1WKLA

Crystal structure of nucleoside diphosphate kinase from thermus thermophilus hb8 in complex with atp and adp
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
137
structure length
137
Chain Sequence
MERTFVMIKPDGVRRGLVGEILARFERKGFRIAALKLMQISQELAERHYAEHREKPFFPGLVRFITSGPVVAMVLEGPGVVAEVRKMMGATHPKDALPGTIRGDFATTIDENVIHGSATLEDAQREIALFFRPEELL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords nucleotide diphosphate kinase
publication title Crystal Structure of Nucleoside Diphosphate Kinase from Thermus thermophilus HB8
rcsb
source organism Thermus thermophilus
molecule tags Transferase
total genus 41
structure length 137
sequence length 137
chains with identical sequence B
ec nomenclature ec 2.7.4.6: Nucleoside-diphosphate kinase.
pdb deposition date 2004-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 1wklA00
1LWXA 1MN7A 2BX6A 1W7WA 3NGUA 1NUEA 1NHKL 4O0NA 4UOGA 1BUXA 3Q8VA 3DKDA 4ANDA 3DDIA 4ANCA 4F36A 3ENAA 3FKBA 4WBFA 1PAEX 4DI6A 2DXEA 4ANEA 2AZ3A 1BHNA 3VVTA 1HIYA 3R9LA 3ZTOA 3B6BA 3BBBA 3EVWA 3VGUA 4KPCA 3NGSA 1S59A 1U8WA 3Q86A 3L7UA 2ZUAA 3G2XA 3PJ9A 1WKJA 3FBEA 1JXVA 1XIQA 3Q8YA 3BH6B 2B8PA 3ETMA 3GPAA 3MPDA 3EVMA 3GP9A 3VGSA 2HVDA 5C7PA 1UCNA 4FKXA 4F4AA 1B99A 2HVEA 1HHQA 1NB2A 1PKUA 3BBCA 3VGTA 1K44A 3BH7B 3NGRA 1F3FA 3Q8UA 3EE3A 3Q83A 1NSQA 1NDCA 3FBCA 3PRVA 3VGVA 4W98A 3EJMA 1NCLA 1NSPA 5CABA 3EVOA 1NPKA 1XQIA 2DY9A 3FC9A 3FCVA 3FCWA 3WX8A 3ELHA 3Q89A 3FBBA 3ZTPA 1MN9A 5CAAA 3NGTA 1ZS6A 3B54A 2VU5A 1B4SA 1NDPA 4EK2A 5BXIA 4ENOA 4S0MA 1WKLA 3EM1A 2B8QA 2AZ1A 1EHWA 3EMTA 1WKKA 1NSKL 2DXDA 2BEFA 4FKYA 3JS9A 2DYAA 3ZTSA 1BE4A 2NCKL 1VYAA 1NLKL 3VVUA 4HR2A 4CP5A 1S57A 2CWKA 2DXFA 3ZTRA 1NDLA 4C6AA 2HURA 3EICA 4UOHA 1F6TA 1KDNA 3FBFA 5IOLA 1HLWA 1LEOA 1S5ZA 1NDKA 3BBFA 4UOFA 4DZ6A 3ZTQA 4DUTA
chains in the Genus database with same CATH superfamily
1DZ5A 2GNKA 2YQ3A 3LO3A 3W66A 4GKJJ 2PEBA 4UOGA 1S9GB 4YB1P 2X1BA 3OR2B 2FHJD 1JLAB 1XMQJ 4CRJA 3G9CA 3NMRA 1IR2A 4DPOA 4WP3A 4DG1B 2PA8D 2AV5A 2BE2B 1OWXA 4F04B 3LH2S 3C6UA 2C2MB 4Q5VA 2WVEA 2IA6A 4WCEQ 2Y9HA 2K3KA 4NLDA 1SKRA 1Q79A 3FCVA 5J2PB 6AT1B 3ET6A 4EWTA 4X66J 3HHLC 3R7SB 1N5SA 3K7RA 1MN9A 1RJJA 2YNHA 4EO8A 2IDLA 2NYIA 2ZM6F 3MEDB 1OS5A 1S1WB 1QDUB 3PEHA 1WSRA 4IFVA 5CA5A 3P45B 5IOLA 1K8AT 1S5ZA 1VQ7S 1JLCB 3POTA 4DUZF 1DBDA 4WE1A 1RACB 2P6SA 4AD6A 4M5IA 1DTQB 4YY3J 1R0AA 1JQGA 4LVOP 4FYVB 3F56A 5THWA 2JWNA 1TU0B 4F36A 1UA0A 3GZ7A 2KL8A 2DGVA 3V6JA 4QWCA 3N5FA 4RUBA 4B3SJ 2BJ3A 3VF0B 3BYRA 4LMZA 1VFJA 1BWEA 3K8VA 1U0SA 3MD3A 5F8MA 4WWSA 4G6VB 1RTJB 2ZDOA 3OTOJ 3ISND 2QFIA 3DRRA 2RHSB 3RJMB 4I7FA 4DR4F 5IM0A 3OHBA 3A4TA 3FMBA 1BMQB 3UCGA 1IJFB 2JLGA 2R7UA 4JYAJ 5D4PA 1WF1A 1TKXA 2J9EA 3KMQA 3NS5A 4ZIWA 1PBAA 3OFEA 2GZOA 4UOHA 1LW0B 3SSQA 1IR1A 3RG6A 5DS7A 2DNQA 2CNKB 3GFXA 1D3WA 2NS1B 3U1LA 4I6WA 4P9SA 5D4NA 3V4MA 4EEYA 3GE9A 4RW9B 2MZQA 2N4DA 4ANDA 2DGXA 1O0PA 3LQVA 1EJ7L 2BKOA 4B9SA 1OY9A 4IKAA 3U7JA 4CM0A 2L08A 2E5LJ 4TQRA 2R7XA 3QGIA 4PG7A 1VJWA 3BSOA 2XQCA 1K0TA 2FVRA 1RTHA 3VHQA 2JH3A 1K44A 2HRYA 3HKWA 2OFGX 1RTIB 4NCAA 3M9MB 3OFHA 1HBOA 3QLHB 1FVQA 5L39A 2DR9A 4KPYA 2LECA 5E3AA 2W7AA 4KE5A 2APOA 3HJFA 4IFVB 3CSKA 2FVSA 1NB7A 2H51B 3MM7A 1CEZA 3M30A 3GCWP 3ZZUA 4R0EA 4RBUA 2RQ4A 5KOWA 2HNZB 1MLAA 3UD4P 4WE1B 3HVTA 2D9OA 3GTYX 1HD1A 4CO3A 2M52A 3VV2B 1FFSB 2QA1A 1FRLA 2V8DA 3W1YC 4QWEA 1XMOJ 3TR5A 5ETPA 2WK4A 4FXWA 2U1AA 2CVIA 3TJ8A 3GSDA 2CA9A 4USTA 4BHQA 1TR0A 3EWGA 4L72B 3L7UA 3BSCA 4TLRA 4RX6A 2ZEJA 2ZOMA 3CT9A 4B08A 2ZE2B 3GP9A 3A8EA 4F26A 1VBXA 1TKTA 3TUJC 3BO4A 3W63A 2VFSA 5GADU 4I7FB 3C6TB 5IM0B 2FIUA 3D0HE 5L1IA 3TOQA 4ZPDA 3BQ0A 3JYTB 3R7BB 2QSWA 3BSAA 2RDDA 3V81A 1LV5A 1VC5A 1LNQA 2IM0A 2GVZA 1NSKL 2ZHAA 4OX6A 2G4BA 3DM2B 4MAKA 3H5SA 7AT1B 3IC1A 4DUYJ 2J9DE 1HBMB 1RT3B 3GIKA 3GJRB 2GIRA 3MM9B 3RBZA 2FYXA 2V8VA 2YX1A 1SKSA 3A12A 2A3JA 2DNPA 3N6MA 3LGMA 4EUVA 2GS8A 1RTDA 3PR4A 1B70B 2ZWPA 2B43A 4N7TA 2LEPA 2ABYA 2VICA 1U6FA 3RBXA 4K0KF 2HFVA 4OIXA 1N5YB 3PW4A 4B3MF 5H9FJ 1TAQA 2Y1RI 3HD2A 3TW0A 3R1LA 4O3SA 5L9XA 4LR9A 3EZ5A 3DRYA 2IAJA 4TU9A 4ES3A 1V3SA 3ZTPA 3NGTA 1DQ9A 1RADB 2HKEA 3BZQA 3IS9B 4FF4A 3MUTP 4UY85 5KFNA 1JB0C 2XY6A 3I82A 1WUUA 1N5VA 3QPIA 1TL5A 3KHRA 3HVTB 5HJYA 1HNZF 1DQAA 1S9EB 1NK0A 4ILLA 3NOGA 4F2RA 2HQIA 2DO0A 4PKDB 4NMXA 4PG8A 2RE1A 2VFTA 4YHHF 2A6OA 4OX9F 2NUUG 2HG4A 4YDXA 5D78A 4EFAC 3DLGA 2M8DB 4M94A 4OI3A 1Z2ZA 1U2FA 1KBRA 5AXKA 2PIIA 3V2UC 2RS2A 1UFLA 1Y3JA 4C0BA 3OD2A 1IBMF 5J1EA 4C98A 2XB2D 2UZAA 2DD8S 1GEHA 2H65B 1XK8A 2D41A 2IYIA 2BW7A 4B3TF 1YBTA 1FDDA 4F0HA 4JI7F 3EDRB 3K59A 1NJIT 2AJFE 2GVDA 5D3GB 1VYAA 1P9YA 3ZZRA 4KGXB 2LXFA 2VD3A 3F0NA 5F0WA 2YPZA 3MAAA 4NASA 2ILYA 4LFAJ 3CJRA 4LR8A 1RTDB 2WB4A 3BBFA 3FVYA 4TKTA 3MM5A 2QMUB 4I6YA 1FJGF 1N34F 3TP2A 1SJQA 3W5ZA 4N56A 1OPIA 1UJ6A 1Q0NA 3JSMA 4C0OC 1OSDA 4PEOA 5T41A 1FRIA 1FRMA 3CJ8A 3QO9A 4MMOA 4ZA1A 3MMJA 4DV4F 2CXEA 1UWBA 1YLXA 1VBZA 5E3PA 3M8PA 3H90A 1S97A 4A8MP 4DL7A 2CQPA 3OVBA 3BBCA 2DRDA 2PMHA 4ZDNA 2GO9A 5HSPA 1KVKA 3T19A 1GMUA 4JI6F 1NK8A 5FDLB 2OPPB 3SCJE 2VUGA 2HS3A 1SC6A 1X4AA 5T14A 2UP1A 4B17A 2KO1A 2VU5A 2I6WA 2W9BB 2MGZA 1HNIB 5J2NA 2MJUA 3TVZA 1JLQA 2YWFA 4F50A 1X4CA 3L4BC 2YKNA 2XLJA 2UUWA 2BJ9A 4IG0B 4HR2A 2M8HA 5C42B 1DTTA 4ZP7A 4CH1A 4HTJA 4DF4A 2C3UA 2DBBA 2H4WB 5C2GA 1UEVA 1MN7A 2AHOB 2V4RA 3KXDA 3C14B 1BUXA 1CS4A 3EYZA 1WC1A 4UY8T 2MSTA 4ES1A 4F3MA 1KP6A 4OYBA 2R2SA 2XGQA 3K8WA 2ZUAA 1NKCA 2AJ4A 1XN9A 1S48A 2I1RA 2RT3A 4IQMA 2J76E 4ES2A 3OL6A 2DJWA 3B4MA 1WD6A 4X2BA 2H5IB 3G6VA 1U2CA 4LRBA 4RBTA 2D3UA 2GQCA 3FC9A 4WIIA 4G1PA 4ZPBA 4K4ZA 4FYWB 1KVJA 2GVDB 4LRFA 2HZVA 2QL7B 1CC8A 3W9HA 3MAAB 4JV5J 4DPWA 1PCAA 3BQ1A 3IR7B 2XZTB 2E5GA 1YDLA 5DO2A 4NLWA 1KDNA 1RA7A 2GAGC 3GFHA 5A8KA 2JHEA 3HHLD 1FI4A 2MKKA 1S0MA 2FLPA 2CZVC 2FJWA 4ELUA 1CG2A 4BDPA 3KLVA 3ENAA 1Q53A 1RAEB 1XR6A 2MMYA 1RCXB 2CYYA 1TFYA 2CQ1A 1R0BG 1JLEB 3PZPA 3H98A 3ZZPA 2AGQA 2NXJA 1ZM2A 1IKXB 1LK5A 2WRMA 5KT5A 3ILJA 4QWDA 2FHMA 2BJEA 4QIGA 4A8XA 4JI8F 2OPQB 2HRUA 2ATCB 1TUVA 2KFNA 3T9ZA 1ZM3A 3TUZC 2LA4A 2KG0A 4F4KA 2KZMA 1UFWA 3G8SA 3QQCD 4ECVA 4HYKA 4AQYF 1ZAVA 1KEKA 1VQMS 1KQGB 2JLFA 5KG0A 3PHTA 2KFZA 5I3UA 1FKPB 3IGVA 3Q0AA 3LA0A 1F0XA 5HQLA 4D3GA 4R5PB 3MOJB 2WSEC 2CWKA 3A3OB 3D3BJ 2ZBIA 3R97A 1SH2A 5KFOA 2RUGA 5KFAA 1CS4B 5D0RA 2IBOA 4L3KA 4ZIVA 4WP9A 4DFJA 1BQNA 1ZH5A 3TX0A 2PC6A 5KFXA 3GWCA 1SXLA 2RF2B 5CQGA 1S9FA 2ZUGA 4K4SA 2EI5A 4PAAA 1TP7A 2V8HA 1JJHA 4CNZA 4NX9A 1RUSA 3W8PA 2BKNA 1NM2A 2CRLA 4FYXB 4CLWA 1NHUA 2XY7A 3DI6B 1NSQA 2DHHA 4DR7J 5CABA 2UUCJ 3W2VB 1R27B 3EPIA 2ERRA 3DRSA 3GJQB 4OZ0A 1VQSA 1TMMA 3MFHA 2MLYA 2D1CA 1N52B 2ROEA 4MT1A 3E2EA 1HPZB 2WONB 3NGDA 1FTCA 1T9YA 4J9OA 5DQGA 4FPIA 2R8GA 2XG8A 1S7HA 4JI1F 3IG1B 2AP6A 5HN0A 3I9ZA 2XC9A 2KM8C 2V5HG 3OL9A 1SKWA 3WDOA 2BUNA 4LF7F 3KLGA 3UVJB 4ZVTB 1KHWA 3H5UA 4XAKA 3UR3C 1WDDA 3FUYA 4P6QA 2DPJA 2R7SA 2BANA 4AL7A 2YKMA 4RUCA 3GJTB 3IM9A 5GMEA 1V9OA 4OL8A 1CJTA 1MROA 4LFBJ 4NRTA 1F5CA 4PQUA 3MECA 4DSLA 5F8LA 1XQIA 4KV8B 3DRPA 1I3OB 2WOMA 1TUGB 2YKOA 3M2RA 1O51A 1WKKA 3R3TA 2EWHA 1N0UA 3C66A 5J2MB 4PXDA 4A8YA 4E8UA 2EVZA 3KFWX 1PJ5A 1N32J 5C25A 5ETLA 1SJ4P 1BQNB 4ZVSB 1GTEA 3BSNA 1N36J 1S1VB 2G2ZA 4EO6A 1HWIA 3KK3B 4NYOA 1AA1B 2JX2A 4V1Ak 4OYZA 2B0GA 1RT2A 4RWWA 4JI5J 5EX0A 1V3RA 1K47A 3ZFVA 3O1LA 1HBUA 4DR5F 1B0VA 3SEOA 1Y4ZB 2YNIA 3MR7A 3CJQA 3HT0A 1R8BA 2XMUA 1D0EA 1S1UA 4O4RA 2K8GA 5ETQA 4WTOB 3CULA 3PV8A 1QAXA 2RAQA 5HAOA 4CLTA 3D6MB 4HTIA 4P52A 1U6BA 3TJAA 2YKPA 3OUYB 3TAQA 4QCLA 4JUZA 1RHQB 4DQQA 2IVYA 2FVCA 3Q8RB 2KH9A 2RUSA 5FLXY 2C2ZB 4CO5A 4ZJLA 1U1LA 2N7CA 4HI1A 2XEXA 2O67A 3CC4S 2ZHBA 1N5QA 1YZ7A 1UZDA 3TANA 2HIQA 5HLFA 1BHNA 2EFVA 4WPAA 5E7OB 3GONA 2BANB 3KLEA 2XNRA 2MQLA 1M5KC 1H98A 5CZVA 4FBTA 1FK9A 3CCTA 4OI1A 4DL3A 2DH7A 3MUMP 2JDJA 1Y5NB 5U47A 2YH0A 1FEHA 1N88A 3BGFA 8RUCA 3DGPA 4KQZA 5HI7A 2FZCB 2BJ1A 1AZSA 3IBCB 2C3PA 2W9CA 1UVMA 4W98A 2ZH1A 4E0DA 4ZITA 1PJ6A 3M2RB 4ZCKA 2XCAA 1DY3A 4ZVQB 2GW8A 3WIUA 2E44A 3AFGA 1JJ2R 4NLYA 3AOAA 2LMIA 2J8AA 2NSCA 4RR5A 3DDNA 2BA9A 5K8NA 2BR0A 5F9LA 5HATA 5DG7A 2UVUA 2MQQA 2RKIA 3TAMA 5AT1B 3I5BA 4WIQA 3MM6A 4CTAA 1WELA 3R5DA 2FTRA 1RT2B 3ENQA 3BYPA 1NPRA 3MMBB 2K2PA 2WBMA 3NCRA 2IM3A 3FEZA 2XMTA 4DSIA 1FE0A 4X4RA 1FRXA 5E3QA 1G6BA 3EE3A 1F9EB 1WTBA 3DMJA 2F8EX 4UQGA 3NWGA 4X4TA 2H5JB 3H8YA 5IZHA 4I6AA 3M8YA 3HO1A 2EK1A 2JLEA 1QTMA 3LP2A 3LWMA 2B8QA 3MWBA 2Z2MA 4LF9J 4FPRA 3I9V9 3OHAA 4DSKA 2RH3A 2O1PA 4A8SA 4ZVPB 2X3GA 3RAMA 4R8UB 5D0HA 1CULA 2QTWA 3BGUA 2G1HA 3PFEA 1MMLA 3WHIA 1UKUA 4HH0A 4CLLA 2FZKB 2FZGB 5HLFB 1MWZA 1IVZA 1VBYA 2B6AA 1KLMA 1LFWA 2XCPA 1C2PA 3M32A 1VQOS 2K1RB 3MEGB 1DAXA 2HHWA 3P96A 3M8RA 1FO1A 1ZOTA 1C0TA 1VCTA 2Z2LA 4M5MA 4FF2A 2DGUA 4HACB 3QGHA 3DGPB 2V9WA 2XMMA 4NYZA 4XDDA 3PYDA 1VS3A 1M90T 3UW1A 1IXKA 3UDVA 2OPRB 3NCPA 3SDEB 4LF6J 3SSSA 1VLOA 5KT6A 1DQ8A 1VQ6S 2D3ZA 4LR7A 1GT8A 5IWAF 3MR6A 2H1YA 3BKFA 3ZTSA 2LYVA 3HFZB 3QRPA 4DQSA 5A6PA 2R7WA 2OLWA 1YJTA 4KGMA 2KJWA 5LXYA 2GFFA 1Q86T 2CFXA 2ACMA 4F4WA 3KDNA 2GHPA 2DEIA 4DZ6A 4M5JA 4CTAB 1VDHA 2YKQA 3NCQA 3KLIB 2DIVA 1D9FA 4ZPAA 1BWVA 4F4XA 4ECSA 4X64F 2UV8G 4ANEA 1ICEB 1YITS 3FRZA 3BO2A 3PJWA 3QJPA 3Q2TC 3M6UA 3CC7S 4OHYA 3OQ2A 3SQGA 3LWLA 1M1KT 3CUNA 3ICLA 2R8HA 3PM9A 1WHXA 2MHNA 4KO0A 5C7PA 1UCNA 2OKQA 4H4MB 1UW9A 1Q5VA 2HGMA 2VBWA 3OR1B 2LQ9A 4KKOA 1IQZA 3UFCX 4HH1A 2LQBA 2XO7A 4DX6A 2EBGA 2C28A 3M7VA 1MNEA 3GILA 4CLKA 2MKYA 4PG4A 4IG3B 4X65J 1YRXA 4WFBQ 2AEFA 2DNKA 4LIWA 3J7Z5 3D1QA 3RBDA 1V3ZA 2BM1A 2FVQA 2VJUA 4Z7CA 2ILZA 1CULB 4KY3A 2LQ5A 4N47A 2NZ4A 5D8HB 1HLWA 5GVQA 4IRCA 2YNGA 4ICLA 1LWXA 2B6AB 1RBOB 1UVNA 1IBCB 3NG8A 3S1TA 3M32B 2V8PA 3V4IB 2J6UA 3M8QB 2HHVA 4FVMA 3TNVA 1YJRA 5M2RA 1O6XA 2B51A 2KU7A 1SBRA 3EZOA 2IJRA 2PSZA 5IQ6A 1U8WA 2BM0A 4EGLA 3FBEA 2X1GA 3TAPA 4AE5A 1IBKF 1I94F 1VC0A 2B5JA 3CO0P 2ASLA 2J9DA 3W65A 3LW5C 2CG8A 2IMWP 4TY8A 1SJ3P 1SIZA 2OD6A 4C11B 4ILRA 2EW9A 2V50A 4ZCIA 3MR5A 3UO0A 4OYAA 4ER8A 1Y0HA 2G2YA 2F63A 4QR2A 2VG7A 3L7PA 4WZMA 4IOBA 2BYCA 3UWTA 3CF5Q 1WC6A 4H4KA 3QAEA 1R89A 3HSDA 3V6DA 4C4WA 3L9ZA 1YIJS 3LPEA 2ZM6J 4QR0A 2QEXS 2E5JA 2RQKA 1SC4B 4LRAA 3OLAA 4P2XA 3NY0A 4ZJQA 5M2PA 4DBQA 1HHTP 5J1PA 2ZOGA 4GO5X 2XNQA 1IM4A 2DHXA 4DUZJ 2YBVA 3EX7B 3CMAS 1RXOB 1NJWA 4WYLA 1LK7A 4KO0B 5G4DA 1ZTTA 4DQPA 1FCAA 2N7YA 2I5JA 5B0GA 1ZETA 4KT0C 3Q8QB 5HQ8A 5KG3A 2J5AA 4KKOB 4PR6A 3R1HA 5G0RA 2RRBA 4IO9Q 4TNOA 2CQIA 2O5DA 2IA0A 3UCUP 5H9EJ 4ID8A 1YI2S 2XO6A 4B9VA 3M6XA 1SB6A 5K5MA 4DR4J 3QGPA 1D8YA 4CH0S 1IJEB 4ICLB 3JTPA 1KONA 3VAJA 