR0 A;  1LW0 B;  2A3J A;  3ZZ0 A;  3DOK A;  5E41 A;  4B3M J;  3RYL A;  3HMJ G;  1NKB A;  3R1H A;  4J9U E;  2DXE A;  4B9T A;  4X64 J;  2I5J B;  3M6X A;  4TXS A;  4ZPV R;  3H40 A;  2CDQ A;  3SV3 A;  4AL6 A;  4V1A k;  5C2C A;  4Q0B B;  3BSC A;  4DSJ A;  4XK8 C;  1H98 A;  1N32 F;  2YKN B;  1FJC A;  5M2P A;  4ZVO B;  4NCG A;  4H4O B;  3BO2 A;  4RNM A;  2IHR 1;  2OHD A;  3AT1 B;  1H38 A;  1CQM A;  1U8S A;  3RU0 A;  1RYS A;  4FF2 A;  3T5H A;  3D9B A;  1OJ4 A;  4G1Q B;  4W98 A;  5KFW A;  5FD1 A;  2VG6 B;  1Y10 A;  5L38 A;  3NCR A;  1ZM2 A;  3R1L A;  4NEY A;  3BS9 A;  5KOX A;  4N5S A;  4RNF A;  2I2Y A;  2JJ4 D;  5I4M A;  3OHA A;  1DLO A;  5F41 A;  4HHH A;  1SQG A;  2DHG A;  5KG7 A;  2B6A A;  2DNL A;  2YBV A;  3CGI A;  3A8J A;  5C42 A;  1V9O A;  3THP A;  3H2V E;  4DQS A;  3M8R A;  5C7P A;  4ED8 A;  3HVR A;  1Y4Z B;  3FQK A;  1NU4 A;  2B9Y A;  5KFX A;  4QQB A;  1F9H A;  3MXH P;  1HNZ J;  2XMJ A;  4IR9 A;  3MED B;  2HQF A;  3SIP B;  4LRC A;  4OZL A;  1WSR A;  2DXD A;  2YKO A;  4W92 B;  2J6U A;  4TU7 A;  2A2D A;  2B4O A;  2WON A;  3OL9 A;  2FHO B;  5FJ4 A;  3PIP Q;  4EI2 A;  5KFF A;  3R5C A;  3L7P A;  1RTH A;  3G87 A;  2ZDO A;  2LEB A;  1S0V A;  1PJ6 A;  1UEK A;  4JI6 F;  3QWU A;  3R5G A;  3EWG A;  4PQA A;  3PR5 B;  2SXL A;  4OYZ A;  1VJW A;  1VRU A;  2WW4 A;  2V68 A;  4LFC F;  4N56 A;  3J80 Y;  2CVI A;  4DR5 F;  3BGR A;  1T9Y A;  4UOG A;  2KG0 A;  2DHH A;  5SZT A;  4DR7 J;  1Q7L B;  1R0C B;  2BR0 A;  1T0T V;  4WFY A;  3OR2 A;  3IBC B;  4KC5 A;  3HCX A;  1SB6 A;  3IM9 A;  2WBR A;  3KK2 B;  3QJP A;  2DEJ A;  1U6Z A;  4N8N A;  3DYA A;  4J9V A;  5JVG Q;  3SCI E;  4ZCL A;  4Q8E A;  1FER A;  3T6B A;  5L1L A;  2G2Y A;  2OPS A;  3KLV A;  4TY8 B;  2UXB F;  4UQG A;  2ZC3 A;  2LDY A;  4Y2C A;  3H5S A;  2YH0 A;  3LAK A;  4TN2 A;  1HD1 A;  1N0U A;  3V81 A;  1T3N A;  4ZP8 A;  4DF4 A;  1MNE A;  4C11 B;  4IG0 A;  1TV6 A;  1LWF A;  4DL6 A;  1RT3 A;  2DGU A;  1RT1 B;  2HG4 A;  1SC1 B;  5IWA J;  4LSN A;  1SH3 A;  4CLS A;  5LMU F;  4DCJ B;  3UCU P;  2RSQ A;  2WSF C;  2H4W B;  3DM2 B;  5F8J A;  4DV0 F;  1Q1K A;  3I0S B;  4AQY J;  4KBI A;  2BE9 B;  3DGP B;  2C2R A;  2GX8 A;  3KLH A;  3KHG A;  2MQM A;  3OXG A;  2B56 A;  3OHB A;  1TR0 A;  1SJ1 A;  3IWX A;  3PO4 A;  4PUO B;  4G65 A;  1PYO B;  5BXI A;  4Y6I A;  3HHN B;  2LCW A;  2DGW A;  1TTH B;  1REV B;  3K8V A;  2GGP B;  1U0H A;  3JQK A;  3D3C J;  2RQC A;  3E01 B;  4B9V A;  1IR1 A;  3M8P B;  3PHT A;  4P6Q A;  4WTY A;  1NDC A;  3N5B A;  4BC7 A;  1WOP A;  4X66 F;  4ZP6 A;  3HKZ D;  2R42 A;  1X4H A;  5LSR A;  1XNQ J;  3PJW A;  2LLZ A;  2H4Y B;  4RU9 A;  2ZH9 A;  2EG1 A;  3T1Y J;  2CDR B;  3O8W