1WL6A

Mg-substituted form of e. coli aminopeptidase p
Total Genus 156
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
156
sequence length
440
structure length
440
Chain Sequence
SEISRQEFQRRRQALVEQMQPGSAALIFAAPEVTRSADSEYPYRQNSDFWYFTGFNEPEAVLVLIKSDDTHNHSVLFNRVRDLTAEIWFGRRLGQDAAPEKLGVDRALAFSEINQQLYQLLNGLDVVYHAQGEYAYADVIVNSALEKLRKGSRQNLTAPATMIDWRPVVHEMRLFKSPEEIAVLRRAGEITAMAHTRAMEKCRPGMFEYHLEGEIHHEFNRHGARYPSYNTIVGSGENGCILHYTENECEMRDGDLVLIDAGCEYKGYAGDITRTFPVNGKFTQAQREIYDIVLESLETSLRLYRPGTSILEVTGEVVRIMVSGLVKLGILKGDVDELIAQNAHRPFFMHGLSHWLGLDVHDVGVYGQDRSRILEPGMVLTVEPGLYIAPDAEVPEQYRGIGIRIEDDIVITETGNENLTASVVKKPEEIEALMVAARKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and functional implications of metal ion selection in aminopeptidase p, a metalloprotease with a dinuclear metal center
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords Xaa-Pro aminopeptidase
total genus 156
structure length 440
sequence length 440
ec nomenclature ec 3.4.11.9: Xaa-Pro aminopeptidase.
pdb deposition date 2004-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
A PF05195 AMP_N Aminopeptidase P, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 1wl6A01
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 1wl6A02
3IU9A 1PV9A 1YVMA 1XGOA 3FMRA 5FCFA 2EA4A 3TB5A 2Q96A 1Y1NA 4QR8A 1XGSA 3CB6A 4U76A 4S2RP 1BOAA 3MX6A 3PKCA 3CB5A 2GU7A 3RORA 2BWXA 3S6BA 5CDLA 4U6WA 3BIPA 1C24A 1YJ3A 4U6EA 1YW9A 1C27A 3PKDA 3BITA 3Q6DA 1KQ9A 1M35A 2GU4A 1KQ0A 3PKEA 5JHUA 1B6AA 1W7VA 4FLLA 4S2TP 4U70A 2EVOA 2B3LA 1O0XA 4FLKA 3L24A 2P9AA 3TAVA 5CDEA 4S01A 1N51A 2GU6A 1QXZA 1R58A 2GGBA 4JUQA 4IF7A 2BWSA 1QXWA 4ZNGA 2OAZA 2Q92A 2GZ5A 1A16A 1QZYA 2G6PA 2BWVA 2BHDA 4IDYA 2BWWA 1WN1A 2Q95A 3PKBA 4IPAA 4IU6A 2GU5A 2IW2A 4Z7MA 4U69A 1JAWA 2OKNA 5CIKA 2GGCA 4ZWOA 3PN9A 4FKCA 3MR1A 2B3HA 4HXXA 4IECA 3OVKA 1BN5A 1W2MA 2EVCA 5JFRA 5CE6A 4S00A 1XGNA 2BHAA 1R5GA 2EVMA 1CHMA 2GG8A 2V6CA 3BIQA 4IKSA 