1WL6A

Mg-substituted form of e. coli aminopeptidase p
Total Genus 156
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
156
sequence length
440
structure length
440
Chain Sequence
b'SEISRQEFQRRRQALVEQMQPGSAALIFAAPEVTRSADSEYPYRQNSDFWYFTGFNEPEAVLVLIKSDDTHNHSVLFNRVRDLTAEIWFGRRLGQDAAPEKLGVDRALAFSEINQQLYQLLNGLDVVYHAQGEYAYADVIVNSALEKLRKGSRQNLTAPATMIDWRPVVHEMRLFKSPEEIAVLRRAGEITAMAHTRAMEKCRPGMFEYHLEGEIHHEFNRHGARYPSYNTIVGSGENGCILHYTENECEMRDGDLVLIDAGCEYKGYAGDITRTFPVNGKFTQAQREIYDIVLESLETSLRLYRPGTSILEVTGEVVRIMVSGLVKLGILKGDVDELIAQNAHRPFFMHGLSHWLGLDVHDVGVYGQDRSRILEPGMVLTVEPGLYIAPDAEVPEQYRGIGIRIEDDIVITETGNENLTASVVKKPEEIEALMVAARKQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Xaa-Pro aminopeptidase
publication title Structural and functional implications of metal ion selection in aminopeptidase p, a metalloprotease with a dinuclear metal center
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 156
structure length 440
sequence length 440
ec nomenclature ec 3.4.11.9: Xaa-Pro aminopeptidase.
pdb deposition date 2004-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
A PF05195 AMP_N Aminopeptidase P, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 1wl6A01
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 1wl6A02
2GG2A 4U6WA 4JUQA 2BHBA 2B3LA 1WLRA 2Q8KA 1M35A 4U69A 2GU7A 3OOOA 4A6WA 1XGNA 2BWVA 4IKSA 3FMRA 2GU6A 4B28A 2Q96A 3IG4A 4RZYA 2Q92A 1CHMA 3CB6A 3TB5A 2GTXA 2ZSGA 4ZWPA 1C24A 5JI6A 1B6AA 2OAZA 4U6ZA 3IU8A 3QOCA 2B3HA 1B59A 2NQ6A 1MATA 3CB5A 3BIPA 2P9AA 2GG7A 1YVMA 1W7VA 1WY2A 3MX6A 1C27A 3PKEA 4U6JA 3IU7A 1YJ3A 3PKDA 5D6EA 4FO7A 4IECA 1N51A 2BWUA 3CTZA 4A6VA 1QZYA 3BITA 1A16A 2DFIA 4FLIA 4PNCA 1W2MA 3Q6DA 4R60A 1WL9A 2HOWA 3TAVA 2GA2A 2Q93A 1O0XA 1C21A 2EVMA 4U73A 4U76A 1BN5A 2V3YA 1C22A 4Z7MA 1C23A 1JAWA 1YW7A 3RVAA 4IKTA 4U70A 2GGCA 1KQ0A 1R5GA 1PV9A 4PV4A 2GG5A 2NQ7A 4HXXA 5CNXA 4IPAA 4S00A 5CDEA 2BH3A 4S2TP 1XGMA 5CLSA 1QXYA 2Q94A 2EVCA 