A;  1PCA A;  1MWQ A;  4RLE A;  2AZ1 A;  3LP0 A;  1X4B A;  2ZBQ A;  1GMW D;  2QMX A;  4GC6 A;  4LRB A;  1IQZ A;  4J9O A;  4XDC A;  3CUL A;  4DV7 F;  2HHX A;  4KGK A;  4QR1 A;  2C2M B;  2V9K A;  4I7F B;  1NJW A;  2NYI A;  4NLX A;  3OPK A;  3EPG A;  4DU7 A;  3MAA A;  4OIX A;  1FEE A;  1DHM A;  3UCG A;  1KC8 T;  4X62 J;  1CJV A;  1OMS A;  1P9Q C;  2JX2 A;  2E7V A;  3W2V B;  4PKD B;  2XSF A;  3HVT B;  3WX8 A;  3OFE A;  1J2V A;  3BN7 A;  3MEG B;  3GR0 A;  1RKJ A;  4JI3 J;  2ZVI A;  4LRE A;  1JLF B;  2MKS A;  4KKO B;  2R7R A;  3SI8 A;  3HLU A;  4PAA A;  2DR9 A;  3N6M A;  3ILL A;  2DR6 A;  3OSN A;  5F3T A;  1VRT B;  2Y8Y A;  5IM0 A;  1KON A;  2QLB B;  3J7A N;  5LXR A;  3MR2 A;  2D9O A;  4HH1 A;  4JV5 J;  3AJ1 A;  3BGU A;  4GO5 X;  3BRE A;  5HO4 A;  1VC0 A;  3BBF A;  2AYG A;  4A8M P;  1AW0 A;  2MLY A;  1MN9 A;  1FJ7 A;  3CIM A;  4JI0 F;  2C2Z B;  2MZ1 A;  4JV1 A;  4ED3 A;  2HFS A;  1FK9 A;  4NYZ A;  4ZIW A;  1OY9 A;  2DK2 A;  1SQF A;  2IBK A;  4TLQ A;  1WHW A;  1TMJ A;  2CPH A;  3OVB A;  4ZN3 A;  1H2T Z;  1NH7 A;  5E5N A;  2VA2 A;  3MCM A;  2V4Q A;  2CQH A;  1RCX B;  2IPO B;  2LQJ A;  2HNZ A;  4KR0 B;  3LAL A;  3M9O B;  1HLW A;  4WK1 A;  3P5T L;  2HQD A;  4YDX A;  3UDL A;  2HYI B;  4RW4 B;  3DLE A;  4DFP A;  1EQ0 A;  2HRU A;  1R43 A;  4UY8 T;  3BQ0 A;  3P96 A;  2C3U A;  2VA3 A;  1CS4 B;  2GIF A;  2XY5 A;  4J9P A;  1X5P A;  2X7I A;  4K5R A;  3LH2 S;  1WD6 A;  2BUN A;  2Q3P A;  1DTQ A;  2GHV C;  2IRU A;  2MEW A;  5GAE I;  1IBM J;  2LFV A;  3LP1 A;  5BJR A;  3SDE A;  3ETO A;  1URN A;  1N6Q A;  2H5J B;  4NWB A;  4B02 A;  5GAD I;  2XG8 A;  4P2F A;  4HAC A;  4Q2M A;  4DX8 H;  1S9G B;  2G0C A;  3G4S S;  3SXL A;  4L72 B;  2MHN A;  3N6N A;  3QFH A;  1RTD B;  3MI7 X;  3DDK A;  3JSY A;  4IRK A;  4F3M A;  2ZE2 B;  4CO0 A;  2RU3 A;  2V4R A;  5KOW A;  1QUP A;  4WXO A;  1WKK A;  3HO1 A;  3ZZR A;  4RW9 A;  5DG9 A;  2FLO A;  3MFI A;  2AF6 A;  3TQE A;  5ETN A;  2MKY A;  2OUG A;  1V5I B;  2BRL A;  2OI2 A;  4MIW A;  1U26 A;  1BQN B;  1Y5L B;  1TL4 A;  3BH6 B;  4ZCI A;  1T9W A;  5IFM A;  4QYZ J;  1V3Z A;  1QVG R;  1N34 J;  5DRK A;  1URR A;  2W1B A;  2FDN A;  4FNH A;  2XS5 A;  1VQ9 S;  4KFB B;  1GMV A;  2YPZ A;  4YOE A;  3SQG A;  3V4I B;  1BLU A;  3PJ9 A;  2CYY A;  2HBR B;  1VQS A;  3L7U A;  5I3P A;  5J2N B;  2GV1 A;  1VQM S;  2WVB A;  4MTP A;  3OLB A;  2RQM A;  3F56 A;  3W8P A;  1QAX A;  1UW9 A;  3H4B A;  2QA4 G;  1K73 T;  3AJD A;  1L5U A;  3KLF A;  3R6G B;  3CNQ P;  2KDO A;  1R0A B;  1HPZ A;  4DSF A;  2ZBC A;  4ECU A;  2N3L A;  5JJB A;  3VR1 A;  4B9M A;  4JI2 J;  3CDW A;  1BQM A;  3A4T A;  3MAH A;  1DQ8 A;  3FQL A;  1IR0 A;  2V8P