1WL6A

Mg-substituted form of e. coli aminopeptidase p
Total Genus 156
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
156
sequence length
440
structure length
440
Chain Sequence
SEISRQEFQRRRQALVEQMQPGSAALIFAAPEVTRSADSEYPYRQNSDFWYFTGFNEPEAVLVLIKSDDTHNHSVLFNRVRDLTAEIWFGRRLGQDAAPEKLGVDRALAFSEINQQLYQLLNGLDVVYHAQGEYAYADVIVNSALEKLRKGSRQNLTAPATMIDWRPVVHEMRLFKSPEEIAVLRRAGEITAMAHTRAMEKCRPGMFEYHLEGEIHHEFNRHGARYPSYNTIVGSGENGCILHYTENECEMRDGDLVLIDAGCEYKGYAGDITRTFPVNGKFTQAQREIYDIVLESLETSLRLYRPGTSILEVTGEVVRIMVSGLVKLGILKGDVDELIAQNAHRPFFMHGLSHWLGLDVHDVGVYGQDRSRILEPGMVLTVEPGLYIAPDAEVPEQYRGIGIRIEDDIVITETGNENLTASVVKKPEEIEALMVAARKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Xaa-Pro aminopeptidase
publication title Structural and functional implications of metal ion selection in aminopeptidase p, a metalloprotease with a dinuclear metal center
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 156
structure length 440
sequence length 440
ec nomenclature ec 3.4.11.9: Xaa-Pro aminopeptidase.
pdb deposition date 2004-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
A PF05195 AMP_N Aminopeptidase P, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 1wl6A01
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 1wl6A02
2P9AA 4U6ZA 4FO8A 3PKEA 5CLSA 2Q94A 1XGNA 1C21A 1XGOA 3BIPA 1WN1A 1B6AA 4RZYA 1XNZA 2GGBA 3RORA 5JI6A 2BWXA 2BWUA 4RGZ1 5JFRA 2IW2A 3I7MA 1WLRA 2BHAA 4U6EA 4U70A 4IKSA 1WL9A 3IG4A 1WL6A 2V3ZA 1KQ0A 5D6FA 1BN5A 3OVKA 3FMRA 4FO7A 3L24A 1QXYA 4IKTA 4KM3A 3IL0A 2GU5A 2BB7A 2EVCA 2NQ7A 3FMQA 3PKBA 4U1BA 2B3LA 4QR8A 3TAVA 2GG2A 4U75A 4S2TP 2OAZA 4FLJA 4U71A 1XGMA 1WY2A 1QZYA 4OOKA 1C24A 1YJ3A 5CDVA 2BWSA 2BWTA 2G6PA 1B59A 3MATA 5FCHA 2GU7A 1JAWA 2Q8KA 5E5BA 1C27A 4A6VA 4U6JA 2EVOA 2EVMA 2GG3A 3TB5A 3CB6A 4IECA 2EA2A 2B3HA 3PEBA 2Q92A 3OOOA 1W2MA 1R5HA 2HOWA 1N51A 1YW8A 2BHBA 4FLIA 4RZZA 3S6BA 2Q93A 2EA4A 3RVAA 3D27A 5CDEA 3IU8A 3BITA 4U6CA 4ZWUA 