1VK3A 3KHHA 3HT3A 3BV8A 3KLFB 2W9AA 4X4NA 1VQLS 3FQLA 2DHSA 2VASA 2HFNA 3Q2SC 2EG1A 3QT8A 5HMXA 3NAHA 5IQQA 4LFCF 2HNDA 1AUSL 4ZVGA 3PW0A 1LWEA 1Q8BA 3DYAA 3OSPA 1T02A 4WF9Q 5DRKA 4N5SA 4X4UA 3LTOA 3NXZA 4EMDA 1HHQA 2ZJPQ 4USUA 4J9RA 3ILIA 3QAUA 5GMDA 5KFUA 4Y3CA 1MU2A 2J6SA 4M8LA 4OJGA 3CCJS 1BD6A 1Y5LB 3OPKA 2XHWA 4F8RA 2HVIA 3NLCA 1T05B 3TA2A 4ED4A 3BGRA 3AT1B 3DHWC 2VG7B 4KH1B 4PQAA 1RHMB 1SL0A 4IRDA 2LDYA 3GYNA 4O4GA 2GA7A 5DQHA 1WHYA 4MK8A 4CP5A 4RKUC 1NDLA 1NK5A 3BR8A 4B3RF 2OTJS 4OV6A 4B3OA 3QT5A 2C2OB 1O8BA 1TL1A 2G13A 4DDFA 1U25A 1ZTWA 4YN3B 2CJBA 3CCZA 2HAIA 4OHXA 3DHXA 2Z57B 2LFVA 3IMQJ 1KQFB 5EX3A 2M7SA 2MKSA 1TV6B 3IBFB 1P1LA 3CCES 3ITHA 3N6LA 1UJ5A 5GAHI 1VQ8S 3FCHA 3G4SS 4A8OA 1S6PA 4F7VA 4FS2A 5K14A 2OSQA 3IWNC 3NL0A 3RAQA 3W64A 3Q8UA 5HBMA 4Y28C 2DNOA 1ZBTA 2E5HA 3A3NB 3KNGA 2P9EA 3FCWA 5L1LA 3I96A 3SCKE 1ZPVA 3CJ0A 4NA3A 4CNYA 2HHHF 2QC3A 2V63A 1AT1B 3EGWB 5EHHA 1HQUA 2KI2A 2DRBA 4ZP6A 4FYYB 1JLGA 3PW5A 3HZGA 3HHLB 1QY7A 3K57A 3FFIA 1EP4B 2IVMA 5ETMA 4I56A 1EIYB 2K06A 3KJVB 4IYQA 3OW2R 3OBIA 2E66A 4OHZA 3LF0A 2CPIA 2OFHX 1NBEB 5CCMA 3Q8VA 5CYMA 5FLXU 2F40A 3HHDA 5SZTA 3JQKA 2CDRB 1NK6A 3JTNA 1S0NA 3FK4A 4OHVA 3PJ9A 2JSXA 2IC3A 2IIHA 2DGQA 2P5VA 1MU2B 4OJ1A 3QYYA 4K0KJ 4M5DA 4LRCA 4QU6A 4K4UA 4RNNA 1X8DA 2QLJB 1GTHA 3MMAB 4F67A 4B3MJ 1EX8A 2J0WA 4RW4B 4H4OB 2V2QA 4NLTA 1MMDA 1K9MT 1C1BA 4O4GB 2MZTA 1UVIA 3US5A 2HFUA 1X60A 3ZNUA 1U02A 3CC2S 3HX9A 4QW9A 1V5VA 2FC8A 3ZZYA 4K4XA 2PA3A 3K0JA 1UWAA 2R7QA 1TFWA 1F1BB 3RYLA 4EBCA 1EB0A 1RWXB 2PN6A 2MKJA 1TVRB 1C1CA 3TJ9A 5DG8A 1TKZA 2GHWA 4CLPA 2AJ2A 4ED8A 1HNZJ 2C2EA 3AA9A 3D9BA 3HHKA 2ATLA 3RR8A 1H2UX 4JI4F 2HIYA 4KPCA 4YHHJ 4OX9J 3PHEA 4N76A 2OSRA 1RCOB 2PEHA 3T9NA 3QZ7A 4RL1A 1U1RA 2W24A 2BQUA 2MB0B 1KC8T 1VQKS 2HNYB 5HBMB 2ZD1A 4C3KA 2BRKA 4AXIA 2ACYA 4DOZA 2ZH4A 2AGOA 4TXSA 4QJVA 2OEKA 1RSCA 1IBMJ 3B54A 3PYFA 1OSCA 5AXLA 4CT8A 4PG5A 4DSFA 4NI2A 1H2VZ 1UEKA 3OLBA 2V67A 5GAHU 4B3TJ 3G87A 2FC9A 3VWSA 2KRRA 4I69A 2E9TA 4DJBA 1IQTA 3DLLQ 4K5RA 4JI7J 3O44A 1NK7A 4RU9A 1CJVB 2HWTA 2C2RA 2R7VA 2HEKA 2HPUA 1DLOB 5L8RC 1RHRB 5DGBA 1IKVB 1RU1A 4WBFA 5KFCA 4ATNA 2W01A 4Y6IA 4CYUB 1FJGJ 1N34J 3HF5A 1IKYB 2W2QP 4O0IA 1R31A 4J91A 1KR4A 4O3QA 4XK8C 3GFYA 5F9NA 5A8WB 3WBZA 4F4AA 3TO8A 1CJUB 3KNAA 4C8KA 5CYQB 4DV4J 3NMAA 3VGVA 5KAKA 1YGYA 3FMWA 3K5MA 1RTZA 3H20A 4OJHA 4F2SA 3VCDA 5HMWA 3R5AA 1RT4A 5KT7A 4LSLA 4CLUA 2N3LA 1LWCA 4CWBA 4JI6J 2MDAA 4DXLA 1GXLA 3ADAC 3VVUA 1Y3KA 2XI3A 3NAIA 1M5OC 4NEZA 4NL5A 4FZVA 4U95A 1F2HA 4H54A 4FVCA 3GG0A 4Z37A 1TKZB 5LJ3Y 4ZLNA 4WXWA 2B9YA 2NZCA 2CZ4A 3VZIA 1U2RA 2Z4PA 1IN0A 4DR3F 5IT0A 5MAOA 3Q8SB 3M6VA 1KVIA 1VIXA 2HWIA 3CJ2A 2XSJB 1YWXA 4QBUA 4OLOA 3NGSA 4X4VA 2GMHA 3AH6A 3WZ0A 2FDNA 1KTVA 1UMJA 2HHUA 3T41A 3DOLA 4CO0A 3EXYA 4M63A 2NXUA 1VI7A 2RB7A 4Q0BA 3AHPA 1AROP 1XTZA 1GXUA 3NBPB 3IA0A 3L3CA 1I1GA 3C19A 4C97A 4Y00A 1X0PA 2JL9A 1NZ8A 4JI0F 3B82A 1GH8A 5F8HA 3LP0B 1NDPA 3DCAA 4JOUA 1S6QA 3AQOA 1HMVA 2JJ4D 2FHOB 1S57A 1ZAXA 1Q8LA 2VG5A 2DH9A 3M2UB 4FN5A 3CMES 3MPWA 2KVIA 4IRKA 1RWWB 2NLWA 1XC9A 2DR6A 4J9MA 1JKHA 1RT5B 3MM8A 5DZ6A 2DNHA 1K0VA 2BVZA 1PJ7A 3T6JA 3HCXA 2XYGB 3PNIA 4NRUA 4I2PA 3P5BP 4KFBB 2H4YB 3IRXB 2RU9A 3HJVA 3CMQA 3U27A 2AX1A 5EGYA 2LCWA 4NCGB 1Q4RA 3CJSA 3H5YA 2D74B 5K8OA 1RLDA 4I2QB 1PYTA 1MSWD 2I8EA 1WG1A 2XZDB 2R2TA 3CJ3A 4UF4A 2Q3PA 2DVIA 2CQ0A 4DV7F 4JI8J 1RK8A 4OYMA 4B9MA 1UJ4A 2C2KB 1JMTA 1B7FA 1CPZA 1UTAA 1FRHA 1YVFA 2DR7A 2RVJA 5LMNF 1GX5A 4AQYJ 4KIAA 2F9DA 1S9GA 4J9KA 2VBYA 3M8ZA 3OR2A 2RJZA 4DCPB 2VZ9A 1REGX 4X4OA 5BYRA 4O0NA 3IXQA 1I51B 3LUYA 4ZLPA 1TL7B 1IUJA 3L95X 3W8GA 2BE2A 4E2FB 4AL6A 4YP3A 4ETXA 5CZXA 1XWLA 4OZ2A 4QIFA 3OTEA 3EPGA 3GMGA 4PUOB 1U48A 2W2NP 3NP5A 2NPIA 5J2PA 2ZC3A 5CXTA 2W1BA 2ZBCA 4Y2AA 3RB3A 1AUDA 3H2VE 1NXIA 4RW8B 3I56S 3CIMA 5JUMA 1NCLA 2HFZA 3EXCX 4LBHA 4DV2F 3D67A 1UA1A 4URGA 4J9UE 3NNHA 3W7BA 4QPTA 1EETB 3I55S 2GX8A 5BXIA 2K7KA 2VF3A 3CD7A 2XMKA 1URRA 1CQMA 3MCSA 4URQU 1JLCA 4K4WA 2HVZA 3BN4A 2WBRA 3QFHA 1DTQA 3AB2B 3P6YC 5JMNA 2AKWB 2RHQB 2KB2A 1JKHB 4L75A 3BDEA 5KG5A 2B56A 1M0SA 5BYSA 4L74A 2OH2A 1N33F 2GMJA 3HDSA 2CJXB 3AAWB 4DI6A 2IVFB 2CPXA 2DNNA 5ETOA 3W60A 2DCLA 4JI1J 4I4BA 1CLFA 4CM2A 1H2TZ 3AOBA 4OLPA 3DC2A 1TTHB 2AIRB 3TZXA 3PX4A 1HWUA 5EWEA 5KFVA 3MPUB 3M6WA 4NXNF 5T7LB 2Z2ZA 5CH7B 4LF7J 3CO9A 5CYJA 2H54B 1JNZB 1QAIA 2JEGA 2DHAA 4K5SA 4KHMA 4MKVA 2DH8A 3CB4A 3OT9A 5JVHQ 3D6FB 4KGVB 3PKYA 3IR6B 5L1KA 3ZZ0A 2E29A 1WEZA 2KDOA 3QRQA 1LW0A 1EQ0A 4ZPVR 2PFDA 3D0IE 1XEZA 3KLHB 2YPYA 5HMYA 5B0EA 1GFWB 4RW9A 1AFIA 4UUXA 3HD1A 1RT1B 2RU3A 1OO0B 2QFJA 1WF2A 3FQKA 3AD9C 4CIOA 5H1SV 3MEEB 1OY8A 2ZHOA 4ECWA 2QGFB 3V6KA 4USMA 1M1GA 4DLGA 5A76A 2X1AA 1TL3B 1YRUA 3IN5A 4YR2A 1P9QC 3JQMA 4UOCA 2HWHA 3TUIC 5DZ7A 4MTPA 1WSVA 3HI9A 1RDRA 1RTIA 1XBWA 3PDNA 4X62F 1KLNA 1YQHA 4J5OA 3QLHA 3I6PA 4DX5A 2F4VF 3D54A 1CBKA 4NPOA 2QMWA 2ZH3A 1N5TA 2E5IA 4DR5J 4JI3F 8AT1B 1JLBB 1LWFB 4PXBA 4N8OA 3P49B 1DURA 4USWA 2ZNZA 1KKHA 3MMCB 3DGVA 2HNZA 3M05A 2ALZA 1IBLF 1G1XA 2AMCB 3GIIA 2XS7A 3MGJA 2CJ9A 3R5CA 3EICA 1X9WA 4DS4A 4O23A 2QE5A 2ZZTA 2HBQB 5D6GA 1QAYA 2HK3A 4P75A 2YXLA 5IFMA 3FZBA 2Y1LB 2QO3A 2A10A 2WW4A 2FB0A 3V5RA 2V4JB 2ZE2A 2X7IA 2DNLA 4HHHA 2IBKA 2L9WA 1S4FA 4F4YA 2B4VA 2HAFA 1FTRA 3C6TA 2V0NA 2YH1A 5A0YA 2E7WA 2EK6A 5EUHA 2ZBQA 3M1VB 3MPYA 3MD1A 4ZP8A 3VGSA 4DQRA 1YBUA 4HLBA 1GMWA 3JYTA 4A8KA 4QYRA 3H40A 1RAFB 2YQ0A 4DR1F 4LJMA 3G86A 2WVCA 3DM2A 3LP1B 4WYWA 1E6VB 4RNHA 3P8BB 2X51A 1HBMA 1RT3A 5KFLA 3VQSA 2GGPB 3MM9A 4NXMF 1Q78A 2UUTA 4QIEA 2FD2A 3G8TA 1YJWS 2E1MC 2AYMA 3QRRA 2VOOA 2OAUA 4TYAA 1SH0A 4NZ0A 2GQ2A 4L73A 5GAEI 2ZBPA 4FXDA 4KTQA 2EFNA 2WVFA 3BS9A 3PW7A 5KT2A 2V69A 4DUTA 3IO1A 4MFBB 4OZ1A 1S79A 3D4JA 5KFEA 2Z2YB 4WP8A 3H2UB 5KFJA 1N5YA 1KQSR 1QTNB 1TZ0A 2ZKUA 2IHR1 1VR6A 2LLZA 3CEDA 2E1PA 5IV4A 1H3DA 4ED5A 2MYFA 4USVA 2MQPA 1F9HA 2W4PA 3IWXA 3I0RB 3CJTA 5HMZA 3IS9A 2CPJA 1SJ1A 2KFYA 4HKQA 2VQEF 4ZS6A 4WK1A 1UZHA 5AJ3F 2V34A 1RWKB 2WHOA 1SI9A 4AYBD 1KHVA 1J5EF 1VRUA 2QN6B 5B0FA 4HDGA 1S9EA 4NLSA 9RUBA 2PT0A 1LXJA 1TAUA 1A0OB 2W4DA 2CQCA 1VQYA 4USHA 4X4SA 2ZFHA 2UU9F 2EBEA 4NA2A 4I64A 1TMJA 3DOKB 3NS6A 5B08A 3RW7A 3OXFA 4DX8H 3U02A 2OELA 4KGZB 3UD5A 3NGUA 4OQJA 2GAHC 2RDIA 2UXCF 2JEIA 5E3RA 2VG6B 2HFSA 4DL4A 5BYQA 3OTCA 2C2DA 3ZXWA 3HZEA 3GV8B 3VAKA 5A0YB 4NLVA 1JJ4A 3Q86A 3G71S 1ACMB 3WQPA 4PPZA 2M4MA 1ELOA 4M5LA 2WB1D 3P5TL 1Y9OA 2MXYA 1KNZA 4NA1A 1WI8A 4C3MA 5D3GA 4USIA 4A48A 4C8OA 3T5LA 1K1SA 1EZZB 1ZA1B 2KXHA 2CZ9A 3CDAA 4LQ9A 2KYXA 3UN2A 2R2RA 4ECXA 1FESA 3D2WA 4DR6F 1T9UA 4CO1A 2BQRA 4DV5F 3J81Y 5IWAJ 4ZHRA 1REVA 5KG2A 2N82B 3C15B 2RDJA 2DK2A 2D3OR 4KSEB 2WCXA 5LSLA 2BMBA 2ZH7A 2R8JA 4IQXA 1W2IA 3EGNA 1HHSA 3OXGA 3E3XA 2R2UA 3CDUA 5GAEU 4C8YA 1H0HB 2VFUA 4KBIA 5FDLA 2WSFC 4F3QA 4X64J 4L76A 3ISNC 2OPPA 2FUG9 1WC5A 4OZ3A 4DN0A 1U45A 2W9BA 1HNIA 3EVOA 2DY9A 4P2MA 1VRUB 4OYWA 4DL5A 3CCVS 1UVJA 1HBNB 4IG0A 5C42A 3H4DA 3H2LA 1J27A 3SBMA 2NR0A 2E9RX 4QR1A 3SCIE 3GV5B 2XZWA 4JB8B 1D1UA 1B7YB 1RYRA 4GO7X 3U1MA 3C14A 1ZZNA 2NUHA 1WNEA 3MCNA 3BGOP 3VAGA 5HROA 2IJFA 3MR3A 4KHRA 2VA2A 5F8NA 3NEKA 1U26A 2PD1A 1APSA 1RHUB 4NZ6A 2EFPA 2YKAA 3DLEB 3QSYB 3EVMA 1UP1A 1XJWB 3PRBA 1JIHA 4A47A 1R0CB 3S01A 2G0JA 4IH6A 1IBKJ 1I94J 2XTJP 4PXEA 1VLYA 1SV5B 3I4PA 4TU7A 1FJ7A 4TVAB 2DYAA 4NLXA 2MLZA 3K5NA 4ZHRB 2C3YA 1ZZFA 2KXNB 1REVB 3CD6S 4FNIA 1OY6A 4PWDB 1FDAA 2SXLA 1U7LA 1MWYA 4PCQA 1FXDA 3HXMA 1SPBP 3KK1B 1FD2A 1DFDA 1NMEB 4J90A 4YB6A 2E9ZA 2DNYA 2RNEA 3T5KA 1FNXH 5DG9A 1URNA 1JLEA 4EU0A 2KVQE 1R6VA 1VMBA 2U2FA 1IKXA 4CDIA 3THTA 5D0EA 4YMEA 2WAQD 2OPQA 4Y2IA 4D3HA 1I6JA 5B0DA 2L3MA 3TZYA 5LMUF 5LJ5Y 4Q8FA 2MQOA 1HI0P 1X9MA 1OQ3A 2EKNA 3PRDA 1FKPA 2HSEB 1GK8A 4X84A 4AT1B 4R5PA 3PW2A 4PYDA 5ADZA 3CCWA 1BXNA 1RT6A 4QQBA 1U0HB 4QYZK 3ILLA 2CPFA 2HHTA 1T7PA 4GC6A 1RAAB 1UPMB 3SFUA 4ED3A 3SQOP 2J7WA 2UXBF 2DNMA 1RLCL 5HROB 1S1TB 2B4OA 3BM7A 4WKYA 5DDPC 2RF2A 4O3OA 3AD7C 2LXUA 2VKZG 4ZVRB 1YKWA 3KG4A 2GIQA 5F0UA 1VK8A 4DCJB 5D4LA 1YHQS 1U1PA 5DDRC 1RI7A 2G2OA 3KKFA 2M9KA 3DI6A 2DGTA 1WDTA 3GJSB 3ETMA 2COLA 3W2VA 1E6YB 4TLQA 4LFCJ 3MF5A 5E33A 1FKAF 1BLUA 1S99A 2CQHA 3I5CA 3Q83A 4B9NA 4OMFG 1GQEA 2EKYA 4Q7AA 4U7CA 3FBBA 2VFRA 2CIMA 1NJYA 1HPZA 2WONA 4O44B 4J37A 2KN4A 1B4SA 2EC0A 4PRFA 5KT3A 1CC7A 4S0MA 5DM6Q 4U9RA 5D4OA 3IG1A 1T11A 4WFYA 4NLRA 3RRHA 3PIPQ 2Q43A 4DCOB 2JEFA 3W5YA 3WIVA 2XHCA 1EARA 2BX6A 2DRAA 4C48A 3UVJA 1RZMA 1K1QA 3THPA 5ETKA 4K2JA 2LU1A 4B3RJ 4ECRA 3UCZP 1CVJA 3T5HA 1FJCA 2YY3A 3IP0A 4KHPF 2FY1A 3OVAA 2ZH8A 3H0PA 3Q8YA 4QU7A 1WI6A 4KV8A 1NHVA 4DL6A 5HP1B 2FHKA 4K50A 3AXMA 1T03B 2DPIA 2DGSA 2CQ4A 3M8SA 5DGAA 4RZRA 2B9EA 3T6BA 5CAAA 4QZVB 1T8EA 1RT6B 2PMWA 3H25A 2CNOB 1HKAA 5J2MA 2LXIA 5F8IA 4OYIA 3G6XA 1MWQA 3P4UB 2GQQA 2Q6CA 1X4GA 4ZPTR 2R7TA 2AX0A 5BJRA 1FERA 4YEAA 2HHHJ 3TA0A 5KOXA 1S1VA 3TRGA 1L3UA 3VTIA 2XI2A 3KK3A 2QYGA 1HW9A 4C8ZA 1FDNA 4USJC 2QLWA 1FRKA 1YK9A 2HRTA 1EKRA 5AE3A 2F65A 2WW8A 2J8SA 3D1OA 3RZAA 3RR7A 4PYAA 1R8CA 3ZNJ1 3CVKA 4JV1A 4L6V3 1NO8A 4RU2A 1HA1A 2V6AA 1R8HA 3QGGA 2R42A 4CZCA 1N6QB 3KJNB 3OJUA 2VODA 4MIWA 4BC7A 4M95A 1T9TA 2EFQA 3AB4B 4DF8A 2ZKTA 4ALZA 4Y2MA 5KFBA 3O2IA 2B7BB 2ASDA 4OI4A 1NPKA 5A8RA 1J5OB 2PFFB 1Z2LA 2IRUA 1N0VC 2HBZB 3OUYA 3VAHA 2OTLS 4HI2A 4RBVA 4GKKF 1HNWF 1HYSA 1RBLA 1QD1A 4ID5B 1KFSA 2HW3A 2CJKA 3UI3A 3O8WA 3QNWB 1S1XB 4H4KC 1FKOA 3KHLA 1QE1A 3KJQB 2FHJA 2HQCA 3I0SA 4Q44A 2MQ8A 4RNFA 3VAFA 4WJBA 5K8PA 3HP6A 3HVAA 3ZC4A 5I42B 2DGOA 1RKIA 2VC1A 4EZ6A 4K7QA 2ZJRQ 2R7OA 2MPUA 3MCMA 4EYHB 3B4DA 4QPXA 1XR5A 2GCFA 4M5KA 2W8KA 3G2XA 4QIVA 1Q8KA 4QIWD 3LGHA 2PMZD 3MPDA 2B9XA 3M9OB 1N8RT 4XO0A 2YWWA 5CHCB 4JI4J 1YJ7A 2MQMA 3PJXA 2GMLA 2UXDF 2Y1JA 1VQNS 4CO2A 1C0UB 1SUQB 2OEJA 2H9ZA 4TN2A 5IS2A 3N9UC 2A1BA 1CJKB 2XULA 5MLCV 3AJ2A 4DX7A 2WSCC 3D1HA 1Q5YA 2W8LA 3M4XA 5LT5A 2YWGA 2B7CB 3KG0A 1JJCB 2Q66A 2CQBA 2OI2A 4J9VA 1FDBA 3RAXA 5FIIA 1QSYA 3PIOQ 2CPDA 2HHPA 4LF8F 5F3ZA 1H73A 4LT6A 2L41A 2DNZA 2Z30B 1P27B 1PBUA 3RUBL 5HVHA 4M5GA 3MMBA 1FT8A 2QL9B 3W9IA 3UNYA 1PAEX 4LF5F 1P8GA 2VQFF 2GJIA 4DV6F 3GIRA 1RHJB 2JRSA 3PCOB 4LSNB 5GADI 1XIQA 4OI0A 1NPPA 2CJQA 3UR0A 2XSFA 3K5LA 2VKRA 2ZWOA 4ED2A 1NKEA 3OTDA 5A8RB 2LEAA 4RO0A 3R2DJ 5L38A 3CJ5A 1RT7A 2FQQB 1LKZA 2Y0SD 1G4CA 1WC3A 1VQ9S 1HYSB 2AYGA 3CXCR 3H7HB 4CLZA 3W3SA 4R8UA 1FKOB 2MY8A 4BS2A 5J2QA 1QE1B 5B0BA 1S49A 3B8HA 3F73A 3I0SB 2M88A 3D6TB 1D09B 2HMIB 1SKUB 1B64A 3K2YA 2RIJA 4PWUA 3O3LA 1F2GA 2QLXA 1PO6A 3PO5A 5LM7E 3QT7A 2R9LA 2K1RA 3MEGA 1U1QA 3HMJG 3DKDA 4HACA 3J81U 4YOEA 3SV3A 