1WL6A

Mg-substituted form of e. coli aminopeptidase p
Total Genus 156
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
156
sequence length
440
structure length
440
Chain Sequence
SEISRQEFQRRRQALVEQMQPGSAALIFAAPEVTRSADSEYPYRQNSDFWYFTGFNEPEAVLVLIKSDDTHNHSVLFNRVRDLTAEIWFGRRLGQDAAPEKLGVDRALAFSEINQQLYQLLNGLDVVYHAQGEYAYADVIVNSALEKLRKGSRQNLTAPATMIDWRPVVHEMRLFKSPEEIAVLRRAGEITAMAHTRAMEKCRPGMFEYHLEGEIHHEFNRHGARYPSYNTIVGSGENGCILHYTENECEMRDGDLVLIDAGCEYKGYAGDITRTFPVNGKFTQAQREIYDIVLESLETSLRLYRPGTSILEVTGEVVRIMVSGLVKLGILKGDVDELIAQNAHRPFFMHGLSHWLGLDVHDVGVYGQDRSRILEPGMVLTVEPGLYIAPDAEVPEQYRGIGIRIEDDIVITETGNENLTASVVKKPEEIEALMVAARKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and functional implications of metal ion selection in aminopeptidase p, a metalloprotease with a dinuclear metal center
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords Xaa-Pro aminopeptidase
total genus 156
structure length 440
sequence length 440
ec nomenclature ec 3.4.11.9: Xaa-Pro aminopeptidase.
pdb deposition date 2004-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
A PF05195 AMP_N Aminopeptidase P, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 1wl6A01
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 1wl6A02
5CDLA 1QXZA 2EA4A 4EGEA 3RVAA 1QXYA 1R5HA 4U6ZA 1WLRA 5FCFA 4B28A 3MX6A 1C27A 2DFIA 4IPAA 5E5BA 4S01A 4S2RP 2GU7A 3I7MA 1YJ3A 1XGSA 5JHUA 4ZWPA 3FMQA 3MATA 2GG9A 2P98A 1WN1A 1C21A 1YW9A 4FUKA 1B59A 4IECA 4FLIA 1C22A 3IU7A 3Q6DA 5FCHA 1MATA 2BWUA 1BOAA 4A6WA 1W7VA 2BWWA 2EA2A 1YVMA 1Y1NA 4IKUA 5CE6A 2OAZA 5CNXA 4U1BA 3IG4A 4IF7A 5D6EA 3FMRA 3QOCA 3PKEA 4ZNGA 3MR1A 3TAVA 3FM3A 4U75A 5JI6A 3D27A 4S00A 1JAWA 2GG7A 3BIPA 4PV4A 1KQ0A 4U6CA 1C23A 4FLJA 2B3HA 2B3LA 1WY2A 1KQ9A 4U69A 3S6BA 4U6EA 4KM3A 2BHDA 2IW2A 1M35A 2BH3A 5D6FA 4QR8A 4FO7A 2V3YA 3BIQA 3PN9A 1QXWA 1QZYA 2ADUA 2GG8A 2B3KA 2GU5A 4IKSA 4FLKA 4U76A 3PKCA 3CB6A 2NQ7A 1YW8A 2BHAA 2GG0A 2EVMA 2GGBA 