2OKNA 4MATA 2GGCA 1C23A 4IF7A 1PV9A 2NQ6A 4PNCA 2ZSGA 4A6WA 1M35A 1W7VA 2B3KA 4ZNGA 1YW7A 3FM3A 4IU6A 2BWYA 1YVMA 4FLKA 2BWVA 5JHUA 4ZWOA 5CIKA 2GA2A 1KQ9A 4U69A 4B28A 2MATA 3IU9A 2GG5A 5D6EA 2P99A 2V6CA 3CB5A 5CNXA 2BH3A 2GU4A 3MR1A 1BOAA 4FUKA 2GG8A 1A16A 4JUQA 4S2RP 3PKDA 1R5GA 3PKAA 3PKCA 1XGSA 2V3YA 2Q96A 4U6WA 1WKMA 4HXXA 2P98A 4FKCA 4S01A 2Q95A 2GZ5A 2GTXA 3IU7A 3Q6DA 4S00A 1Y1NA 1YW9A 2GG7A 3MX6A 5E2CA 4U76A 5FCFA 4ZWPA 4IDYA 3BIQA 4IKRA 1R58A 2BHDA 4EGEA 2BN7A 5CE6A 2GG9A 2DFIA 4PV4A 1O0XA 3QOCA 4IKUA 1CHMA 1MATA 2ADUA 5CDLA 3L7GA 2BWWA 2V3XA 4R60A 1WBQA 1QXZA 3O5VA 4IPAA 4FLLA 3CTZA 1KP0A 3PN9A 4Z7MA 1QXWA 1C22A 2BHCA 4U73A 2GG0A 2GU6A
chains in the Genus database with same CATH superfamily
2P9AA 4U6ZA 4FO8A 3PKEA 5CLSA 2Q94A 1XGNA 1C21A 1XGOA 3BIPA 1WN1A 1B6AA 4RZYA 1XNZA 2GGBA 3RORA 5JI6A 2BWXA 2BWUA 4RGZ1 5JFRA 2IW2A 3I7MA 1WLRA 2BHAA 4U6EA 4U70A 4IKSA 1WL9A 3IG4A 1WL6A 2V3ZA 1KQ0A 5D6FA 1BN5A 3OVKA 3FMRA 4FO7A 3L24A 1QXYA 4IKTA 4KM3A 3IL0A 2GU5A 2BB7A 2EVCA 2NQ7A 3FMQA 3PKBA 4U1BA 2B3LA 4QR8A 3TAVA 2GG2A 4U75A 4S2TP 2OAZA 4FLJA 4U71A 1XGMA 1WY2A 1QZYA 4OOKA 1C24A 1YJ3A 5CDVA 2BWSA 2BWTA 2G6PA 1B59A 3MATA 5FCHA 2GU7A 1JAWA 2Q8KA 5E5BA 1C27A 4A6VA 4U6JA 2EVOA 2EVMA 2GG3A 3TB5A 3CB6A 4IECA 2EA2A 2B3HA 3PEBA 2Q92A 3OOOA 1W2MA 1R5HA 2HOWA 1N51A 1YW8A 2BHBA 4FLIA 4RZZA 3S6BA 2Q93A 2EA4A 3RVAA 3D27A 5CDEA 3IU8A 3BITA 4U6CA 4ZWUA 2OKNA 4MATA 2GGCA 1C23A 4IF7A 1PV9A 2NQ6A 4PNCA 2ZSGA 4A6WA 1M35A 1W7VA 2B3KA 4ZNGA 1YW7A 3FM3A 4IU6A 2BWYA 1YVMA 4FLKA 2BWVA 5JHUA 4ZWOA 5CIKA 2GA2A 1KQ9A 4U69A 4B28A 2MATA 3IU9A 2GG5A 5D6EA 2P99A 2V6CA 3CB5A 5CNXA 2BH3A 2GU4A 3MR1A 1BOAA 4FUKA 2GG8A 1A16A 4JUQA 4S2RP 3PKDA 1R5GA 3PKAA 3PKCA 1XGSA 2V3YA 2Q96A 4U6WA 1WKMA 4HXXA 2P98A 4FKCA 4S01A 2Q95A 2GZ5A 2GTXA 3IU7A 3Q6DA 4S00A 1Y1NA 1YW9A 2GG7A 3MX6A 5E2CA 4U76A 5FCFA 4ZWPA 4IDYA 3BIQA 4IKRA 1R58A 2BHDA 4EGEA 2BN7A 5CE6A 2GG9A 2DFIA 4PV4A 1O0XA 3QOCA 4IKUA 1CHMA 1MATA 2ADUA 5CDLA 3L7GA 2BWWA 2V3XA 4R60A 1WBQA 1QXZA 3O5VA 4IPAA 4FLLA 3CTZA 1KP0A 3PN9A 4Z7MA 1QXWA 1C22A 2BHCA 4U73A 2GG0A 2GU6A
