1WLCA

Congerin ii y16s/t88i double mutant
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
134
structure length
134
Chain Sequence
DRAEVRNIPFKLGMSLTVGGVVNSNATRFSINVGESTDSIAMHMDHRFSYGADQNVLVLNSLVHNVGWQQEERSKKFPFTKGDHFQITITFDTHTFYIQLSNGETVEFPNRNKDAAFNLIYLAGDARLTFVRLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title In vitro evolutionary thermostabilization of congerin II: a limited reproduction of natural protein evolution by artificial selection pressure
pubmed doi rcsb
source organism Conger myriaster
molecule tags Sugar binding protein
molecule keywords Congerin II
total genus 29
structure length 134
sequence length 134
ec nomenclature
pdb deposition date 2004-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00337 Gal-bind_lectin Galactoside-binding lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1wlcA00
1GLHA 4P9WA 3AJYA 1Q8VA 4AVVA 4GWMA 4YM0A 1F5FA 3VKOA 1BXHA 2VU9A 3ENRA 4YGBA 1GZ9A 1W6QB 4XHXA 5GLUA 4YZ5A 1EPWA 3SISA 3WG3A 2R16A 3POWA 4AVSA 4YG3A 1LGBA 4Q26A 4XTMA 1IS6A 1LOEA 2ENRA 4XDQA 3CNAA 1KDMA 1CN1A 4YG6A 1QNWA 3O0XA 3N3HA 4FQ4A 1IKQA 1AXYA 4BQ1A 1V6OA 1Q8PA 2WNEA 2ZABA 1MS3A 1WBLA 2KM2A 2Z42A 4Y22A 3ZXJA 5IK7A 1UPSA 3AZVA 4FPHA 4M3CA 1FNYA 1O4YA 2NP0A 1KRIA 1MR5A 3GNEA 5DG1A 3JU9A 4Y24A 4U2AA 2CWMA 2D7FA 3WDYA 5JDBA 4AGGA 1UX6A 1CJPA 2GDFA 5HCFA 1AJKA 4H55A 4GKXA 4AGRA 4ZXKA 2I2SA 2WT0A 2PHFA 2YV8A 1MS0A 1LJ7A 3IPVB 3FBYA 1LGCA 2PHWA 2AREA 2ZZJA 4CTEA 4Y1XA 1DYKA 4GKYA 1CR7A 4P14A 4DPNA 4YFZA 2GNMA 5T5JA 2D6OX 2GMMA 1GNHA 4LBNA 1CQ9A 1SLIA 2A6XA 2D3PA 2EXHA 2A70A 2ZGMA 3SNMA 1HDKA 2WJSA 3A0NA 1W6NB 4OZXA 4YM2A 3MW3A 2D43A 3O12A 4NO4A 4YW3A 2WSUA 1UMZA 2YMZA 3MW4A 1PZ8A 4TYSA 4ISRA 1CONA 1DQ2A 1QGLA 4D69A 1GZWA 4FOQA 2A3XA 3POSA 1G9FA 2W52A 4GXLA 4DS0A 2NYYA 1RITA 3OJBA 3T1LA 2DVFA 3AYEA 2C9AA 4YW4A 5T5OA 3APBA 1R1ZA 1DYPA 1DHKB 2OUHA 1FATA 1V6NA 3M3CA 4C1XA 1G8WA 4LBMA 3ILNA 4XZPA 5GZFA 4HL0A 2ZGLA 2JKBA 4AGVA 2GN3A 1GSLA 1MZ5A 4YG0A 1LOFC 1OQ1A 2CTVA 5T52A 3OGGA 1N1TA 4Y22B 3IM0A 3FUQA 2EALA 1MS5A 2A6YA 1WW4A 2ZKNA 4Q8LA 4XBLA 3QCWA 4XXAA 4DRRA 2JDZA 3WNXA 3ATGA 3VUOA 4DRVA 1QOTA 4M01A 2JECA 1G86A 1N47A 2DWRA 4BM8A 1C1LA 