2GG2A 2GU4A 4U6JA 4IDYA 1PV9A 2Q8KA 1WBQA 4RZZA 2MATA 1XGMA 3IU9A 2HOWA 1R58A 4A6VA 1CHMA 2P9AA 4FKCA 4IKRA 4RZYA 1YW7A 4FO8A 2GGCA 2BWYA 3TB5A 1KP0A 1W2MA 2V3ZA 3CB5A 1R5GA 2BB7A 2GG3A 2BWSA 5CDVA 4ZWOA 4IKTA 2GTXA 3OVKA 2Q92A 2GU6A 2P99A 2V3XA 4Z7MA 5CIKA 5E2CA 1O0XA 4PNCA 3PKBA 2GG5A 2NQ6A 1XGNA 2Q95A 2BHBA 4R60A 2EVCA 3RORA 4U70A 1XGOA 1N51A 4U73A 4IU6A 4U6WA 2Q96A 3PKDA 4FLLA 4HXXA 3OOOA 4JUQA 3L24A 3L7GA 2V6CA 1B6AA 3IU8A 1WL9A 4RGZ1 4U71A 2OKNA 2Q93A 1XNZA 3PEBA 2GZ5A 1C24A 5CDEA 1WKMA 3O5VA 2BWXA 4OOKA 4ZWUA 1A16A 2ZSGA 3CTZA 2BWTA 1BN5A 3IL0A 2Q94A 1WL6A 5JFRA 3BITA 4S2TP 2BWVA 5CLSA 3PKAA 2EVOA 2GA2A 2G6PA 2BHCA 4MATA 2BN7A
chains in the Genus database with same CATH superfamily
5CDLA 1QXZA 2EA4A 4EGEA 3RVAA 1QXYA 1R5HA 4U6ZA 1WLRA 5FCFA 4B28A 3MX6A 1C27A 2DFIA 4IPAA 5E5BA 4S01A 4S2RP 2GU7A 3I7MA 1YJ3A 1XGSA 5JHUA 4ZWPA 3FMQA 3MATA 2GG9A 2P98A 1WN1A 1C21A 1YW9A 4FUKA 1B59A 4IECA 4FLIA 1C22A 3IU7A 3Q6DA 5FCHA 1MATA 2BWUA 1BOAA 4A6WA 1W7VA 2BWWA 2EA2A 1YVMA 1Y1NA 4IKUA 5CE6A 2OAZA 5CNXA 4U1BA 3IG4A 4IF7A 5D6EA 3FMRA 3QOCA 3PKEA 4ZNGA 3MR1A 3TAVA 3FM3A 4U75A 5JI6A 3D27A 4S00A 1JAWA 2GG7A 3BIPA 4PV4A 1KQ0A 4U6CA 1C23A 4FLJA 2B3HA 2B3LA 1WY2A 1KQ9A 4U69A 3S6BA 4U6EA 4KM3A 2BHDA 2IW2A 1M35A 2BH3A 5D6FA 4QR8A 4FO7A 2V3YA 3BIQA 3PN9A 1QXWA 1QZYA 2ADUA 2GG8A 2B3KA 2GU5A 4IKSA 4FLKA 4U76A 3PKCA 3CB6A 2NQ7A 1YW8A 2BHAA 2GG0A 2EVMA 2GGBA 2GG2A 2GU4A 4U6JA 4IDYA 1PV9A 2Q8KA 1WBQA 4RZZA 2MATA 1XGMA 3IU9A 2HOWA 1R58A 4A6VA 1CHMA 2P9AA 4FKCA 4IKRA 4RZYA 1YW7A 4FO8A 2GGCA 2BWYA 3TB5A 1KP0A 1W2MA 2V3ZA 3CB5A 1R5GA 2BB7A 2GG3A 2BWSA 5CDVA 4ZWOA 4IKTA 2GTXA 3OVKA 2Q92A 2GU6A 2P99A 2V3XA 4Z7MA 5CIKA 5E2CA 1O0XA 4PNCA 3PKBA 2GG5A 2NQ6A 1XGNA 2Q95A 2BHBA 4R60A 2EVCA 3RORA 4U70A 1XGOA 1N51A 4U73A 4IU6A 4U6WA 2Q96A 3PKDA 4FLLA 4HXXA 3OOOA 4JUQA 3L24A 3L7GA 2V6CA 1B6AA 3IU8A 1WL9A 4RGZ1 4U71A 2OKNA 2Q93A 1XNZA 3PEBA 2GZ5A 1C24A 5CDEA 1WKMA 3O5VA 2BWXA 4OOKA 4ZWUA 1A16A 2ZSGA 3CTZA 2BWTA 1BN5A 3IL0A 2Q94A 1WL6A 5JFRA 3BITA 4S2TP 2BWVA 5CLSA 3PKAA 2EVOA 2GA2A 2G6PA 2BHCA 4MATA 2BN7A