A;  2J7K A;  1UJ6 A;  3QQC D;  3VWS A;  2HVZ A;  4DF8 A;  4XIU A;  3VAK A;  3UR0 A;  2J9D E;  4ELV A;  5D3G A;  3D2W A;  3C14 A;  3CDB A;  4ZCK A;  1VC6 A;  2R7X A;  3B78 A;  2XZT B;  1WHV A;  3LP2 B;  3MM9 B;  1GXL A;  2VFV A;  1R8P A;  3MM8 A;  5FLX U;  4LF4 F;  3TA2 A;  1C0T A;  4NLV A;  3BF4 A;  3ZXW A;  2ZM6 J;  1RT6 A;  3Q8Y A;  3MPD A;  1LWC B;  4Y65 A;  3G82 B;  4IQM A;  2CQ2 A;  2NYH A;  4KRW A;  1EZZ B;  2IVF B;  3FMB A;  2QO3 A;  3KDN A;  3HSD A;  4HKQ A;  1E6Y A;  1N5T A;  5CZV A;  2V69 A;  2AD9 A;  2KFZ A;  4C8Z A;  2F63 A;  2X1F A;  1GNK A;  4NI2 B;  2UUC J;  1JLE B;  3KJQ B;  2J8S A;  1U8W A;  1L3V A;  2BX6 A;  4F8R A;  4LFA F;  3KMS A;  1QAI A;  2UXD F;  5HBM B;  1HI1 A;  3QBC A;  1IKW A;  4L75 A;  1EET A;  2IJF A;  1XC9 A;  5A8K A;  3NNA A;  2PFF B;  4ITS A;  4Z2X A;  1U6B A;  1PIE A;  2GC8 A;  2GO9 A;  2QMW A;  2ZWO A;  3NCP A;  2V63 A;  3PYF A;  3UR3 C;  1U1K A;  5KFS A;  3O2I A;  3MUR P;  2QGF B;  4NLD A;  1EKS A;  1I1G A;  2I1R A;  1AUD A;  2O5D A;  4DMZ A;  2DY9 A;  3GYX B;  3DOK B;  4RPF A;  3UCZ P;  1SKU B;  2MQN A;  5CAA A;  3G71 S;  1LV5 A;  3K2Y A;  3M05 A;  3D28 A;  3W66 A;  1ARO P;  3EM1 A;  3N28 A;  1HW8 A;  1HQU A;  4IDK B;  1YHQ S;  1N32 J;  2QG9 B;  1I3O B;  3PW7 A;  1UWB B;  2UVW A;  1YGY A;  3ELH A;  2ALZ A;  4NCG B;  1R7I A;  4G6V B;  1GK8 A;  2DY1 A;  2B4V A;  2XMK A;  3HHL D;  2HS4 A;  2DO0 A;  2W24 A;  3HVW A;  1XN9 A;  1RLD A;  1JLQ A;  3TZW A;  2XB2 D;  5IC6 B;  4JB8 B;  1HHQ A;  1AFJ A;  3PW4 A;  1FWK A;  3PKY A;  4WYL A;  3BDE A;  3T3F A;  4ZK7 M;  3C15 A;  2J6S A;  3R2D J;  2Y0S D;  2KXH A;  1YJN S;  1UP1 A;  4KGM A;  3PX6 A;  3EXY A;  2MXY A;  3T1H F;  1U2C A;  4E8U A;  2PD1 A;  3CED A;  1LK5 A;  3DMJ B;  3IM8 A;  1XQI A;  1GFW B;  4PPD A;  1PG5 B;  4HYK A;  4K4T A;  2BKP A;  4YB5 A;  5KFP A;  2BKN A;  5AXK A;  1DLO B;  2YKQ A;  3HSZ A;  2JLE A;  5FLX Y;  1F5A A;  4L76 A;  1YIT S;  4LF1 A;  5D0H A;  4CNZ A;  1BD6 A;  5D0G A;  1SJ4 P;  3E51 A;  4C8K A;  4JI8 F;  3W5Y A;  1FRK A;  1S1T A;  2FPH X;  2BRK A;  2M70 A;  4U7U D;  4A46 A;  1JIH A;  3T5J A;  1VJQ A;  1M0S A;  2DRB A;  4U7U K;  2HK2 A;  5F9N A;  1T7P A;  4DZ6 A;  2WSE C;  1RT7 B;  4OZJ A;  1Y11 A;  5ETP A;  3VCD A;  2CXE A;  4RKU C;  2CZ9 A;  4PG6 A;  2V5H G;  2Y1I A;  2DGO A;  4RUB A;  1X5T A;  4JP8 A;  2A18 A;  2AZ3 A;  1S6O A;  2AJ1 A;  3NAH A;  2B0G A;  3TVY A;  4B9N A;  3M6W A;  2XMT A;  4JI6 J;  3KYL A;  1S6U A;  3GV8 B;  5T7L A;  2LQ8 A;  3KHR A;  3K5O A;  1XR5 A;  1IUJ A;  3R97 A;  2ILY A;  3AHP A;  1LW2 A;  1EP4 A;  1VRU B;  5KFD A;  1SL2 A;  1S7I A;  3AB2 B;  3BYP A;  2MPU A;  2KYZ A;  4LFC J;  