1LESA 4WVVA 5AVAA 2DUQA 2VUAA 3ZXLA 2JE7A 5KXEA 2CYFA 1O4ZA 3V65A 4Q27A 2UWBA 1QDCA 1QF3A 2ZGNA 1QOSA 2ZGPA 3O5SA 3L2YA 3A0KA 5JOWA 5GJ6A 1SBFA 5F9TA 3AP4A 4CZSA 4BMBA 5SV8A 4XJZA 1FV3A 1GZWB 4ATEA 4FQZA 5DUWA 3SH3A 4HANA 1C4RA 1C1FA 4P9XA 5GZGA 1DQ6A 1YI7A 4BOWA 3VKNA 1LECA 4PBPA 1C57A 5LK5A 5DXDA 1DBNA 2DURA 3WDTA 1LOCA 1VAMA 1N3PA 3UJQA 2SLIA 2C5DA 1N3QA 3GALA 4BMEA 3WUCA 3BOPA 2A75A 5F5QA 1LODA 2WT2A 3AXDA 3IPVA 1UZZA 2V73A 5T5PA 3VV1A 2ZHNA 4FPOB 1LULA 4YZ3A 1AXKA 2E7QA 4BLJA 2DU0A 3ZSMA 3NV3A 1SLCA 4IQPA 1LU2A 2D6NA 2V5YA 3N7LA 2NZ9A 1CIWA 4Y26A 3ZPYA 2DUPA 5H9SA 1IKPA 1S0JA 1SBEA 3ASIA 2EIGA 2ZGKA 4XBNA 1S0EA 4FPKA 1VLNA 2AUYA 1KJLA 3JUUA 1J1TA 2YZ4A 1MS4A 3WOGA 1WW6A 1WW5A 2YROA 5DUXA 4LBQD 1A8DA 2D6PA 2A5ZA 4Y1YA 2DYCA 2B7YA 4GWNA 1G9AA 2EAKA 5EYYA 3WDVA 1CVNA 2GN7A 1NXD1 4ASMB 1H9PA 1WLCA 2P3JA 2DTYA 1W0OA 2D6LX 3FFZA 2DVBA 5GLZA 4YZ2A 2P34A 2ES3A 1MVQA 3QLQA 3R4UA 1SCSA 5T55A 2YXSA 4FP3A 4YLZA 2DV9A 4LBQA 3AYDA 2G4IA 2W08A 2VW1A 2ZMLA 1XQNA 1LEMA 4GALA 3SLIA 4XYXA 2A6VA 3DUIA 5EYXA 3AYAA 2AENA 3OPZA 4PCRA 1LOBA 1W6PB 4LBOA 4FPLA 3V0AB 4YFWA 4AVTA 2UWAA 1W6OA 1V6IA 4WV8A 4XBQA 4FPYA 2LTNA 2ARBA 2EXKA 4FPCA 5T50A 3ILFA 3MW2A 1PZ9A 2DVDA 1UAIA 2NMNA 1AVBA 2A3YA 4UW6A 3RG0A 3AP9A 4Z8BA 1IOAA 2ZMNA 3B69A 2E53A 1D0HA 1WD4A 1I1EA 1DIWA 1GYKA 1ONAA 2D44A 3D5OA 4UW5A 4YGCA 3WDWA 2R0FA 4FOWA 1KDKA 1SACA 1W6OB 3RS6A 4Q8KA 1WCSA 3ZYPA 3DGTA 4P9YA 5JLVA 4XJAA 1MACA 2P3KA 2ZGQA 3U4XA 1HLCA 1LHNA 5EWSA 3MEPA 2GNTA 5GLWA 3POYA 1S0DA 4Y20B 3D4KA 3ZSLA 1QU0A 5GLTA 3WVJA 4FPFA 1CESA 4XJ9A 4LBQB 4Y1ZA 5FREA 3VKLA 4F83A 1LENA 4FPJA 1DQ5A 2ZGTA 2R1BA 3WCRA 1APNA 1WUVA 2YY1A 3M3QA 2CL2A 2ERFA 4BLIA 2ZACA 3BTAA 3V0AA 3ZSKA 3AZZA 1QNYA 1W6PA 2DVAA 5JMCA 1JXNA 1SCRA 3WHUA 3T1MA 4XIOA 4C1WA 3KQRA 1Z78A 2P3IA 2W68A 4RA0A 5DUUA 2VW0A 1N1YA 1AZDA 4YW2A 4Q2FA 3AFKA 1DQ0A 5DZGA 2ZHLA 5IK4A 1LU1A 2VXRA 2NM1A 1IS4A 3OYWA 4Q1PA 1W6MA 3ZYRA 2VW2A 3D6EA 4M3CB 1WW7A 3RMYA 4BPZA 4XE9A 1PZ7A 2A3WA 1AF9A 2UWCA 3ZVXA 3B00A 2NMOA 2ZGUA 1W6MB 1YIFA 2E6VA 1U0AA 4M00A 1JBCA 3AP7A 1SLTA 4FOYA 1GICA 5GLVA 5DG2A 4DQAA 1V6KA 3AK0A 5DUVA 3PVOA 3SITA 4U36A 4UW4A 4MYEA 2PHTA 3PMEA 2UURA 3WG1A 4DFSA 