1WL6A

Mg-substituted form of e. coli aminopeptidase p
Total Genus 156
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
156
sequence length
440
structure length
440
Chain Sequence
SEISRQEFQRRRQALVEQMQPGSAALIFAAPEVTRSADSEYPYRQNSDFWYFTGFNEPEAVLVLIKSDDTHNHSVLFNRVRDLTAEIWFGRRLGQDAAPEKLGVDRALAFSEINQQLYQLLNGLDVVYHAQGEYAYADVIVNSALEKLRKGSRQNLTAPATMIDWRPVVHEMRLFKSPEEIAVLRRAGEITAMAHTRAMEKCRPGMFEYHLEGEIHHEFNRHGARYPSYNTIVGSGENGCILHYTENECEMRDGDLVLIDAGCEYKGYAGDITRTFPVNGKFTQAQREIYDIVLESLETSLRLYRPGTSILEVTGEVVRIMVSGLVKLGILKGDVDELIAQNAHRPFFMHGLSHWLGLDVHDVGVYGQDRSRILEPGMVLTVEPGLYIAPDAEVPEQYRGIGIRIEDDIVITETGNENLTASVVKKPEEIEALMVAARKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Xaa-Pro aminopeptidase
publication title Structural and functional implications of metal ion selection in aminopeptidase p, a metalloprotease with a dinuclear metal center
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 156
structure length 440
sequence length 440
ec nomenclature ec 3.4.11.9: Xaa-Pro aminopeptidase.
pdb deposition date 2004-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
A PF05195 AMP_N Aminopeptidase P, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 1wl6A01
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 1wl6A02
2GG9A 5E5BA 2NQ6A 1XGOA 3FMQA 3BIQA 1CHMA 4ZWPA 1KP0A 4A6VA 4B28A 2B3KA 5D6FA 4R60A 4U6CA 3PEBA 2OKNA 2EVOA 2Q96A 4FKCA 2GG8A 4FLKA 3I7MA 4ZNGA 1WL6A 2B3LA 5CDEA 2Q92A 4FUKA 1XGNA 2ZSGA 3TAVA 2GU4A 2BWSA 4IKUA 2G6PA 1B6AA 2EA4A 2Q95A 3D27A 3S6BA 4KM3A 4RGZ1 3PKBA 2EA2A 2GTXA 2BHBA 2P98A 2BB7A 2GZ5A 1WN1A 3CB6A 2BWTA 3BITA 3QOCA 4HXXA 1Y1NA 2EVCA 2DFIA 2V3YA 2BWVA 4U70A 4FO7A 5JI6A 3L24A 3O5VA 3IL0A 2BHAA 2Q8KA 5CDVA 2GG3A 4IPAA 1R58A 3IG4A 2V6CA 3IU8A 1QXYA 1XGMA 3OOOA 2P99A 2GU5A 2MATA 4FO8A 2BWWA 4PNCA 2BN7A 5JFRA 3PKCA 1XGSA 1C22A 5CNXA 1O0XA 4U6JA 5FCFA 1YW8A 4S00A 2GU6A 4IDYA 3FM3A 4MATA 1WY2A 4U76A 1W7VA 5CIKA 3RVAA 4U6WA 4U6ZA 3IU7A 