chains in the Genus database with same CATH topology
5CDLA 1QXZA 2EA4A 4EGEA 3RVAA 1QXYA 1R5HA 4U6ZA 1WLRA 5FCFA 4B28A 3MX6A 1C27A 2DFIA 4IPAA 5E5BA 4S01A 4S2RP 2GU7A 3I7MA 1YJ3A 1XGSA 5JHUA 4ZWPA 3FMQA 3MATA 2GG9A 2P98A 1WN1A 1C21A 1YW9A 4FUKA 1B59A 4IECA 4FLIA 1C22A 3IU7A 3Q6DA 5FCHA 1MATA 2BWUA 1BOAA 4A6WA 1W7VA 2BWWA 2EA2A 1YVMA 1Y1NA 4IKUA 5CE6A 2OAZA 5CNXA 4U1BA 3IG4A 4IF7A 5D6EA 3FMRA 3QOCA 3PKEA 4ZNGA 3MR1A 3TAVA 3FM3A 4U75A 5JI6A 3D27A 4S00A 1JAWA 2GG7A 3BIPA 4PV4A 1KQ0A 4U6CA 1C23A 4FLJA 2B3HA 2B3LA 1WY2A 1KQ9A 4U69A 3S6BA 4U6EA 4KM3A 2BHDA 2IW2A 1M35A 2BH3A 5D6FA 4QR8A 4FO7A 2V3YA 3BIQA 3PN9A 1QXWA 1QZYA 2ADUA 2GG8A 2B3KA 2GU5A 4IKSA 4FLKA 4U76A 3PKCA 3CB6A 2NQ7A 1YW8A 2BHAA 2GG0A 2EVMA 2GGBA 2GG2A 2GU4A 4U6JA 4IDYA 1PV9A 2Q8KA 1WBQA 4RZZA 2MATA 1XGMA 3IU9A 2HOWA 1R58A 4A6VA 1CHMA 2P9AA 4FKCA 4IKRA 4RZYA 1YW7A 4FO8A 2GGCA 2BWYA 3TB5A 1KP0A 1W2MA 2V3ZA 3CB5A 1R5GA 2BB7A 2GG3A 2BWSA 5CDVA 4ZWOA 4IKTA 2GTXA 3OVKA 2Q92A 2GU6A 2P99A 2V3XA 4Z7MA 5CIKA 5E2CA 1O0XA 4PNCA 3PKBA 2GG5A 2NQ6A 1XGNA 2Q95A 2BHBA 4R60A 2EVCA 3RORA 4U70A 1XGOA 1N51A 4U73A 4IU6A 4U6WA 2Q96A 3PKDA 4FLLA 4HXXA 3OOOA 4JUQA 3L24A 3L7GA 2V6CA 1B6AA 3IU8A 1WL9A 4RGZ1 4U71A 2OKNA 2Q93A 1XNZA 3PEBA 2GZ5A 1C24A 5CDEA 1WKMA 3O5VA 2BWXA 4OOKA 4ZWUA 1A16A 2ZSGA 3CTZA 2BWTA 1BN5A 3IL0A 2Q94A 1WL6A 5JFRA 3BITA 4S2TP 2BWVA 5CLSA 3PKAA 2EVOA 2GA2A 2G6PA 2BHCA 4MATA 2BN7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CDL A;  1QXZ A;  2EA4 A;  4EGE A;  3RVA A;  1QXY A;  1R5H A;  4U6Z A;  1WLR A;  5FCF A;  4B28 A;  3MX6 A;  1C27 A;  2DFI A;  4IPA A;  5E5B A;  4S01 A;  4S2R P;  2GU7 A;  3I7M A;  1YJ3 A;  1XGS A;  5JHU A;  4ZWP A;  3FMQ A;  3MAT A;  2GG9 A;  2P98 A;  1WN1 A;  1C21 A;  1YW9 A;  4FUK A;  1B59 A;  4IEC A;  4FLI A;  1C22 A;  3IU7 A;  3Q6D A;  5FCH A;  1MAT A;  2BWU