3ZTOA 3B6BA 1OQ6A 4G1QA 3HFVA 4DV0F 1HWLA 4ED6A 2BXJA 2GHVC 2OPRA 4WU3A 5C5JA 3SDEA 4DR3J 4NLPA 2Z8QA 3UQSA 2BZ2A 4U7UK 1T3NA 4FBUA 3C6UB 1WOSA 4Q2LA 1NZAA 3IBWA 4WTYA 1RWMB 3QIDA 5E41A 3I5AA 3ET6B 3NOCA 1YJVA 1R6YA 2VL1A 2HQDA 4JI0J 2YNHB 4ZLLA 3C46A 1VIOA 4CLSA 1AFJA 2ZITA 3KLIA 4ECYA 7FD1A 4IUFA 4B9LA 4UT4A 3DNCA 2HQGA 5KG1A 2BRLA 2JEJA 1MMNA 1UPPA 1X5SA 3JXOA 3DDIA 1LFPA 3BQ2A 3TX8A 1F60B 3POTB 3BN7A 3BJYA 2W2OP 4IFYA 1R0AB 1RYSA 2J0SD 4KB7A 4H4MA 1Q8IA 2ZH5A 3T1HF 3FZ2A 4A8FA 4J9PA 3UN5A 2FJBB 4MIBA 1G7CB 2Z56B 3N5BA 1T0TV 3OR1A 1OPZA 4B02A 1RT7B 1S12A 3FSIA 2I2YA 2G0CA 4JI2F 3N4WA 1W2BR 3EJMA 2JVOA 4IG3A 3OVSA 4OZLA 3EGVA 2DCUB 2DY1A 4WFAQ 1PC4A 5J2QB 4IR9A 1B0PA 3GR0A 1RE1B 3DRRB 2ZC4A 2BEFA 3CDEA 2CJAA 2KRBA 5A2QY 1ROFA 4JP8A 4NLOA 4WFNQ 1VJQA 1GXTA 1HR0F 1Z4UA 4WKRA 1XNQF 4AUKA 2IMOA 3FBFA 3T1AA 2FVPA 1TKXB 4DV7J 3V4IA 4W92B 2HHXA 5KFWA 3M8QA 2XYHB 1IWGA 1KOOA 3GB0A 3BKTA 2VIHA 2C22A 4ZN1A 5LMNJ 4G1QB 2KJVA 3DU6A 4C7QA 2BJ7A 5M2UA 2CADA 1FD8A 4DV3F 3BBBA 5EWGA 5KFDA 4AFFA 1FF2A 4K2XA 1NEEA 1JXVA 2RQCA 2E1RA 3AJ1A 4P72A 1M5VC 2B8PA 1L3VA 2JFDA 4UW2A 1YZ6A 2LU2A 4C11A 1SQFA 3NGRA 1NK4A 5C24A 3K17A 1ZA2B 3GQCA 1NSPA 2BKPA 1RTHB 2XS5A 2DO4A 3X1LB 2AYBA 1C4CA 4MJKA 4XDCA 5DDQC 4ENOA 2ADCA 2OGUA 4OYXA 2J7KA 1HBOB 4DV2J 2V4QA 3KDOA 4LRDA 2FLLA 2Z0GA 2MZJA 2GJFA 5DDOC 2HGNA 4NOHA 1YX2A 2QT7A 5KFZA 1U49A 3MM7B 1B3TA 3CCQS 3M30B 3UDCA 3VALA 2FGCA 2P6TA 3CDBA 1QM9A 1KD1T 4P2SA 1RA6A 1Q7YT 2IM2A 1WG5A 5AE1A 3FKBA 4O3RA 4IFYB 3N01A 2XMAA 3SXLA 4RUHA 2NYHA 4MKYA 2D7SA 1YJNS 1X5TA 5LL6d 3HVRA 1N33J 2Y3YA 4LREA 2MZRA 3QFWA 3H42A 5HK4A 2IFXA 3RB4A 3VZHA 3N6NA 1SL1A 3PFOA 2R4FA 1VHIA 2DTJA 4DL2A 1SC3B 3Q23A 2IPOB 1X0FA 3K5PA 2FY8A 2KXFA 2AD9A 4OYOA 5KFGA 4NXNJ 4LQ3A 2ZJQQ 1TKTB 4XPEA 3D3CJ 2CPEA 4P73A 3ETOA 3KMSA 3HSJA 2OIHA 1ITPA 3SFGA 2XGPA 2QMXA 5BR8F 3V81B 3ILOA 3KLFA 2L9DA 5H9FK 2OUGA 2GVZB 5HVFA 5KFYA 3GCXP 3KHGA 1NDKA 1RU2A 2FGOA 1H72C 3BGLA 3CCMS 1VQ4S 1GAOA 4IR1A 1X4DA 4P7TA 3OXLA 2QG9B 2M70A 4G3IA 1R43A 4MK7A 4ZJOA 3IFEA 4WZQA 4DSEA 5HANA 2E7VA 3HFKA 3SCLE 1KFDA 2F7VA 4W4MA 2ASYA 3I4HX 5C24B 2HLTA 4N77A 4ZPWR 2IRYA 1T05A 3BH7B 2CNNB 2MKCA 2CQDA 2P9CA 3BR9A 2ZH2A 4OX7A 3Q8PB 5HQMA 3PYEA 1PG5B 2DISA 4X62J 2NQPA 4DQIA 1Q95G 3CPWR 4M5NA 2F4VJ 1SJRA 2IAJB 4U67Q 2H48B 5LSOA 4WFZA 4NYPA 3QWUA 2BE7D 4IO1A 1KOHA 4JI3J 2CQGA 2M2BA 4YFUA 1QSLA 1FE4A 3NS7B 1IBLJ 1BQMA 1A9NB 1VBKA 2O66A 1HQ2A 1TV6A 3LOUA 4FP9A 2Y8WA 3TWZA 4LF4F 1TUWA 2HS4A 1BC6A 2HQ3A 3O5TB 2K3IA 5KG6A 2IY5B 4HT7A 1Q82T 1S7IA 2LEBA 2OD4A 3DLGB 1NSAA 1TQLA 2UUAF 4LBIA 1QUVA 2VPYB 2VPWB 1Q81T 2WTFA 1NB2A 1RWNB 2B4PA 2JOQA 3JB9k 3W9JA 2V9KA 4LIRA 3BEGB 5EWFA 5J1EB 3HHLA 3K89A 4EK2A 3V6HA 3EM1A 1EP4A 1UVLA 2MHEA 3DLKA 3KJVA 4DR1J 2D69A 3KUGA 3BPDA 1RAGB 2MJNA 2PGCA 4B9UA 1WWHA 1IM6A 3EZUA 1FNMA 3MURP 2CVEA 1X7VA 4NE9C 1LEOA 3PG9A 4NXMJ 3X3UA 4UOFA 3J7ZT 2M5YA 2ZDPA 3NKYA 1ZPWX 3FSXA 1T95A 1PIEA 3I32A 3T1YF 3G96A 3W2WA 2XMWA 3OFGA 3SI8A 3MM5B 4OJ3A 2H3EB 2UUBF 3LPYA 3ENVA 3VGUA 3JSMB 2Z58B 2VBXA 2A0FB 4OYPA 2XWXA 5KFFA 3MMAA 4C8LA 2MLXA 1L3TA 3QO9B 1B0TA 4RW4A 4H4OA 4MIAA 3VGTA 4DL0C 1UVKA 1QUPA 1UWBB 2YX4A 3M8PB 3J7YI 4CLFA 1L3KA 3EDQB 2Q6BA 1H74A 2VPXB 2VQEJ 1NJZA 5AJ3J 1TVRA 6FD1A 1J5EJ 2F4FA 3MEKA 2L48A 2YWHA 4DEZA 2MGZB 5J2NB 2AU0A 1Y10A 2AF6A 4XTTA 1HW8A 1JLQB 1HWKA 1BQMB 2YKNB 2KYZA 4KR0B 2XY5A 2LP4A 1SQEA 1HQEA 4F25A 1DTTB 2CG4A 1NH8A 1HI1A 4KH0B 2UU9J 4CQ1A 2CDQA 4DU7A 2HVHA 4ECZA 2J0QD 2AZ3A 3JAMY 4DR2F 3R9LA 2CJYB 4DMZA 2HNYA 2HGLA 4K4TA 1S59A 3OV7A 2UXCJ 2VJVA 5DJBA 5I3QA 3GPAA 3PX0A 1VQ5S 2P2CB 3DRXA 5DM7Q 4FS1A 4DV1F 5CD4H 2AJQA 1JX4A 3WX8A 1HNXF 3AODA 4OZ5A 3R5GA 2MZSA 3TZWA 3DLKB 1YG0A 1RB0A 3HHEA 5KFTA 3HVWA 3RB6A 1VGYA 4ELTA 1XNRF 1CJVA 1D9DA 1SC1B 4HHJA 3TQEA 1NH7A 3KG1A 1DLOA 3PYGA 3MTKA 1IKVA 3MOZA 2HHSA 2PO4A 2VA3A 5F8GA 1LW2A 1X4BA 1R7IA 5E5NA 2E7XA 2JC0A 1WHWA 3W2WB 4KAIA 4DR6J 4CYUA 2A6MA 4DV5J 2YVSA 5A8KB 1IKYA 4M5HA 1FA0A 1VC6A 5A8WA 1QSSA 1M5PC 1CJUA 1JXLA 5CYQA 4ZVUB 3OFFA 4OZNA 5F41A 3CCRS 3G8QA 2KZZA 3OL8A 1Y11A 3PEJA 1LQ9A 4CO4A 1D8ZA 5CD4A 2F8HA 1HFEL 1WKLA 3Q22A 2GO8A 2DXDA 1FX2A 3EGZA 1H7XA 1KS2A 3DOMA 4GKJF 2F9JA 2DXFA 3M9NB 2ZH6A 1HQEB 2I0XA 2OP5A 5DLGA 5I3UB 3J7YU 1CSJA 2G1DA 2GJ2A 1XMQF 2XSJA 1F5BA 2CPYA 5C2CA 2CPZA 2J7UA 1FWLA 2XS2A 1T9XA 4QWBA 2G0IA 1S0OA 2BACA 4BC9A 3D68A 2CQ2A 3NBPA 2LA6A 4X66F 5FJ4A 1UAWA 2LQJA 5HJXA 5AE2A 1WTFA 2CQ3A 3LP0A 4UTGA 1J2VA 2V2ZA 5AXNA 3R27A 5I4MA 4FF1A 5F8JA 2VB6A 3GG1A 2VOPA 1EAYC 1TKDA 6FDRA 2CAJA 3N0VA 1M5HA 2E1CA 3M2UA 4Y34A 3MPVA 3DRSB 1VOMA 1PYOB 3K58A 3CWJA 4KRWA 2QA4G 4YY3F 2X1FA 3ZTRA 2M3DA 1LW2B 3CJKA 4LUBA 1RT5A 1S0VA 4MKAA 3BREA 3EUNA 3D7SB 4HDHA 4K8RA 1HNVA 5A2QU 4B3SF 4K4VA 4ELVA 1VISA 4P2FA 4KFBA 5B0AA 5SUHA 4U6PA 3IRXA 4X4QA 4Q2MA 2K7JA 4RPFA 1PSDA 4MYUA 1I5OB 3OTOF 3KUEA 4NCGA 4ECUA 4L3NA 1YTYA 4ZPCA 4ED7A 3AXKA 4URSA 2FJVA 3KLGB 1L3SA 4CCHA 2IYGA 1Q1KA 2BJDA 4YDDB 4I2QA 3LANA 4Q43A 3Q24A 4JYAF 2XYPB 2HS0A 2C3MA 2YKMB 2EG2A 1DARA 5CCLA 2YTCA 2RMLA 3A3PB 1CJTB 1MROB 5LMUJ 2V94A 2PI5A 3MECB 4PQUB 3DOMB 2BOPA 5A6WA 1TK8A 3GSIA 3DRPB 4EBDA 4F3OA 4ED0A 2NCKL 2DHGA 4R25A 4DPXA 2NPFA 2QLBB 2WOMB 4Q45A 1VRTA 1YSJA 4BLGA 1R8AA 1TL7A 2V2VA 2DNRA 4FNHA 3LAMA 2LKZA 2W2PP 2X3DA 1F5AA 2MEWA 2E5LF 3DXBA 2HLUA 1T94A 4PUOA 5KFPA 5C25B 1K73T 5IT4A 4DHVA 2UXBJ 2DGWA 5GMKa 2BABA 3MR2A 4NLQA 3MI7X 2D3O1 3TVKA 4RW7A 2CPHA 2ZVSA 3D5MA 4RW8A 4ECQA 4ZKAA 4XIUA 4AXJA 4EBEA 3MFIA 3DXSX 3TARA 1TL4A 3I31A 3FGVA 1EETA 2V8GA 1HBUB 2C3OA 1XMBA 3MTJA 2QLFB 2YNIB 1U24A 4P10A 2CUYA 4UZCA 1S1UB 1U1NA 3CD0A 4I0WA 3AA8A 1EHWA 4FKYA 2ZNYA 4KYZA 4GVLA 4ZOSA 2EFOA 3CJKB 1U1MA 2Y0BB 1TELA 1TK5A 1X9SA 1W25A 1YJ9S 3HKZD 3G82A 1FWKA 2QYCA 4PZVA 2ZOFA 1HNVB 1XMOF 5HL7Q 4J9NA 3WC0A 3FEYB 4CI0B 1QLNA 4YUDA 1A7GE 2NXEA 3UNGC 1U6ZA 4KC5A 1BGXT 2CKWA 4UZBA 3FNNA 3DU5A 2Y1IA 5E3CA 5T7LA 4NEYA 2W25A 1RAOA 2HK2A 3UN3A 1X31C 2ALYB 5ETRA 3KLEB 1IWAA 3R2CJ 4U96A 3CCSS 1M5SA 4Z2XA 1F3FA 1FK9B 2I38A 4YR0A 4KHPJ 4RWXA 3L09A 3E01A 1PAUB 1RAJA 4DUYF 2ZH9A 4RNOA 3KLHA 3QWPA 1AZSB 3R6GB 3A8IA 2W9CB 1S6OA 4ZVFA 4IDKA 1RT1A 2DT9A 2FJEB 4LSZB 3JS9A 3HHNB 1Q16B 2ZVIA 3RBEA 3C16A 1VRTB 3IWLA 1NK9A 3NWRA 2R3VA 2XWYA 1LXNA 3MEEA 8ATCB 1S6UA 1Y7PA 1IR0A 2N3OA 5LOQA 3HULA 4ITSA 3UE2A 1CQNA 1TL3A 1YJUA 3IRWP 1OYDA 2CWXA 2EFGA 4NWBA 3R8YA 5IT9Y 4ZMMA 1SVDA 2XLKA 2GIFA 1NHKL 1NRKA 2A2CA 2MTLA 3H5XA 3LAKA 4RW7B 2RKIB 3TAMB 1AYEA 4NLGA 5KFMA 5ETVA 2QIFA 3NNCA 3MM6B 2BQ3A 1WKJA 4DZDA 1UEUA 1X4FA 1V5IB 3GIMA 4M1KA 4U7UD 5KFRA 3CD5A 4GVBA 4FXVA 2WZ1A 3QJLA 1GNKA 1FNOA 4OI2A 1JLBA 4LVNP 3SZ2A 1H38A 3J80Y 1LWFA 2FPHX 4MKBA 3MMCA 3T5JA 1A6LA 4A4JA 5ETNA 4TQSA 5HVGA 1VQPS 1H7WA 1F9FA 1QJHA 4MYTA 2BE9B 2HYIB 3DMJB 4DU8A 4DPTA 1UFKA 4LF2A 2W2MP 3G82B 3LP2B 2ADBA 4GKKJ 1T9VA 1HNWJ 1U47A 1F6TA 1KN6A 3DN9A 1QAJA 2V4JA 3C3LA 4OI6A 5KFSA 5B7WA 1OMSA 3JQJA 4F02A 2FJXA 1YBAA 3RB0A 1DHMA 4EYIB 3M1VA 1TK0A 1S77D 3D28A 4CLYA 5GAGI 3S8SA 1KLMB 1OYEA 1WACA 1QVFR 3WX4A 3BO3A 1VRQC 3GU0A 1BY9A 2HVDA 1C0TB 3LP1A 3MZIA 2AT1B 1E6VA 3H59A 3PVXA 3ISZA 3E01B 3D66A 2LVWA 3FBCA 2AQ4A 4ILMA 2GGPA 2IM1A 3ELHA 3NNAA 4IDKB 1O5JA 2DNGA 3CCLS 1N48A 4LFAF 3M2VA 2UXDJ 1U1OA 3N28A 3A8KA 3C16B 2J0XA 1BE4A 2OPSA 4MFBA 4OZJA 3BF4A 3IR5B 4DFPA 2QZ8A 1MW7A 1WC0A 1L5UA 2YQ1A 1MG7A 4NMLA 3HM9A 5IXUA 2C42A 2PI4A 2MQNA 2UV8A 4LF8J 3UDEA 1ZYQA 4V19X 4C2MA 4C9DA 1XERA 4ZLJA 2DXEA 2KG1A 5DETA 1WJ9A 2F3JA 3PACA 4FDFA 3OL7A 2MKIA 3I0RA 2AJ0A 4GVBB 4W90B 3J81j 1Y00A 3O6QA 3E51A 2P8IA 4LF5J 3JAMU 2Q79A 2VQFJ 4B9TA 3CE8A 4DV6J 3SQGB 4CT9A 3VAMA 2HQFA 3R7NB 2B3TB 3UD3P 3UPFA 1HWJA 1AXQA 3OTBA 2Q1LA 2XMVA 3OSNA 1N4LA 2LQ8A 4ZVEA 1RQ0A 3DOKA 4DPUA 4EZ9A 4P74A 4YR3A 3F44A 2ZZNA 1NAQA 2HURA 3VR1A 4GC7A 3ZO7A 4ZCMA 2C2NA 2VG6A 4G1IA 1NU4A 1RAIB 2P9GA 1SCJB 2DR5A 2BDPA 4TU8A 1S72S 2JVRA 2UVWA 2AW0A 1Y5IB 3SMZA 2YNGB 1HI8A 2MSSA 2BW2A 4PXCA 3T3FA 5D0GA 7FDRA 4YB5A 2NREA 1Z1ZA 4FKXA 4I67A 1U1KA 4U8YA 2FJDB 4DV0J 2YX7A 4BCAA 1HARA 2B5JB 4JV5F 3FJ2A 2ROPA 1WORA 3M2VB 3DLHA 2BJ8A 1ZS6A 1N54B 5JXSA 5GAGU 4TY8B 3CCUS 2OPSB 1ZM4A 2V2KA 5HO4A 2QL5B 5IC6B 1GMWD 3C15A 2QSFA 3A8JA 3IGNA 1T9WA 4FF3A 5B0CA 4WXOA 4F0KA 1ZM9A 3VAIA 3WC2A 2MZ1A 2KM8B 2W7PA 2Y8YA 2EXUA 2PE8A 1RHKB 4ZN3A 3V6DB 3RTVA 2OO4A 5H9EK 2XBPA 3TYTA 4BBYA 1R3NA 3IAM9 4X4PA 1X4EA 2CNLB 4QOTA 3E8OA 3AQPA 4J9LA 1WEYA 2KKHA 1T3OA 2N4CA 1AB8A 2HBRB 4WFXA 1B99A 2KHDA 4IH7A 1HBNA 1UL3A 1FHTA 3T1HJ 1OJ4A 3D0GE 2I5JB 1KQKA 2XLIA 2PDAA 2XMJA 3GYGA 3DFEA 5D15A 3TZZA 1RAHB 4JI2J 3CTRA 2AZ1A 3EMTA 1RISA 5G0RB 1ZAWA 4O3PA 1U8SA 3AJDA 3FSYA 1BQXA 2KT2A 2NXNA 5IV3A 1X5PA 1WHVA 2GC8A 3LGNA 2AEJA 5KFQA 1RKJA 3J7AN 2AGPA 1W7WA 5FD1A 1WF0A 3DLJA 1HR0J 1FVSA 1XNQJ 4PG6A 3DLEA 1FXLA 3QATA 4G65A 4O3NA 3MXHP 4ED1A 4HVZA 4I1TA 3FEXB 4DR7F 1JWWA 3KTQA 2HZCA 4RNMA 2UUCF 2RSQA 2E1AA 4GRSA 2UVRA 1S10A 2HNDB 4YB7A 4USKA 1LWEB 4DV3J 3DYAB 4DFKA 1LOUA 3VQTA 3HSZA 3TA1A 1SV5A 2MY7A 3MCOA 3S6EA 3NGKA 4J9SA 1KTQA 2IJNA 1FJEB 4U8VA 2C1EB 3ZZOA 3JSYA 1FXRA 3I87A 3TI0A 1RABB 3U1NA 4PWDA 3JTOA 3TEHB 4ZP9A 3BGRB 3KK1A 3TVYA 3TEGA 5EDWA 2KTQA 4BWMA 2W4CA 2VDIA 4TY9A 1KRPA 2BOAA 2NSBA 3A13A 3ZTQA 3OJSA 4Y2KA 2RILA 4DPYA 2EEYA 4J9QA 5IC4B 4N41A 1P6TA 2JNJA 2VHGA 3IAS9 2RQMA 2V68A 4B3OB 1TL1B 1RP5A 3HPOA 2B4UA 3THVA 4DS5A 1JLFA 1FWPA 3W61A 3KK2A 2F5GA 4LFBF 1FFGB 3ULHA 3RGIA 3GIJA 2BBEA 3ZZZA 1XR7A 1NKBA 2KHCA 4UQTA 2EPIA 3ENWA 3HLUA 3FDSA 4MK9A 1JXEA 1WG4A 2RRNA 2HVEA 1PKUA 2OHDA 4KGKA 3ITHB 4YQWA 4KJIA 4GMKA 2IDEA 4DN9A 3B78A 5K8MA 1U0HA 3Q89A 4HHUA 1S6PB 1WOPA 5K14B 4ERDA 4N8NA 3P3DA 4R0JA 2POKA 3CDWA 1FEEA 2QX0A 2DITA 2OJ3A 1N32F 2VC0A 5KFKA 2OMOA 1UW4A 3AOCA 5EN1A 4A8WA 4DLEA 3GLJA 1S1TA 1N36F 2A2DA 1HQUB 1JLGB 4DSJA 1V6HA 1RWUA 2ZBRA 4AL5A 4HEA9 4ZVOB 2QA4S 3GFZA 5BR8J 3FFIB 3SSRA 4JI5F 3RU0A 4RW6A 3GV7B 1ULRA 5KG4A 4UUWA 2RS8A 2QA2A 3KOAA 4OHWA 4QYZJ 1Q7LB 1E6YA 1GMVA 4C8NA 4IOCQ 5K9FA 5D77A 1PYSB 5CYMB 2UVVA 2GV1A 2BV3A 2VV5A 3BDPA 1EQMA 2HHQA 3PY8A 3QMQA 4O44A 3R6LB 1KWMA 3F41A 1S4EA 3PRVA 3SV4A 2IC3B 2VBZA 3C2PA 4OV1A 5E2QA 3CJ4A 4E98A 3M8WA 3AY0A 1G2EA 4M5DB 3SYZA 1S76D 2HBYB 3CNQP 3SIPB 2KT5A 4P7VA 4PWWA 1NJXA 2QV6A 1SL2A 4RLEA 1C1BB 3QSIA 2J6TA 5KG7A 1WEXA 2G9OA 4HL9A 4QW8A 3MAHA 4C8MA 2ZZMA 4V19J 1M1HA 1VHFA 3RRGA 1JLFB 3KK2B 3NRBA 4XPCA 1C1CB 4NLUA 3EVWA 5AXMA 5HP1A 2J9CA 5IT9U 1JNRB 1T03A 4PABA 2NXCA 3PX6A 3KYLA 4LF4J 2DR8A 4WU2A 2I9SA 1EKSA 2MKHA 1NDCA 1FFWB 4EI2A 5RUBA 2UUAJ 2ZD1B 4C3LA 4K4YA 2O3DA 2M0GB 5ETSA 3GYXB 1X5OA 4JBCA 2F1FA 3PTWA 5LSRA 2OEMA 3J80U 4LF1A 4IH5A 