1YJ3A 5CE6A 3MATA 4U6EA 2IW2A 2BH3A 4IKTA 3OVKA 1KQ9A 4OOKA 2V3ZA 4PV4A 4EGEA 2GU7A 4FLLA 4QR8A 4U73A 5E2CA 1KQ0A 4JUQA 4Z7MA 1QXWA 2GA2A 1XNZA 2B3HA 1JAWA 2BWYA 3PN9A 1YW9A 2NQ7A 1WKMA 4IECA 2BWUA 4FLIA 5JHUA 1R5GA 2GG0A 5FCHA 1WL9A 4S2RP 1R5HA 2BHDA 2HOWA 3CTZA 1WLRA 2EVMA 2GG7A 5D6EA 3CB5A 1BN5A 3BIPA 3TB5A 3MR1A 4RZYA 1QXZA 4U1BA 5CDLA 2GGCA 5CLSA 3MX6A 1YW7A 3PKEA 1A16A 4S2TP 3IU9A 4FLJA 4IKSA 1C21A 3FMRA 4IF7A 2Q94A 2GG5A 4ZWUA 4IU6A 3PKAA 2V3XA 1W2MA 2GGBA 3PKDA 1M35A 4U75A 4A6WA 3Q6DA 1YVMA 4U71A 1WBQA 2BHCA 2Q93A 4IKRA 1BOAA 1PV9A 1MATA 2P9AA 1C24A 2ADUA 4RZZA 3L7GA 4ZWOA 1B59A 1C27A 2GG2A 2OAZA 1QZYA 2BWXA 1C23A 4S01A 1N51A 3RORA 4U69A
chains in the Genus database with same CATH superfamily
2GG9A 5E5BA 2NQ6A 1XGOA 3FMQA 3BIQA 1CHMA 4ZWPA 1KP0A 4A6VA 4B28A 2B3KA 5D6FA 4R60A 4U6CA 3PEBA 2OKNA 2EVOA 2Q96A 4FKCA 2GG8A 4FLKA 3I7MA 4ZNGA 1WL6A 2B3LA 5CDEA 2Q92A 4FUKA 1XGNA 2ZSGA 3TAVA 2GU4A 2BWSA 4IKUA 2G6PA 1B6AA 2EA4A 2Q95A 3D27A 3S6BA 4KM3A 4RGZ1 3PKBA 2EA2A 2GTXA 2BHBA 2P98A 2BB7A 2GZ5A 1WN1A 3CB6A 2BWTA 3BITA 3QOCA 4HXXA 1Y1NA 2EVCA 2DFIA 2V3YA 2BWVA 4U70A 4FO7A 5JI6A 3L24A 3O5VA 3IL0A 2BHAA 2Q8KA 5CDVA 2GG3A 4IPAA 1R58A 3IG4A 2V6CA 3IU8A 1QXYA 1XGMA 3OOOA 2P99A 2GU5A 2MATA 4FO8A 2BWWA 4PNCA 2BN7A 5JFRA 3PKCA 1XGSA 1C22A 5CNXA 1O0XA 4U6JA 5FCFA 1YW8A 4S00A 2GU6A 4IDYA 3FM3A 4MATA 1WY2A 4U76A 1W7VA 5CIKA 3RVAA 4U6WA 4U6ZA 3IU7A 1YJ3A 5CE6A 3MATA 4U6EA 2IW2A 2BH3A 4IKTA 3OVKA 1KQ9A 4OOKA 2V3ZA 4PV4A 4EGEA 2GU7A 4FLLA 4QR8A 4U73A 5E2CA 1KQ0A 4JUQA 4Z7MA 1QXWA 2GA2A 1XNZA 2B3HA 1JAWA 2BWYA 3PN9A 1YW9A 2NQ7A 1WKMA 4IECA 2BWUA 4FLIA 5JHUA 1R5GA 2GG0A 5FCHA 1WL9A 4S2RP 1R5HA 2BHDA 2HOWA 3CTZA 1WLRA 2EVMA 2GG7A 5D6EA 3CB5A 1BN5A 3BIPA 3TB5A 3MR1A 4RZYA 1QXZA 4U1BA 5CDLA 2GGCA 5CLSA 3MX6A 1YW7A 3PKEA 1A16A 4S2TP 3IU9A 4FLJA 4IKSA 1C21A 3FMRA 4IF7A 2Q94A 2GG5A 4ZWUA 4IU6A 3PKAA 2V3XA 1W2MA 2GGBA 3PKDA 1M35A 4U75A 4A6WA 3Q6DA 1YVMA 4U71A 1WBQA 2BHCA 2Q93A 4IKRA 1BOAA 1PV9A 1MATA 2P9AA 1C24A 2ADUA 4RZZA 3L7GA 4ZWOA 1B59A 1C27A 2GG2A 2OAZA 1QZYA 2BWXA 1C23A 4S01A 1N51A 3RORA 4U69A