chains in the Genus database with same CATH topology
2P9AA 4U6ZA 4FO8A 3PKEA 5CLSA 2Q94A 1XGNA 1C21A 1XGOA 3BIPA 1WN1A 1B6AA 4RZYA 1XNZA 2GGBA 3RORA 5JI6A 2BWXA 2BWUA 4RGZ1 5JFRA 2IW2A 3I7MA 1WLRA 2BHAA 4U6EA 4U70A 4IKSA 1WL9A 3IG4A 1WL6A 2V3ZA 1KQ0A 5D6FA 1BN5A 3OVKA 3FMRA 4FO7A 3L24A 1QXYA 4IKTA 4KM3A 3IL0A 2GU5A 2BB7A 2EVCA 2NQ7A 3FMQA 3PKBA 4U1BA 2B3LA 4QR8A 3TAVA 2GG2A 4U75A 4S2TP 2OAZA 4FLJA 4U71A 1XGMA 1WY2A 1QZYA 4OOKA 1C24A 1YJ3A 5CDVA 2BWSA 2BWTA 2G6PA 1B59A 3MATA 5FCHA 2GU7A 1JAWA 2Q8KA 5E5BA 1C27A 4A6VA 4U6JA 2EVOA 2EVMA 2GG3A 3TB5A 3CB6A 4IECA 2EA2A 2B3HA 3PEBA 2Q92A 3OOOA 1W2MA 1R5HA 2HOWA 1N51A 1YW8A 2BHBA 4FLIA 4RZZA 3S6BA 2Q93A 2EA4A 3RVAA 3D27A 5CDEA 3IU8A 3BITA 4U6CA 4ZWUA 2OKNA 4MATA 2GGCA 1C23A 4IF7A 1PV9A 2NQ6A 4PNCA 2ZSGA 4A6WA 1M35A 1W7VA 2B3KA 4ZNGA 1YW7A 3FM3A 4IU6A 2BWYA 1YVMA 4FLKA 2BWVA 5JHUA 4ZWOA 5CIKA 2GA2A 1KQ9A 4U69A 4B28A 2MATA 3IU9A 2GG5A 5D6EA 2P99A 2V6CA 3CB5A 5CNXA 2BH3A 2GU4A 3MR1A 1BOAA 4FUKA 2GG8A 1A16A 4JUQA 4S2RP 3PKDA 1R5GA 3PKAA 3PKCA 1XGSA 2V3YA 2Q96A 4U6WA 1WKMA 4HXXA 2P98A 4FKCA 4S01A 2Q95A 2GZ5A 2GTXA 3IU7A 3Q6DA 4S00A 1Y1NA 1YW9A 2GG7A 3MX6A 5E2CA 4U76A 5FCFA 4ZWPA 4IDYA 3BIQA 4IKRA 1R58A 2BHDA 4EGEA 2BN7A 5CE6A 2GG9A 2DFIA 4PV4A 1O0XA 3QOCA 4IKUA 1CHMA 1MATA 2ADUA 5CDLA 3L7GA 2BWWA 2V3XA 4R60A 1WBQA 1QXZA 3O5VA 4IPAA 4FLLA 3CTZA 1KP0A 3PN9A 4Z7MA 1QXWA 1C22A 2BHCA 4U73A 2GG0A 2GU6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P9A A;  4U6Z A;  4FO8 A;  3PKE A;  5CLS A;  2Q94 A;  1XGN A;  1C21 A;  1XGO A;  3BIP A;  1WN1 A;  1B6A A;  4RZY A;  1XNZ A;  2GGB A;  3ROR A;  5JI6 A;  2BWX A;  2BWU A;  4RGZ 1;  5JFR A;  2IW2 A;  3I7M A;  1WLR A;  2BHA A;  4U6E A;  4U70 A;  4IKS A;  1WL9 A;  3IG4 A;  1WL6 A;  2V3Z A;  1KQ0 A;  5D6F A;  1BN5 A;  3OVK A;  3FMR A;  4FO7 A;  3L24 A;  1QXY A;  