3HVA A;  5D4P A;  2ZNY A;  1LFP A;  5F0U A;  1U1R A;  1D1U A;  4QCL A;  3G8T A;  4U7C A;  4L73 A;  3KLE A;  3BV8 A;  4QIW D;  1YJV A;  2RNE A;  3K0J A;  3GPA A;  1R31 A;  3CCL S;  2WOM A;  2F9D A;  3DYA B;  3MPY A;  3X3U A;  2OPS B;  2UXB J;  4B3R F;  3BEG B;  1T8E A;  2KXF A;  5J2P B;  2RRA A;  1MW7 A;  4XPC A;  4DUY F;  1AFI A;  1BWV A;  5KG4 A;  5I42 A;  3QGP A;  2XMU A;  1X0P A;  2W9A A;  1L3K A;  4PRF A;  4HHJ A;  3CCR S;  4WU2 A;  5M2R A;  2IM2 A;  2ZHO A;  3M6U A;  1WAC A;  3QJL A;  3V81 B;  2HVE A;  3CE8 A;  4KGV B;  1HNW F;  4CLY A;  3EUN A;  5J1N A;  5HQL A;  1TV6 B;  3FC9 A;  4PYA A;  5A2Q U;  5J2M A;  5D0R A;  1JNR B;  1RT3 B;  3OL7 A;  1EHW A;  4OYA A;  2XYP B;  5LMU J;  1HYS A;  1WOR A;  5EX0 A;  4MK8 A;  3AXM A;  4DV0 J;  1JJH A;  1A7G E;  1Y7P A;  4PXB A;  1M5P C;  3VAM A;  2AQ4 A;  1OSC A;  3KLH B;  1NB7 A;  1H2U X;  4OV1 A;  3ZC4 A;  3M2U B;  2HFZ A;  4NLW A;  3TA1 A;  1U4B A;  4NLS A;  3N4W A;  4QBU A;  1HBU A;  2XCP A;  4MKA A;  2B8Q A;  1XWL A;  3A12 A;  3POT B;  3I4H X;  2IYI A;  2GVZ B;  2D7S A;  3NWR A;  2WVD A;  4NLG A;  2DHX A;  1U0H B;  1SV5 B;  2UUA F;  4ZVQ B;  1YJT A;  3TAR A;  2HSE B;  1JLC A;  3L7O A;  2FLP A;  4X66 J;  2Y1J A;  2CQD A;  3T41 A;  3IBW A;  2MZQ A;  1FT8 A;  2VFU A;  2CJQ A;  1VBY A;  1XER A;  3VAJ A;  4CLP A;  1K0T A;  3CJ3 A;  3TWZ A;  2HQG A;  2A6O A;  4DV4 F;  4WE1 A;  3LP0 B;  1VK8 A;  1U2R A;  1YLX A;  2MLX A;  2WHO A;  4LRD A;  4K0K F;  2DVI A;  4WYW A;  4DV7 J;  1KLN A;  3S1T A;  4YDD B;  1Q8K A;  1CC8 A;  3QLH B;  5HVH A;  3GU0 A;  3N79 A;  2KZM A;  1VDH A;  1IR2 A;  2QYG A;  5KFZ A;  2FYX A;  4KPY A;  3LPY A;  2H1Y A;  3FFI A;  4ZPD A;  3MAA B;  3H2U B;  4ES1 A;  4WKR A;  4Q2L A;  2ZH8 A;  4I4B A;  2IM3 A;  4G3I A;  1CJV B;  2CPF A;  3G86 A;  2VOP A;  4IO9 Q;  3DXS X;  4ZVF A;  4IFY A;  1NK7 A;  5F9L A;  4QR0 A;  4M5D A;  4I6Y A;  2CWX A;  2W2O P;  1T9T A;  3CJT A;  4OZ1 A;  3TUZ C;  4FF1 A;  5HVF A;  3SCJ E;  4ED4 A;  4ZVH A;  1BE4 A;  4WBF A;  4DV6 F;  4ECW A;  3LA0 A;  5F8L A;  2LQ5 A;  2MSS A;  1RAH B;  2RD5 C;  5GVQ A;  1FA0 A;  2CNL B;  2QLF B;  2ALY B;  1N48 A;  1OY8 A;  4EBD A;  2EBG A;  3UVJ A;  2H48 B;  3ENQ A;  3FCV A;  3RBD A;  3MMA B;  1SL1 A;  3OR1 A;  3JAM U;  5HMY A;  2CG8 A;  3C16 B;  3EGV A;  1M5S A;  4O3S A;  2LU1 A;  1KTV A;  4WFX A;  2Y1L B;  3TUP A;  5HP1 B;  1WI6 A;  2FZC B;  5A6P A;  2DNG A;  1FK9 B;  3J81 Y;  2GHW A;  3W2W A;  2CQP A;  3KXD A;  2LXU A;  5KT3 A;  2ZOM A;  1HFE L;  3BGL A;  3I0R A;  2GJF A;  4OX8 A;  4P10 A;  2ZBR A;  5KFM A;  2ATL A;  3PTW A;  1QY7 A;  2G2O A;  1L3U A;  4I2P A;  3PFE A;  1NLK L;  1MWZ A;  