3MAQA 4HT5A 1SJFA 1PGZA 2FLNA 2QRRA 4NI2B 3PXGa 4BWJA 5L1JA 1DJ0A 3KWMA 1C4AA 4RW6B 2IRXA 3GR1A 2JZ5A 1PC5A 2VDHA 4P71A 1U09A 3R5JB 5ITHA 3HSGA 3J7A1 3L7OA 2RD5C 4ETZA 4ANCA 1N6QA 4I68A 3FRYA 3VVTA 1HIYA 3G6YA 3BB5A 2R8KA 2D9PA 2RRAA 2YNFA 3T1YJ 5KFIA 1SIWB 2F8MA 3K5OA 3BH6B 1RWOB 2FLOA 1J5OA 3JSRA 2UUBJ 5DQIA 2EC2A 1WC4A 5KTQA 3LALA 4QWAA 1U4BA 4LF9F 4ID5A 3D6HB 3TUPA 3QIPA 1AW0A 2HFOA 3H4BA 1S1XA 2LDIA 1X4HA 5K20B 1H6KX 2VONA 1IKWA 4JV2A 4CH7A 4Y0FA 5L46A 3DLBA 1UETA 2QJ3A 1RT4B 4LSLB 1OIAA 2VH7A 1JK9B 1LWCB 5I42A 2W7OA 3RRKA 5DLFA 1P1TA 3R5BA 4OFZA 1QVGR 4IOAQ 4NCBA 1NUEA 5I3PA 5LXRA 3ZZTA 3BKUA 1G3OA 2KT3A 1SQGA 2H5EA 3QJJA 5J1NA 4DWIA 3QBCA 2YWKA 1W26A 5JJBA 3RW6A 5KFHA 3W62A 4LF6F 1JLAA 3DDKA 2XM3A 1C0UA 1SUQA 4Y65A 5L9NA 4ZVHA 1FRJA 2DIUA 4OX8A 4DG1A 4DR2J 2DB1A 1WOOA 2FJAB 3CIZA 1CJKA 1RGVA 3MHYA 2DEJA 3DOLB 2AEMA 4Q0BB 4Y2CA 3PKMA 3CW2C 4MH8A 2A18A 1NNDA 3A1YG 2B9WA 4DV1J 9ATCB 4ZK7M 2VFVA 1SH3A 2ROGA 5E0OA 3N79A 1HNXJ 1NLKL 1D9AA 4C6AA 3IM8A 1S6QB 5F3TA 4A8QA 1FX4A 3MEDA 4J7CA 3S7RA 1S1WA 4F0MA 1HMVB 2AWZA 2HZAA 1XNRJ 4ECTA 4TYBA 1HL6A 4Z7YA 4RUAA 1KSPA 2L9NA 2VG5B 4YS2A 4LBPA 1F3VA 4LSNA 1YRTA 2YNFB 2O01C 3CGIA 1N56A 3TQ1A 3QT6A 2JFKA 1GX6A 2DKOB 4RJVA 4Q8EA 3MM8B 4WK3A 5ETTA 2AJ1A 4NZ7A 3ONQA 3PO4A 3BPSP 4JV0A 3UDLA 4I2PB 2YWEA 3C8YA 2AYEA 5JVGQ 3QIPB 1RWVB 4C0HA 4X65F 3PR5B 1RTJA 3KUHA 1RBAA 2JC1A 1PILA 1IKWB 4FYDA 2ASJA 1RWPB 2OMLA 3KJFB 1HD0A 1R8PA 3MUVP 2R7RA 2HMIA 3MDFA 3QZ8A 4F4ZA 4A46A 4PPDA 2R8IA 2VPZB 3G6ES 3AD8C 4DFMA 5B09A 2WVDA 4K59A 3W5XA 4ZCLA 1DRZA 3HK2A 5KT4A 3JSBA 2WVBA
chains in the Genus database with same CATH topology
1LWXA 1MN7A 2BX6A 1W7WA 3NGUA 1NUEA 1NHKL 4O0NA 4UOGA 1BUXA 3Q8VA 3DKDA 4ANDA 3DDIA 4ANCA 4F36A 3ENAA 3FKBA 4WBFA 1PAEX 4DI6A 2DXEA 4ANEA 2AZ3A 1BHNA 3VVTA 1HIYA 3R9LA 3ZTOA 3B6BA 3BBBA 3EVWA 3VGUA 4KPCA 3NGSA 1S59A 1U8WA 3Q86A 3L7UA 2ZUAA 3G2XA 3PJ9A 1WKJA 3FBEA 1JXVA 1XIQA 3Q8YA 3BH6B 2B8PA 3ETMA 3GPAA 3MPDA 3EVMA 3GP9A 3VGSA 2HVDA 5C7PA 1UCNA 4FKXA 4F4AA 1B99A 2HVEA 1HHQA 1NB2A 1PKUA 3BBCA 3VGTA 1K44A 3BH7B 3NGRA 1F3FA 3Q8UA 3EE3A 3Q83A 1NSQA 1NDCA 3FBCA 3PRVA 3VGVA 4W98A 3EJMA 1NCLA 1NSPA 5CABA 3EVOA 1NPKA 1XQIA 2DY9A 3FC9A 3FCVA 3FCWA 3WX8A 3ELHA 3Q89A 3FBBA 3ZTPA 1MN9A 5CAAA 3NGTA 1ZS6A 3B54A 2VU5A 1B4SA 1NDPA 4EK2A 5BXIA 4ENOA 4S0MA 1WKLA 3EM1A 2B8QA 2AZ1A 1EHWA 3EMTA 1WKKA 1NSKL 2DXDA 2BEFA 4FKYA 3JS9A 2DYAA 3ZTSA 1BE4A 2NCKL 1VYAA 1NLKL 3VVUA 4HR2A 4CP5A 1S57A 2CWKA 2DXFA 3ZTRA 1NDLA 4C6AA 2HURA 3EICA 4UOHA 1F6TA 1KDNA 3FBFA 5IOLA 1HLWA 1LEOA 1S5ZA 1NDKA 3BBFA 4UOFA 4DZ6A 3ZTQA 4DUTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LWX A;  1MN7 A;  2BX6 A;  1W7W A;  3NGU A;  1NUE A;  1NHK L;  4O0N A;  4UOG A;  1BUX A;  3Q8V A;  3DKD A;  4AND A;  3DDI A;  4ANC A;  4F36 A;  3ENA A;  3FKB A;  4WBF A;  1PAE X;  4DI6 A;  2DXE A;  4ANE A;  2AZ3 A;  1BHN A;  3VVT A;  1HIY A;  3R9L A;  3ZTO A;  3B6B A;  3BBB A;  3EVW A;  3VGU A;  4KPC A;  3NGS A;  1S59 A;  1U8W A;  3Q86 A;  3L7U A;  2ZUA A;  3G2X A;  3PJ9 A;  1WKJ A;  3FBE A;  1JXV A;  1XIQ A;  3Q8Y A;  3BH6 B;  2B8P A;  3ETM A;  3GPA A;  3MPD A;  3EVM A;  3GP9 A;  3VGS A;  2HVD A;  5C7P A;  1UCN A;  4FKX A;  4F4A A;  1B99 A;  2HVE A;  1HHQ A;  1NB2 A;  1PKU A;  3BBC A;  3VGT A;  1K44 A;  3BH7 B;  3NGR A;  1F3F A;  3Q8U A;  3EE3 A;  3Q83 A;  1NSQ A;  1NDC A;  3FBC A;  3PRV A;  3VGV A;  4W98 A;  3EJM A;  1NCL A;  1NSP A;  5CAB A;  3EVO A;  1NPK A;  1XQI A;  2DY9 A;  3FC9 A;  3FCV A;  3FCW A;  3WX8 A;  3ELH A;  3Q89 A;  3FBB A;  3ZTP A;  1MN9 A;  5CAA A;  3NGT A;  1ZS6 A;  3B54 A;  2VU5 A;  1B4S A;  1NDP A;  4EK2 A;  5BXI A;  4ENO A;  4S0M A;  1WKL A;  3EM1 A;  2B8Q A;  2AZ1 A;  1EHW A;  3EMT A;  1WKK A;  1NSK L;  2DXD A;  2BEF A;  4FKY A;  3JS9 A;  2DYA A;  3ZTS A;  1BE4 A;  2NCK L;  1VYA A;  1NLK L;  3VVU A;  4HR2 A;  4CP5 A;  1S57 A;  2CWK A;  2DXF A;  3ZTR A;  1NDL A;  4C6A A;  2HUR A;  3EIC A;  4UOH A;  1F6T A;  1KDN A;  3FBF A;  5IOL A;  1HLW A;  1LEO A;  1S5Z A;  1NDK A;  3BBF A;  4UOF A;  4DZ6 A;  3ZTQ A;  4DUT A; 
#chains in the Genus database with same CATH topology
 1DZ5 A;  2GNK A;  2YQ3 A;  3LO3 A;  3W66 A;  4GKJ J;  2PEB A;  4UOG A;  1S9G B;  4YB1 P;  2X1B A;  3OR2 B;  2FHJ D;  1JLA B;  1XMQ J;  4CRJ A;  3G9C A;  3NMR A;  1IR2 A;  4DPO A;  4WP3 A;  4DG1 B;  2PA8 D;  2AV5 A;  2BE2 B;  1OWX A;  4F04 B;  3LH2 S;  3C6U A;  2C2M B;  4Q5V A;  2WVE A;  2IA6 A;  4WCE Q;  2Y9H A;  2K3K A;  4NLD A;  1SKR A;  1Q79 A;  3FCV A;  5J2P B;  6AT1 B;  3ET6 A;  4EWT A;  4X66 J;  3HHL C;  3R7S B;  1N5S A;  3K7R A;  1MN9 A;  1RJJ A;  2YNH A;  4EO8 A;  2IDL A;  2NYI A;  2ZM6 F;  3MED B;  1OS5 A;  1S1W B;  1QDU B;  3PEH A;  1WSR A;  4IFV A;  5CA5 A;  3P45 B;  5IOL A;  1K8A T;  1S5Z A;  1VQ7 S;  1JLC B;  3POT A;  4DUZ F;  1DBD A;  4WE1 A;  1RAC B;  2P6S A;  4AD6 A;  4M5I A;  1DTQ B;  4YY3 J;  1R0A A;  1JQG A;  4LVO P;  4FYV B;  3F56 A;  5THW A;  2JWN A;  1TU0 B;  4F36 A;  1UA0 A;  3GZ7 A;  2KL8 A;  2DGV A;  3V6J A;  4QWC A;  3N5F A;  4RUB A;  4B3S J;  2BJ3 A;  3VF0 B;  3BYR A;  4LMZ A;  1VFJ A;  1BWE A;  3K8V A;  1U0S A;  3MD3 A;  5F8M A;  4WWS A;  4G6V B;  1RTJ B;  2ZDO A;  3OTO J;  3ISN D;  2QFI A;  3DRR A;  2RHS B;  3RJM B;  4I7F A;  4DR4 F;  5IM0 A;  3OHB A;  3A4T A;  3FMB A;  1BMQ B;  3UCG A;  1IJF B;  2JLG A;  2R7U A;  4JYA J;  5D4P A;  1WF1 A;  1TKX A;  2J9E A;  3KMQ A;  3NS5 A;  4ZIW A;  1PBA A;  3OFE A;  2GZO A;  4UOH A;  1LW0 B;  3SSQ A;  1IR1 A;  3RG6 A;  5DS7 A;  2DNQ A;  2CNK B;  3GFX A;  1D3W A;  2NS1 B;  3U1L A;  4I6W A;  4P9S A;  5D4N A;  3V4M A;  4EEY A;  3GE9 A;  4RW9 B;  2MZQ A;  2N4D A;  4AND A;  2DGX A;  1O0P A;  3LQV A;  1EJ7 L;  2BKO A;  4B9S A;  1OY9 A;  4IKA A;  3U7J A;  4CM0 A;  2L08 A;  2E5L J;  4TQR A;  2R7X A;  3QGI A;  4PG7 A;  1VJW A;  3BSO A;  2XQC A;  1K0T A;  2FVR A;  1RTH A;  3VHQ A;  2JH3 A;  1K44 A;  2HRY A;  3HKW A;  2OFG X;  1RTI B;  4NCA A;  3M9M B;  3OFH A;  1HBO A;  3QLH B;  1FVQ A;  5L39 A;  2DR9 A;  4KPY A;  2LEC A;  5E3A A;  2W7A A;  4KE5 A;  2APO A;  3HJF A;  4IFV B;  3CSK A;  2FVS A;  1NB7 A;  2H51 B;  3MM7 A;  1CEZ A;  3M30 A;  3GCW P;  3ZZU A;  4R0E A;  4RBU A;  2RQ4 A;  5KOW A;  2HNZ B;  1MLA A;  3UD4 P;  4WE1 B;  3HVT A;  2D9O A;  3GTY X;  1HD1 A;  4CO3 A;  2M52 A;  3VV2 B;  1FFS B;  2QA1 A;  1FRL A;  2V8D A;  3W1Y C;  4QWE A;  1XMO J;  3TR5 A;  5ETP A;  2WK4 A;  4FXW A;  2U1A A;  2CVI A;  3TJ8 A;  3GSD A;  2CA9 A;  4UST A;  4BHQ A;  1TR0 A;  3EWG A;  4L72 B;  3L7U A;  3BSC A;  4TLR A;  4RX6 A;  2ZEJ A;  2ZOM A;  3CT9 A;  4B08 A;  2ZE2 B;  3GP9 A;  3A8E A;  4F26 A;  1VBX A;  1TKT A;  3TUJ C;  3BO4 A;  3W63 A;  2VFS A;  5GAD U;  4I7F B;  3C6T B;  5IM0 B;  2FIU A;  3D0H E;  5L1I A;  3TOQ A;  4ZPD A;  3BQ0 A;  3JYT B;  3R7B B;  2QSW A;  3BSA A;  2RDD A;  3V81 A;  1LV5 A;  1VC5 A;  1LNQ A;  2IM0 A;  2GVZ A;  1NSK L;  2ZHA A;  4OX6 A;  2G4B A;  3DM2 B;  4MAK A;  3H5S A;  7AT1 B;  3IC1 A;  4DUY J;  2J9D E;  1HBM B;  1RT3 B;  3GIK A;  3GJR B;  2GIR A;  3MM9 B;  3RBZ A;  2FYX A;  2V8V A;  2YX1 A;  1SKS A;  3A12 A;  2A3J A;  2DNP A;  3N6M A;  3LGM A;  4EUV A;  2GS8 A;  1RTD A;  3PR4 A;  1B70 B;  2ZWP A;  2B43 A;  4N7T A;  2LEP A;  2ABY A;  2VIC A;  1U6F A;  3RBX A;  4K0K F;  2HFV A;  4OIX A;  1N5Y B;  3PW4 A;  4B3M F;  5H9F J;  1TAQ A;  2Y1R I;  3HD2 A;  3TW0 A;  3R1L A;  4O3S A;  5L9X A;  4LR9 A;  3EZ5 A;  3DRY A;  2IAJ A;  4TU9 A;  4ES3 A;  1V3S A;  3ZTP A;  3NGT A;  1DQ9 A;  1RAD B;  2HKE A;  3BZQ A;  3IS9 B;  4FF4 A;  3MUT P;  4UY8 5;  5KFN A;  1JB0 C;  2XY6 A;  3I82 A;  1WUU A;  1N5V A;  3QPI A;  1TL5 A;  3KHR A;  3HVT B;  5HJY A;  1HNZ F;  1DQA A;  1S9E B;  1NK0 A;  4ILL A;  3NOG A;  4F2R A;  2HQI A;  2DO0 A;  4PKD B;  4NMX A;  4PG8 A;  2RE1 A;  2VFT A;  4YHH F;  2A6O A;  4OX9 F;  2NUU G;  2HG4 A;  4YDX A;  5D78 A;  4EFA C;  3DLG A;  2M8D B;  4M94 A;  4OI3 A;  1Z2Z A;  1U2F A;  1KBR A;  5AXK A;  2PII A;  3V2U C;  2RS2 A;  1UFL A;  1Y3J A;  4C0B A;  3OD2 A;  1IBM F;  5J1E A;  4C98 A;  2XB2 D;  2UZA A;  2DD8 S;  1GEH A;  2H65 B;  1XK8 A;  2D41 A;  2IYI A;  2BW7 A;  4B3T F;  1YBT A;  1FDD A;  4F0H A;  4JI7 F;  3EDR B;  3K59 A;  1NJI T;  2AJF E;  2GVD A;  5D3G B;  1VYA A;  1P9Y A;  3ZZR A;  4KGX B;  2LXF A;  2VD3 A;  3F0N A;  5F0W A;  2YPZ A;  3MAA A;  4NAS A;  2ILY A;  4LFA J;  3CJR A;  4LR8 A;  1RTD B;  2WB4 A;  3BBF A;  3FVY A;  4TKT A;  3MM5 A;  2QMU B;  4I6Y A;  1FJG F;  1N34 F;  3TP2 A;  1SJQ A;  3W5Z A;  4N56 A;  1OPI A;  1UJ6 A;  1Q0N A;  3JSM A;  4C0O C;  1OSD A;  4PEO A;  5T41 A;  1FRI A;  1FRM A;  3CJ8 A;  3QO9 A;  4MMO A;  4ZA1 A;  3MMJ A;  4DV4 F;  2CXE A;  1UWB A;  1YLX A;  1VBZ A;  5E3P A;  3M8P A;  3H90 A;  1S97 A;  4A8M P;  4DL7 A;  2CQP A;  3OVB A;  3BBC A;  2DRD A;  2PMH A;  4ZDN A;  2GO9 A;  5HSP A;  1KVK A;  3T19 A;  1GMU A;  4JI6 F;  1NK8 A;  5FDL B;  2OPP B;  3SCJ E;  2VUG A;  2HS3 A;  1SC6 A;  1X4A A;  5T14 A;  2UP1 A;  4B17 A;  2KO1 A;  2VU5 A;  2I6W A;  2W9B B;  2MGZ A;  1HNI B;  5J2N A;  2MJU A;  3TVZ A;  1JLQ A;  2YWF A;  4F50 A;  1X4C A;  3L4B C;  2YKN A;  2XLJ A;  2UUW A;  2BJ9 A;  4IG0 B;  4HR2 A;  2M8H A;  5C42 B;  1DTT A;  4ZP7 A;  4CH1 A;  4HTJ A;  4DF4 A;  2C3U A;  2DBB A;  2H4W B;  5C2G A;  1UEV A;  1MN7 A;  2AHO B;  2V4R A;  3KXD A;  3C14 B;  1BUX A;  1CS4 A;  3EYZ A;  1WC1 A;  4UY8 T;  2MST A;  4ES1 A;  4F3M A;  1KP6 A;  4OYB A;  2R2S A;  2XGQ A;  3K8W A;  2ZUA A;  1NKC A;  2AJ4 A;  1XN9 A;  1S48 A;  2I1R A;  2RT3 A;  4IQM A;  2J76 E;  4ES2 A;  3OL6 A;  2DJW A;  3B4M A;  1WD6 A;  4X2B A;  2H5I B;  3G6V A;  1U2C A;  4LRB A;  4RBT A;  2D3U A;  2GQC A;  3FC9 A;  4WII A;  4G1P A;  4ZPB A;  4K4Z A;  4FYW B;  1KVJ A;  2GVD B;  4LRF A;  2HZV A;  2QL7 B;  1CC8 A;  3W9H A;  3MAA B;  4JV5 J;  4DPW A;  1PCA A;  3BQ1 A;  3IR7 B;  2XZT B;  2E5G A;  1YDL A;  5DO2 A;  4NLW A;  1KDN A;  1RA7 A;  2GAG C;  3GFH A;  5A8K A;  2JHE A;  3HHL D;  1FI4 A;  2MKK A;  1S0M A;  2FLP A;  2CZV C;  2FJW A;  4ELU A;  1CG2 A;  4BDP A;  3KLV A;  3ENA A;  1Q53 A;  1RAE B;  1XR6 A;  2MMY A;  1RCX B;  2CYY A;  1TFY A;  2CQ1 A;  1R0B G;  1JLE B;  3PZP A;  3H98 A;  3ZZP A;  2AGQ A;  2NXJ A;  1ZM2 A;  1IKX B;  1LK5 A;  2WRM A;  5KT5 A;  3ILJ A;  4QWD A;  2FHM A;  2BJE A;  4QIG A;  4A8X A;  4JI8 F;  2OPQ B;  2HRU A;  2ATC B;  1TUV A;  2KFN A;  3T9Z A;  1ZM3 A;  3TUZ C;  2LA4 A;  2KG0 A;  4F4K A;  2KZM A;  1UFW A;  3G8S A;  3QQC D;  4ECV A;  4HYK A;  4AQY F;  1ZAV A;  1KEK A;  