chains in the Genus database with same CATH topology
2GG9A 5E5BA 2NQ6A 1XGOA 3FMQA 3BIQA 1CHMA 4ZWPA 1KP0A 4A6VA 4B28A 2B3KA 5D6FA 4R60A 4U6CA 3PEBA 2OKNA 2EVOA 2Q96A 4FKCA 2GG8A 4FLKA 3I7MA 4ZNGA 1WL6A 2B3LA 5CDEA 2Q92A 4FUKA 1XGNA 2ZSGA 3TAVA 2GU4A 2BWSA 4IKUA 2G6PA 1B6AA 2EA4A 2Q95A 3D27A 3S6BA 4KM3A 4RGZ1 3PKBA 2EA2A 2GTXA 2BHBA 2P98A 2BB7A 2GZ5A 1WN1A 3CB6A 2BWTA 3BITA 3QOCA 4HXXA 1Y1NA 2EVCA 2DFIA 2V3YA 2BWVA 4U70A 4FO7A 5JI6A 3L24A 3O5VA 3IL0A 2BHAA 2Q8KA 5CDVA 2GG3A 4IPAA 1R58A 3IG4A 2V6CA 3IU8A 1QXYA 1XGMA 3OOOA 2P99A 2GU5A 2MATA 4FO8A 2BWWA 4PNCA 2BN7A 5JFRA 3PKCA 1XGSA 1C22A 5CNXA 1O0XA 4U6JA 5FCFA 1YW8A 4S00A 2GU6A 4IDYA 3FM3A 4MATA 1WY2A 4U76A 1W7VA 5CIKA 3RVAA 4U6WA 4U6ZA 3IU7A 1YJ3A 5CE6A 3MATA 4U6EA 2IW2A 2BH3A 4IKTA 3OVKA 1KQ9A 4OOKA 2V3ZA 4PV4A 4EGEA 2GU7A 4FLLA 4QR8A 4U73A 5E2CA 1KQ0A 4JUQA 4Z7MA 1QXWA 2GA2A 1XNZA 2B3HA 1JAWA 2BWYA 3PN9A 1YW9A 2NQ7A 1WKMA 4IECA 2BWUA 4FLIA 5JHUA 1R5GA 2GG0A 5FCHA 1WL9A 4S2RP 1R5HA 2BHDA 2HOWA 3CTZA 1WLRA 2EVMA 2GG7A 5D6EA 3CB5A 1BN5A 3BIPA 3TB5A 3MR1A 4RZYA 1QXZA 4U1BA 5CDLA 2GGCA 5CLSA 3MX6A 1YW7A 3PKEA 1A16A 4S2TP 3IU9A 4FLJA 4IKSA 1C21A 3FMRA 4IF7A 2Q94A 2GG5A 4ZWUA 4IU6A 3PKAA 2V3XA 1W2MA 2GGBA 3PKDA 1M35A 4U75A 4A6WA 3Q6DA 1YVMA 4U71A 1WBQA 2BHCA 2Q93A 4IKRA 1BOAA 1PV9A 1MATA 2P9AA 1C24A 2ADUA 4RZZA 3L7GA 4ZWOA 1B59A 1C27A 2GG2A 2OAZA 1QZYA 2BWXA 1C23A 4S01A 1N51A 3RORA 4U69A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GG9 A;  5E5B A;  2NQ6 A;  1XGO A;  3FMQ A;  3BIQ A;  1CHM A;  4ZWP A;  1KP0 A;  4A6V A;  4B28 A;  2B3K A;  5D6F A;  4R60 A;  4U6C A;  3PEB A;  2OKN A;  2EVO A;  2Q96 A;  4FKC A;  2GG8 A;  4FLK A;  3I7M A;  4ZNG A;  1WL6 A;  2B3L A;  5CDE A;  2Q92 A;  4FUK A;  1XGN A;  2ZSG A;  3TAV A;  2GU4 A;  2BWS A;  4IKU A;  2G6P A;  1B6A A;  2EA4 A;  2Q95 A;  3D27 A;  