1UEV A;  1SH2 A;  4OYW A;  4PXD A;  1N54 B;  3OTE A;  3PRD A;  2UVU A;  4FP9 A;  1FDA A;  4NE9 C;  2V9W A;  3CJQ A;  4NPO A;  4CP5 A;  2IA6 A;  1HQE A;  3BGF A;  2LEP A;  3IAM 9;  3CC7 S;  2N7C A;  4DPW A;  1GH8 A;  3NGD A;  1RJJ A;  5LM7 E;  4OYI A;  4M5I A;  3UDE A;  1N5Y B;  3PIO Q;  1AT1 B;  4DQI A;  4C6A A;  1NSQ A;  3LP1 B;  3SDE B;  1B0P A;  1ZM4 A;  3IRW P;  3OJS A;  2R2U A;  4DPT A;  1VIO A;  2CPZ A;  4X4V A;  4HAC B;  5G0R A;  8RUC A;  2KT3 A;  4XO0 A;  2RKI B;  4UT4 A;  4E2F B;  2CG4 A;  4XAK A;  1EB0 A;  2QSF A;  3SCK E;  2ZJP Q;  4A8Q A;  2E5H A;  2RRB A;  3MM7 B;  3W5X A;  3W63 A;  4UF4 A;  4YQW A;  3C3L A;  2IMO A;  4OZ0 A;  3SEO A;  4DFJ A;  3MGJ A;  1RKI A;  4NCA A;  4KJI A;  3QO9 A;  3QRP A;  4MMO A;  2HQC A;  5MAO A;  2YX7 A;  1KFD A;  1W25 A;  2OTJ S;  3RRG A;  1BQX A;  1V3S A;  4CO2 A;  1YDL A;  4K4S A;  2DGS A;  3H59 A;  1NK8 A;  4CLU A;  1SI9 A;  1R8H A;  5ETM A;  1NDL A;  1FXR A;  1J5O A;  2IJN A;  3SQG B;  3AY0 A;  1UVL A;  3IC1 A;  2KFN A;  2LDI A;  4F4Y A;  1LFW A;  3A8I A;  2ASJ A;  1YJU A;  3M6V A;  1OYD A;  1DTT A;  3D4J A;  5EGY A;  4P9S A;  1FDB A;  4LBP A;  1FXD A;  1NAQ A;  3T9N A;  1HNI B;  3GFX A;  5GAE U;  3PW2 A;  2YTC A;  2ZUA A;  1PAE X;  2F7V A;  4DSI A;  1CLF A;  2I9S A;  4LR9 A;  2MGZ B;  1LKZ A;  2V50 A;  2DNQ A;  5GAD U;  4KO0 A;  4RU2 A;  3AQO A;  2YNH A;  1IKX B;  3ADA C;  3CCW A;  1NPR A;  2Z4P A;  3B6B A;  2EFO A;  1YZ7 A;  2V0N A;  4B3T F;  1RWN B;  2GQ2 A;  3C14 B;  4I6W A;  4GVL A;  4M5L A;  4DN0 A;  4NLO A;  3CT9 A;  4ECT A;  3DLG A;  3Q0A A;  4LF4 J;  2XSJ A;  3OXF A;  4OYB A;  3MM8 B;  3EX7 B;  2AEF A;  4IKA A;  3EE3 A;  1C0T B;  3DI6 B;  4KAI A;  3RW7 A;  3RAQ A;  3CC4 S;  1RT6 B;  2DR8 A;  3C6U A;  1VQO S;  3NXZ A;  2GA7 A;  4ID5 A;  2YKM A;  2YQ1 A;  2EXU A;  5BR8 F;  4YB1 P;  1GMU A;  3ICL A;  1RA7 A;  4USI A;  2ZZN A;  5DM7 Q;  2JC0 A;  2EKN A;  3WDO A;  1S97 A;  1SH0 A;  1CJU B;  2R2R A;  1RLC L;  4KPC A;  3RGI A;  3WZ0 A;  1G3O A;  2UXC F;  4LFA J;  3IMQ J;  1X9S A;  2APO A;  1RP5 A;  1UZH A;  2ZH1 A;  2UXD J;  5KT5 A;  4ETX A;  3OTB A;  2CNO B;  1X0F A;  3OTO F;  2QTW A;  4F2R A;  2BDP A;  2N4D A;  1CSJ A;  1SC4 B;  2UP1 A;  1EET B;  1Q86 T;  3CME S;  4ES3 A;  3WQP A;  5A8K B;  1N56 A;  4ZLP A;  5B0B A;  3CCM S;  1ACM B;  2ZBI A;  1KBR A;  3UD4 P;  2JFD A;  3NG8 A;  4PAB A;  1UEU A;  4MYT A;  4Q0B A;  3MTJ A;  2I38 A;  4LVO P;  2YKN A;  3BBB A;  3M8S A;  3V6J A;  1M5O C;  5CH7 B;  3Q23 A;  2IMW P;  2BAN A;  4C0O C;  4PPZ A;  2DGV A;  4LRA A;  2CA9 A;  1NHU A;  3UE2 A;  3ONQ A;  3BO3 A;  1GT8 A;  2AEM A;  3UDC A;  4KGZ B;  3IP0 A;  4CI0 B;  