A;  1BOA A;  4A6W A;  1W7V A;  2BWW A;  2EA2 A;  1YVM A;  1Y1N A;  4IKU A;  5CE6 A;  2OAZ A;  5CNX A;  4U1B A;  3IG4 A;  4IF7 A;  5D6E A;  3FMR A;  3QOC A;  3PKE A;  4ZNG A;  3MR1 A;  3TAV A;  3FM3 A;  4U75 A;  5JI6 A;  3D27 A;  4S00 A;  1JAW A;  2GG7 A;  3BIP A;  4PV4 A;  1KQ0 A;  4U6C A;  1C23 A;  4FLJ A;  2B3H A;  2B3L A;  1WY2 A;  1KQ9 A;  4U69 A;  3S6B A;  4U6E A;  4KM3 A;  2BHD A;  2IW2 A;  1M35 A;  2BH3 A;  5D6F A;  4QR8 A;  4FO7 A;  2V3Y A;  3BIQ A;  3PN9 A;  1QXW A;  1QZY A;  2ADU A;  2GG8 A;  2B3K A;  2GU5 A;  4IKS A;  4FLK A;  4U76 A;  3PKC A;  3CB6 A;  2NQ7 A;  1YW8 A;  2BHA A;  2GG0 A;  2EVM A;  2GGB A;  2GG2 A;  2GU4 A;  4U6J A;  4IDY A;  1PV9 A;  2Q8K A;  1WBQ A;  4RZZ A;  2MAT A;  1XGM A;  3IU9 A;  2HOW A;  1R58 A;  4A6V A;  1CHM A;  2P9A A;  4FKC A;  4IKR A;  4RZY A;  1YW7 A;  4FO8 A;  2GGC A;  2BWY A;  3TB5 A;  1KP0 A;  1W2M A;  2V3Z A;  3CB5 A;  1R5G A;  2BB7 A;  2GG3 A;  2BWS A;  5CDV A;  4ZWO A;  4IKT A;  2GTX A;  3OVK A;  2Q92 A;  2GU6 A;  2P99 A;  2V3X A;  4Z7M A;  5CIK A;  5E2C A;  1O0X A;  4PNC A;  3PKB A;  2GG5 A;  2NQ6 A;  1XGN A;  2Q95 A;  2BHB A;  4R60 A;  2EVC A;  3ROR A;  4U70 A;  1XGO A;  1N51 A;  4U73 A;  4IU6 A;  4U6W A;  2Q96 A;  3PKD A;  4FLL A;  4HXX A;  3OOO A;  4JUQ A;  3L24 A;  3L7G A;  2V6C A;  1B6A A;  3IU8 A;  1WL9 A;  4RGZ 1;  4U71 A;  2OKN A;  2Q93 A;  1XNZ A;  3PEB A;  2GZ5 A;  1C24 A;  5CDE A;  1WKM A;  3O5V A;  2BWX A;  4OOK A;  4ZWU A;  1A16 A;  2ZSG A;  3CTZ A;  2BWT A;  1BN5 A;  3IL0 A;  2Q94 A;  1WL6 A;  5JFR A;  3BIT A;  4S2T P;  2BWV A;  5CLS A;  3PKA A;  2EVO A;  2GA2 A;  2G6P A;  2BHC A;  4MAT A;  2BN7 A; 
#chains in the Genus database with same CATH topology