3S6B A;  4KM3 A;  4RGZ 1;  3PKB A;  2EA2 A;  2GTX A;  2BHB A;  2P98 A;  2BB7 A;  2GZ5 A;  1WN1 A;  3CB6 A;  2BWT A;  3BIT A;  3QOC A;  4HXX A;  1Y1N A;  2EVC A;  2DFI A;  2V3Y A;  2BWV A;  4U70 A;  4FO7 A;  5JI6 A;  3L24 A;  3O5V A;  3IL0 A;  2BHA A;  2Q8K A;  5CDV A;  2GG3 A;  4IPA A;  1R58 A;  3IG4 A;  2V6C A;  3IU8 A;  1QXY A;  1XGM A;  3OOO A;  2P99 A;  2GU5 A;  2MAT A;  4FO8 A;  2BWW A;  4PNC A;  2BN7 A;  5JFR A;  3PKC A;  1XGS A;  1C22 A;  5CNX A;  1O0X A;  4U6J A;  5FCF A;  1YW8 A;  4S00 A;  2GU6 A;  4IDY A;  3FM3 A;  4MAT A;  1WY2 A;  4U76 A;  1W7V A;  5CIK A;  3RVA A;  4U6W A;  4U6Z A;  3IU7 A;  1YJ3 A;  5CE6 A;  3MAT A;  4U6E A;  2IW2 A;  2BH3 A;  4IKT A;  3OVK A;  1KQ9 A;  4OOK A;  2V3Z A;  4PV4 A;  4EGE A;  2GU7 A;  4FLL A;  4QR8 A;  4U73 A;  5E2C A;  1KQ0 A;  4JUQ A;  4Z7M A;  1QXW A;  2GA2 A;  1XNZ A;  2B3H A;  1JAW A;  2BWY A;  3PN9 A;  1YW9 A;  2NQ7 A;  1WKM A;  4IEC A;  2BWU A;  4FLI A;  5JHU A;  1R5G A;  2GG0 A;  5FCH A;  1WL9 A;  4S2R P;  1R5H A;  2BHD A;  2HOW A;  3CTZ A;  1WLR A;  2EVM A;  2GG7 A;  5D6E A;  3CB5 A;  1BN5 A;  3BIP A;  3TB5 A;  3MR1 A;  4RZY A;  1QXZ A;  4U1B A;  5CDL A;  2GGC A;  5CLS A;  3MX6 A;  1YW7 A;  3PKE A;  1A16 A;  4S2T P;  3IU9 A;  4FLJ A;  4IKS A;  1C21 A;  3FMR A;  4IF7 A;  2Q94 A;  2GG5 A;  4ZWU A;  4IU6 A;  3PKA A;  2V3X A;  1W2M A;  2GGB A;  3PKD A;  1M35 A;  4U75 A;  4A6W A;  3Q6D A;  1YVM A;  4U71 A;  1WBQ A;  2BHC A;  2Q93 A;  4IKR A;  1BOA A;  1PV9 A;  1MAT A;  2P9A A;  1C24 A;  2ADU A;  4RZZ A;  3L7G A;  4ZWO A;  1B59 A;  1C27 A;  2GG2 A;  2OAZ A;  1QZY A;  2BWX A;  1C23 A;  4S01 A;  1N51 A;  3ROR A;  4U69 A; 
#chains in the Genus database with same CATH topology