2IW2A 1YW9A 4ZNGA 2GG3A 1WL6A 3O5VA 2MATA 3PKBA 3IL0A 4FKCA 1XGOA 4FLKA 4FO8A 2BHCA 4S2RP 3S6BA 3FM3A 1XNZA 3MR1A 4RGZ1 4ZWUA 4U75A 3L7GA 4U71A 2B3KA 5E2CA 1QXWA 5FCHA 5FCFA 4ZWOA 3IU9A 3L24A 1YW8A 4U6CA 1QXZA 3BIQA 4IU6A 4S01A 5CDVA 1WN1A 2OKNA 2G6PA 2EA2A 4IDYA 3RORA 2P98A 5E5BA 2ADUA 2BHAA 4EGEA 4FLLA 2EA4A 4U1BA 1WBQA 2GZ5A 1R5HA 2Q95A 5JHUA 1KQ9A 4IKUA 2V3XA 4U6EA 1R58A 3OVKA 2BB7A 4RZZA 3FMQA 4FUKA 4OOKA 5CIKA 1KP0A 3PN9A 3PKCA 2BWYA 4IKRA 2BWTA 4IF7A 2EVOA 2BWWA 4MATA 1XGSA 1BOAA 1WKMA 5D6FA 1Y1NA 2GG0A 3D27A 3I7MA 4QR8A 2GU5A 5JFRA 3MATA 2V3ZA 5CE6A 4FLJA 2GGBA 2GU4A 4KM3A 2BWSA 3PKAA 2P99A 2BHDA 2V6CA 5CDLA 2BWXA 2GG8A 2GG9A 2BN7A 3PEBA
chains in the Genus database with same CATH superfamily
2GG2A 4U6WA 4JUQA 2BHBA 2B3LA 1WLRA 2Q8KA 1M35A 4U69A 2GU7A 3OOOA 4A6WA 1XGNA 2BWVA 4IKSA 3FMRA 2GU6A 4B28A 2Q96A 3IG4A 4RZYA 2Q92A 1CHMA 3CB6A 3TB5A 2GTXA 2ZSGA 4ZWPA 1C24A 5JI6A 1B6AA 2OAZA 4U6ZA 3IU8A 3QOCA 2B3HA 1B59A 2NQ6A 1MATA 3CB5A 3BIPA 2P9AA 2GG7A 1YVMA 1W7VA 1WY2A 3MX6A 1C27A 3PKEA 4U6JA 3IU7A 1YJ3A 3PKDA 5D6EA 4FO7A 4IECA 1N51A 2BWUA 3CTZA 4A6VA 1QZYA 3BITA 1A16A 2DFIA 4FLIA 4PNCA 1W2MA 3Q6DA 4R60A 1WL9A 2HOWA 3TAVA 2GA2A 2Q93A 1O0XA 1C21A 2EVMA 4U73A 4U76A 1BN5A 2V3YA 1C22A 4Z7MA 1C23A 1JAWA 1YW7A 3RVAA 4IKTA 4U70A 2GGCA 1KQ0A 1R5GA 1PV9A 4PV4A 2GG5A 2NQ7A 4HXXA 5CNXA 4IPAA 4S00A 5CDEA 2BH3A 4S2TP 1XGMA 5CLSA 1QXYA 2Q94A 2EVCA 2IW2A 1YW9A 4ZNGA 2GG3A 1WL6A 3O5VA 2MATA 3PKBA 3IL0A 4FKCA 1XGOA 4FLKA 4FO8A 2BHCA 4S2RP 3S6BA 3FM3A 1XNZA 3MR1A 4RGZ1 4ZWUA 4U75A 3L7GA 4U71A 2B3KA 5E2CA 1QXWA 5FCHA 5FCFA 4ZWOA 3IU9A 3L24A 1YW8A 4U6CA 1QXZA 3BIQA 4IU6A 4S01A 5CDVA 1WN1A 2OKNA 2G6PA 2EA2A 4IDYA 3RORA 2P98A 5E5BA 2ADUA 2BHAA 4EGEA 4FLLA 2EA4A 4U1BA 1WBQA 2GZ5A 1R5HA 2Q95A 5JHUA 1KQ9A 4IKUA 2V3XA 4U6EA 1R58A 3OVKA 2BB7A 4RZZA 3FMQA 4FUKA 4OOKA 5CIKA 1KP0A 3PN9A 3PKCA 2BWYA 4IKRA 2BWTA 4IF7A 2EVOA 2BWWA 4MATA 1XGSA 1BOAA 1WKMA 5D6FA 1Y1NA 2GG0A 3D27A 3I7MA 4QR8A 2GU5A 5JFRA 3MATA 2V3ZA 5CE6A 4FLJA 2GGBA 2GU4A 4KM3A 2BWSA 3PKAA 2P99A 2BHDA 2V6CA 5CDLA 2BWXA 2GG8A 2GG9A 2BN7A 3PEBA