1VQM S;  1KQG B;  2JLF A;  5KG0 A;  3PHT A;  2KFZ A;  5I3U A;  1FKP B;  3IGV A;  3Q0A A;  3LA0 A;  1F0X A;  5HQL A;  4D3G A;  4R5P B;  3MOJ B;  2WSE C;  2CWK A;  3A3O B;  3D3B J;  2ZBI A;  3R97 A;  1SH2 A;  5KFO A;  2RUG A;  5KFA A;  1CS4 B;  5D0R A;  2IBO A;  4L3K A;  4ZIV A;  4WP9 A;  4DFJ A;  1BQN A;  1ZH5 A;  3TX0 A;  2PC6 A;  5KFX A;  3GWC A;  1SXL A;  2RF2 B;  5CQG A;  1S9F A;  2ZUG A;  4K4S A;  2EI5 A;  4PAA A;  1TP7 A;  2V8H A;  1JJH A;  4CNZ A;  4NX9 A;  1RUS A;  3W8P A;  2BKN A;  1NM2 A;  2CRL A;  4FYX B;  4CLW A;  1NHU A;  2XY7 A;  3DI6 B;  1NSQ A;  2DHH A;  4DR7 J;  5CAB A;  2UUC J;  3W2V B;  1R27 B;  3EPI A;  2ERR A;  3DRS A;  3GJQ B;  4OZ0 A;  1VQS A;  1TMM A;  3MFH A;  2MLY A;  2D1C A;  1N52 B;  2ROE A;  4MT1 A;  3E2E A;  1HPZ B;  2WON B;  3NGD A;  1FTC A;  1T9Y A;  4J9O A;  5DQG A;  4FPI A;  2R8G A;  2XG8 A;  1S7H A;  4JI1 F;  3IG1 B;  2AP6 A;  5HN0 A;  3I9Z A;  2XC9 A;  2KM8 C;  2V5H G;  3OL9 A;  1SKW A;  3WDO A;  2BUN A;  4LF7 F;  3KLG A;  3UVJ B;  4ZVT B;  1KHW A;  3H5U A;  4XAK A;  3UR3 C;  1WDD A;  3FUY A;  4P6Q A;  2DPJ A;  2R7S A;  2BAN A;  4AL7 A;  2YKM A;  4RUC A;  3GJT B;  3IM9 A;  5GME A;  1V9O A;  4OL8 A;  1CJT A;  1MRO A;  4LFB J;  4NRT A;  1F5C A;  4PQU A;  3MEC A;  4DSL A;  5F8L A;  1XQI A;  4KV8 B;  3DRP A;  1I3O B;  2WOM A;  1TUG B;  2YKO A;  3M2R A;  1O51 A;  1WKK A;  3R3T A;  2EWH A;  1N0U A;  3C66 A;  5J2M B;  4PXD A;  4A8Y A;  4E8U A;  2EVZ A;  3KFW X;  1PJ5 A;  1N32 J;  5C25 A;  5ETL A;  1SJ4 P;  1BQN B;  4ZVS B;  1GTE A;  3BSN A;  1N36 J;  1S1V B;  2G2Z A;  4EO6 A;  1HWI A;  3KK3 B;  4NYO A;  1AA1 B;  2JX2 A;  4V1A k;  4OYZ A;  2B0G A;  1RT2 A;  4RWW A;  4JI5 J;  5EX0 A;  1V3R A;  1K47 A;  3ZFV A;  3O1L A;  1HBU A;  4DR5 F;  1B0V A;  3SEO A;  1Y4Z B;  2YNI A;  3MR7 A;  3CJQ A;  3HT0 A;  1R8B A;  2XMU A;  1D0E A;  1S1U A;  4O4R A;  2K8G A;  5ETQ A;  4WTO B;  3CUL A;  3PV8 A;  1QAX A;  2RAQ A;  5HAO A;  4CLT A;  3D6M B;  4HTI A;  4P52 A;  1U6B A;  3TJA A;  2YKP A;  3OUY B;  3TAQ A;  4QCL A;  4JUZ A;  1RHQ B;  4DQQ A;  2IVY A;  2FVC A;  3Q8R B;  2KH9 A;  2RUS A;  5FLX Y;  2C2Z B;  4CO5 A;  4ZJL A;  1U1L A;  2N7C A;  4HI1 A;  2XEX A;  2O67 A;  3CC4 S;  2ZHB A;  1N5Q A;  1YZ7 A;  1UZD A;  3TAN A;  2HIQ A;  5HLF A;  1BHN A;  2EFV A;  4WPA A;  5E7O B;  3GON A;  2BAN B;  3KLE A;  2XNR A;  2MQL A;  1M5K C;  1H98 A;  5CZV A;  4FBT A;  1FK9 A;  3CCT A;  4OI1 A;  4DL3 A;  2DH7 A;  3MUM P;  2JDJ A;  1Y5N B;  5U47 A;  2YH0 A;  1FEH A;  1N88 A;  3BGF A;  8RUC A;  3DGP A;  4KQZ A;  5HI7 A;  2FZC B;  2BJ1 A;  1AZS A;  3IBC B;  2C3P A;  2W9C A;  1UVM A;  4W98 A;  2ZH1 A;  4E0D A;  4ZIT A;  1PJ6 A;  3M2R B;  4ZCK A;  2XCA A;  1DY3 A;  4ZVQ B;  2GW8 A;  3WIU A;  2E44 A;  3AFG A;  1JJ2 R;  4NLY A;  3AOA A;  2LMI A;  2J8A A;  2NSC A;  4RR5 A;  3DDN A;  2BA9 A;  5K8N A;  2BR0 A;  5F9L A;  5HAT A;  5DG7 A;  2UVU A;  2MQQ A;  2RKI A;  3TAM A;  5AT1 B;  3I5B A;  4WIQ A;  3MM6 A;  4CTA A;  1WEL A;  3R5D A;  2FTR A;  1RT2 B;  3ENQ A;  3BYP A;  1NPR A;  3MMB B;  2K2P A;  2WBM A;  3NCR A;  2IM3 A;  3FEZ A;  2XMT A;  4DSI A;  1FE0 A;  4X4R A;  1FRX A;  5E3Q A;  1G6B A;  3EE3 A;  1F9E B;  1WTB A;  3DMJ A;  2F8E X;  4UQG A;  3NWG A;  4X4T A;  2H5J B;  3H8Y A;  5IZH A;  4I6A A;  3M8Y A;  3HO1 A;  2EK1 A;  2JLE A;  1QTM A;  3LP2 A;  3LWM A;  2B8Q A;  3MWB A;  2Z2M A;  4LF9 J;  4FPR A;  3I9V 9;  3OHA A;  4DSK A;  2RH3 A;  2O1P A;  4A8S A;  4ZVP B;  2X3G A;  3RAM A;  4R8U B;  5D0H A;  1CUL A;  2QTW A;  3BGU A;  2G1H A;  3PFE A;  1MML A;  3WHI A;  1UKU A;  4HH0 A;  4CLL A;  2FZK B;  2FZG B;  5HLF B;  1MWZ A;  1IVZ A;  1VBY A;  2B6A A;  1KLM A;  1LFW A;  2XCP A;  1C2P A;  3M32 A;  1VQO S;  2K1R B;  3MEG B;  1DAX A;  2HHW A;  3P96 A;  3M8R A;  1FO1 A;  1ZOT A;  1C0T A;  1VCT A;  2Z2L A;  4M5M A;  4FF2 A;  2DGU A;  4HAC B;  3QGH A;  3DGP B;  2V9W A;  2XMM A;  4NYZ A;  4XDD A;  3PYD A;  1VS3 A;  1M90 T;  3UW1 A;  1IXK A;  3UDV A;  2OPR B;  3NCP A;  3SDE B;  4LF6 J;  3SSS A;  1VLO A;  5KT6 A;  1DQ8 A;  1VQ6 S;  2D3Z A;  4LR7 A;  1GT8 A;  5IWA F;  3MR6 A;  2H1Y A;  3BKF A;  3ZTS A;  2LYV A;  3HFZ B;  3QRP A;  4DQS A;  5A6P A;  2R7W A;  2OLW A;  1YJT A;  4KGM A;  2KJW A;  5LXY A;  2GFF A;  1Q86 T;  2CFX A;  2ACM A;  4F4W A;  3KDN A;  2GHP A;  2DEI A;  4DZ6 A;  4M5J A;  4CTA B;  1VDH A;  2YKQ A;  3NCQ A;  3KLI B;  2DIV A;  1D9F A;  4ZPA A;  1BWV A;  4F4X A;  4ECS A;  4X64 F;  2UV8 G;  4ANE A;  1ICE B;  1YIT S;  3FRZ A;  3BO2 A;  3PJW A;  3QJP A;  3Q2T C;  3M6U A;  3CC7 S;  4OHY A;  3OQ2 A;  3SQG A;  3LWL A;  1M1K T;  3CUN A;  3ICL A;  2R8H A;  3PM9 A;  1WHX A;  2MHN A;  4KO0 A;  5C7P A;  1UCN A;  2OKQ A;  4H4M B;  1UW9 A;  1Q5V A;  2HGM A;  2VBW A;  3OR1 B;  2LQ9 A;  4KKO A;  1IQZ A;  3UFC X;  4HH1 A;  2LQB A;  2XO7 A;  4DX6 A;  2EBG A;  2C28 A;  3M7V A;  1MNE A;  3GIL A;  4CLK A;  2MKY A;  4PG4 A;  4IG3 B;  4X65 J;  1YRX A;  4WFB Q;  2AEF A;  2DNK A;  4LIW A;  3J7Z 5;  3D1Q A;  3RBD A;  1V3Z A;  2BM1 A;  2FVQ A;  2VJU A;  4Z7C A;  2ILZ A;  1CUL B;  4KY3 A;  2LQ5 A;  4N47 A;  2NZ4 A;  5D8H B;  1HLW A;  5GVQ A;  4IRC A;  2YNG A;  4ICL A;  1LWX A;  2B6A B;  1RBO B;  1UVN A;  1IBC B;  3NG8 A;  3S1T A;  3M32 B;  2V8P A;  3V4I B;  2J6U A;  3M8Q B;  2HHV A;  4FVM A;  3TNV A;  1YJR A;  5M2R A;  1O6X A;  2B51 A;  2KU7 A;  1SBR A;  3EZO A;  2IJR A;  2PSZ A;  5IQ6 A;  1U8W A;  2BM0 A;  4EGL A;  3FBE A;  2X1G A;  3TAP A;  4AE5 A;  1IBK F;  1I94 F;  1VC0 A;  2B5J A;  3CO0 P;  2ASL A;  2J9D A;  3W65 A;  3LW5 C;  2CG8 A;  2IMW P;  4TY8 A;  1SJ3 P;  1SIZ A;  2OD6 A;  4C11 B;  4ILR A;  2EW9 A;  2V50 A;  4ZCI A;  3MR5 A;  3UO0 A;  4OYA A;  4ER8 A;  1Y0H A;  2G2Y A;  2F63 A;  4QR2 A;  2VG7 A;  3L7P A;  4WZM A;  4IOB A;  2BYC A;  3UWT A;  3CF5 Q;  1WC6 A;  4H4K A;  3QAE A;  1R89 A;  3HSD A;  3V6D A;  4C4W A;  3L9Z A;  1YIJ S;  3LPE A;  2ZM6 J;  4QR0 A;  2QEX S;  2E5J A;  2RQK A;  1SC4 B;  4LRA A;  3OLA A;  4P2X A;  3NY0 A;  4ZJQ A;  5M2P A;  4DBQ A;  1HHT P;  5J1P A;  2ZOG A;  4GO5 X;  2XNQ A;  1IM4 A;  2DHX A;  4DUZ J;  2YBV A;  3EX7 B;  3CMA S;  1RXO B;  1NJW A;  4WYL A;  1LK7 A;  4KO0 B;  5G4D A;  1ZTT A;  4DQP A;  1FCA A;  2N7Y A;  2I5J A;  5B0G A;  1ZET A;  4KT0 C;  3Q8Q B;  5HQ8 A;  5KG3 A;  2J5A A;  4KKO B;  4PR6 A;  3R1H A;  5G0R A;  2RRB A;  4IO9 Q;  4TNO A;  2CQI A;  2O5D A;  2IA0 A;  3UCU P;  5H9E J;  4ID8 A;  1YI2 S;  2XO6 A;  4B9V A;  3M6X A;  1SB6 A;  5K5M A;  4DR4 J;  3QGP A;  1D8Y A;  4CH0 S;  1IJE B;  4ICL B;  3JTP A;  1KON A;  3VAJ A;  1VK3 A;  3KHH A;  3HT3 A;  3BV8 A;  3KLF B;  2W9A A;  4X4N A;  1VQL S;  3FQL A;  2DHS A;  2VAS A;  2HFN A;  3Q2S C;  2EG1 A;  3QT8 A;  5HMX A;  3NAH A;  5IQQ A;  4LFC F;  2HND A;  1AUS L;  4ZVG A;  3PW0 A;  1LWE A;  1Q8B A;  3DYA A;  3OSP A;  1T02 A;  4WF9 Q;  5DRK A;  4N5S A;  4X4U A;  3LTO A;  3NXZ A;  4EMD A;  1HHQ A;  2ZJP Q;  4USU A;  4J9R A;  3ILI A;  3QAU A;  5GMD A;  5KFU A;  4Y3C A;  1MU2 A;  2J6S A;  4M8L A;  4OJG A;  3CCJ S;  1BD6 A;  1Y5L B;  3OPK A;  2XHW A;  4F8R A;  2HVI A;  3NLC A;  1T05 B;  3TA2 A;  4ED4 A;  3BGR A;  3AT1 B;  3DHW C;  2VG7 B;  4KH1 B;  4PQA A;  1RHM B;  1SL0 A;  4IRD A;  2LDY A;  3GYN A;  4O4G A;  2GA7 A;  5DQH A;  1WHY A;  4MK8 A;  4CP5 A;  4RKU C;  1NDL A;  1NK5 A;  3BR8 A;  4B3R F;  2OTJ S;  4OV6 A;  4B3O A;  3QT5 A;  2C2O B;  1O8B A;  1TL1 A;  2G13 A;  4DDF A;  1U25 A;  1ZTW A;  4YN3 B;  2CJB A;  3CCZ A;  2HAI A;  4OHX A;  3DHX A;  2Z57 B;  2LFV A;  3IMQ J;  1KQF B;  5EX3 A;  2M7S A;  2MKS A;  1TV6 B;  3IBF B;  1P1L A;  3CCE S;  3ITH A;  3N6L A;  1UJ5 A;  5GAH I;  1VQ8 S;  3FCH A;  3G4S S;  4A8O A;  1S6P A;  4F7V A;  4FS2 A;  5K14 A;  2OSQ A;  3IWN C;  3NL0 A;  3RAQ A;  3W64 A;  3Q8U A;  5HBM A;  4Y28 C;  2DNO A;  1ZBT A;  2E5H A;  3A3N B;  3KNG A;  2P9E A;  3FCW A;  5L1L A;  3I96 A;  3SCK E;  1ZPV A;  3CJ0 A;  4NA3 A;  4CNY A;  2HHH F;  2QC3 A;  2V63 A;  1AT1 B;  3EGW B;  5EHH A;  1HQU A;  2KI2 A;  2DRB A;  4ZP6 A;  4FYY B;  1JLG A;  3PW5 A;  3HZG A;  3HHL B;  1QY7 A;  3K57 A;  3FFI A;  1EP4 B;  2IVM A;  5ETM A;  4I56 A;  1EIY B;  2K06 A;  3KJV B;  4IYQ A;  3OW2 R;  3OBI A;  2E66 A;  4OHZ A;  3LF0 A;  2CPI A;  2OFH X;  1NBE B;  5CCM A;  3Q8V A;  5CYM A;  5FLX U;  2F40 A;  3HHD A;  5SZT A;  3JQK A;  2CDR B;  1NK6 A;  3JTN A;  1S0N A;  3FK4 A;  4OHV A;  3PJ9 A;  2JSX A;  2IC3 A;  2IIH A;  2DGQ A;  2P5V A;  1MU2 B;  4OJ1 A;  3QYY A;  4K0K J;  4M5D A;  4LRC A;  4QU6 A;  4K4U A;  4RNN A;  1X8D A;  2QLJ B;  1GTH A;  3MMA B;  4F67 A;  4B3M J;  1EX8 A;  2J0W A;  4RW4 B;  4H4O B;  2V2Q A;  4NLT A;  1MMD A;  1K9M T;  1C1B A;  4O4G B;  2MZT A;  1UVI A;  3US5 A;  2HFU A;  1X60 A;  3ZNU A;  1U02 A;  3CC2 S;  3HX9 A;  4QW9 A;  1V5V A;  2FC8 A;  3ZZY A;  4K4X A;  2PA3 A;  3K0J A;  1UWA A;  2R7Q A;  1TFW A;  1F1B B;  3RYL A;  4EBC A;  1EB0 A;  1RWX B;  2PN6 A;  2MKJ A;  1TVR B;  1C1C A;  3TJ9 A;  5DG8 A;  1TKZ A;  2GHW A;  4CLP A;  2AJ2 A;  4ED8 A;  1HNZ J;  2C2E A;  3AA9 A;  3D9B A;  3HHK A;  2ATL A;  3RR8 A;  1H2U X;  4JI4 F;  2HIY A;  4KPC A;  4YHH J;  4OX9 J;  3PHE A;  4N76 A;  2OSR A;  1RCO B;  2PEH A;  3T9N A;  3QZ7 A;  4RL1 A;  1U1R A;  2W24 A;  2BQU A;  2MB0 B;  1KC8 T;  1VQK S;  2HNY B;  5HBM B;  2ZD1 A;  4C3K A;  2BRK A;  4AXI A;  2ACY A;  4DOZ A;  2ZH4 A;  2AGO A;  4TXS A;  4QJV A;  2OEK A;  1RSC A;  1IBM J;  3B54 A;  3PYF A;  1OSC A;  5AXL A;  4CT8 A;  4PG5 A;  4DSF A;  4NI2 A;  1H2V Z;  1UEK A;  3OLB A;  2V67 A;  5GAH U;  4B3T J;  3G87 A;  2FC9 A;  3VWS A;  2KRR A;  4I69 A;  2E9T A;  4DJB A;  1IQT A;  3DLL Q;  4K5R A;  4JI7 J;  3O44 A;  1NK7 A;  4RU9 A;  1CJV B;  2HWT A;  2C2R A;  2R7V A;  2HEK A;  2HPU A;  1DLO B;  5L8R C;  1RHR B;  5DGB A;  1IKV B;  1RU1 A;  4WBF A;  5KFC A;  4ATN A;  2W01 A;  4Y6I A;  4CYU B;  1FJG J;  1N34 J;  3HF5 A;  1IKY B;  2W2Q P;  4O0I A;  1R31 A;  4J91 A;  1KR4 A;  4O3Q A;  4XK8 C;  3GFY A;  5F9N A;  5A8W B;  3WBZ A;  4F4A A;  3TO8 A;  1CJU B;  3KNA A;  4C8K A;  5CYQ B;  4DV4 J;  3NMA A;  3VGV A;  5KAK A;  1YGY A;  3FMW A;  3K5M A;  1RTZ A;  3H20 A;  4OJH A;  4F2S A;  3VCD A;  5HMW A;  3R5A A;  1RT4 A;  5KT7 A;  4LSL A;  4CLU A;  2N3L A;  1LWC A;  4CWB A;  4JI6 J;  2MDA A;  4DXL A;  1GXL A;  3ADA C;  3VVU A;  1Y3K A;  2XI3 A;  3NAI A;  1M5O C;  4NEZ A;  4NL5 A;  4FZV A;  4U95 A;  1F2H A;  4H54 A;  4FVC A;  3GG0 A;  4Z37 A;  1TKZ B;  5LJ3 Y;  4ZLN A;  4WXW A;  2B9Y A;  2NZC A;  2CZ4 A;  3VZI A;  1U2R A;  2Z4P A;  