5J1P A;  2N4C A;  2EBE A;  2VG6 A;  2KZZ A;  4TQS A;  3BR8 A;  2UZA A;  1VQY A;  2ZNZ A;  3ISZ A;  1C4C A;  1R0B G;  3MPU B;  3JB9 k;  1RTI A;  3OT9 A;  3RRK A;  4ICL A;  1WG1 A;  3I9Z A;  2IFX A;  3I5A A;  5FII A;  5L1I A;  1VLY A;  3C15 B;  2M52 A;  1OO0 B;  2C2O B;  1C2P A;  3HHL B;  3T1H J;  1D3W A;  2WK4 A;  2DNZ A;  2F8E X;  3LQV A;  1FRH A;  1APS A;  4FYV B;  4PEO A;  1FNM A;  4KE5 A;  3DC2 A;  2Y1R I;  2QA2 A;  2DHS A;  3AH6 A;  1PJ7 A;  5DDR C;  1RHJ B;  4O3R A;  1YJ7 A;  4JI8 J;  3QMQ A;  1D9F A;  1S1T B;  2H9Z A;  2BA9 A;  2E44 A;  1H3D A;  2ZH3 A;  1CG2 A;  3JSM B;  1IM6 A;  5KFH A;  4DBQ A;  2DIS A;  2RUG A;  2V94 A;  2R7U A;  2FJE B;  4EFA C;  2AYB A;  1X4F A;  4QIE A;  3P3D A;  4LVN P;  2XGQ A;  1IBK J;  3A3P B;  1R27 B;  1KHV A;  3QT7 A;  4P71 A;  3UN3 A;  2DNH A;  4WII A;  2VAS A;  2HFU A;  1SXL A;  1YZ6 A;  2YWE A;  2Z30 B;  3GV7 B;  2FZK B;  1H72 C;  5T7L B;  3US5 A;  4PQU B;  5L9X A;  1JJ4 A;  2L3M A;  3TA0 A;  3ZZY A;  2V2K A;  1LW2 B;  2V2Q A;  2BM0 A;  3GJR B;  1WEY A;  3OUY A;  3SV4 A;  3GFH A;  4TY8 A;  1XR6 A;  3GJQ B;  3KMQ A;  3GG0 A;  1VQP S;  4Z37 A;  1B99 A;  3ZO7 A;  2A10 A;  3I6P A;  4CTA A;  1ZAX A;  1PC4 A;  3JXO A;  3JS9 A;  4LF8 J;  3K57 A;  2ZOG A;  4U9R A;  4OYX A;  4B3R J;  1T11 A;  3W7B A;  1HA1 A;  4C11 A;  2MB0 B;  1OSD A;  2IDL A;  4YME A;  4J91 A;  1O0P A;  4DUY J;  5I42 B;  1VQ8 S;  1RT1 A;  3AOD A;  1RCO B;  3CWJ A;  1ZPW X;  5IT4 A;  2QT7 A;  5K14 A;  3CJK B;  2VV5 A;  3KJV A;  2K2P A;  4X4P A;  1XMQ F;  3DM2 A;  2BVZ A;  3TEG A;  3N6L A;  1TU0 B;  3I0S A;  4N76 A;  1HNW J;  1FD8 A;  3MAQ A;  4B08 A;  3K7R A;  2X3G A;  2L9D A;  4K2X A;  4JUZ A;  3H2L A;  2WB4 A;  4ZPA A;  1SBR A;  1RBO B;  3BJY A;  4PUO A;  1VBZ A;  2K8G A;  3NRB A;  1HL6 A;  2XWX A;  3HHE A;  3EPI A;  1DQ9 A;  3U27 A;  1HYS B;  1REV A;  1MLA A;  1BC6 A;  2QLJ B;  3Q2T C;  2EFG A;  2GGP A;  2ASD A;  2CQB A;  4LSL B;  1XMO F;  1P27 B;  1WHX A;  3TX0 A;  2G1D A;  4AYB D;  3HF5 A;  1NJZ A;  2QIF A;  1BY9 A;  4DV3 F;  2G1H A;  4AND A;  1TUV A;  4QR2 A;  2FLL A;  3CDA A;  3JTP A;  4F4W A;  4OJ1 A;  4NRT A;  2DH8 A;  2ZH4 A;  1IXK A;  4CNY A;  1IKV A;  2VG7 A;  5KG3 A;  3GIL A;  2VKR A;  2MLZ A;  4ZLJ A;  4P7T A;  2XZW A;  1P6T A;  2UUA J;  1SCJ B;  5D15 A;  1QSY A;  1NB2 A;  3FVY A;  1JLC B;  1QDU B;  1TUW A;  2WSC C;  3HHL C;  1RWM B;  4X4S A;  1NJY A;  3CJ8 A;  4KTQ A;  2E9Z A;  3FBE A;  2JFK A;  1IWA A;  3GQC A;  1JLB A;  4DV4 J;  1UAW A;  4ZIT A;  3TAM B;  1R89 A;  3RRH A;  3I96 A;  4K4X A;  1UVK A;  3Q8Q B;  3NS5 A;  4OLO A;  3WHI A;  2FD2 A;  4RWX A;  2DJW A;  3TRG A;  2D9P A;  4JV2 A;  4K0K