chains in the Genus database with same CATH topology
2GG2A 4U6WA 4JUQA 2BHBA 2B3LA 1WLRA 2Q8KA 1M35A 4U69A 2GU7A 3OOOA 4A6WA 1XGNA 2BWVA 4IKSA 3FMRA 2GU6A 4B28A 2Q96A 3IG4A 4RZYA 2Q92A 1CHMA 3CB6A 3TB5A 2GTXA 2ZSGA 4ZWPA 1C24A 5JI6A 1B6AA 2OAZA 4U6ZA 3IU8A 3QOCA 2B3HA 1B59A 2NQ6A 1MATA 3CB5A 3BIPA 2P9AA 2GG7A 1YVMA 1W7VA 1WY2A 3MX6A 1C27A 3PKEA 4U6JA 3IU7A 1YJ3A 3PKDA 5D6EA 4FO7A 4IECA 1N51A 2BWUA 3CTZA 4A6VA 1QZYA 3BITA 1A16A 2DFIA 4FLIA 4PNCA 1W2MA 3Q6DA 4R60A 1WL9A 2HOWA 3TAVA 2GA2A 2Q93A 1O0XA 1C21A 2EVMA 4U73A 4U76A 1BN5A 2V3YA 1C22A 4Z7MA 1C23A 1JAWA 1YW7A 3RVAA 4IKTA 4U70A 2GGCA 1KQ0A 1R5GA 1PV9A 4PV4A 2GG5A 2NQ7A 4HXXA 5CNXA 4IPAA 4S00A 5CDEA 2BH3A 4S2TP 1XGMA 5CLSA 1QXYA 2Q94A 2EVCA 2IW2A 1YW9A 4ZNGA 2GG3A 1WL6A 3O5VA 2MATA 3PKBA 3IL0A 4FKCA 1XGOA 4FLKA 4FO8A 2BHCA 4S2RP 3S6BA 3FM3A 1XNZA 3MR1A 4RGZ1 4ZWUA 4U75A 3L7GA 4U71A 2B3KA 5E2CA 1QXWA 5FCHA 5FCFA 4ZWOA 3IU9A 3L24A 1YW8A 4U6CA 1QXZA 3BIQA 4IU6A 4S01A 5CDVA 1WN1A 2OKNA 2G6PA 2EA2A 4IDYA 3RORA 2P98A 5E5BA 2ADUA 2BHAA 4EGEA 4FLLA 2EA4A 4U1BA 1WBQA 2GZ5A 1R5HA 2Q95A 5JHUA 1KQ9A 4IKUA 2V3XA 4U6EA 1R58A 3OVKA 2BB7A 4RZZA 3FMQA 4FUKA 4OOKA 5CIKA 1KP0A 3PN9A 3PKCA 2BWYA 4IKRA 2BWTA 4IF7A 2EVOA 2BWWA 4MATA 1XGSA 1BOAA 1WKMA 5D6FA 1Y1NA 2GG0A 3D27A 3I7MA 4QR8A 2GU5A 5JFRA 3MATA 2V3ZA 5CE6A 4FLJA 2GGBA 2GU4A 4KM3A 2BWSA 3PKAA 2P99A 2BHDA 2V6CA 5CDLA 2BWXA 2GG8A 2GG9A 2BN7A 3PEBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GG2 A;  4U6W A;  4JUQ A;  2BHB A;  2B3L A;  1WLR A;  2Q8K A;  1M35 A;  4U69 A;  2GU7 A;  3OOO A;  4A6W A;  1XGN A;  2BWV A;  4IKS A;  3FMR A;  2GU6 A;  4B28 A;  2Q96 A;  3IG4 A;  4RZY A;  2Q92 A;  1CHM A;  3CB6 A;  3TB5 A;  2GTX A;  2ZSG A;  4ZWP A;  1C24 A;  5JI6 A;  1B6A A;  2OAZ A;  4U6Z A;  3IU8 A;  3QOC A;  2B3H A;  1B59 A;  2NQ6 A;  1MAT A;  3CB5 