 2GG9 A;  5E5B A;  2NQ6 A;  1XGO A;  3FMQ A;  3BIQ A;  1CHM A;  4ZWP A;  1KP0 A;  4A6V A;  4B28 A;  2B3K A;  5D6F A;  4R60 A;  4U6C A;  3PEB A;  2OKN A;  2EVO A;  2Q96 A;  4FKC A;  2GG8 A;  4FLK A;  3I7M A;  4ZNG A;  1WL6 A;  2B3L A;  5CDE A;  2Q92 A;  4FUK A;  1XGN A;  2ZSG A;  3TAV A;  2GU4 A;  2BWS A;  4IKU A;  2G6P A;  1B6A A;  2EA4 A;  2Q95 A;  3D27 A;  3S6B A;  4KM3 A;  4RGZ 1;  3PKB A;  2EA2 A;  2GTX A;  2BHB A;  2P98 A;  2BB7 A;  2GZ5 A;  1WN1 A;  3CB6 A;  2BWT A;  3BIT A;  3QOC A;  4HXX A;  1Y1N A;  2EVC A;  2DFI A;  2V3Y A;  2BWV A;  4U70 A;  4FO7 A;  5JI6 A;  3L24 A;  3O5V A;  3IL0 A;  2BHA A;  2Q8K A;  5CDV A;  2GG3 A;  4IPA A;  1R58 A;  3IG4 A;  2V6C A;  3IU8 A;  1QXY A;  1XGM A;  3OOO A;  2P99 A;  2GU5 A;  2MAT A;  4FO8 A;  2BWW A;  4PNC A;  2BN7 A;  5JFR A;  3PKC A;  1XGS A;  1C22 A;  5CNX A;  1O0X A;  4U6J A;  5FCF A;  1YW8 A;  4S00 A;  2GU6 A;  4IDY A;  3FM3 A;  4MAT A;  1WY2 A;  4U76 A;  1W7V A;  5CIK A;  3RVA A;  4U6W A;  4U6Z A;  3IU7 A;  1YJ3 A;  5CE6 A;  3MAT A;  4U6E A;  2IW2 A;  2BH3 A;  4IKT A;  3OVK A;  1KQ9 A;  4OOK A;  2V3Z A;  4PV4 A;  4EGE A;  2GU7 A;  4FLL A;  4QR8 A;  4U73 A;  5E2C A;  1KQ0 A;  4JUQ A;  4Z7M A;  1QXW A;  2GA2 A;  1XNZ A;  2B3H A;  1JAW A;  2BWY A;  3PN9 A;  1YW9 A;  2NQ7 A;  1WKM A;  4IEC A;  2BWU A;  4FLI A;  5JHU A;  1R5G A;  2GG0 A;  5FCH A;  1WL9 A;  4S2R P;  1R5H A;  2BHD A;  2HOW A;  3CTZ A;  1WLR A;  2EVM A;  2GG7 A;  5D6E A;  3CB5 A;  1BN5 A;  3BIP A;  3TB5 A;  3MR1 A;  4RZY A;  1QXZ A;  4U1B A;  5CDL A;  2GGC A;  5CLS A;  3MX6 A;  1YW7 A;  3PKE A;  1A16 A;  4S2T P;  3IU9 A;  4FLJ A;  4IKS A;  1C21 A;  3FMR A;  4IF7 A;  2Q94 A;  2GG5 A;  4ZWU A;  4IU6 A;  3PKA A;  2V3X A;  1W2M A;  2GGB A;  3PKD A;  1M35 A;  4U75 A;  4A6W A;  3Q6D A;  1YVM A;  4U71 A;  1WBQ A;  2BHC A;  2Q93 A;  4IKR A;  1BOA A;  1PV9 A;  1MAT A;  2P9A A;  1C24 A;  2ADU A;  4RZZ A;  3L7G A;  4ZWO A;  1B59 A;  1C27 A;  2GG2 A;  2OAZ A;  1QZY A;  2BWX A;  1C23 A;  4S01 A;  1N51 A;  3ROR A;  4U69 A; 
#chains in the Genus database with same CATH homology