1IN0 A;  4DR3 F;  5IT0 A;  5MAO A;  3Q8S B;  3M6V A;  1KVI A;  1VIX A;  2HWI A;  3CJ2 A;  2XSJ B;  1YWX A;  4QBU A;  4OLO A;  3NGS A;  4X4V A;  2GMH A;  3AH6 A;  3WZ0 A;  2FDN A;  1KTV A;  1UMJ A;  2HHU A;  3T41 A;  3DOL A;  4CO0 A;  3EXY A;  4M63 A;  2NXU A;  1VI7 A;  2RB7 A;  4Q0B A;  3AHP A;  1ARO P;  1XTZ A;  1GXU A;  3NBP B;  3IA0 A;  3L3C A;  1I1G A;  3C19 A;  4C97 A;  4Y00 A;  1X0P A;  2JL9 A;  1NZ8 A;  4JI0 F;  3B82 A;  1GH8 A;  5F8H A;  3LP0 B;  1NDP A;  3DCA A;  4JOU A;  1S6Q A;  3AQO A;  1HMV A;  2JJ4 D;  2FHO B;  1S57 A;  1ZAX A;  1Q8L A;  2VG5 A;  2DH9 A;  3M2U B;  4FN5 A;  3CME S;  3MPW A;  2KVI A;  4IRK A;  1RWW B;  2NLW A;  1XC9 A;  2DR6 A;  4J9M A;  1JKH A;  1RT5 B;  3MM8 A;  5DZ6 A;  2DNH A;  1K0V A;  2BVZ A;  1PJ7 A;  3T6J A;  3HCX A;  2XYG B;  3PNI A;  4NRU A;  4I2P A;  3P5B P;  4KFB B;  2H4Y B;  3IRX B;  2RU9 A;  3HJV A;  3CMQ A;  3U27 A;  2AX1 A;  5EGY A;  2LCW A;  4NCG B;  1Q4R A;  3CJS A;  3H5Y A;  2D74 B;  5K8O A;  1RLD A;  4I2Q B;  1PYT A;  1MSW D;  2I8E A;  1WG1 A;  2XZD B;  2R2T A;  3CJ3 A;  4UF4 A;  2Q3P A;  2DVI A;  2CQ0 A;  4DV7 F;  4JI8 J;  1RK8 A;  4OYM A;  4B9M A;  1UJ4 A;  2C2K B;  1JMT A;  1B7F A;  1CPZ A;  1UTA A;  1FRH A;  1YVF A;  2DR7 A;  2RVJ A;  5LMN F;  1GX5 A;  4AQY J;  4KIA A;  2F9D A;  1S9G A;  4J9K A;  2VBY A;  3M8Z A;  3OR2 A;  2RJZ A;  4DCP B;  2VZ9 A;  1REG X;  4X4O A;  5BYR A;  4O0N A;  3IXQ A;  1I51 B;  3LUY A;  4ZLP A;  1TL7 B;  1IUJ A;  3L95 X;  3W8G A;  2BE2 A;  4E2F B;  4AL6 A;  4YP3 A;  4ETX A;  5CZX A;  1XWL A;  4OZ2 A;  4QIF A;  3OTE A;  3EPG A;  3GMG A;  4PUO B;  1U48 A;  2W2N P;  3NP5 A;  2NPI A;  5J2P A;  2ZC3 A;  5CXT A;  2W1B A;  2ZBC A;  4Y2A A;  3RB3 A;  1AUD A;  3H2V E;  1NXI A;  4RW8 B;  3I56 S;  3CIM A;  5JUM A;  1NCL A;  2HFZ A;  3EXC X;  4LBH A;  4DV2 F;  3D67 A;  1UA1 A;  4URG A;  4J9U E;  3NNH A;  3W7B A;  4QPT A;  1EET B;  3I55 S;  2GX8 A;  5BXI A;  2K7K A;  2VF3 A;  3CD7 A;  2XMK A;  1URR A;  1CQM A;  3MCS A;  4URQ U;  1JLC A;  4K4W A;  2HVZ A;  3BN4 A;  2WBR A;  3QFH A;  1DTQ A;  3AB2 B;  3P6Y C;  5JMN A;  2AKW B;  2RHQ B;  2KB2 A;  1JKH B;  4L75 A;  3BDE A;  5KG5 A;  2B56 A;  1M0S A;  5BYS A;  4L74 A;  2OH2 A;  1N33 F;  2GMJ A;  3HDS A;  2CJX B;  3AAW B;  4DI6 A;  2IVF B;  2CPX A;  2DNN A;  5ETO A;  3W60 A;  2DCL A;  4JI1 J;  4I4B A;  1CLF A;  4CM2 A;  1H2T Z;  3AOB A;  4OLP A;  3DC2 A;  1TTH B;  2AIR B;  3TZX A;  3PX4 A;  1HWU A;  5EWE A;  5KFV A;  3MPU B;  3M6W A;  4NXN F;  5T7L B;  2Z2Z A;  5CH7 B;  4LF7 J;  3CO9 A;  5CYJ A;  2H54 B;  1JNZ B;  1QAI A;  2JEG A;  2DHA A;  4K5S A;  4KHM A;  4MKV A;  2DH8 A;  3CB4 A;  3OT9 A;  5JVH Q;  3D6F B;  4KGV B;  3PKY A;  3IR6 B;  5L1K A;  3ZZ0 A;  2E29 A;  1WEZ A;  2KDO A;  3QRQ A;  1LW0 A;  1EQ0 A;  4ZPV R;  2PFD A;  3D0I E;  1XEZ A;  3KLH B;  2YPY A;  5HMY A;  5B0E A;  1GFW B;  4RW9 A;  1AFI A;  4UUX A;  3HD1 A;  1RT1 B;  2RU3 A;  1OO0 B;  2QFJ A;  1WF2 A;  3FQK A;  3AD9 C;  4CIO A;  5H1S V;  3MEE B;  1OY8 A;  2ZHO A;  4ECW A;  2QGF B;  3V6K A;  4USM A;  1M1G A;  4DLG A;  5A76 A;  2X1A A;  1TL3 B;  1YRU A;  3IN5 A;  4YR2 A;  1P9Q C;  3JQM A;  4UOC A;  2HWH A;  3TUI C;  5DZ7 A;  4MTP A;  1WSV A;  3HI9 A;  1RDR A;  1RTI A;  1XBW A;  3PDN A;  4X62 F;  1KLN A;  1YQH A;  4J5O A;  3QLH A;  3I6P A;  4DX5 A;  2F4V F;  3D54 A;  1CBK A;  4NPO A;  2QMW A;  2ZH3 A;  1N5T A;  2E5I A;  4DR5 J;  4JI3 F;  8AT1 B;  1JLB B;  1LWF B;  4PXB A;  4N8O A;  3P49 B;  1DUR A;  4USW A;  2ZNZ A;  1KKH A;  3MMC B;  3DGV A;  2HNZ A;  3M05 A;  2ALZ A;  1IBL F;  1G1X A;  2AMC B;  3GII A;  2XS7 A;  3MGJ A;  2CJ9 A;  3R5C A;  3EIC A;  1X9W A;  4DS4 A;  4O23 A;  2QE5 A;  2ZZT A;  2HBQ B;  5D6G A;  1QAY A;  2HK3 A;  4P75 A;  2YXL A;  5IFM A;  3FZB A;  2Y1L B;  2QO3 A;  2A10 A;  2WW4 A;  2FB0 A;  3V5R A;  2V4J B;  2ZE2 A;  2X7I A;  2DNL A;  4HHH A;  2IBK A;  2L9W A;  1S4F A;  4F4Y A;  2B4V A;  2HAF A;  1FTR A;  3C6T A;  2V0N A;  2YH1 A;  5A0Y A;  2E7W A;  2EK6 A;  5EUH A;  2ZBQ A;  3M1V B;  3MPY A;  3MD1 A;  4ZP8 A;  3VGS A;  4DQR A;  1YBU A;  4HLB A;  1GMW A;  3JYT A;  4A8K A;  4QYR A;  3H40 A;  1RAF B;  2YQ0 A;  4DR1 F;  4LJM A;  3G86 A;  2WVC A;  3DM2 A;  3LP1 B;  4WYW A;  1E6V B;  4RNH A;  3P8B B;  2X51 A;  1HBM A;  1RT3 A;  5KFL A;  3VQS A;  2GGP B;  3MM9 A;  4NXM F;  1Q78 A;  2UUT A;  4QIE A;  2FD2 A;  3G8T A;  1YJW S;  2E1M C;  2AYM A;  3QRR A;  2VOO A;  2OAU A;  4TYA A;  1SH0 A;  4NZ0 A;  2GQ2 A;  4L73 A;  5GAE I;  2ZBP A;  4FXD A;  4KTQ A;  2EFN A;  2WVF A;  3BS9 A;  3PW7 A;  5KT2 A;  2V69 A;  4DUT A;  3IO1 A;  4MFB B;  4OZ1 A;  1S79 A;  3D4J A;  5KFE A;  2Z2Y B;  4WP8 A;  3H2U B;  5KFJ A;  1N5Y A;  1KQS R;  1QTN B;  1TZ0 A;  2ZKU A;  2IHR 1;  1VR6 A;  2LLZ A;  3CED A;  2E1P A;  5IV4 A;  1H3D A;  4ED5 A;  2MYF A;  4USV A;  2MQP A;  1F9H A;  2W4P A;  3IWX A;  3I0R B;  3CJT A;  5HMZ A;  3IS9 A;  2CPJ A;  1SJ1 A;  2KFY A;  4HKQ A;  2VQE F;  4ZS6 A;  4WK1 A;  1UZH A;  5AJ3 F;  2V34 A;  1RWK B;  2WHO A;  1SI9 A;  4AYB D;  1KHV A;  1J5E F;  1VRU A;  2QN6 B;  5B0F A;  4HDG A;  1S9E A;  4NLS A;  9RUB A;  2PT0 A;  1LXJ A;  1TAU A;  1A0O B;  2W4D A;  2CQC A;  1VQY A;  4USH A;  4X4S A;  2ZFH A;  2UU9 F;  2EBE A;  4NA2 A;  4I64 A;  1TMJ A;  3DOK B;  3NS6 A;  5B08 A;  3RW7 A;  3OXF A;  4DX8 H;  3U02 A;  2OEL A;  4KGZ B;  3UD5 A;  3NGU A;  4OQJ A;  2GAH C;  2RDI A;  2UXC F;  2JEI A;  5E3R A;  2VG6 B;  2HFS A;  4DL4 A;  5BYQ A;  3OTC A;  2C2D A;  3ZXW A;  3HZE A;  3GV8 B;  3VAK A;  5A0Y B;  4NLV A;  1JJ4 A;  3Q86 A;  3G71 S;  1ACM B;  3WQP A;  4PPZ A;  2M4M A;  1ELO A;  4M5L A;  2WB1 D;  3P5T L;  1Y9O A;  2MXY A;  1KNZ A;  4NA1 A;  1WI8 A;  4C3M A;  5D3G A;  4USI A;  4A48 A;  4C8O A;  3T5L A;  1K1S A;  1EZZ B;  1ZA1 B;  2KXH A;  2CZ9 A;  3CDA A;  4LQ9 A;  2KYX A;  3UN2 A;  2R2R A;  4ECX A;  1FES A;  3D2W A;  4DR6 F;  1T9U A;  4CO1 A;  2BQR A;  4DV5 F;  3J81 Y;  5IWA J;  4ZHR A;  1REV A;  5KG2 A;  2N82 B;  3C15 B;  2RDJ A;  2DK2 A;  2D3O R;  4KSE B;  2WCX A;  5LSL A;  2BMB A;  2ZH7 A;  2R8J A;  4IQX A;  1W2I A;  3EGN A;  1HHS A;  3OXG A;  3E3X A;  2R2U A;  3CDU A;  5GAE U;  4C8Y A;  1H0H B;  2VFU A;  4KBI A;  5FDL A;  2WSF C;  4F3Q A;  4X64 J;  4L76 A;  3ISN C;  2OPP A;  2FUG 9;  1WC5 A;  4OZ3 A;  4DN0 A;  1U45 A;  2W9B A;  1HNI A;  3EVO A;  2DY9 A;  4P2M A;  1VRU B;  4OYW A;  4DL5 A;  3CCV S;  1UVJ A;  1HBN B;  4IG0 A;  5C42 A;  3H4D A;  3H2L A;  1J27 A;  3SBM A;  2NR0 A;  2E9R X;  4QR1 A;  3SCI E;  3GV5 B;  2XZW A;  4JB8 B;  1D1U A;  1B7Y B;  1RYR A;  4GO7 X;  3U1M A;  3C14 A;  1ZZN A;  2NUH A;  1WNE A;  3MCN A;  3BGO P;  3VAG A;  5HRO A;  2IJF A;  3MR3 A;  4KHR A;  2VA2 A;  5F8N A;  3NEK A;  1U26 A;  2PD1 A;  1APS A;  1RHU B;  4NZ6 A;  2EFP A;  2YKA A;  3DLE B;  3QSY B;  3EVM A;  1UP1 A;  1XJW B;  3PRB A;  1JIH A;  4A47 A;  1R0C B;  3S01 A;  2G0J A;  4IH6 A;  1IBK J;  1I94 J;  2XTJ P;  4PXE A;  1VLY A;  1SV5 B;  3I4P A;  4TU7 A;  1FJ7 A;  4TVA B;  2DYA A;  4NLX A;  2MLZ A;  3K5N A;  4ZHR B;  2C3Y A;  1ZZF A;  2KXN B;  1REV B;  3CD6 S;  4FNI A;  1OY6 A;  4PWD B;  1FDA A;  2SXL A;  1U7L A;  1MWY A;  4PCQ A;  1FXD A;  3HXM A;  1SPB P;  3KK1 B;  1FD2 A;  1DFD A;  1NME B;  4J90 A;  4YB6 A;  2E9Z A;  2DNY A;  2RNE A;  3T5K A;  1FNX H;  5DG9 A;  1URN A;  1JLE A;  4EU0 A;  2KVQ E;  1R6V A;  1VMB A;  2U2F A;  1IKX A;  4CDI A;  3THT A;  5D0E A;  4YME A;  2WAQ D;  2OPQ A;  4Y2I A;  4D3H A;  1I6J A;  5B0D A;  2L3M A;  3TZY A;  5LMU F;  5LJ5 Y;  4Q8F A;  2MQO A;  1HI0 P;  1X9M A;  1OQ3 A;  2EKN A;  3PRD A;  1FKP A;  2HSE B;  1GK8 A;  4X84 A;  4AT1 B;  4R5P A;  3PW2 A;  4PYD A;  5ADZ A;  3CCW A;  1BXN A;  1RT6 A;  4QQB A;  1U0H B;  4QYZ K;  3ILL A;  2CPF A;  2HHT A;  1T7P A;  4GC6 A;  1RAA B;  1UPM B;  3SFU A;  4ED3 A;  3SQO P;  2J7W A;  2UXB F;  2DNM A;  1RLC L;  5HRO B;  1S1T B;  2B4O A;  3BM7 A;  4WKY A;  5DDP C;  2RF2 A;  4O3O A;  3AD7 C;  2LXU A;  2VKZ G;  4ZVR B;  1YKW A;  3KG4 A;  2GIQ A;  5F0U A;  1VK8 A;  4DCJ B;  5D4L A;  1YHQ S;  1U1P A;  5DDR C;  1RI7 A;  2G2O A;  3KKF A;  2M9K A;  3DI6 A;  2DGT A;  1WDT A;  3GJS B;  3ETM A;  2COL A;  3W2V A;  1E6Y B;  4TLQ A;  4LFC J;  3MF5 A;  5E33 A;  1FKA F;  1BLU A;  1S99 A;  2CQH A;  3I5C A;  3Q83 A;  4B9N A;  4OMF G;  1GQE A;  2EKY A;  4Q7A A;  4U7C A;  3FBB A;  2VFR A;  2CIM A;  1NJY A;  1HPZ A;  2WON A;  4O44 B;  4J37 A;  2KN4 A;  1B4S A;  2EC0 A;  4PRF A;  5KT3 A;  1CC7 A;  4S0M A;  5DM6 Q;  4U9R A;  5D4O A;  3IG1 A;  1T11 A;  4WFY A;  4NLR A;  3RRH A;  3PIP Q;  2Q43 A;  4DCO B;  2JEF A;  3W5Y A;  3WIV A;  2XHC A;  1EAR A;  2BX6 A;  2DRA A;  4C48 A;  3UVJ A;  1RZM A;  1K1Q A;  3THP A;  5ETK A;  4K2J A;  2LU1 A;  4B3R J;  4ECR A;  3UCZ P;  1CVJ A;  3T5H A;  1FJC A;  2YY3 A;  3IP0 A;  4KHP F;  2FY1 A;  3OVA A;  2ZH8 A;  3H0P A;  3Q8Y A;  4QU7 A;  1WI6 A;  4KV8 A;  1NHV A;  4DL6 A;  5HP1 B;  2FHK A;  4K50 A;  3AXM A;  1T03 B;  2DPI A;  2DGS A;  2CQ4 A;  3M8S A;  5DGA A;  4RZR A;  2B9E A;  3T6B A;  5CAA A;  4QZV B;  1T8E A;  1RT6 B;  2PMW A;  3H25 A;  2CNO B;  1HKA A;  5J2M A;  2LXI A;  5F8I A;  4OYI A;  3G6X A;  1MWQ A;  3P4U B;  2GQQ A;  2Q6C A;  1X4G A;  4ZPT R;  2R7T A;  2AX0 A;  5BJR A;  1FER A;  4YEA A;  2HHH J;  3TA0 A;  5KOX A;  1S1V A;  3TRG A;  1L3U A;  3VTI A;  2XI2 A;  3KK3 A;  2QYG A;  1HW9 A;  4C8Z A;  1FDN A;  4USJ C;  2QLW A;  1FRK A;  1YK9 A;  2HRT A;  1EKR A;  5AE3 A;  2F65 A;  2WW8 A;  2J8S A;  3D1O A;  3RZA A;  3RR7 A;  4PYA A;  1R8C A;  3ZNJ 1;  3CVK A;  4JV1 A;  4L6V 3;  1NO8 A;  4RU2 A;  1HA1 A;  2V6A A;  1R8H A;  3QGG A;  2R42 A;  4CZC A;  1N6Q B;  3KJN B;  3OJU A;  2VOD A;  4MIW A;  4BC7 A;  4M95 A;  1T9T A;  2EFQ A;  3AB4 B;  4DF8 A;  2ZKT A;  4ALZ A;  4Y2M A;  5KFB A;  3O2I A;  2B7B B;  2ASD A;  4OI4 A;  1NPK A;  5A8R A;  1J5O B;  2PFF B;  1Z2L A;  2IRU A;  1N0V C;  2HBZ B;  3OUY A;  3VAH A;  2OTL S;  4HI2 A;  4RBV A;  4GKK F;  1HNW F;  1HYS A;  1RBL A;  1QD1 A;  4ID5 B;  1KFS A;  2HW3 A;  2CJK A;  3UI3 A;  3O8W A;  3QNW B;  1S1X B;  4H4K C;  1FKO A;  3KHL A;  1QE1 A;  3KJQ B;  2FHJ A;  2HQC A;  3I0S A;  4Q44 A;  2MQ8 A;  4RNF A;  3VAF A;  4WJB A;  5K8P A;  3HP6 A;  3HVA A;  3ZC4 A;  5I42 B;  2DGO A;  1RKI A;  2VC1 A;  4EZ6 A;  4K7Q A;  2ZJR Q;  2R7O A;  2MPU A;  3MCM A;  4EYH B;  3B4D A;  4QPX A;  1XR5 A;  2GCF A;  4M5K A;  2W8K A;  3G2X A;  4QIV A;  1Q8K A;  4QIW D;  3LGH A;  2PMZ D;  3MPD A;  2B9X A;  3M9O B;  1N8R T;  4XO0 A;  2YWW A;  5CHC B;  4JI4 J;  1YJ7 