A;  3BIP A;  2P9A A;  2GG7 A;  1YVM A;  1W7V A;  1WY2 A;  3MX6 A;  1C27 A;  3PKE A;  4U6J A;  3IU7 A;  1YJ3 A;  3PKD A;  5D6E A;  4FO7 A;  4IEC A;  1N51 A;  2BWU A;  3CTZ A;  4A6V A;  1QZY A;  3BIT A;  1A16 A;  2DFI A;  4FLI A;  4PNC A;  1W2M A;  3Q6D A;  4R60 A;  1WL9 A;  2HOW A;  3TAV A;  2GA2 A;  2Q93 A;  1O0X A;  1C21 A;  2EVM A;  4U73 A;  4U76 A;  1BN5 A;  2V3Y A;  1C22 A;  4Z7M A;  1C23 A;  1JAW A;  1YW7 A;  3RVA A;  4IKT A;  4U70 A;  2GGC A;  1KQ0 A;  1R5G A;  1PV9 A;  4PV4 A;  2GG5 A;  2NQ7 A;  4HXX A;  5CNX A;  4IPA A;  4S00 A;  5CDE A;  2BH3 A;  4S2T P;  1XGM A;  5CLS A;  1QXY A;  2Q94 A;  2EVC A;  2IW2 A;  1YW9 A;  4ZNG A;  2GG3 A;  1WL6 A;  3O5V A;  2MAT A;  3PKB A;  3IL0 A;  4FKC A;  1XGO A;  4FLK A;  4FO8 A;  2BHC A;  4S2R P;  3S6B A;  3FM3 A;  1XNZ A;  3MR1 A;  4RGZ 1;  4ZWU A;  4U75 A;  3L7G A;  4U71 A;  2B3K A;  5E2C A;  1QXW A;  5FCH A;  5FCF A;  4ZWO A;  3IU9 A;  3L24 A;  1YW8 A;  4U6C A;  1QXZ A;  3BIQ A;  4IU6 A;  4S01 A;  5CDV A;  1WN1 A;  2OKN A;  2G6P A;  2EA2 A;  4IDY A;  3ROR A;  2P98 A;  5E5B A;  2ADU A;  2BHA A;  4EGE A;  4FLL A;  2EA4 A;  4U1B A;  1WBQ A;  2GZ5 A;  1R5H A;  2Q95 A;  5JHU A;  1KQ9 A;  4IKU A;  2V3X A;  4U6E A;  1R58 A;  3OVK A;  2BB7 A;  4RZZ A;  3FMQ A;  4FUK A;  4OOK A;  5CIK A;  1KP0 A;  3PN9 A;  3PKC A;  2BWY A;  4IKR A;  2BWT A;  4IF7 A;  2EVO A;  2BWW A;  4MAT A;  1XGS A;  1BOA A;  1WKM A;  5D6F A;  1Y1N A;  2GG0 A;  3D27 A;  3I7M A;  4QR8 A;  2GU5 A;  5JFR A;  3MAT A;  2V3Z A;  5CE6 A;  4FLJ A;  2GGB A;  2GU4 A;  4KM3 A;  2BWS A;  3PKA A;  2P99 A;  2BHD A;  2V6C A;  5CDL A;  2BWX A;  2GG8 A;  2GG9 A;  2BN7 A;  3PEB A; 
#chains in the Genus database with same CATH topology