J;  4NOH A;  2HWT A;  4QYR A;  3PRB A;  4C8N A;  1B7F A;  3QIP A;  3HFK A;  2I0X A;  3N5F A;  2XEX A;  1PGZ A;  3HVT A;  5I3U A;  4KIA A;  4ER8 A;  4NML A;  4DLG A;  1F3V A;  5J1E B;  3GG1 A;  2CUY A;  3MEG A;  2ZC4 A;  4NLT A;  4TVA B;  3K5M A;  1QSL A;  3FFI B;  4ANE A;  3LAN A;  1JLF A;  4KKO A;  2GHP A;  2JSX A;  1TL5 A;  4M1K A;  4OL8 A;  2V6A A;  3KLG A;  5B08 A;  2FIU A;  1GTE A;  2CKW A;  2DIT A;  3BZQ A;  2N3O A;  1U09 A;  1MU2 B;  2PMH A;  1ICE B;  1SJR A;  5DDP C;  1RAB B;  3HJV A;  1S48 A;  1B70 B;  2EC0 A;  2YWG A;  4IH5 A;  2VOD A;  5CCL A;  3VAG A;  2J7W A;  4P2S A;  4ALZ A;  5D0E A;  2DNN A;  5H9F J;  4DOZ A;  1XIQ A;  4HT5 A;  1S49 A;  4FZV A;  3UO0 A;  5F8M A;  1WTB A;  1YKW A;  4K7Q A;  5HQ8 A;  1YK9 A;  1HAR A;  2CNN B;  2DHA A;  1S57 A;  2QEX S;  3R5D A;  2VFT A;  4BS2 A;  1WI8 A;  4M5M A;  1TKZ A;  5KFO A;  3EXC X;  4MKB A;  3UVJ B;  2BQ3 A;  1MRO B;  4OMF G;  1E6V B;  1TKD A;  2XO7 A;  5CXT A;  2HNY A;  4F4K A;  2XUL A;  3FEY B;  1H73 A;  2E66 A;  4RW4 A;  1WF1 A;  2RVJ A;  2LXI A;  3IG1 A;  2VPZ B;  5C25 A;  2FUG 9;  7FD1 A;  3W2W B;  1SPB P;  1F60 B;  3QNW B;  2HVH A;  3SMZ A;  4W90 B;  3I0R B;  2QLW A;  3RUB L;  1F5B A;  3PW5 A;  1TZ0 A;  3SZ2 A;  4ED6 A;  2UUB F;  2CQ1 A;  2DRD A;  2HHQ A;  1Q82 T;  3IR5 B;  3HUL A;  1H7X A;  5L46 A;  2KT2 A;  2JDJ A;  4OX6 A;  3QJJ A;  2J0W A;  1FJG F;  4CQ1 A;  4DSK A;  4TQR A;  4YR2 A;  4NLY A;  2XI3 A;  4USH A;  3M9N B;  1O5J A;  2QSW A;  2B4P A;  1UA1 A;  1Z1Z A;  1HQE B;  4WP9 A;  3T5K A;  1NK9 A;  2YNI A;  1S9G A;  2BJE A;  4N47 A;  4OHZ A;  4J9K A;  1RTD A;  4NX9 A;  4QWA A;  2ZE2 A;  1NO8 A;  1U6F A;  5DGB A;  2XLJ A;  3PEJ A;  2E9R X;  3KG1 A;  1NK4 A;  4YUD A;  2OPP A;  3EVW A;  1EAY C;  1R6V A;  2VPW B;  4FYY B;  1B7Y B;  3D54 A;  3W5Z A;  1BQN A;  4K59 A;  4FF4 A;  5DZ7 A;  1FRL A;  2F1F A;  4MT1 A;  1TAU A;  4ECV A;  3TQ1 A;  5G0R B;  2ZIT A;  3DRR B;  3CD6 S;  3UWT A;  3NBP A;  1BGX T;  2GJI A;  5E33 A;  3MR7 A;  3WBZ A;  3PXG a;  3T1A A;  3DHW C;  2QA4 S;  3GTY X;  4DL5 A;  2LEC A;  3MEC B;  5BYQ A;  3N01 A;  4OHY A;  3FKB A;  1QTM A;  4JYA F;  3TJA A;  3R7N B;  2M0G B;  2KVI A;  3VGU A;  2HFO A;  2HIQ A;  3ILJ A;  2CPY A;  3QO9 B;  2RF2 A;  4JV0 A;  2VUG A;  4BWM A;  3CB4 A;  4WFB Q;  2RHS B;  1JNZ B;  4FPR A;  2BOA A;  3ETM A;  2BJ8 A;  4TLR A;  3H5Y A;  2R7W A;  3M30 B;  1NPK A;  1RE1 B;  4C97 A;  3HM9 A;  4YB6 A;  4NA1 A;  5EN1 A;  2Z2Z A;  1U1L A;  5DO2 A;  1DTT B;  1KVI A;  4UTG A;  4I69 A;  4UUW A;  3AJ2 A;  5K9F A;  2O1P A;  3CJ4 A;  3IRX A;  4RBT A;  2L9W A;  1X9W A;  2L48 A;  2J0S D;  4HDG A;  1U1P A;  3EIC A;  1A9N