A;  2MQM A;  3PJX A;  2GML A;  2UXD F;  2Y1J A;  1VQN S;  4CO2 A;  1C0U B;  1SUQ B;  2OEJ A;  2H9Z A;  4TN2 A;  5IS2 A;  3N9U C;  2A1B A;  1CJK B;  2XUL A;  5MLC V;  3AJ2 A;  4DX7 A;  2WSC C;  3D1H A;  1Q5Y A;  2W8L A;  3M4X A;  5LT5 A;  2YWG A;  2B7C B;  3KG0 A;  1JJC B;  2Q66 A;  2CQB A;  2OI2 A;  4J9V A;  1FDB A;  3RAX A;  5FII A;  1QSY A;  3PIO Q;  2CPD A;  2HHP A;  4LF8 F;  5F3Z A;  1H73 A;  4LT6 A;  2L41 A;  2DNZ A;  2Z30 B;  1P27 B;  1PBU A;  3RUB L;  5HVH A;  4M5G A;  3MMB A;  1FT8 A;  2QL9 B;  3W9I A;  3UNY A;  1PAE X;  4LF5 F;  1P8G A;  2VQF F;  2GJI A;  4DV6 F;  3GIR A;  1RHJ B;  2JRS A;  3PCO B;  4LSN B;  5GAD I;  1XIQ A;  4OI0 A;  1NPP A;  2CJQ A;  3UR0 A;  2XSF A;  3K5L A;  2VKR A;  2ZWO A;  4ED2 A;  1NKE A;  3OTD A;  5A8R B;  2LEA A;  4RO0 A;  3R2D J;  5L38 A;  3CJ5 A;  1RT7 A;  2FQQ B;  1LKZ A;  2Y0S D;  1G4C A;  1WC3 A;  1VQ9 S;  1HYS B;  2AYG A;  3CXC R;  3H7H B;  4CLZ A;  3W3S A;  4R8U A;  1FKO B;  2MY8 A;  4BS2 A;  5J2Q A;  1QE1 B;  5B0B A;  1S49 A;  3B8H A;  3F73 A;  3I0S B;  2M88 A;  3D6T B;  1D09 B;  2HMI B;  1SKU B;  1B64 A;  3K2Y A;  2RIJ A;  4PWU A;  3O3L A;  1F2G A;  2QLX A;  1PO6 A;  3PO5 A;  5LM7 E;  3QT7 A;  2R9L A;  2K1R A;  3MEG A;  1U1Q A;  3HMJ G;  3DKD A;  4HAC A;  3J81 U;  4YOE A;  3SV3 A;  3ZTO A;  3B6B A;  1OQ6 A;  4G1Q A;  3HFV A;  4DV0 F;  1HWL A;  4ED6 A;  2BXJ A;  2GHV C;  2OPR A;  4WU3 A;  5C5J A;  3SDE A;  4DR3 J;  4NLP A;  2Z8Q A;  3UQS A;  2BZ2 A;  4U7U K;  1T3N A;  4FBU A;  3C6U B;  1WOS A;  4Q2L A;  1NZA A;  3IBW A;  4WTY A;  1RWM B;  3QID A;  5E41 A;  3I5A A;  3ET6 B;  3NOC A;  1YJV A;  1R6Y A;  2VL1 A;  2HQD A;  4JI0 J;  2YNH B;  4ZLL A;  3C46 A;  1VIO A;  4CLS A;  1AFJ A;  2ZIT A;  3KLI A;  4ECY A;  7FD1 A;  4IUF A;  4B9L A;  4UT4 A;  3DNC A;  2HQG A;  5KG1 A;  2BRL A;  2JEJ A;  1MMN A;  1UPP A;  1X5S A;  3JXO A;  3DDI A;  1LFP A;  3BQ2 A;  3TX8 A;  1F60 B;  3POT B;  3BN7 A;  3BJY A;  2W2O P;  4IFY A;  1R0A B;  1RYS A;  2J0S D;  4KB7 A;  4H4M A;  1Q8I A;  2ZH5 A;  3T1H F;  3FZ2 A;  4A8F A;  4J9P A;  3UN5 A;  2FJB B;  4MIB A;  1G7C B;  2Z56 B;  3N5B A;  1T0T V;  3OR1 A;  1OPZ A;  4B02 A;  1RT7 B;  1S12 A;  3FSI A;  2I2Y A;  2G0C A;  4JI2 F;  3N4W A;  1W2B R;  3EJM A;  2JVO A;  4IG3 A;  3OVS A;  4OZL A;  3EGV A;  2DCU B;  2DY1 A;  4WFA Q;  1PC4 A;  5J2Q B;  4IR9 A;  1B0P A;  3GR0 A;  1RE1 B;  3DRR B;  2ZC4 A;  2BEF A;  3CDE A;  2CJA A;  2KRB A;  5A2Q Y;  1ROF A;  4JP8 A;  4NLO A;  4WFN Q;  1VJQ A;  1GXT A;  1HR0 F;  1Z4U A;  4WKR A;  1XNQ F;  4AUK A;  2IMO A;  3FBF A;  3T1A A;  2FVP A;  1TKX B;  4DV7 J;  3V4I A;  4W92 B;  2HHX A;  5KFW A;  3M8Q A;  2XYH B;  1IWG A;  1KOO A;  3GB0 A;  3BKT A;  2VIH A;  2C22 A;  4ZN1 A;  5LMN J;  4G1Q B;  2KJV A;  3DU6 A;  4C7Q A;  2BJ7 A;  5M2U A;  2CAD A;  1FD8 A;  4DV3 F;  3BBB A;  5EWG A;  5KFD A;  4AFF A;  1FF2 A;  4K2X A;  1NEE A;  1JXV A;  2RQC A;  2E1R A;  3AJ1 A;  4P72 A;  1M5V C;  2B8P A;  1L3V A;  2JFD A;  4UW2 A;  1YZ6 A;  2LU2 A;  4C11 A;  1SQF A;  3NGR A;  1NK4 A;  5C24 A;  3K17 A;  1ZA2 B;  3GQC A;  1NSP A;  2BKP A;  1RTH B;  2XS5 A;  2DO4 A;  3X1L B;  2AYB A;  1C4C A;  4MJK A;  4XDC A;  5DDQ C;  4ENO A;  2ADC A;  2OGU A;  4OYX A;  2J7K A;  1HBO B;  4DV2 J;  2V4Q A;  3KDO A;  4LRD A;  2FLL A;  2Z0G A;  2MZJ A;  2GJF A;  5DDO C;  2HGN A;  4NOH A;  1YX2 A;  2QT7 A;  5KFZ A;  1U49 A;  3MM7 B;  1B3T A;  3CCQ S;  3M30 B;  3UDC A;  3VAL A;  2FGC A;  2P6T A;  3CDB A;  1QM9 A;  1KD1 T;  4P2S A;  1RA6 A;  1Q7Y T;  2IM2 A;  1WG5 A;  5AE1 A;  3FKB A;  4O3R A;  4IFY B;  3N01 A;  2XMA A;  3SXL A;  4RUH A;  2NYH A;  4MKY A;  2D7S A;  1YJN S;  1X5T A;  5LL6 d;  3HVR A;  1N33 J;  2Y3Y A;  4LRE A;  2MZR A;  3QFW A;  3H42 A;  5HK4 A;  2IFX A;  3RB4 A;  3VZH A;  3N6N A;  1SL1 A;  3PFO A;  2R4F A;  1VHI A;  2DTJ A;  4DL2 A;  1SC3 B;  3Q23 A;  2IPO B;  1X0F A;  3K5P A;  2FY8 A;  2KXF A;  2AD9 A;  4OYO A;  5KFG A;  4NXN J;  4LQ3 A;  2ZJQ Q;  1TKT B;  4XPE A;  3D3C J;  2CPE A;  4P73 A;  3ETO A;  3KMS A;  3HSJ A;  2OIH A;  1ITP A;  3SFG A;  2XGP A;  2QMX A;  5BR8 F;  3V81 B;  3ILO A;  3KLF A;  2L9D A;  5H9F K;  2OUG A;  2GVZ B;  5HVF A;  5KFY A;  3GCX P;  3KHG A;  1NDK A;  1RU2 A;  2FGO A;  1H72 C;  3BGL A;  3CCM S;  1VQ4 S;  1GAO A;  4IR1 A;  1X4D A;  4P7T A;  3OXL A;  2QG9 B;  2M70 A;  4G3I A;  1R43 A;  4MK7 A;  4ZJO A;  3IFE A;  4WZQ A;  4DSE A;  5HAN A;  2E7V A;  3HFK A;  3SCL E;  1KFD A;  2F7V A;  4W4M A;  2ASY A;  3I4H X;  5C24 B;  2HLT A;  4N77 A;  4ZPW R;  2IRY A;  1T05 A;  3BH7 B;  2CNN B;  2MKC A;  2CQD A;  2P9C A;  3BR9 A;  2ZH2 A;  4OX7 A;  3Q8P B;  5HQM A;  3PYE A;  1PG5 B;  2DIS A;  4X62 J;  2NQP A;  4DQI A;  1Q95 G;  3CPW R;  4M5N A;  2F4V J;  1SJR A;  2IAJ B;  4U67 Q;  2H48 B;  5LSO A;  4WFZ A;  4NYP A;  3QWU A;  2BE7 D;  4IO1 A;  1KOH A;  4JI3 J;  2CQG A;  2M2B A;  4YFU A;  1QSL A;  1FE4 A;  3NS7 B;  1IBL J;  1BQM A;  1A9N B;  1VBK A;  2O66 A;  1HQ2 A;  1TV6 A;  3LOU A;  4FP9 A;  2Y8W A;  3TWZ A;  4LF4 F;  1TUW A;  2HS4 A;  1BC6 A;  2HQ3 A;  3O5T B;  2K3I A;  5KG6 A;  2IY5 B;  4HT7 A;  1Q82 T;  1S7I A;  2LEB A;  2OD4 A;  3DLG B;  1NSA A;  1TQL A;  2UUA F;  4LBI A;  1QUV A;  2VPY B;  2VPW B;  1Q81 T;  2WTF A;  1NB2 A;  1RWN B;  2B4P A;  2JOQ A;  3JB9 k;  3W9J A;  2V9K A;  4LIR A;  3BEG B;  5EWF A;  5J1E B;  3HHL A;  3K89 A;  4EK2 A;  3V6H A;  3EM1 A;  1EP4 A;  1UVL A;  2MHE A;  3DLK A;  3KJV A;  4DR1 J;  2D69 A;  3KUG A;  3BPD A;  1RAG B;  2MJN A;  2PGC A;  4B9U A;  1WWH A;  1IM6 A;  3EZU A;  1FNM A;  3MUR P;  2CVE A;  1X7V A;  4NE9 C;  1LEO A;  3PG9 A;  4NXM J;  3X3U A;  4UOF A;  3J7Z T;  2M5Y A;  2ZDP A;  3NKY A;  1ZPW X;  3FSX A;  1T95 A;  1PIE A;  3I32 A;  3T1Y F;  3G96 A;  3W2W A;  2XMW A;  3OFG A;  3SI8 A;  3MM5 B;  4OJ3 A;  2H3E B;  2UUB F;  3LPY A;  3ENV A;  3VGU A;  3JSM B;  2Z58 B;  2VBX A;  2A0F B;  4OYP A;  2XWX A;  5KFF A;  3MMA A;  4C8L A;  2MLX A;  1L3T A;  3QO9 B;  1B0T A;  4RW4 A;  4H4O A;  4MIA A;  3VGT A;  4DL0 C;  1UVK A;  1QUP A;  1UWB B;  2YX4 A;  3M8P B;  3J7Y I;  4CLF A;  1L3K A;  3EDQ B;  2Q6B A;  1H74 A;  2VPX B;  2VQE J;  1NJZ A;  5AJ3 J;  1TVR A;  6FD1 A;  1J5E J;  2F4F A;  3MEK A;  2L48 A;  2YWH A;  4DEZ A;  2MGZ B;  5J2N B;  2AU0 A;  1Y10 A;  2AF6 A;  4XTT A;  1HW8 A;  1JLQ B;  1HWK A;  1BQM B;  2YKN B;  2KYZ A;  4KR0 B;  2XY5 A;  2LP4 A;  1SQE A;  1HQE A;  4F25 A;  1DTT B;  2CG4 A;  1NH8 A;  1HI1 A;  4KH0 B;  2UU9 J;  4CQ1 A;  2CDQ A;  4DU7 A;  2HVH A;  4ECZ A;  2J0Q D;  2AZ3 A;  3JAM Y;  4DR2 F;  3R9L A;  2CJY B;  4DMZ A;  2HNY A;  2HGL A;  4K4T A;  1S59 A;  3OV7 A;  2UXC J;  2VJV A;  5DJB A;  5I3Q A;  3GPA A;  3PX0 A;  1VQ5 S;  2P2C B;  3DRX A;  5DM7 Q;  4FS1 A;  4DV1 F;  5CD4 H;  2AJQ A;  1JX4 A;  3WX8 A;  1HNX F;  3AOD A;  4OZ5 A;  3R5G A;  2MZS A;  3TZW A;  3DLK B;  1YG0 A;  1RB0 A;  3HHE A;  5KFT A;  3HVW A;  3RB6 A;  1VGY A;  4ELT A;  1XNR F;  1CJV A;  1D9D A;  1SC1 B;  4HHJ A;  3TQE A;  1NH7 A;  3KG1 A;  1DLO A;  3PYG A;  3MTK A;  1IKV A;  3MOZ A;  2HHS A;  2PO4 A;  2VA3 A;  5F8G A;  1LW2 A;  1X4B A;  1R7I A;  5E5N A;  2E7X A;  2JC0 A;  1WHW A;  3W2W B;  4KAI A;  4DR6 J;  4CYU A;  2A6M A;  4DV5 J;  2YVS A;  5A8K B;  1IKY A;  4M5H A;  1FA0 A;  1VC6 A;  5A8W A;  1QSS A;  1M5P C;  1CJU A;  1JXL A;  5CYQ A;  4ZVU B;  3OFF A;  4OZN A;  5F41 A;  3CCR S;  3G8Q A;  2KZZ A;  3OL8 A;  1Y11 A;  3PEJ A;  1LQ9 A;  4CO4 A;  1D8Z A;  5CD4 A;  2F8H A;  1HFE L;  1WKL A;  3Q22 A;  2GO8 A;  2DXD A;  1FX2 A;  3EGZ A;  1H7X A;  1KS2 A;  3DOM A;  4GKJ F;  2F9J A;  2DXF A;  3M9N B;  2ZH6 A;  1HQE B;  2I0X A;  2OP5 A;  5DLG A;  5I3U B;  3J7Y U;  1CSJ A;  2G1D A;  2GJ2 A;  1XMQ F;  2XSJ A;  1F5B A;  2CPY A;  5C2C A;  2CPZ A;  2J7U A;  1FWL A;  2XS2 A;  1T9X A;  4QWB A;  2G0I A;  1S0O A;  2BAC A;  4BC9 A;  3D68 A;  2CQ2 A;  3NBP A;  2LA6 A;  4X66 F;  5FJ4 A;  1UAW A;  2LQJ A;  5HJX A;  5AE2 A;  1WTF A;  2CQ3 A;  3LP0 A;  4UTG A;  1J2V A;  2V2Z A;  5AXN A;  3R27 A;  5I4M A;  4FF1 A;  5F8J A;  2VB6 A;  3GG1 A;  2VOP A;  1EAY C;  1TKD A;  6FDR A;  2CAJ A;  3N0V A;  1M5H A;  2E1C A;  3M2U A;  4Y34 A;  3MPV A;  3DRS B;  1VOM A;  1PYO B;  3K58 A;  3CWJ A;  4KRW A;  2QA4 G;  4YY3 F;  2X1F A;  3ZTR A;  2M3D A;  1LW2 B;  3CJK A;  4LUB A;  1RT5 A;  1S0V A;  4MKA A;  3BRE A;  3EUN A;  3D7S B;  4HDH A;  4K8R A;  1HNV A;  5A2Q U;  4B3S F;  4K4V A;  4ELV A;  1VIS A;  4P2F A;  4KFB A;  5B0A A;  5SUH A;  4U6P A;  3IRX A;  4X4Q A;  4Q2M A;  2K7J A;  4RPF A;  1PSD A;  4MYU A;  1I5O B;  3OTO F;  3KUE A;  4NCG A;  4ECU A;  4L3N A;  1YTY A;  4ZPC A;  4ED7 A;  3AXK A;  4URS A;  2FJV A;  3KLG B;  1L3S A;  4CCH A;  2IYG A;  1Q1K A;  2BJD A;  4YDD B;  4I2Q A;  3LAN A;  4Q43 A;  3Q24 A;  4JYA F;  2XYP B;  2HS0 A;  2C3M A;  2YKM B;  2EG2 A;  1DAR A;  5CCL A;  2YTC A;  2RML A;  3A3P B;  1CJT B;  1MRO B;  5LMU J;  2V94 A;  2PI5 A;  3MEC B;  4PQU B;  3DOM B;  2BOP A;  5A6W A;  1TK8 A;  3GSI A;  3DRP B;  4EBD A;  4F3O A;  4ED0 A;  2NCK L;  2DHG A;  4R25 A;  4DPX A;  2NPF A;  2QLB B;  2WOM B;  4Q45 A;  1VRT A;  1YSJ A;  4BLG A;  1R8A A;  1TL7 A;  2V2V A;  2DNR A;  4FNH A;  3LAM A;  2LKZ A;  2W2P P;  2X3D A;  1F5A A;  2MEW A;  2E5L F;  3DXB A;  2HLU A;  1T94 A;  4PUO A;  5KFP A;  5C25 B;  1K73 T;  5IT4 A;  4DHV A;  2UXB J;  2DGW A;  5GMK a;  2BAB A;  3MR2 A;  4NLQ A;  3MI7 X;  2D3O 1;  3TVK A;  4RW7 A;  2CPH A;  2ZVS A;  3D5M A;  4RW8 A;  4ECQ A;  4ZKA A;  4XIU A;  4AXJ A;  4EBE A;  3MFI A;  3DXS X;  3TAR A;  1TL4 A;  3I31 A;  3FGV A;  1EET A;  2V8G A;  1HBU B;  2C3O A;  1XMB A;  3MTJ A;  2QLF B;  2YNI B;  1U24 A;  4P10 A;  2CUY A;  4UZC A;  1S1U B;  1U1N A;  3CD0 A;  4I0W A;  3AA8 A;  1EHW A;  4FKY A;  2ZNY A;  4KYZ A;  4GVL A;  4ZOS A;  2EFO A;  3CJK B;  1U1M A;  2Y0B B;  1TEL A;  1TK5 A;  1X9S A;  1W25 A;  1YJ9 S;  3HKZ D;  3G82 A;  1FWK A;  2QYC A;  4PZV A;  2ZOF A;  1HNV B;  1XMO F;  5HL7 Q;  4J9N A;  3WC0 A;  3FEY B;  4CI0 B;  1QLN A;  4YUD A;  1A7G E;  2NXE A;  3UNG C;  1U6Z A;  4KC5 A;  1BGX T;  2CKW A;  4UZB A;  3FNN A;  3DU5 A;  2Y1I A;  5E3C A;  5T7L A;  4NEY A;  2W25 A;  1RAO A;  2HK2 A;  3UN3 A;  1X31 C;  2ALY B;  5ETR A;  3KLE B;  1IWA A;  3R2C J;  4U96 A;  3CCS S;  1M5S A;  4Z2X A;  1F3F A;  1FK9 B;  2I38 A;  4YR0 A;  4KHP J;  4RWX A;  3L09 A;  3E01 A;  1PAU B;  1RAJ A;  4DUY F;  2ZH9 A;  4RNO A;  3KLH A;  3QWP A;  1AZS B;  3R6G B;  3A8I A;  2W9C B;  1S6O A;  4ZVF A;  4IDK A;  1RT1 A;  2DT9 A;  2FJE B;  4LSZ B;  3JS9 