1LHWA 2P2KA 1SLLA 1ZA4A 1GNZA 1NLSA 3OY8A 3VKMA 5DZFA 5GALA 2RHPA 2ZHMA 1D2SA 1A3KA 1MS9A 2ZGRA 5HCBA 4GA9A 4XMAA 1ULDA 2XB6C 1MVEA 1SBDA 1VIWB 1W6NA 2XG3A 2OUJA 1Y7BA 1LGNA 4Q1RA 3W59A 1RINA 4L8QA 3IKWA 4XIKA 1LTEA 1JUIA 2EXIA 4CRQA 1Q8OA 4SLIA 2UU8A 5CB7A 3N36A 5JOYA 2DUOA 2SBAA 1G7YA 2HYKA 3V64A 1AX0A 2E51A 4AYUA 3C2UA 3KM5A 4FOVA 4YGEA 4JCKA 1JN2P 4XTPA 3WDXA 2WSVA 3T2TA 3ZSJA 4YZ4A 3AP6A 3M1HA 4FPEA 3O0WA 1FX5A 1GBGA 1CPNA 1N1SA 5GM0A 5KXDA 3PVNA 2R49A 1FAYA 2WQZC 4R9AA 2DTWA 2DU1A 4JRAA 1BQPA 1ULEA 1ULCA 4LBJA 1JYCA 1UZYA 2H0BA 2D3RA 1UL9A 1SLBA 1AJOA 4PBOA 1UKGA 3RRDA 3RSJA 1WLWA 4ATFA 3NWKA 1GANA 3IN9A 1WLDA 4FVVA 4ISQA 3PJQA 1LOGA 1VAVA 1GZCA 1S0IA 1V6MA 4XOGA 1JOJA 2ZA9A 2W39A 1Z0HA 2AH2A 4XJUA 1JW6A 2A7AA 2D6KA 1LOAA 4YGDA 1BKZA 2CY6A 2VH9A 5JOXA 1WBFA 1Q8SA 3WG4A 3N35A 2A71A 2PHUA 5FRAA 1V6LA 1YXWA 1AX1A 1G9BA 1V00A 2DVGA 3ZXFA 3B9CA 3SH4A 1LOFA 4K21A 3I4IA 2OVUA 3M2MA 1HQLA 2VY0A 4KBBA 4LBKA 3TAYA 3LCPA 1DQ4A 4K1ZA 1LCLA 4YW1A 3USUA 1FYUA 3VKFC 2LALA 1V6JA 4Y20A 1JYIA 1KITA 2R1DA 4WZFA 4PF5A 5E8AA 4R9DA 1KQRA 2D6MA 3AZXA 5KXCA 3UK9A 4JC1A 3LSEA 1N3OA 1ENQA 1S1AA 1S0GA 1YO8A 5GZDA 2BQPA 5L73A 4Y1UA 3WZ1A 3NV2A 3NV4A 3OY8B 3HN1A 3Q9OA 4TZDA 1JHNA 1LHVA 1H30A 2FHRA 5E88A 4K1YA 2A6ZA 4NOTA 3O0VA 1TEIA 5EXOA 3INAA 2AYHA 1DFQA 3WG2A 1CPMA 1S0BA 2E7TA 1F31A 3BIWE 4ITCA 1LHOA 1G9DA 4M3CF 5H9RA 2PHRA 3FLPA 4WVWA 2D3SA 3SH5A 3N7KA 4FP2A 1MS1A 1G9CA 2ZHKA 5HCAA 1OKQA 2CNAA 5IT6A 4AWDA 2ARXA 1LEDA 1HQWA 3AYCA 2OW4A 3OYWB 3ILRA 1ZM1A 2R0HA 1ENRA 3M3EA 3MPPG 3AX4A 1ENSA 5CAZA 2ZGOA 5H9QA 3WHTA 3OBRA 4RL7A 5T5LA 2PELA 2CWSA 3FUOA 1KJRA 3R05A 1LHUA 3ZXKA 1S0FA 1WD3A 5GZEA 1MS8A 2JJ6A 4R9CA 4XHBA 2AGSA 4Y1VA 3UJOA 2GMEA 1Q56A 4XXPA 4XJ8A 4YZ1A 2PHXA 3TB0A 5IK5A 5JOZA 3HR9A 3A4UA 1AXZA 3USUB 1BYHA 3NV1A 1W6QA 3OBTA 2ZBJA 1BZWA 2EF6A 4UW3A 3WUDA 3H0OA 4I30A 3IMNA 5H9PA 3WLUA 1Q8QA 3LSDA 1IS5A 5JVVA 1N1VA 3AP5A 3AZWA 1F9KA 3R4SA 3B3QE 4M3CE 5KXBA 1VALA 2P37A 4YM3A 2GMPA 1DQ1A 1QDOA 5E89A 3BODA 3HMYA 3AXEA 2ZMKA 1MZ6A 2EXJA 1ULGA 2A6WA 4K20A 2TEPA 1BJQA 1URXA 1I3HA 4YM1A 5DZEA 3WCSA 1YYNA 2WLQA 1GKBA 5IK8A 1FV2A 5CBLA 5IUQA 3W58A 3ZXEA 1DZQA 1QOOA 1IS3A 1RIRA 1AX2A 