 2GG9 A;  5E5B A;  2NQ6 A;  1XGO A;  3FMQ A;  3BIQ A;  1CHM A;  4ZWP A;  1KP0 A;  4A6V A;  4B28 A;  2B3K A;  5D6F A;  4R60 A;  4U6C A;  3PEB A;  2OKN A;  2EVO A;  2Q96 A;  4FKC A;  2GG8 A;  4FLK A;  3I7M A;  4ZNG A;  1WL6 A;  2B3L A;  5CDE A;  2Q92 A;  4FUK A;  1XGN A;  2ZSG A;  3TAV A;  2GU4 A;  2BWS A;  4IKU A;  2G6P A;  1B6A A;  2EA4 A;  2Q95 A;  3D27 A;  3S6B A;  4KM3 A;  4RGZ 1;  3PKB A;  2EA2 A;  2GTX A;  2BHB A;  2P98 A;  2BB7 A;  2GZ5 A;  1WN1 A;  3CB6 A;  2BWT A;  3BIT A;  3QOC A;  4HXX A;  1Y1N A;  2EVC A;  2DFI A;  2V3Y A;  2BWV A;  4U70 A;  4FO7 A;  5JI6 A;  3L24 A;  3O5V A;  3IL0 A;  2BHA A;  2Q8K A;  5CDV A;  2GG3 A;  4IPA A;  1R58 A;  3IG4 A;  2V6C A;  3IU8 A;  1QXY A;  1XGM A;  3OOO A;  2P99 A;  2GU5 A;  2MAT A;  4FO8 A;  2BWW A;  4PNC A;  2BN7 A;  5JFR A;  3PKC A;  1XGS A;  1C22 A;  5CNX A;  1O0X A;  4U6J A;  5FCF A;  1YW8 A;  4S00 A;  2GU6 A;  4IDY A;  3FM3 A;  4MAT A;  1WY2 A;  4U76 A;  1W7V A;  5CIK A;  3RVA A;  4U6W A;  4U6Z A;  3IU7 A;  1YJ3 A;  5CE6 A;  3MAT A;  4U6E A;  2IW2 A;  2BH3 A;  4IKT A;  3OVK A;  1KQ9 A;  4OOK A;  2V3Z A;  4PV4 A;  4EGE A;  2GU7 A;  4FLL A;  4QR8 A;  4U73 A;  5E2C A;  1KQ0 A;  4JUQ A;  4Z7M A;  1QXW A;  2GA2 A;  1XNZ A;  2B3H A;  1JAW A;  2BWY A;  3PN9 A;  1YW9 A;  2NQ7 A;  1WKM A;  4IEC A;  2BWU A;  4FLI A;  5JHU A;  1R5G A;  2GG0 A;  5FCH A;  1WL9 A;  4S2R P;  1R5H A;  2BHD A;  2HOW A;  3CTZ A;  1WLR A;  2EVM A;  2GG7 A;  5D6E A;  3CB5 A;  1BN5 A;  3BIP A;  3TB5 A;  3MR1 A;  4RZY A;  1QXZ A;  4U1B A;  5CDL A;  2GGC A;  5CLS A;  3MX6 A;  1YW7 A;  3PKE A;  1A16 A;  4S2T P;  3IU9 A;  4FLJ A;  4IKS A;  1C21 A;  3FMR A;  4IF7 A;  2Q94 A;  2GG5 A;  4ZWU A;  4IU6 A;  3PKA A;  2V3X A;  1W2M A;  2GGB A;  3PKD A;  1M35 A;  4U75 A;  4A6W A;  3Q6D A;  1YVM A;  4U71 A;  1WBQ A;  2BHC A;  2Q93 A;  4IKR A;  1BOA A;  1PV9 A;  1MAT A;  2P9A A;  1C24 A;  2ADU A;  4RZZ A;  3L7G A;  4ZWO A;  1B59 A;  1C27 A;  2GG2 A;  2OAZ A;  1QZY A;  2BWX A;  1C23 A;  4S01 A;  1N51 A;  3ROR A;  4U69 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...