A;  3HHN B;  1Q16 B;  2ZVI A;  3RBE A;  3C16 A;  1VRT B;  3IWL A;  1NK9 A;  3NWR A;  2R3V A;  2XWY A;  1LXN A;  3MEE A;  8ATC B;  1S6U A;  1Y7P A;  1IR0 A;  2N3O A;  5LOQ A;  3HUL A;  4ITS A;  3UE2 A;  1CQN A;  1TL3 A;  1YJU A;  3IRW P;  1OYD A;  2CWX A;  2EFG A;  4NWB A;  3R8Y A;  5IT9 Y;  4ZMM A;  1SVD A;  2XLK A;  2GIF A;  1NHK L;  1NRK A;  2A2C A;  2MTL A;  3H5X A;  3LAK A;  4RW7 B;  2RKI B;  3TAM B;  1AYE A;  4NLG A;  5KFM A;  5ETV A;  2QIF A;  3NNC A;  3MM6 B;  2BQ3 A;  1WKJ A;  4DZD A;  1UEU A;  1X4F A;  1V5I B;  3GIM A;  4M1K A;  4U7U D;  5KFR A;  3CD5 A;  4GVB A;  4FXV A;  2WZ1 A;  3QJL A;  1GNK A;  1FNO A;  4OI2 A;  1JLB A;  4LVN P;  3SZ2 A;  1H38 A;  3J80 Y;  1LWF A;  2FPH X;  4MKB A;  3MMC A;  3T5J A;  1A6L A;  4A4J A;  5ETN A;  4TQS A;  5HVG A;  1VQP S;  1H7W A;  1F9F A;  1QJH A;  4MYT A;  2BE9 B;  2HYI B;  3DMJ B;  4DU8 A;  4DPT A;  1UFK A;  4LF2 A;  2W2M P;  3G82 B;  3LP2 B;  2ADB A;  4GKK J;  1T9V A;  1HNW J;  1U47 A;  1F6T A;  1KN6 A;  3DN9 A;  1QAJ A;  2V4J A;  3C3L A;  4OI6 A;  5KFS A;  5B7W A;  1OMS A;  3JQJ A;  4F02 A;  2FJX A;  1YBA A;  3RB0 A;  1DHM A;  4EYI B;  3M1V A;  1TK0 A;  1S77 D;  3D28 A;  4CLY A;  5GAG I;  3S8S A;  1KLM B;  1OYE A;  1WAC A;  1QVF R;  3WX4 A;  3BO3 A;  1VRQ C;  3GU0 A;  1BY9 A;  2HVD A;  1C0T B;  3LP1 A;  3MZI A;  2AT1 B;  1E6V A;  3H59 A;  3PVX A;  3ISZ A;  3E01 B;  3D66 A;  2LVW A;  3FBC A;  2AQ4 A;  4ILM A;  2GGP A;  2IM1 A;  3ELH A;  3NNA A;  4IDK B;  1O5J A;  2DNG A;  3CCL S;  1N48 A;  4LFA F;  3M2V A;  2UXD J;  1U1O A;  3N28 A;  3A8K A;  3C16 B;  2J0X A;  1BE4 A;  2OPS A;  4MFB A;  4OZJ A;  3BF4 A;  3IR5 B;  4DFP A;  2QZ8 A;  1MW7 A;  1WC0 A;  1L5U A;  2YQ1 A;  1MG7 A;  4NML A;  3HM9 A;  5IXU A;  2C42 A;  2PI4 A;  2MQN A;  2UV8 A;  4LF8 J;  3UDE A;  1ZYQ A;  4V19 X;  4C2M A;  4C9D A;  1XER A;  4ZLJ A;  2DXE A;  2KG1 A;  5DET A;  1WJ9 A;  2F3J A;  3PAC A;  4FDF A;  3OL7 A;  2MKI A;  3I0R A;  2AJ0 A;  4GVB B;  4W90 B;  3J81 j;  1Y00 A;  3O6Q A;  3E51 A;  2P8I A;  4LF5 J;  3JAM U;  2Q79 A;  2VQF J;  4B9T A;  3CE8 A;  4DV6 J;  3SQG B;  4CT9 A;  3VAM A;  2HQF A;  3R7N B;  2B3T B;  3UD3 P;  3UPF A;  1HWJ A;  1AXQ A;  3OTB A;  2Q1L A;  2XMV A;  3OSN A;  1N4L A;  2LQ8 A;  4ZVE A;  1RQ0 A;  3DOK A;  4DPU A;  4EZ9 A;  4P74 A;  4YR3 A;  3F44 A;  2ZZN A;  1NAQ A;  2HUR A;  3VR1 A;  4GC7 A;  3ZO7 A;  4ZCM A;  2C2N A;  2VG6 A;  4G1I A;  1NU4 A;  1RAI B;  2P9G A;  1SCJ B;  2DR5 A;  2BDP A;  4TU8 A;  1S72 S;  2JVR A;  2UVW A;  2AW0 A;  1Y5I B;  3SMZ A;  2YNG B;  1HI8 A;  2MSS A;  2BW2 A;  4PXC A;  3T3F A;  5D0G A;  7FDR A;  4YB5 A;  2NRE A;  1Z1Z A;  4FKX A;  4I67 A;  1U1K A;  4U8Y A;  2FJD B;  4DV0 J;  2YX7 A;  4BCA A;  1HAR A;  2B5J B;  4JV5 F;  3FJ2 A;  2ROP A;  1WOR A;  3M2V B;  3DLH A;  2BJ8 A;  1ZS6 A;  1N54 B;  5JXS A;  5GAG U;  4TY8 B;  3CCU S;  2OPS B;  1ZM4 A;  2V2K A;  5HO4 A;  2QL5 B;  5IC6 B;  1GMW D;  3C15 A;  2QSF A;  3A8J A;  3IGN A;  1T9W A;  4FF3 A;  5B0C A;  4WXO A;  4F0K A;  1ZM9 A;  3VAI A;  3WC2 A;  2MZ1 A;  2KM8 B;  2W7P A;  2Y8Y A;  2EXU A;  2PE8 A;  1RHK B;  4ZN3 A;  3V6D B;  3RTV A;  2OO4 A;  5H9E K;  2XBP A;  3TYT A;  4BBY A;  1R3N A;  3IAM 9;  4X4P A;  1X4E A;  2CNL B;  4QOT A;  3E8O A;  3AQP A;  4J9L A;  1WEY A;  2KKH A;  1T3O A;  2N4C A;  1AB8 A;  2HBR B;  4WFX A;  1B99 A;  2KHD A;  4IH7 A;  1HBN A;  1UL3 A;  1FHT A;  3T1H J;  1OJ4 A;  3D0G E;  2I5J B;  1KQK A;  2XLI A;  2PDA A;  2XMJ A;  3GYG A;  3DFE A;  5D15 A;  3TZZ A;  1RAH B;  4JI2 J;  3CTR A;  2AZ1 A;  3EMT A;  1RIS A;  5G0R B;  1ZAW A;  4O3P A;  1U8S A;  3AJD A;  3FSY A;  1BQX A;  2KT2 A;  2NXN A;  5IV3 A;  1X5P A;  1WHV A;  2GC8 A;  3LGN A;  2AEJ A;  5KFQ A;  1RKJ A;  3J7A N;  2AGP A;  1W7W A;  5FD1 A;  1WF0 A;  3DLJ A;  1HR0 J;  1FVS A;  1XNQ J;  4PG6 A;  3DLE A;  1FXL A;  3QAT A;  4G65 A;  4O3N A;  3MXH P;  4ED1 A;  4HVZ A;  4I1T A;  3FEX B;  4DR7 F;  1JWW A;  3KTQ A;  2HZC A;  4RNM A;  2UUC F;  2RSQ A;  2E1A A;  4GRS A;  2UVR A;  1S10 A;  2HND B;  4YB7 A;  4USK A;  1LWE B;  4DV3 J;  3DYA B;  4DFK A;  1LOU A;  3VQT A;  3HSZ A;  3TA1 A;  1SV5 A;  2MY7 A;  3MCO A;  3S6E A;  3NGK A;  4J9S A;  1KTQ A;  2IJN A;  1FJE B;  4U8V A;  2C1E B;  3ZZO A;  3JSY A;  1FXR A;  3I87 A;  3TI0 A;  1RAB B;  3U1N A;  4PWD A;  3JTO A;  3TEH B;  4ZP9 A;  3BGR B;  3KK1 A;  3TVY A;  3TEG A;  5EDW A;  2KTQ A;  4BWM A;  2W4C A;  2VDI A;  4TY9 A;  1KRP A;  2BOA A;  2NSB A;  3A13 A;  3ZTQ A;  3OJS A;  4Y2K A;  2RIL A;  4DPY A;  2EEY A;  4J9Q A;  5IC4 B;  4N41 A;  1P6T A;  2JNJ A;  2VHG A;  3IAS 9;  2RQM A;  2V68 A;  4B3O B;  1TL1 B;  1RP5 A;  3HPO A;  2B4U A;  3THV A;  4DS5 A;  1JLF A;  1FWP A;  3W61 A;  3KK2 A;  2F5G A;  4LFB F;  1FFG B;  3ULH A;  3RGI A;  3GIJ A;  2BBE A;  3ZZZ A;  1XR7 A;  1NKB A;  2KHC A;  4UQT A;  2EPI A;  3ENW A;  3HLU A;  3FDS A;  4MK9 A;  1JXE A;  1WG4 A;  2RRN A;  2HVE A;  1PKU A;  2OHD A;  4KGK A;  3ITH B;  4YQW A;  4KJI A;  4GMK A;  2IDE A;  4DN9 A;  3B78 A;  5K8M A;  1U0H A;  3Q89 A;  4HHU A;  1S6P B;  1WOP A;  5K14 B;  4ERD A;  4N8N A;  3P3D A;  4R0J A;  2POK A;  3CDW A;  1FEE A;  2QX0 A;  2DIT A;  2OJ3 A;  1N32 F;  2VC0 A;  5KFK A;  2OMO A;  1UW4 A;  3AOC A;  5EN1 A;  4A8W A;  4DLE A;  3GLJ A;  1S1T A;  1N36 F;  2A2D A;  1HQU B;  1JLG B;  4DSJ A;  1V6H A;  1RWU A;  2ZBR A;  4AL5 A;  4HEA 9;  4ZVO B;  2QA4 S;  3GFZ A;  5BR8 J;  3FFI B;  3SSR A;  4JI5 F;  3RU0 A;  4RW6 A;  3GV7 B;  1ULR A;  5KG4 A;  4UUW A;  2RS8 A;  2QA2 A;  3KOA A;  4OHW A;  4QYZ J;  1Q7L B;  1E6Y A;  1GMV A;  4C8N A;  4IOC Q;  5K9F A;  5D77 A;  1PYS B;  5CYM B;  2UVV A;  2GV1 A;  2BV3 A;  2VV5 A;  3BDP A;  1EQM A;  2HHQ A;  3PY8 A;  3QMQ A;  4O44 A;  3R6L B;  1KWM A;  3F41 A;  1S4E A;  3PRV A;  3SV4 A;  2IC3 B;  2VBZ A;  3C2P A;  4OV1 A;  5E2Q A;  3CJ4 A;  4E98 A;  3M8W A;  3AY0 A;  1G2E A;  4M5D B;  3SYZ A;  1S76 D;  2HBY B;  3CNQ P;  3SIP B;  2KT5 A;  4P7V A;  4PWW A;  1NJX A;  2QV6 A;  1SL2 A;  4RLE A;  1C1B B;  3QSI A;  2J6T A;  5KG7 A;  1WEX A;  2G9O A;  4HL9 A;  4QW8 A;  3MAH A;  4C8M A;  2ZZM A;  4V19 J;  1M1H A;  1VHF A;  3RRG A;  1JLF B;  3KK2 B;  3NRB A;  4XPC A;  1C1C B;  4NLU A;  3EVW A;  5AXM A;  5HP1 A;  2J9C A;  5IT9 U;  1JNR B;  1T03 A;  4PAB A;  2NXC A;  3PX6 A;  3KYL A;  4LF4 J;  2DR8 A;  4WU2 A;  2I9S A;  1EKS A;  2MKH A;  1NDC A;  1FFW B;  4EI2 A;  5RUB A;  2UUA J;  2ZD1 B;  4C3L A;  4K4Y A;  2O3D A;  2M0G B;  5ETS A;  3GYX B;  1X5O A;  4JBC A;  2F1F A;  3PTW A;  5LSR A;  2OEM A;  3J80 U;  4LF1 A;  4IH5 A;  3MAQ A;  4HT5 A;  1SJF A;  1PGZ A;  2FLN A;  2QRR A;  4NI2 B;  3PXG a;  4BWJ A;  5L1J A;  1DJ0 A;  3KWM A;  1C4A A;  4RW6 B;  2IRX A;  3GR1 A;  2JZ5 A;  1PC5 A;  2VDH A;  4P71 A;  1U09 A;  3R5J B;  5ITH A;  3HSG A;  3J7A 1;  3L7O A;  2RD5 C;  4ETZ A;  4ANC A;  1N6Q A;  4I68 A;  3FRY A;  3VVT A;  1HIY A;  3G6Y A;  3BB5 A;  2R8K A;  2D9P A;  2RRA A;  2YNF A;  3T1Y J;  5KFI A;  1SIW B;  2F8M A;  3K5O A;  3BH6 B;  1RWO B;  2FLO A;  1J5O A;  3JSR A;  2UUB J;  5DQI A;  2EC2 A;  1WC4 A;  5KTQ A;  3LAL A;  4QWA A;  1U4B A;  4LF9 F;  4ID5 A;  3D6H B;  3TUP A;  3QIP A;  1AW0 A;  2HFO A;  3H4B A;  1S1X A;  2LDI A;  1X4H A;  5K20 B;  1H6K X;  2VON A;  1IKW A;  4JV2 A;  4CH7 A;  4Y0F A;  5L46 A;  3DLB A;  1UET A;  2QJ3 A;  1RT4 B;  4LSL B;  1OIA A;  2VH7 A;  1JK9 B;  1LWC B;  5I42 A;  2W7O A;  3RRK A;  5DLF A;  1P1T A;  3R5B A;  4OFZ A;  1QVG R;  4IOA Q;  4NCB A;  1NUE A;  5I3P A;  5LXR A;  3ZZT A;  3BKU A;  1G3O A;  2KT3 A;  1SQG A;  2H5E A;  3QJJ A;  5J1N A;  4DWI A;  3QBC A;  2YWK A;  1W26 A;  5JJB A;  3RW6 A;  5KFH A;  3W62 A;  4LF6 F;  1JLA A;  3DDK A;  2XM3 A;  1C0U A;  1SUQ A;  4Y65 A;  5L9N A;  4ZVH A;  1FRJ A;  2DIU A;  4OX8 A;  4DG1 A;  4DR2 J;  2DB1 A;  1WOO A;  2FJA B;  3CIZ A;  1CJK A;  1RGV A;  3MHY A;  2DEJ A;  3DOL B;  2AEM A;  4Q0B B;  4Y2C A;  3PKM A;  3CW2 C;  4MH8 A;  2A18 A;  1NND A;  3A1Y G;  2B9W A;  4DV1 J;  9ATC B;  4ZK7 M;  2VFV A;  1SH3 A;  2ROG A;  5E0O A;  3N79 A;  1HNX J;  1NLK L;  1D9A A;  4C6A A;  3IM8 A;  1S6Q B;  5F3T A;  4A8Q A;  1FX4 A;  3MED A;  4J7C A;  3S7R A;  1S1W A;  4F0M A;  1HMV B;  2AWZ A;  2HZA A;  1XNR J;  4ECT A;  4TYB A;  1HL6 A;  4Z7Y A;  4RUA A;  1KSP A;  2L9N A;  2VG5 B;  4YS2 A;  4LBP A;  1F3V A;  4LSN A;  1YRT A;  2YNF B;  2O01 C;  3CGI A;  1N56 A;  3TQ1 A;  3QT6 A;  2JFK A;  1GX6 A;  2DKO B;  4RJV A;  4Q8E A;  3MM8 B;  4WK3 A;  5ETT A;  2AJ1 A;  4NZ7 A;  3ONQ A;  3PO4 A;  3BPS P;  4JV0 A;  3UDL A;  4I2P B;  2YWE A;  3C8Y A;  2AYE A;  5JVG Q;  3QIP B;  1RWV B;  4C0H A;  4X65 F;  3PR5 B;  1RTJ A;  3KUH A;  1RBA A;  2JC1 A;  1PIL A;  1IKW B;  4FYD A;  2ASJ A;  1RWP B;  2OML A;  3KJF B;  1HD0 A;  1R8P A;  3MUV P;  2R7R A;  2HMI A;  3MDF A;  3QZ8 A;  4F4Z A;  4A46 A;  4PPD A;  2R8I A;  2VPZ B;  3G6E S;  3AD8 C;  4DFM A;  5B09 A;  2WVD A;  4K59 A;  3W5X A;  4ZCL A;  1DRZ A;  3HK2 A;  5KT4 A;  3JSB A;  2WVB A; 
#chains in the Genus database with same CATH homology
 1LWX A;  1MN7 A;  2BX6 A;  1W7W A;  3NGU A;  1NUE A;  1NHK L;  4O0N A;  4UOG A;  1BUX A;  3Q8V A;  3DKD A;  4AND A;  3DDI A;  4ANC A;  4F36 A;  3ENA A;  3FKB A;  4WBF A;  1PAE X;  4DI6 A;  2DXE A;  4ANE A;  2AZ3 A;  1BHN A;  3VVT A;  1HIY A;  3R9L A;  3ZTO A;  3B6B A;  3BBB A;  3EVW A;  3VGU A;  4KPC A;  3NGS A;  1S59 A;  1U8W A;  3Q86 A;  3L7U A;  2ZUA A;  3G2X A;  3PJ9 A;  1WKJ A;  3FBE A;  1JXV A;  1XIQ A;  3Q8Y A;  3BH6 B;  2B8P A;  3ETM A;  3GPA A;  3MPD A;  3EVM A;  3GP9 A;  3VGS A;  2HVD A;  5C7P A;  1UCN A;  4FKX A;  4F4A A;  1B99 A;  2HVE A;  1HHQ A;  1NB2 A;  1PKU A;  3BBC A;  3VGT A;  1K44 A;  3BH7 B;  3NGR A;  1F3F A;  3Q8U A;  3EE3 A;  3Q83 A;  1NSQ A;  1NDC A;  3FBC A;  3PRV A;  3VGV A;  4W98 A;  3EJM A;  1NCL A;  1NSP A;  5CAB A;  3EVO A;  1NPK A;  1XQI A;  2DY9 A;  3FC9 A;  3FCV A;  3FCW A;  3WX8 A;  3ELH A;  3Q89 A;  3FBB A;  3ZTP A;  1MN9 A;  5CAA A;  3NGT A;  1ZS6 A;  3B54 A;  2VU5 A;  1B4S A;  1NDP A;  4EK2 A;  5BXI A;  4ENO A;  4S0M A;  1WKL A;  3EM1 A;  2B8Q A;  2AZ1 A;  1EHW A;  3EMT A;  1WKK A;  1NSK L;  2DXD A;  2BEF A;  4FKY A;  3JS9 A;  2DYA A;  3ZTS A;  1BE4 A;  2NCK L;  1VYA A;  1NLK L;  3VVU A;  4HR2 A;  4CP5 A;  1S57 A;  2CWK A;  2DXF A;  3ZTR A;  1NDL A;  4C6A A;  2HUR A;  3EIC A;  4UOH A;  1F6T A;  1KDN A;  3FBF A;  5IOL A;  1HLW A;  1LEO A;  1S5Z A;  1NDK A;  3BBF A;  4UOF A;  4DZ6 A;  3ZTQ A;  4DUT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...