 2GG2 A;  4U6W A;  4JUQ A;  2BHB A;  2B3L A;  1WLR A;  2Q8K A;  1M35 A;  4U69 A;  2GU7 A;  3OOO A;  4A6W A;  1XGN A;  2BWV A;  4IKS A;  3FMR A;  2GU6 A;  4B28 A;  2Q96 A;  3IG4 A;  4RZY A;  2Q92 A;  1CHM A;  3CB6 A;  3TB5 A;  2GTX A;  2ZSG A;  4ZWP A;  1C24 A;  5JI6 A;  1B6A A;  2OAZ A;  4U6Z A;  3IU8 A;  3QOC A;  2B3H A;  1B59 A;  2NQ6 A;  1MAT A;  3CB5 A;  3BIP A;  2P9A A;  2GG7 A;  1YVM A;  1W7V A;  1WY2 A;  3MX6 A;  1C27 A;  3PKE A;  4U6J A;  3IU7 A;  1YJ3 A;  3PKD A;  5D6E A;  4FO7 A;  4IEC A;  1N51 A;  2BWU A;  3CTZ A;  4A6V A;  1QZY A;  3BIT A;  1A16 A;  2DFI A;  4FLI A;  4PNC A;  1W2M A;  3Q6D A;  4R60 A;  1WL9 A;  2HOW A;  3TAV A;  2GA2 A;  2Q93 A;  1O0X A;  1C21 A;  2EVM A;  4U73 A;  4U76 A;  1BN5 A;  2V3Y A;  1C22 A;  4Z7M A;  1C23 A;  1JAW A;  1YW7 A;  3RVA A;  4IKT A;  4U70 A;  2GGC A;  1KQ0 A;  1R5G A;  1PV9 A;  4PV4 A;  2GG5 A;  2NQ7 A;  4HXX A;  5CNX A;  4IPA A;  4S00 A;  5CDE A;  2BH3 A;  4S2T P;  1XGM A;  5CLS A;  1QXY A;  2Q94 A;  2EVC A;  2IW2 A;  1YW9 A;  4ZNG A;  2GG3 A;  1WL6 A;  3O5V A;  2MAT A;  3PKB A;  3IL0 A;  4FKC A;  1XGO A;  4FLK A;  4FO8 A;  2BHC A;  4S2R P;  3S6B A;  3FM3 A;  1XNZ A;  3MR1 A;  4RGZ 1;  4ZWU A;  4U75 A;  3L7G A;  4U71 A;  2B3K A;  5E2C A;  1QXW A;  5FCH A;  5FCF A;  4ZWO A;  3IU9 A;  3L24 A;  1YW8 A;  4U6C A;  1QXZ A;  3BIQ A;  4IU6 A;  4S01 A;  5CDV A;  1WN1 A;  2OKN A;  2G6P A;  2EA2 A;  4IDY A;  3ROR A;  2P98 A;  5E5B A;  2ADU A;  2BHA A;  4EGE A;  4FLL A;  2EA4 A;  4U1B A;  1WBQ A;  2GZ5 A;  1R5H A;  2Q95 A;  5JHU A;  1KQ9 A;  4IKU A;  2V3X A;  4U6E A;  1R58 A;  3OVK A;  2BB7 A;  4RZZ A;  3FMQ A;  4FUK A;  4OOK A;  5CIK A;  1KP0 A;  3PN9 A;  3PKC A;  2BWY A;  4IKR A;  2BWT A;  4IF7 A;  2EVO A;  2BWW A;  4MAT A;  1XGS A;  1BOA A;  1WKM A;  5D6F A;  1Y1N A;  2GG0 A;  3D27 A;  3I7M A;  4QR8 A;  2GU5 A;  5JFR A;  3MAT A;  2V3Z A;  5CE6 A;  4FLJ A;  2GGB A;  2GU4 A;  4KM3 A;  2BWS A;  3PKA A;  2P99 A;  2BHD A;  2V6C A;  5CDL A;  2BWX A;  2GG8 A;  2GG9 A;  2BN7 A;  3PEB A; 
#chains in the Genus database with same CATH homology