2BB7A 1WKMA 4MATA 4PNCA 5CDVA 2V3XA 3PKAA 2ADUA 3IG4A 5D6FA 2V3ZA 1C22A 1KP0A 2Q93A 4FO8A 2Q94A 4IKTA 5D6EA 2NQ7A 4PV4A 2DFIA 2GG7A 5E2CA 2GG0A 2HOWA 1WL6A 4U6ZA 2GG5A 5FCHA 2MATA 1R5HA 5CLSA 1WBQA 3RVAA 2BH3A 2P98A 4FO7A 2BN7A 4U73A 2BWYA 4ZWPA 3FM3A 2ZSGA 2GG3A 1WY2A 1QXYA 4EGEA 4R60A 4U6JA 1XNZA 4IKUA 4FUKA 4A6VA 2EA2A 4RZZA 1WL9A 3FMQA 3QOCA 2BWUA 3PEBA 4FLIA 4KM3A 1C23A 2B3KA 2GA2A 3IL0A 1YW8A 2BHBA 5E5BA 4U6CA 4A6WA 4RZYA 5CNXA 2BWTA 2P99A 4IKRA 4U75A 4FLJA 4B28A 4RGZ1 2GG9A 1WLRA 3MATA 4U1BA 3IU7A 3OOOA 2GG2A 3O5VA 2BHCA 3CTZA 2V3YA 1YW7A 3IU8A 3L7GA 5JI6A 3D27A 4ZWUA 2Q8KA 2GTXA 4OOKA 1B59A 1XGMA 2NQ6A 4U71A 1MATA 1C21A 3I7MA
chains in the Genus database with same CATH superfamily
3IU9A 1PV9A 1YVMA 1XGOA 3FMRA 5FCFA 2EA4A 3TB5A 2Q96A 1Y1NA 4QR8A 1XGSA 3CB6A 4U76A 4S2RP 1BOAA 3MX6A 3PKCA 3CB5A 2GU7A 3RORA 2BWXA 3S6BA 5CDLA 4U6WA 3BIPA 1C24A 1YJ3A 4U6EA 1YW9A 1C27A 3PKDA 3BITA 3Q6DA 1KQ9A 1M35A 2GU4A 1KQ0A 3PKEA 5JHUA 1B6AA 1W7VA 4FLLA 4S2TP 4U70A 2EVOA 2B3LA 1O0XA 4FLKA 3L24A 2P9AA 3TAVA 5CDEA 4S01A 1N51A 2GU6A 1QXZA 1R58A 2GGBA 4JUQA 4IF7A 2BWSA 1QXWA 4ZNGA 2OAZA 2Q92A 2GZ5A 1A16A 1QZYA 2G6PA 2BWVA 2BHDA 4IDYA 2BWWA 1WN1A 2Q95A 3PKBA 4IPAA 4IU6A 2GU5A 2IW2A 4Z7MA 4U69A 1JAWA 2OKNA 5CIKA 2GGCA 4ZWOA 3PN9A 4FKCA 3MR1A 2B3HA 4HXXA 4IECA 3OVKA 1BN5A 1W2MA 2EVCA 5JFRA 5CE6A 4S00A 1XGNA 2BHAA 1R5GA 2EVMA 1CHMA 2GG8A 2V6CA 3BIQA 4IKSA 2BB7A 1WKMA 4MATA 4PNCA 5CDVA 2V3XA 3PKAA 2ADUA 3IG4A 5D6FA 2V3ZA 1C22A 1KP0A 2Q93A 4FO8A 2Q94A 4IKTA 5D6EA 2NQ7A 4PV4A 2DFIA 2GG7A 5E2CA 2GG0A 2HOWA 1WL6A 4U6ZA 2GG5A 5FCHA 2MATA 1R5HA 5CLSA 1WBQA 3RVAA 2BH3A 2P98A 4FO7A 2BN7A 4U73A 2BWYA 4ZWPA 3FM3A 2ZSGA 2GG3A 1WY2A 1QXYA 4EGEA 4R60A 4U6JA 1XNZA 4IKUA 4FUKA 4A6VA 2EA2A 4RZZA 1WL9A 3FMQA 3QOCA 2BWUA 3PEBA 4FLIA 4KM3A 1C23A 2B3KA 2GA2A 3IL0A 1YW8A 2BHBA 5E5BA 4U6CA 4A6WA 4RZYA 5CNXA 2BWTA 2P99A 4IKRA 4U75A 4FLJA 4B28A 4RGZ1 2GG9A 1WLRA 3MATA 4U1BA 3IU7A 3OOOA 2GG2A 3O5VA 2BHCA 3CTZA 2V3YA 1YW7A 3IU8A 3L7GA 5JI6A 3D27A 4ZWUA 2Q8KA 2GTXA 4OOKA 1B59A 1XGMA 2NQ6A 4U71A 1MATA 1C21A 3I7MA