1SFYA 1X50A 2FMDA 1A78A 2JE9A 3FLTA 3I8TA 4LBLA 3N7MA 3V0BB 3AJZA 3RQ0A 4XILA 1QKQA 2GNDA 2ZGSA 3M3OA 3WV6A 3FLRA 3N7JA 1OFSA 4XJWA 3WDUA 3V0BA 1SLAA 5T54A 1YRZA 3UL2A 5BYNA 4FPGA 1FNZA 1HKDA 2JD4A 2GALA 4XMIA 5GZCA 2GNBA 4W65A 1B09A 1DLLA 1GV9A 1UN1A 4R9BA 2AR6A 2ZAAA 2WKKA 1H9WA 3RMXA 4ZKTB 5CA6A 4YW5A 4PQ9A 2WT1A 2NN8A 1W0PA 3B01A 3PVEA 1S0CA 2Q5TA 3AZYA 5CNAA 1DGLA 1QMJA 1ULFA
chains in the Genus database with same CATH superfamily
2D97A 4XFGA 4P9WA 5D8AA 1F4AA 1EAH1 1HN1A 4AVVA 1HXS3 3FWEA 1DU3D 3MV01 1COV3 3THPA 3GZAA 3AC0A 4NIGA 3CJIC 5FY0A 2HWE3 1GZ9A 4YZ5A 1CAXA 5A3LA 2VNVA 3WG3A 2R16A 3MDPA 5B4NA 4MUVA 4N7IA 4CU7A 1DP0A 4FFIA 4LO6B 1IS6A 2FDKA 2Z69A 3GYDA 3IBMA 2VG9A 2JDMA 4KNCA 4EV0A 3THDA 3CNAA 1KDMA 4QX3A 4YG6A 3O0XA 3VD5A 1RUD3 4E2SA 1AXYA 4BQ1A 1DZRA 4N53C 4F8AA 2RDSA 5KHKA 1WBLA 3J8F1 1ZBE1 2JG9C 2RS12 4Y22A 4XFCA 3LOBA 4FPHA 1OA2A 4KWUA 3UNPA 2NP0A 3RZMA 1KRIA 3GNEA 2R32A 4WM8C 5DG1A 2CWMA 3WDYA 4PI2A 1YHFA 1CJPA 2B45X 2GDFA 2FQPA 3GF6A 4QWNA 5HCFA 3HAGA 4OCTA 4ZXKA 4OI0A 3HBZA 3DCQA 2VNOA 1FMD1 2DBNA 1F8VA 3IPVB 5FZ1A 1LGCA 5A3NA 5CU1A 4AEMA 4YFZA 2VZRA 3WF0A 4QAWA 3JQXA 5JR7B 5A6XA 3LIGA 1UD1A 3TN93 2IXHA 5FZ8A 3LA2A 5LY2A 3SNMA 3VBOA 1ENXA 3W21A 3K3OA 2WSUA 2YMZA 2W47A 1XSQA 2WN3A 2J1UA 2VMDA 4RFT0 3OPWA 4AFCA 1QJX2 5FUIA 1QGLA 1EUUA 4D69A 3POSA 4XW3A 3H8RA 2NYYA 5J7MA 2JDHA 3MIGA 2EIBA 4N43B 2AC1A 3POIA 4AI8A 1WMXA 3OJBA 2DVFA 3AYEA 1JU3A 2C9AA 3Q8CA 4YW4A 5T5OA 3HQRA 3S7IA 2ZAHA 1DGWA 1DYPA 1DHKB 1UU6A 2OUHA 3M3CA 3Q8EA 4P00B 1G8WA 3CKHA 4LBMA 3SKJE 3WQ7A 4QM9A 3P6BA 2WNVB 1BLZA 3AMQA 4AGVA 4I0AA 4JKMA 3ZYHA 4LLOA 2XJRA 4HOOA 5CZKA 1LRHA 3T09A 3KV9A 3IM0A 4PIYA 1RUC1 2QDNA 5JAXA 2EALA 2H0VA 3HNMA 1MS5A 3KGZA 4DRRA 3GZTB 4LA2A 3QCWA 3LAGA 2JDZA 5A6QA 3VUOA 4UT5A 1QOTA 4Y5SA 5L7OC 5E16A 3ZIXA 3WNOA 1LESA 5AVAA 2VVEA 2PTMA 1O3SA 5JMOA 3ECQA 4LE4A 5CFCC 4QHBA 4AE2A 3NAPB 2CYFA 3V65A 4Q27A 1R091 3FL7A 1QF3A 2VZOA 1B35A 3VL9A 1OLMA 2YBPA 1SMVA 3ZLIA 3O5SA 1H4HA 1SBFA 2KA3A 2R063 2GH2A 2IVIB 3I2KA 1FPN1 4YVSC 2HH9A 3RWNA 1FV3A 4FQZA 2AACA 2LW8A 5FYZA 4AOCA 4AXOA 4IE4A 4P9XA 5FY1A 4UF0B 4B4RA 4EROA 4CU9A 5GZGA 2XDVA 1VAKA 3VKNA 2VQAA 4AHXA 