4IKT A;  4KM3 A;  3IL0 A;  2GU5 A;  2BB7 A;  2EVC A;  2NQ7 A;  3FMQ A;  3PKB A;  4U1B A;  2B3L A;  4QR8 A;  3TAV A;  2GG2 A;  4U75 A;  4S2T P;  2OAZ A;  4FLJ A;  4U71 A;  1XGM A;  1WY2 A;  1QZY A;  4OOK A;  1C24 A;  1YJ3 A;  5CDV A;  2BWS A;  2BWT A;  2G6P A;  1B59 A;  3MAT A;  5FCH A;  2GU7 A;  1JAW A;  2Q8K A;  5E5B A;  1C27 A;  4A6V A;  4U6J A;  2EVO A;  2EVM A;  2GG3 A;  3TB5 A;  3CB6 A;  4IEC A;  2EA2 A;  2B3H A;  3PEB A;  2Q92 A;  3OOO A;  1W2M A;  1R5H A;  2HOW A;  1N51 A;  1YW8 A;  2BHB A;  4FLI A;  4RZZ A;  3S6B A;  2Q93 A;  2EA4 A;  3RVA A;  3D27 A;  5CDE A;  3IU8 A;  3BIT A;  4U6C A;  4ZWU A;  2OKN A;  4MAT A;  2GGC A;  1C23 A;  4IF7 A;  1PV9 A;  2NQ6 A;  4PNC A;  2ZSG A;  4A6W A;  1M35 A;  1W7V A;  2B3K A;  4ZNG A;  1YW7 A;  3FM3 A;  4IU6 A;  2BWY A;  1YVM A;  4FLK A;  2BWV A;  5JHU A;  4ZWO A;  5CIK A;  2GA2 A;  1KQ9 A;  4U69 A;  4B28 A;  2MAT A;  3IU9 A;  2GG5 A;  5D6E A;  2P99 A;  2V6C A;  3CB5 A;  5CNX A;  2BH3 A;  2GU4 A;  3MR1 A;  1BOA A;  4FUK A;  2GG8 A;  1A16 A;  4JUQ A;  4S2R P;  3PKD A;  1R5G A;  3PKA A;  3PKC A;  1XGS A;  2V3Y A;  2Q96 A;  4U6W A;  1WKM A;  4HXX A;  2P98 A;  4FKC A;  4S01 A;  2Q95 A;  2GZ5 A;  2GTX A;  3IU7 A;  3Q6D A;  4S00 A;  1Y1N A;  1YW9 A;  2GG7 A;  3MX6 A;  5E2C A;  4U76 A;  5FCF A;  4ZWP A;  4IDY A;  3BIQ A;  4IKR A;  1R58 A;  2BHD A;  4EGE A;  2BN7 A;  5CE6 A;  2GG9 A;  2DFI A;  4PV4 A;  1O0X A;  3QOC A;  4IKU A;  1CHM A;  1MAT A;  2ADU A;  5CDL A;  3L7G A;  2BWW A;  2V3X A;  4R60 A;  1WBQ A;  1QXZ A;  3O5V A;  4IPA A;  4FLL A;  3CTZ A;  1KP0 A;  3PN9 A;  4Z7M A;  1QXW A;  1C22 A;  2BHC A;  4U73 A;  2GG0 A;  2GU6 A; 
#chains in the Genus database with same CATH topology