 2GG2 A;  4U6W A;  4JUQ A;  2BHB A;  2B3L A;  1WLR A;  2Q8K A;  1M35 A;  4U69 A;  2GU7 A;  3OOO A;  4A6W A;  1XGN A;  2BWV A;  4IKS A;  3FMR A;  2GU6 A;  4B28 A;  2Q96 A;  3IG4 A;  4RZY A;  2Q92 A;  1CHM A;  3CB6 A;  3TB5 A;  2GTX A;  2ZSG A;  4ZWP A;  1C24 A;  5JI6 A;  1B6A A;  2OAZ A;  4U6Z A;  3IU8 A;  3QOC A;  2B3H A;  1B59 A;  2NQ6 A;  1MAT A;  3CB5 A;  3BIP A;  2P9A A;  2GG7 A;  1YVM A;  1W7V A;  1WY2 A;  3MX6 A;  1C27 A;  3PKE A;  4U6J A;  3IU7 A;  1YJ3 A;  3PKD A;  5D6E A;  4FO7 A;  4IEC A;  1N51 A;  2BWU A;  3CTZ A;  4A6V A;  1QZY A;  3BIT A;  1A16 A;  2DFI A;  4FLI A;  4PNC A;  1W2M A;  3Q6D A;  4R60 A;  1WL9 A;  2HOW A;  3TAV A;  2GA2 A;  2Q93 A;  1O0X A;  1C21 A;  2EVM A;  4U73 A;  4U76 A;  1BN5 A;  2V3Y A;  1C22 A;  4Z7M A;  1C23 A;  1JAW A;  1YW7 A;  3RVA A;  4IKT A;  4U70 A;  2GGC A;  1KQ0 A;  1R5G A;  1PV9 A;  4PV4 A;  2GG5 A;  2NQ7 A;  4HXX A;  5CNX A;  4IPA A;  4S00 A;  5CDE A;  2BH3 A;  4S2T P;  1XGM A;  5CLS A;  1QXY A;  2Q94 A;  2EVC A;  2IW2 A;  1YW9 A;  4ZNG A;  2GG3 A;  1WL6 A;  3O5V A;  2MAT A;  3PKB A;  3IL0 A;  4FKC A;  1XGO A;  4FLK A;  4FO8 A;  2BHC A;  4S2R P;  3S6B A;  3FM3 A;  1XNZ A;  3MR1 A;  4RGZ 1;  4ZWU A;  4U75 A;  3L7G A;  4U71 A;  2B3K A;  5E2C A;  1QXW A;  5FCH A;  5FCF A;  4ZWO A;  3IU9 A;  3L24 A;  1YW8 A;  4U6C A;  1QXZ A;  3BIQ A;  4IU6 A;  4S01 A;  5CDV A;  1WN1 A;  2OKN A;  2G6P A;  2EA2 A;  4IDY A;  3ROR A;  2P98 A;  5E5B A;  2ADU A;  2BHA A;  4EGE A;  4FLL A;  2EA4 A;  4U1B A;  1WBQ A;  2GZ5 A;  1R5H A;  2Q95 A;  5JHU A;  1KQ9 A;  4IKU A;  2V3X A;  4U6E A;  1R58 A;  3OVK A;  2BB7 A;  4RZZ A;  3FMQ A;  4FUK A;  4OOK A;  5CIK A;  1KP0 A;  3PN9 A;  3PKC A;  2BWY A;  4IKR A;  2BWT A;  4IF7 A;  2EVO A;  2BWW A;  4MAT A;  1XGS A;  1BOA A;  1WKM A;  5D6F A;  1Y1N A;  2GG0 A;  3D27 A;  3I7M A;  4QR8 A;  2GU5 A;  5JFR A;  3MAT A;  2V3Z A;  5CE6 A;  4FLJ A;  2GGB A;  2GU4 A;  4KM3 A;  2BWS A;  3PKA A;  2P99 A;  2BHD A;  2V6C A;  5CDL A;  2BWX A;  2GG8 A;  2GG9 A;  2BN7 A;  3PEB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...