chains in the Genus database with same CATH topology
3IU9A 1PV9A 1YVMA 1XGOA 3FMRA 5FCFA 2EA4A 3TB5A 2Q96A 1Y1NA 4QR8A 1XGSA 3CB6A 4U76A 4S2RP 1BOAA 3MX6A 3PKCA 3CB5A 2GU7A 3RORA 2BWXA 3S6BA 5CDLA 4U6WA 3BIPA 1C24A 1YJ3A 4U6EA 1YW9A 1C27A 3PKDA 3BITA 3Q6DA 1KQ9A 1M35A 2GU4A 1KQ0A 3PKEA 5JHUA 1B6AA 1W7VA 4FLLA 4S2TP 4U70A 2EVOA 2B3LA 1O0XA 4FLKA 3L24A 2P9AA 3TAVA 5CDEA 4S01A 1N51A 2GU6A 1QXZA 1R58A 2GGBA 4JUQA 4IF7A 2BWSA 1QXWA 4ZNGA 2OAZA 2Q92A 2GZ5A 1A16A 1QZYA 2G6PA 2BWVA 2BHDA 4IDYA 2BWWA 1WN1A 2Q95A 3PKBA 4IPAA 4IU6A 2GU5A 2IW2A 4Z7MA 4U69A 1JAWA 2OKNA 5CIKA 2GGCA 4ZWOA 3PN9A 4FKCA 3MR1A 2B3HA 4HXXA 4IECA 3OVKA 1BN5A 1W2MA 2EVCA 5JFRA 5CE6A 4S00A 1XGNA 2BHAA 1R5GA 2EVMA 1CHMA 2GG8A 2V6CA 3BIQA 4IKSA 2BB7A 1WKMA 4MATA 4PNCA 5CDVA 2V3XA 3PKAA 2ADUA 3IG4A 5D6FA 2V3ZA 1C22A 1KP0A 2Q93A 4FO8A 2Q94A 4IKTA 5D6EA 2NQ7A 4PV4A 2DFIA 2GG7A 5E2CA 2GG0A 2HOWA 1WL6A 4U6ZA 2GG5A 5FCHA 2MATA 1R5HA 5CLSA 1WBQA 3RVAA 2BH3A 2P98A 4FO7A 2BN7A 4U73A 2BWYA 4ZWPA 3FM3A 2ZSGA 2GG3A 1WY2A 1QXYA 4EGEA 4R60A 4U6JA 1XNZA 4IKUA 4FUKA 4A6VA 2EA2A 4RZZA 1WL9A 3FMQA 3QOCA 2BWUA 3PEBA 4FLIA 4KM3A 1C23A 2B3KA 2GA2A 3IL0A 1YW8A 2BHBA 5E5BA 4U6CA 4A6WA 4RZYA 5CNXA 2BWTA 2P99A 4IKRA 4U75A 4FLJA 4B28A 4RGZ1 2GG9A 1WLRA 3MATA 4U1BA 3IU7A 3OOOA 2GG2A 3O5VA 2BHCA 3CTZA 2V3YA 1YW7A 3IU8A 3L7GA 5JI6A 3D27A 4ZWUA 2Q8KA 2GTXA 4OOKA 1B59A 1XGMA 2NQ6A 4U71A 1MATA 1C21A 3I7MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IU9 A;  1PV9 A;  1YVM A;  1XGO A;  3FMR A;  5FCF A;  2EA4 A;  3TB5 A;  2Q96 A;  1Y1N A;  4QR8 A;  1XGS A;  3CB6 A;  4U76 A;  4S2R P;  1BOA A;  3MX6 A;  3PKC A;  3CB5 A;  2GU7 A;  3ROR A;  2BWX A;  3S6B A;  5CDL A;  4U6W A;  3BIP A;  1C24 A;  1YJ3 A;  4U6E A;  1YW9 A;  1C27 A;  3PKD A;  3BIT A;  3Q6D A;  1KQ9 A;  1M35 A;  2GU4 A;  1KQ0 A;  3PKE A;  5JHU A;  1B6A