 2P9A A;  4U6Z A;  4FO8 A;  3PKE A;  5CLS A;  2Q94 A;  1XGN A;  1C21 A;  1XGO A;  3BIP A;  1WN1 A;  1B6A A;  4RZY A;  1XNZ A;  2GGB A;  3ROR A;  5JI6 A;  2BWX A;  2BWU A;  4RGZ 1;  5JFR A;  2IW2 A;  3I7M A;  1WLR A;  2BHA A;  4U6E A;  4U70 A;  4IKS A;  1WL9 A;  3IG4 A;  1WL6 A;  2V3Z A;  1KQ0 A;  5D6F A;  1BN5 A;  3OVK A;  3FMR A;  4FO7 A;  3L24 A;  1QXY A;  4IKT A;  4KM3 A;  3IL0 A;  2GU5 A;  2BB7 A;  2EVC A;  2NQ7 A;  3FMQ A;  3PKB A;  4U1B A;  2B3L A;  4QR8 A;  3TAV A;  2GG2 A;  4U75 A;  4S2T P;  2OAZ A;  4FLJ A;  4U71 A;  1XGM A;  1WY2 A;  1QZY A;  4OOK A;  1C24 A;  1YJ3 A;  5CDV A;  2BWS A;  2BWT A;  2G6P A;  1B59 A;  3MAT A;  5FCH A;  2GU7 A;  1JAW A;  2Q8K A;  5E5B A;  1C27 A;  4A6V A;  4U6J A;  2EVO A;  2EVM A;  2GG3 A;  3TB5 A;  3CB6 A;  4IEC A;  2EA2 A;  2B3H A;  3PEB A;  2Q92 A;  3OOO A;  1W2M A;  1R5H A;  2HOW A;  1N51 A;  1YW8 A;  2BHB A;  4FLI A;  4RZZ A;  3S6B A;  2Q93 A;  2EA4 A;  3RVA A;  3D27 A;  5CDE A;  3IU8 A;  3BIT A;  4U6C A;  4ZWU A;  2OKN A;  4MAT A;  2GGC A;  1C23 A;  4IF7 A;  1PV9 A;  2NQ6 A;  4PNC A;  2ZSG A;  4A6W A;  1M35 A;  1W7V A;  2B3K A;  4ZNG A;  1YW7 A;  3FM3 A;  4IU6 A;  2BWY A;  1YVM A;  4FLK A;  2BWV A;  5JHU A;  4ZWO A;  5CIK A;  2GA2 A;  1KQ9 A;  4U69 A;  4B28 A;  2MAT A;  3IU9 A;  2GG5 A;  5D6E A;  2P99 A;  2V6C A;  3CB5 A;  5CNX A;  2BH3 A;  2GU4 A;  3MR1 A;  1BOA A;  4FUK A;  2GG8 A;  1A16 A;  4JUQ A;  4S2R P;  3PKD A;  1R5G A;  3PKA A;  3PKC A;  1XGS A;  2V3Y A;  2Q96 A;  4U6W A;  1WKM A;  4HXX A;  2P98 A;  4FKC A;  4S01 A;  2Q95 A;  2GZ5 A;  2GTX A;  3IU7 A;  3Q6D A;  4S00 A;  1Y1N A;  1YW9 A;  2GG7 A;  3MX6 A;  5E2C A;  4U76 A;  5FCF A;  4ZWP A;  4IDY A;  3BIQ A;  4IKR A;  1R58 A;  2BHD A;  4EGE A;  2BN7 A;  5CE6 A;  2GG9 A;  2DFI A;  4PV4 A;  1O0X A;  3QOC A;  4IKU A;  1CHM A;  1MAT A;  2ADU A;  5CDL A;  3L7G A;  2BWW A;  2V3X A;  4R60 A;  1WBQ A;  1QXZ A;  3O5V A;  4IPA A;  4FLL A;  3CTZ A;  1KP0 A;  3PN9 A;  4Z7M A;  1QXW A;  1C22 A;  2BHC A;  4U73 A;  2GG0 A;  2GU6 A; 
#chains in the Genus database with same CATH homology