3I2HA 2KXLA 2WR9A 3WDTA 3EB7A 2W92A 1LOCA 3CBNA 1JZ2A 1F5JA 1N3QA 4N43C 2LROA 5FJKA 2WFF1 2XLGA 3QH7A 3BU0A 1X82A 5C3OA 1BMV2 2WT2A 2WZPP 3DEMA 5AFEA 2V73A 2VPVA 3OGRA 4CCKA 4FPOB 3PL0A 4YZ3A 1ACCA 5CEHA 3ZYFA 1DDLA 2BFUS 3ZSMA 4PI0A 1SLCA 1E5IA 2D6NA 2RJKA 3CHXA 5I8YA 4FTEA 5LZ6A 1YFWA 3ACIA 5HXVA 3U14A 4DIQA 3ASIA 2ET7A 3NW4A 2J1TA 1VLNA 2HLEA 3VD9A 1BVVA 2HWE1 1ZBA3 1PGSA 3ORJA 2YZ4A 1MS4A 4V1PA 1EV12 1CX1A 1VBC3 1KXGA 2JX9A 1CWPA 5EJ1B 1QXRA 4J1WA 2A5ZA 1NG0A 2DYCA 1AR92 3IAPA 3MIFA 4GWNA 2FDFA 4HETA 2GN7A 1NXD1 1QQP3 4ASMB 1IQDC 2W94A 4XUQA 3OBAA 1WLCA 1I5PA 2ATFA 2CSGA 3KVBA 2OQ7A 5GLZA 3ALQA 1L7RA 3AL5A 4CDQA 3QLQA 1SCSA 2YXSA 1RJ8A 4XUOA 3NSTA 5BNPB 4PLNA 5F5CA 1A8MA 2W08A 2VW1A 1XJAA 1BMV1 1YJLA 3WEZA 1K5MA 2UY9A 3DUIA 1HRV2 1UYXA 2FDJA 4KI5M 3T2QA 3AYAA 1H1MA 2HWC1 2HBUA 1LOBA 1W6PB 4MHUA 5L7OB 5FWJA 2I07B 2Y6LA 5DDJ2 2WNUA 4E4SA 3LB9A 1NZIA 1V6IA 4KG0A 4FPYA 2FZ2A 1NA1C 1XNDA 5FUNA 5T50A 5C9AB 4HN1A 1HJFA 1RJ7A 5FY4A 1W9FA 2NMNA 2VOKA 4E27A 1RHI1 1GWMA 5LATA 4BH9A 3IT8A 4NPMA 3NNGA 4Z8BA 2HEWF 3B69A 3P5BA 2X05A 1D0HA 2WNVC 4FFFA 4UFMA 2NPIA 1I1EA 5JXIA 1V9U2 2PHLA 2QBXA 4YGCA 2UYBA 4FOWA 4Q8KA 3ZYPA 2RJ2A 2KD7A 5A6YA 5FZ3A 2P3KA 5EWSA 4A7ZA 4WM7C 3MEPA 5FZDA 2XKOA 1X9TA 3POYA 5JZGA 3C7OA 2FDGA 5GLTA 2ORZA 1WMFA 2C1FA 4LBQB 4NAOA 4XJ9A 1Q43A 5FLJA 3VKLA 3U1XA 2XJVA 4GIQA 4QD2A 3WCRA 1HRV1 4E8CA 5EFUA 2WO1A 2VNRA 3NJXA 4QGLA 1H8TA 3ZXDA 2CL2A 2ERFA 3ZSEA 1VR3A 4DXTA 2V72A 1PMHX 1RUH2 1W6PA 2VAUA 3VDBA 3FN9A 4P08A 4CCLA 3BVCA 1SCRA 4N7UA 3K75B 1KEXA 2OS2A 3KQRA 4RA0A 4YW6A 5DUUA 2J1RA 1GOFA 2BOJA 5DAVA 5IJRA 5C5UA 5DZGA 3AFKA 3ETQA 4DMIA 4TLGA 3WW4A 2VCMA 4S2HA 3VZNA 1EYBA 3WF4A 2VXRA 4XFFA 1BEV3 2JDUA 2VW2A 1WW7A 3ZFEC 4UOJA 3KV6A 1PZ7A 1AF9A 3J9SA 4MGIE 1QJFA 4QPIC 4BA6A 3S5QA 1YIFA 4OHVA 4AQ2A 3RZLA 2PQQA 1EPZA 4GWIA 1UY0A 5JIUA 1OI6A 1GICA 1W8OA 2VQUA 5GLVA 2WWUA 2WAAA 1K3IA 5DUVA 3SITA 4AEDC 3IAQA 4UW4A 5FKCA 5T3NA 3LF7A 4LHLA 1JZ8A 2BZDA 1ZA4A 3AKSA 3C7EA 3DKQA 5DZFA 1D2QA 2RHPA 4CEYA 1MS9A 5HCBA 4ET7A 4BDVB 3OUIA 4A42A 4V2VA 1MVEA 1QXJA 4LA3A 2H6BA 4X8NA 3VZJA 1FT9A 3K4ZA 2V4VA 2BJSA 3OTFA 3IKWA 3EBRA 2VUCA 5I8TA 4CRQA 4SLIA 3FBMA 2R043 2UU8A 