 5CDL A;  1QXZ A;  2EA4 A;  4EGE A;  3RVA A;  1QXY A;  1R5H A;  4U6Z A;  1WLR A;  5FCF A;  4B28 A;  3MX6 A;  1C27 A;  2DFI A;  4IPA A;  5E5B A;  4S01 A;  4S2R P;  2GU7 A;  3I7M A;  1YJ3 A;  1XGS A;  5JHU A;  4ZWP A;  3FMQ A;  3MAT A;  2GG9 A;  2P98 A;  1WN1 A;  1C21 A;  1YW9 A;  4FUK A;  1B59 A;  4IEC A;  4FLI A;  1C22 A;  3IU7 A;  3Q6D A;  5FCH A;  1MAT A;  2BWU A;  1BOA A;  4A6W A;  1W7V A;  2BWW A;  2EA2 A;  1YVM A;  1Y1N A;  4IKU A;  5CE6 A;  2OAZ A;  5CNX A;  4U1B A;  3IG4 A;  4IF7 A;  5D6E A;  3FMR A;  3QOC A;  3PKE A;  4ZNG A;  3MR1 A;  3TAV A;  3FM3 A;  4U75 A;  5JI6 A;  3D27 A;  4S00 A;  1JAW A;  2GG7 A;  3BIP A;  4PV4 A;  1KQ0 A;  4U6C A;  1C23 A;  4FLJ A;  2B3H A;  2B3L A;  1WY2 A;  1KQ9 A;  4U69 A;  3S6B A;  4U6E A;  4KM3 A;  2BHD A;  2IW2 A;  1M35 A;  2BH3 A;  5D6F A;  4QR8 A;  4FO7 A;  2V3Y A;  3BIQ A;  3PN9 A;  1QXW A;  1QZY A;  2ADU A;  2GG8 A;  2B3K A;  2GU5 A;  4IKS A;  4FLK A;  4U76 A;  3PKC A;  3CB6 A;  2NQ7 A;  1YW8 A;  2BHA A;  2GG0 A;  2EVM A;  2GGB A;  2GG2 A;  2GU4 A;  4U6J A;  4IDY A;  1PV9 A;  2Q8K A;  1WBQ A;  4RZZ A;  2MAT A;  1XGM A;  3IU9 A;  2HOW A;  1R58 A;  4A6V A;  1CHM A;  2P9A A;  4FKC A;  4IKR A;  4RZY A;  1YW7 A;  4FO8 A;  2GGC A;  2BWY A;  3TB5 A;  1KP0 A;  1W2M A;  2V3Z A;  3CB5 A;  1R5G A;  2BB7 A;  2GG3 A;  2BWS A;  5CDV A;  4ZWO A;  4IKT A;  2GTX A;  3OVK A;  2Q92 A;  2GU6 A;  2P99 A;  2V3X A;  4Z7M A;  5CIK A;  5E2C A;  1O0X A;  4PNC A;  3PKB A;  2GG5 A;  2NQ6 A;  1XGN A;  2Q95 A;  2BHB A;  4R60 A;  2EVC A;  3ROR A;  4U70 A;  1XGO A;  1N51 A;  4U73 A;  4IU6 A;  4U6W A;  2Q96 A;  3PKD A;  4FLL A;  4HXX A;  3OOO A;  4JUQ A;  3L24 A;  3L7G A;  2V6C A;  1B6A A;  3IU8 A;  1WL9 A;  4RGZ 1;  4U71 A;  2OKN A;  2Q93 A;  1XNZ A;  3PEB A;  2GZ5 A;  1C24 A;  5CDE A;  1WKM A;  3O5V A;  2BWX A;  4OOK A;  4ZWU A;  1A16 A;  2ZSG A;  3CTZ A;  2BWT A;  1BN5 A;  3IL0 A;  2Q94 A;  1WL6 A;  5JFR A;  3BIT A;  4S2T P;  2BWV A;  5CLS A;  3PKA A;  2EVO A;  2GA2 A;  2G6P A;  2BHC A;  4MAT A;  2BN7 A; 
#chains in the Genus database with same CATH homology