A;  1W7V A;  4FLL A;  4S2T P;  4U70 A;  2EVO A;  2B3L A;  1O0X A;  4FLK A;  3L24 A;  2P9A A;  3TAV A;  5CDE A;  4S01 A;  1N51 A;  2GU6 A;  1QXZ A;  1R58 A;  2GGB A;  4JUQ A;  4IF7 A;  2BWS A;  1QXW A;  4ZNG A;  2OAZ A;  2Q92 A;  2GZ5 A;  1A16 A;  1QZY A;  2G6P A;  2BWV A;  2BHD A;  4IDY A;  2BWW A;  1WN1 A;  2Q95 A;  3PKB A;  4IPA A;  4IU6 A;  2GU5 A;  2IW2 A;  4Z7M A;  4U69 A;  1JAW A;  2OKN A;  5CIK A;  2GGC A;  4ZWO A;  3PN9 A;  4FKC A;  3MR1 A;  2B3H A;  4HXX A;  4IEC A;  3OVK A;  1BN5 A;  1W2M A;  2EVC A;  5JFR A;  5CE6 A;  4S00 A;  1XGN A;  2BHA A;  1R5G A;  2EVM A;  1CHM A;  2GG8 A;  2V6C A;  3BIQ A;  4IKS A;  2BB7 A;  1WKM A;  4MAT A;  4PNC A;  5CDV A;  2V3X A;  3PKA A;  2ADU A;  3IG4 A;  5D6F A;  2V3Z A;  1C22 A;  1KP0 A;  2Q93 A;  4FO8 A;  2Q94 A;  4IKT A;  5D6E A;  2NQ7 A;  4PV4 A;  2DFI A;  2GG7 A;  5E2C A;  2GG0 A;  2HOW A;  1WL6 A;  4U6Z A;  2GG5 A;  5FCH A;  2MAT A;  1R5H A;  5CLS A;  1WBQ A;  3RVA A;  2BH3 A;  2P98 A;  4FO7 A;  2BN7 A;  4U73 A;  2BWY A;  4ZWP A;  3FM3 A;  2ZSG A;  2GG3 A;  1WY2 A;  1QXY A;  4EGE A;  4R60 A;  4U6J A;  1XNZ A;  4IKU A;  4FUK A;  4A6V A;  2EA2 A;  4RZZ A;  1WL9 A;  3FMQ A;  3QOC A;  2BWU A;  3PEB A;  4FLI A;  4KM3 A;  1C23 A;  2B3K A;  2GA2 A;  3IL0 A;  1YW8 A;  2BHB A;  5E5B A;  4U6C A;  4A6W A;  4RZY A;  5CNX A;  2BWT A;  2P99 A;  4IKR A;  4U75 A;  4FLJ A;  4B28 A;  4RGZ 1;  2GG9 A;  1WLR A;  3MAT A;  4U1B A;  3IU7 A;  3OOO A;  2GG2 A;  3O5V A;  2BHC A;  3CTZ A;  2V3Y A;  1YW7 A;  3IU8 A;  3L7G A;  5JI6 A;  3D27 A;  4ZWU A;  2Q8K A;  2GTX A;  4OOK A;  1B59 A;  1XGM A;  2NQ6 A;  4U71 A;  1MAT A;  1C21 A;  3I7M A; 
#chains in the Genus database with same CATH topology