5D2AA 5A3PA 5JOYA 2DUOA 3POBA 1COV1 3OUHA 1G7YA 1OD5A 2B9VA 5F3CA 4YVSB 1RUJ3 1O6UA 3MO4A 3ZFFB 3DECA 2AEYA 1JN2P 4XTPA 3TEXA 1VBA3 1A34A 4YVWB 3AP6A 3M1HA 4FPEA 3O0WA 5DPNA 2ZEZA 4D8MA 1CD3G 4CDXB 4B1LA 5EP9A 1C8M3 2R49A 1HW5A 4QX1A 4N90A 4ZZ5A 2DU1A 4ZPIA 4CEYC 1W90A 4LBJA 1JYCA 2BYVE 5LRRA 1UY1A 1OPMA 3UV9A 1AJOA 2ZXQA 1PMJX 3NWKA 1GANA 1IGOA 4OI2A 4Y4RA 5FO7B 4AEDA 5LRSA 1UMIA 4S2DA 1EY2A 1GZCA 1VAVA 1D7PM 1S2BA 2ZA9A 3D3AA 4AEKA 4CCNA 5HXMA 1Z0HA 2AH2A 5K0UC 2RV9A 4IE5A 2A7AA 3G6JB 2XL7A 2VUDA 5JOXA 3KQ4B 3RYKA 4QB2A 1Q8SA 4UFLA 2MEV1 3VZLA 3WG4A 4MGSA 4FSJA 1FPN2 4FT8A 1OSGA 4M0HA 5FFOC 4BU2A 2VBPA 3C7FA 4BQYA 3ZFEA 2RS33 5EJ3A 3B9CA 1X33A 3TEYA 2PAMA 5BNPA 4OYUA 5FZCA 4E4ZA 1GQHA 1UX7A 5EIYB 1NLRA 1A6CA 1LCLA 4RN5A 2LALA 1V6JA 1JYIA 4GH4A 1KITA 2NLRA 1IG3A 4WZFA 5IYYA 3O1TA 1U5ZA 4BQXA 2RG4A 5FBJA 4JC1A 1OHFA 3EQEA 4MADA 4YVWA 5IVVA 5J1XA 3HWJA 1RYYA 1YO8A 4B4PA 5GZDA 2Y0IA 4AVBA 5JI7A 3NV4A 3HN1A 2WL1A 2YC2A 2VR4A 3IDCB 3X29B 4ASLA 2WS91 4NOTA 5BNPC 1RUOA 1SG3A 1NUKA 2QQIA 3VDDA 5A6ZA 3WG2A 1UWWA 3VBOC 5LA0A 1HXS2 1REEA 2JICA 2WUHA 1WMDA 3I3BA 2VJXA 2PHRA 1RUJ2 3FLPA 4WVWA 2D3SA 3SH5A 2CNAA 2W1QA 2VZPA 4LJHA 4AWDA 3IIAA 4EN7B 2DCJA 4X6RB 5FY7A 2F17A 4ARYA 3OYWB 4CSWA 1PM4A 1POQA 1ZM1A 4HVRA 4ZXEA 1S55A 4EJRA 5FMOS 4A44A 4H3WA 1ENRA 3M3EA 3MPPG 1U12A 1QY4A 5H9QA 3OBRA 3ZDVA 2W0XA 3Q8BA 1J3QA 3IB3A 4URAA 3E5QA 3ACFA 4HBNA 1AR72 2QTWB 4Y1VA 2FCUA 4FXKB 2IC1A 2OKXA 2VOWA 2WZR3 1NA1A 5IATA 5IK5A 1VRH1 5FDBA 4IEQA 3P3NA 3USUB 4JKKA 1H8TB 3OBTA 1W39A 2Q1MA 1BZWA 1RUG3 3BPSA 1OQDA 1QJX3 3ZM8A 3WLUA 3IMNA 3UESA 1JYNA 4BQ3A 4RS5B 4JGZA 1PX3A 1Q8QA 4CCMA 4COVA 3LPFA 5A7WB 3R4SA 5JWPA 1AL21 5DDJ1 3LZZA 1Z7S3 2GMPA 1CAUB 2YBKA 2OZJA 1ZNPA 3BODA 3HMYA 3CJIA 1OVPA 4I0BA 2OIIA 2A6WA 5FZIA 2TEPA 4QM8A 1FMD2 4QXKA 5HV4A 1YWKA 1BJQA 4HLTA 4SBVA 5CADA 4WVMA 3WCSA 5FLIA 1YYNA 2JDAA 5JUVA 5IK8A 1H4GA 4LNVA 5IUQA 1DZQA 3WDWA 3NVCA 1X50A 4QPWA 1JOBA 4LMFA 1IZ3A 1RUE1 4XILA 3RQ0A 1QKQA 3ZKYA 4D3WA 2RE9A 1D0GA 1OFSA 4K7JA 3OOXA 4DEQA 5D21A 3CL1A 5A33A 2VMFA 1SFPA 1W2OA 3ELNA 5BYNA 1ASJ1 4RR3B 4AR2A 3H8OA 4P9JA 2ZS6B 2JD4A 3MUZ1 1R083 2GU9A 2OX0A 4S2FA 4XMIA 4YARA 4IV3A 2GNBA 