 2P9A A;  4U6Z A;  4FO8 A;  3PKE A;  5CLS A;  2Q94 A;  1XGN A;  1C21 A;  1XGO A;  3BIP A;  1WN1 A;  1B6A A;  4RZY A;  1XNZ A;  2GGB A;  3ROR A;  5JI6 A;  2BWX A;  2BWU A;  4RGZ 1;  5JFR A;  2IW2 A;  3I7M A;  1WLR A;  2BHA A;  4U6E A;  4U70 A;  4IKS A;  1WL9 A;  3IG4 A;  1WL6 A;  2V3Z A;  1KQ0 A;  5D6F A;  1BN5 A;  3OVK A;  3FMR A;  4FO7 A;  3L24 A;  1QXY A;  4IKT A;  4KM3 A;  3IL0 A;  2GU5 A;  2BB7 A;  2EVC A;  2NQ7 A;  3FMQ A;  3PKB A;  4U1B A;  2B3L A;  4QR8 A;  3TAV A;  2GG2 A;  4U75 A;  4S2T P;  2OAZ A;  4FLJ A;  4U71 A;  1XGM A;  1WY2 A;  1QZY A;  4OOK A;  1C24 A;  1YJ3 A;  5CDV A;  2BWS A;  2BWT A;  2G6P A;  1B59 A;  3MAT A;  5FCH A;  2GU7 A;  1JAW A;  2Q8K A;  5E5B A;  1C27 A;  4A6V A;  4U6J A;  2EVO A;  2EVM A;  2GG3 A;  3TB5 A;  3CB6 A;  4IEC A;  2EA2 A;  2B3H A;  3PEB A;  2Q92 A;  3OOO A;  1W2M A;  1R5H A;  2HOW A;  1N51 A;  1YW8 A;  2BHB A;  4FLI A;  4RZZ A;  3S6B A;  2Q93 A;  2EA4 A;  3RVA A;  3D27 A;  5CDE A;  3IU8 A;  3BIT A;  4U6C A;  4ZWU A;  2OKN A;  4MAT A;  2GGC A;  1C23 A;  4IF7 A;  1PV9 A;  2NQ6 A;  4PNC A;  2ZSG A;  4A6W A;  1M35 A;  1W7V A;  2B3K A;  4ZNG A;  1YW7 A;  3FM3 A;  4IU6 A;  2BWY A;  1YVM A;  4FLK A;  2BWV A;  5JHU A;  4ZWO A;  5CIK A;  2GA2 A;  1KQ9 A;  4U69 A;  4B28 A;  2MAT A;  3IU9 A;  2GG5 A;  5D6E A;  2P99 A;  2V6C A;  3CB5 A;  5CNX A;  2BH3 A;  2GU4 A;  3MR1 A;  1BOA A;  4FUK A;  2GG8 A;  1A16 A;  4JUQ A;  4S2R P;  3PKD A;  1R5G A;  3PKA A;  3PKC A;  1XGS A;  2V3Y A;  2Q96 A;  4U6W A;  1WKM A;  4HXX A;  2P98 A;  4FKC A;  4S01 A;  2Q95 A;  2GZ5 A;  2GTX A;  3IU7 A;  3Q6D A;  4S00 A;  1Y1N A;  1YW9 A;  2GG7 A;  3MX6 A;  5E2C A;  4U76 A;  5FCF A;  4ZWP A;  4IDY A;  3BIQ A;  4IKR A;  1R58 A;  2BHD A;  4EGE A;  2BN7 A;  5CE6 A;  2GG9 A;  2DFI A;  4PV4 A;  1O0X A;  3QOC A;  4IKU A;  1CHM A;  1MAT A;  2ADU A;  5CDL A;  3L7G A;  2BWW A;  2V3X A;  4R60 A;  1WBQ A;  1QXZ A;  3O5V A;  4IPA A;  4FLL A;  3CTZ A;  1KP0 A;  3PN9 A;  4Z7M A;  1QXW A;  1C22 A;  2BHC A;  4U73 A;  2GG0 A;  2GU6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...