 3IU9 A;  1PV9 A;  1YVM A;  1XGO A;  3FMR A;  5FCF A;  2EA4 A;  3TB5 A;  2Q96 A;  1Y1N A;  4QR8 A;  1XGS A;  3CB6 A;  4U76 A;  4S2R P;  1BOA A;  3MX6 A;  3PKC A;  3CB5 A;  2GU7 A;  3ROR A;  2BWX A;  3S6B A;  5CDL A;  4U6W A;  3BIP A;  1C24 A;  1YJ3 A;  4U6E A;  1YW9 A;  1C27 A;  3PKD A;  3BIT A;  3Q6D A;  1KQ9 A;  1M35 A;  2GU4 A;  1KQ0 A;  3PKE A;  5JHU A;  1B6A A;  1W7V A;  4FLL A;  4S2T P;  4U70 A;  2EVO A;  2B3L A;  1O0X A;  4FLK A;  3L24 A;  2P9A A;  3TAV A;  5CDE A;  4S01 A;  1N51 A;  2GU6 A;  1QXZ A;  1R58 A;  2GGB A;  4JUQ A;  4IF7 A;  2BWS A;  1QXW A;  4ZNG A;  2OAZ A;  2Q92 A;  2GZ5 A;  1A16 A;  1QZY A;  2G6P A;  2BWV A;  2BHD A;  4IDY A;  2BWW A;  1WN1 A;  2Q95 A;  3PKB A;  4IPA A;  4IU6 A;  2GU5 A;  2IW2 A;  4Z7M A;  4U69 A;  1JAW A;  2OKN A;  5CIK A;  2GGC A;  4ZWO A;  3PN9 A;  4FKC A;  3MR1 A;  2B3H A;  4HXX A;  4IEC A;  3OVK A;  1BN5 A;  1W2M A;  2EVC A;  5JFR A;  5CE6 A;  4S00 A;  1XGN A;  2BHA A;  1R5G A;  2EVM A;  1CHM A;  2GG8 A;  2V6C A;  3BIQ A;  4IKS A;  2BB7 A;  1WKM A;  4MAT A;  4PNC A;  5CDV A;  2V3X A;  3PKA A;  2ADU A;  3IG4 A;  5D6F A;  2V3Z A;  1C22 A;  1KP0 A;  2Q93 A;  4FO8 A;  2Q94 A;  4IKT A;  5D6E A;  2NQ7 A;  4PV4 A;  2DFI A;  2GG7 A;  5E2C A;  2GG0 A;  2HOW A;  1WL6 A;  4U6Z A;  2GG5 A;  5FCH A;  2MAT A;  1R5H A;  5CLS A;  1WBQ A;  3RVA A;  2BH3 A;  2P98 A;  4FO7 A;  2BN7 A;  4U73 A;  2BWY A;  4ZWP A;  3FM3 A;  2ZSG A;  2GG3 A;  1WY2 A;  1QXY A;  4EGE A;  4R60 A;  4U6J A;  1XNZ A;  4IKU A;  4FUK A;  4A6V A;  2EA2 A;  4RZZ A;  1WL9 A;  3FMQ A;  3QOC A;  2BWU A;  3PEB A;  4FLI A;  4KM3 A;  1C23 A;  2B3K A;  2GA2 A;  3IL0 A;  1YW8 A;  2BHB A;  5E5B A;  4U6C A;  4A6W A;  4RZY A;  5CNX A;  2BWT A;  2P99 A;  4IKR A;  4U75 A;  4FLJ A;  4B28 A;  4RGZ 1;  2GG9 A;  1WLR A;  3MAT A;  4U1B A;  3IU7 A;  3OOO A;  2GG2 A;  3O5V A;  2BHC A;  3CTZ A;  2V3Y A;  1YW7 A;  3IU8 A;  3L7G A;  5JI6 A;  3D27 A;  4ZWU A;  2Q8K A;  2GTX A;  4OOK A;  1B59 A;  1XGM A;  2NQ6 A;  4U71 A;  1MAT A;  1C21 A;  3I7M A; 
#chains in the Genus database with same CATH homology