4LKDA 2YBSA 5FZ6A 2YFUA 1UN1A 5AC92 5ACA2 1YLLA 2ZAAA 5DABA 2Y6FA 4CXYA 1ODNA 3HEIA 4JDMA 4MSVA 4RD7A 2NN8A 3PVEA 3LA7A 1K5MB 3M70A 3VBUB 1GLHA 1IG0A 1PNGA 5CFDC 1ZX5A 4YM0A 1F5FA 2VNGA 1BXHA 1SDWA 1R081 2Y0OA 5CYYA 1OH3A 5DQ0A 3ZYBA 4CUCA 1H8TC 4IUGA 2GC0A 3ROUA 2CGNA 2WNUB 4ZU4A 4CA9A 4D7SA 4AVSA 3FHQA 4XQWA 5C8CA 4YG3A 4Q26A 4XTMA 3JB8A 4XDQA 1RUG2 4DUVA 2HBTA 2BWCA 2XOMA 1NYWA 1PK6C 2J1AA 1FXZA 2PLV1 4YVSA 1UCXA 2X5IB 2B39A 4TXWA 5FXWA 1YQ2A 1R64A 4JHTA 2G9FA 3WF1A 5IK7A 1UPSA 1XSRA 2JB8A 3HT1A 2R042 2ID4A 4QKDA 5LBBA 3JU9A 4K6BA 4KWJA 2CAUA 4EN8B 5JDBA 3LQCA 1UX6A 3W20A 5FV3A 4QXHA 3VD4A 4RGGA 4AGRA 2YGLA 3U11A 4QT6A 1PM7A 3NL1A 2YV8A 1F4HA 3DYMA 3VL8A 3WP6A 4BQ2A 3LDKA 3KGLA 4P14A 4Y1XA 1I9RA 5AFBA 2GNMA 3I49A 5T5JA 4AVCA 2GMMA 5FP3A 1UZ0A 4ARXA 3N4MA 1PGL1 2EXHA 3Q8AA 4NROA 1Z7S2 2R061 1HDKA 1H2LA 4OZXA 5JR2A 1T2XA 3AM2A 2D43A 4NO4A 1NKGA 2CDOA 5LBFA 3SKVA 3VBOB 3VBRB 1K5MC 1HB2A 1D4VB 4TYSA 1FOD2 5AVPA 4D7YA 1DQ2A 1NAEA 1DCSA 1F15A 1Y3TA 5DAWA 1G9FA 2W52A 3PTYA 1RITA 5TSWA 4AHYA 3VBRC 3RZHA 2JWPA 4IESA 3APBA 1R1ZA 1ZREA 1CZSA 3IMMA 1FATA 1V6NA 1H8VA 5IFTA 5F6LB 3ILNA 5FY8A 3H3ZA 2VZQA 5ERLA 2ZGLA 1IPJA 5C8CB 2BWAA 3DXTA 3MHZA 3AVRA 2GN3A 4AI2A 1GSLA 4PF1A 5A32B 1LOFC 2XJPA 4P9LA 5T52A 1TMF3 4Y22B 2XLAA 4I3PA 1BVP1 1XE8A 4Q4X2 1RMU2 1DZTA 2Y6KA 3FUQA 4KU7A 2Q4SA 1WW4A 4XXAA 3UT0A 5F2WA 3KT1A 4BK4A 1NE4A 4XCAA 4M01A 2JECA 2QQJA 4S2GA 1PVXA 4L2NA 1AR82 2YDEA 3BTZA 4WVVA 4NWVA 2DUQA 5I0UA 4Q4W2 5FPXA 1Q5OA 1QDCA 2K0GA 1JH5A 2ZGNA 1QOSA 1W06A 2ZPXA 3A0KA 4IETA 1PIV2 2WFF3 3AP4A 2TNFA 4CZSA 3O14A 5IVFA 5SV8A 2ZCWA 1GZWB 4ATEA 3DF0A 3SH3A 1MZFA 1C4RA 1PK6B 1C1FA 4NIIA 1DQ6A 1QJU1 1VRBA 1YI7A 2DDUA 2ARAA 2WA3A 3KD4A 4BOWA 1LECA 2JIJA 4PBPA 1C57A 2PYTA 4CDXA 3E6CC 4B29A 2BV4A 1DBNA 4CPBA 4CCOA 3SXWA 3URFA 1N3PA 3NJYA 3UJQA 5EHDA 5FWEA 4H14A 3KF5A 5FP4A 4OHZA 3GALA 4CP2A 4BMEA 3T2OA 3BOPA 2A75A 3SCHA 2A1XA 1LODA 5F5QA 3WXPA 3DV8A 5T5PA 2GSYA 5K9YA 5A3UA 5FZFA 1W0NA 5C3PA 1XNAA 3GJBA 4BXFA 4BLJA 2DU0A 3D8CA 3NRUA 2NZ9A 1CIWA 4Y26A 4A3ZA 3NNLA 2PAKA 3ZFGB 1MEC1 1S0JA 1UZWA 1W8FA 3GHNA 2XJTA 4XBNA 4A3XA 4AHZA 1S0EA 4FPKA 3S6PA 5HI0A 5BNNB 1RUE3 4XUPA 1J1TA 4MOAA 