 5CDL A;  1QXZ A;  2EA4 A;  4EGE A;  3RVA A;  1QXY A;  1R5H A;  4U6Z A;  1WLR A;  5FCF A;  4B28 A;  3MX6 A;  1C27 A;  2DFI A;  4IPA A;  5E5B A;  4S01 A;  4S2R P;  2GU7 A;  3I7M A;  1YJ3 A;  1XGS A;  5JHU A;  4ZWP A;  3FMQ A;  3MAT A;  2GG9 A;  2P98 A;  1WN1 A;  1C21 A;  1YW9 A;  4FUK A;  1B59 A;  4IEC A;  4FLI A;  1C22 A;  3IU7 A;  3Q6D A;  5FCH A;  1MAT A;  2BWU A;  1BOA A;  4A6W A;  1W7V A;  2BWW A;  2EA2 A;  1YVM A;  1Y1N A;  4IKU A;  5CE6 A;  2OAZ A;  5CNX A;  4U1B A;  3IG4 A;  4IF7 A;  5D6E A;  3FMR A;  3QOC A;  3PKE A;  4ZNG A;  3MR1 A;  3TAV A;  3FM3 A;  4U75 A;  5JI6 A;  3D27 A;  4S00 A;  1JAW A;  2GG7 A;  3BIP A;  4PV4 A;  1KQ0 A;  4U6C A;  1C23 A;  4FLJ A;  2B3H A;  2B3L A;  1WY2 A;  1KQ9 A;  4U69 A;  3S6B A;  4U6E A;  4KM3 A;  2BHD A;  2IW2 A;  1M35 A;  2BH3 A;  5D6F A;  4QR8 A;  4FO7 A;  2V3Y A;  3BIQ A;  3PN9 A;  1QXW A;  1QZY A;  2ADU A;  2GG8 A;  2B3K A;  2GU5 A;  4IKS A;  4FLK A;  4U76 A;  3PKC A;  3CB6 A;  2NQ7 A;  1YW8 A;  2BHA A;  2GG0 A;  2EVM A;  2GGB A;  2GG2 A;  2GU4 A;  4U6J A;  4IDY A;  1PV9 A;  2Q8K A;  1WBQ A;  4RZZ A;  2MAT A;  1XGM A;  3IU9 A;  2HOW A;  1R58 A;  4A6V A;  1CHM A;  2P9A A;  4FKC A;  4IKR A;  4RZY A;  1YW7 A;  4FO8 A;  2GGC A;  2BWY A;  3TB5 A;  1KP0 A;  1W2M A;  2V3Z A;  3CB5 A;  1R5G A;  2BB7 A;  2GG3 A;  2BWS A;  5CDV A;  4ZWO A;  4IKT A;  2GTX A;  3OVK A;  2Q92 A;  2GU6 A;  2P99 A;  2V3X A;  4Z7M A;  5CIK A;  5E2C A;  1O0X A;  4PNC A;  3PKB A;  2GG5 A;  2NQ6 A;  1XGN A;  2Q95 A;  2BHB A;  4R60 A;  2EVC A;  3ROR A;  4U70 A;  1XGO A;  1N51 A;  4U73 A;  4IU6 A;  4U6W A;  2Q96 A;  3PKD A;  4FLL A;  4HXX A;  3OOO A;  4JUQ A;  3L24 A;  3L7G A;  2V6C A;  1B6A A;  3IU8 A;  1WL9 A;  4RGZ 1;  4U71 A;  2OKN A;  2Q93 A;  1XNZ A;  3PEB A;  2GZ5 A;  1C24 A;  5CDE A;  1WKM A;  3O5V A;  2BWX A;  4OOK A;  4ZWU A;  1A16 A;  2ZSG A;  3CTZ A;  2BWT A;  1BN5 A;  3IL0 A;  2Q94 A;  1WL6 A;  5JFR A;  3BIT A;  4S2T P;  2BWV A;  5CLS A;  3PKA A;  2EVO A;  2GA2 A;  2G6P A;  2BHC A;  4MAT A;  2BN7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...