B;  2VQE F;  4KHR A;  3W60 A;  2YPY A;  1S0O A;  3D67 A;  1RK8 A;  3LP2 A;  1FXL A;  2IVM A;  5HJX A;  5IV3 A;  4R0J A;  4J9Q A;  4DSL A;  4KO0 B;  4DV2 F;  1C0U A;  3UN5 A;  1KFS A;  2YNH B;  3O1L A;  1LWC A;  3MTK A;  3G82 A;  4QU6 A;  1GX5 A;  2R7Q A;  4B3T J;  3J7Y I;  2XLI A;  1HWI A;  3GIK A;  1IVZ A;  4NLQ A;  2OFG X;  1KD1 T;  1NXI A;  1PJ5 A;  3RR7 A;  4H4M A;  2C3M A;  2F4F A;  3AXK A;  2OD6 A;  4ZJO A;  1FRJ A;  5KT6 A;  3HZG A;  4NI2 A;  1VYA A;  1JLE A;  1F9E B;  4IUF A;  3HHK A;  5LMN F;  2CPE A;  1F5C A;  3C6U B;  2JNJ A;  4ID5 B;  1B0V A;  3Q86 A;  2PEH A;  5BR8 J;  4X2B A;  4ELT A;  2RDJ A;  1RWP B;  5C5J A;  2ABY A;  2B4U A;  1N8R T;  2RDD A;  2D1C A;  2UXC J;  1S76 D;  4L3N A;  2M2B A;  1BUX A;  3W8G A;  3RBZ A;  1D9A A;  4I6A A;  3J80 U;  3F44 A;  3OTO J;  5EWE A;  5KTQ A;  4O3Q A;  1AUS L;  3Q2S C;  1LXJ A;  4DPU A;  3CDU A;  4GO7 X;  3VZH A;  4ECR A;  4DX7 A;  4CCH A;  3ULH A;  2VFR A;  4DR1 F;  2OD4 A;  1WEZ A;  2OML A;  3U02 A;  3H0P A;  2OH2 A;  2VJU A;  4IDK A;  3PVX A;  7AT1 B;  3W9J A;  2MQL A;  3IN5 A;  3DGV A;  1W2B R;  1UWB A;  3CCQ S; 
#chains in the Genus database with same CATH homology
 1NPK A;  4ANC A;  3FCV A;  2DXE A;  1B99 A;  3NGT A;  5CAA A;  3ZTQ A;  3NGS A;  3B54 A;  3BBF A;  4C6A A;  3FCW A;  2DXF A;  1B4S A;  1MN9 A;  1NSQ A;  2NCK L;  3EVW A;  3Q86 A;  3EM1 A;  1WKL A;  3NGU A;  1ZS6 A;  5C7P A;  4HR2 A;  3JS9 A;  3VVU A;  5BXI A;  4AND A;  5CAB A;  4ENO A;  4ANE A;  2CWK A;  1W7W A;  2DXD A;  4EK2 A;  3EVO A;  4DZ6 A;  2B8Q A;  3ZTO A;  3ZTP A;  1S59 A;  1LEO A;  3ELH A;  1NCL A;  1NSP A;  1KDN A;  1LWX A;  1U8W A;  3ZTS A;  4F36 A;  2BX6 A;  3BBC A;  4KPC A;  3Q89 A;  2ZUA A;  3FBB A;  3EIC A;  1PAE X;  1JXV A;  3ZTR A;  1S5Z A;  2HUR A;  1BUX A;  3EVM A;  4UOH A;  2AZ3 A;  1WKK A;  3WX8 A;  1NDC A;  1NB2 A;  4W98 A;  1NSK L;  1NDK A;  1HHQ A;  3VGS A;  1HLW A;  4S0M A;  4FKX A;  4FKY A;  3GP9 A;  4UOF A;  3VVT A;  1MN7 A;  3FBC A;  3DKD A;  3ENA A;  3FKB A;  2HVE A;  1BE4 A;  3Q8V A;  4WBF A;  3BH6 B;  1NLK L;  3B6B A;  1HIY A;  3FBE A;  3VGU A;  1NDP A;  3EJM A;  4DI6 A;  1XIQ A;  3BH7 B;  3VGT A;  1NHK L;  2DYA A;  3DDI A;  1XQI A;  3FC9 A;  3NGR A;  5IOL A;  2AZ1 A;  3FBF A;  2HVD A;  1EHW A;  1F3F A;  3EMT A;  4CP5 A;  3R9L A;  3PRV A;  3G2X A;  4UOG A;  1S57 A;  2DY9 A;  4DUT A;  4O0N A;  1NUE A;  1NDL A;  1PKU A;  3Q83 A;  1K44 A;  3ETM A;  3BBB A;  2BEF A;  1BHN A;  3EE3 A;  1F6T A;  2VU5 A;  3Q8U A;  3PJ9 A;  3GPA A;  4F4A A;  3Q8Y A;  1WKJ A;  3L7U A;  3MPD A;  2B8P A;  3VGV A;  1VYA A;  1UCN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...