 3IU9 A;  1PV9 A;  1YVM A;  1XGO A;  3FMR A;  5FCF A;  2EA4 A;  3TB5 A;  2Q96 A;  1Y1N A;  4QR8 A;  1XGS A;  3CB6 A;  4U76 A;  4S2R P;  1BOA A;  3MX6 A;  3PKC A;  3CB5 A;  2GU7 A;  3ROR A;  2BWX A;  3S6B A;  5CDL A;  4U6W A;  3BIP A;  1C24 A;  1YJ3 A;  4U6E A;  1YW9 A;  1C27 A;  3PKD A;  3BIT A;  3Q6D A;  1KQ9 A;  1M35 A;  2GU4 A;  1KQ0 A;  3PKE A;  5JHU A;  1B6A A;  1W7V A;  4FLL A;  4S2T P;  4U70 A;  2EVO A;  2B3L A;  1O0X A;  4FLK A;  3L24 A;  2P9A A;  3TAV A;  5CDE A;  4S01 A;  1N51 A;  2GU6 A;  1QXZ A;  1R58 A;  2GGB A;  4JUQ A;  4IF7 A;  2BWS A;  1QXW A;  4ZNG A;  2OAZ A;  2Q92 A;  2GZ5 A;  1A16 A;  1QZY A;  2G6P A;  2BWV A;  2BHD A;  4IDY A;  2BWW A;  1WN1 A;  2Q95 A;  3PKB A;  4IPA A;  4IU6 A;  2GU5 A;  2IW2 A;  4Z7M A;  4U69 A;  1JAW A;  2OKN A;  5CIK A;  2GGC A;  4ZWO A;  3PN9 A;  4FKC A;  3MR1 A;  2B3H A;  4HXX A;  4IEC A;  3OVK A;  1BN5 A;  1W2M A;  2EVC A;  5JFR A;  5CE6 A;  4S00 A;  1XGN A;  2BHA A;  1R5G A;  2EVM A;  1CHM A;  2GG8 A;  2V6C A;  3BIQ A;  4IKS A;  2BB7 A;  1WKM A;  4MAT A;  4PNC A;  5CDV A;  2V3X A;  3PKA A;  2ADU A;  3IG4 A;  5D6F A;  2V3Z A;  1C22 A;  1KP0 A;  2Q93 A;  4FO8 A;  2Q94 A;  4IKT A;  5D6E A;  2NQ7 A;  4PV4 A;  2DFI A;  2GG7 A;  5E2C A;  2GG0 A;  2HOW A;  1WL6 A;  4U6Z A;  2GG5 A;  5FCH A;  2MAT A;  1R5H A;  5CLS A;  1WBQ A;  3RVA A;  2BH3 A;  2P98 A;  4FO7 A;  2BN7 A;  4U73 A;  2BWY A;  4ZWP A;  3FM3 A;  2ZSG A;  2GG3 A;  1WY2 A;  1QXY A;  4EGE A;  4R60 A;  4U6J A;  1XNZ A;  4IKU A;  4FUK A;  4A6V A;  2EA2 A;  4RZZ A;  1WL9 A;  3FMQ A;  3QOC A;  2BWU A;  3PEB A;  4FLI A;  4KM3 A;  1C23 A;  2B3K A;  2GA2 A;  3IL0 A;  1YW8 A;  2BHB A;  5E5B A;  4U6C A;  4A6W A;  4RZY A;  5CNX A;  2BWT A;  2P99 A;  4IKR A;  4U75 A;  4FLJ A;  4B28 A;  4RGZ 1;  2GG9 A;  1WLR A;  3MAT A;  4U1B A;  3IU7 A;  3OOO A;  2GG2 A;  3O5V A;  2BHC A;  3CTZ A;  2V3Y A;  1YW7 A;  3IU8 A;  3L7G A;  5JI6 A;  3D27 A;  4ZWU A;  2Q8K A;  2GTX A;  4OOK A;  1B59 A;  1XGM A;  2NQ6 A;  4U71 A;  1MAT A;  1C21 A;  3I7M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...