5LWBA 2XHNA 2YROA 5JI9A 4OI1A 1RUF3 3GGLA 4LBQD 2C26A 4LIVA 2WN2A 3S7EA 3I2OA 1B35B 4COZA 2VOXA 5JCTA 3S5AA 2E7AA 1NT0A 4K3UA 1GWKA 2OA2A 3TOJA 2GP3A 2EAKA 3J8F3 5F37A 1JYTA 2VZ1A 1QJU2 2HWD3 1QEXA 1AR83 4OMDA 2DTYA 5L19A 3UGFA 2VO5A 2VUJA 1ZZ6A 1V70A 3KMHA 2DFBA 3P3PA 4MXWB 4NN0A 4YZ2A 2P34A 2ES3A 1MVQA 4D7TA 1OPOA 5C5TA 2VULA 2WRAA 5T55A 1UOFA 4FP3A 3R6SA 4YLZA 4LBQA 4HK8A 5B4XA 1LEMA 2R6QA 3KLSA 2OQ6A 4RHV3 3U37A 3S57A 3LFIA 1AR91 2A6VA 2K2SA 2XVGA 4CUAA 4NIHA 3A22A 2AENA 3OPZA 4RQPC 3Q8FA 3RFRA 5J48A 2VTXA 1REDA 5IW0A 3FE5A 4MVTA 3V0AB 1LR5A 4QQOA 1OD3A 5JZGC 1W6OA 1VBB3 3MBWA 4XBQA 3N9OA 1R093 3BYWA 4FPCA 2Y33A 3ILFA 3FHIB 1UAIA 1PNFA 4AZZA 4Q0PA 4GJZA 4FAGA 4DXZA 4UW6A 3CU7A 1NE6A 1EP0A 3RG0A 1OLME 3THCA 5L9RA 1J3PA 2E53A 5FZLA 1WD4A 4RFRB 3ZFGC 5FOBB 4WM8A 1GYKA 2Q1FA 1YI9A 3D5OA 3KCYA 3MI8A 5C7GA 1STMA 1U5YA 1PVC2 1ZBE2 2JG9A 2R7EB 3HIFA 4QX7A 1WCSA 5JLVA 4BQWA 2W9XA 4XJAA 1ZYBA 4OZOA 2X29A 3U4XA 1DGRN 1HLCA 4Q4V3 2PLV2 2WBKA 3LD8A 1S0DA 4CE8A 3D4KA 1QU0A 2YB7A 2N7GA 1JZ7A 1CESA 1JOPA 2DCZA 2XQRA 1HB3A 1XNKA 3CEWA 5FREA 1JYXA 3U10A 1LENA 4JKLA 2X10A 5FK7A 2RS11 4RHV2 2QQWA 1V9U1 1WA4A 1AR63 1APNA 3WNLA 3WF3A 1WUVA 1W28A 4BLIA 3O1PA 3WNKA 4MGKE 2OZ6A 3T0DA 1AYN3 3CJXA 3JXSA 4URTA 5IAXA 1OC1A 3FFQA 4KU8A 5FXXA 3V0AA 2VQTA 4PDWA 2DVAA 3H50A 5JMCA 1JZ5A 1JXNA 5CVRA 1NQJA 2ZX2A 1C5HA 2KR2A 4WBBA 4XIOA 4C1WA 5FZKA 1O3RA 2IXIA 2XWBB 1UF2C 3AKPA 4RQPB 5FLHA 4EN9B 1LU1A 3ACLA 2Q8OA 1C3HA 1IS4A 3OYWA 4Q1PA 3ZYRA 2NQYA 4M3CB 3OGJA 2A3WA 4O61A 1YEWA 4HSJA 2NMOA 4IV1A 5FZ7A 2R062 4O65A 2I74A 4MLOA 2E6VA 3IWZA 1YQ8A 4FOYA 4BYYA 3NO8A 4H7LA 5DG2A 4M4PA 4CDWB 3AKRA 3AK0A 3NQHA 1X7NA 1TME1 1HRI3 2D5HA 2C0ZA 3SEEA 1QH6A 4Q4Y1 4JQRA 3CDZB 4MYEA 1NLQA 3A21A 4GB33 4O7XA 5FZAA 4E2QA 1AR73 1GR3A 1LHWA 1OBNA 3UGGA 3OY8A 1VBA1 3RNSA 3EMRA 1RMU3 3KV5A 1ULDA 2WS92 2XB6C 4LUKA 5E1RA 1O7FA 4JVAA 5BNNC 4FO9A 4K8RB 1SBDA 1UOGA 2XG3A 4IEXA 3VHRA 4AW7A 1Y7BA 5BUVA 5KWRA 1LGNA 1OKOA 1RINA 1ZBA1 1QJZA 4Z1VA 1BK0A 3FX3A 2EXIA 1Q8OA 1JYWA 4EWDA 5JSRA 3CF6E 2XUEA 4N8MA 4QDRA 2HYKA 1AX0A 1WCUA 1XOYA 2DCKA 4V2WA 3C2UA 4FOVA 4YGEA 2ARCA 3DPRC 3ZSJA 1PIV3 4QKFA 2AZ5A 2VOTA 2C6SA 3LPGA 4DXRA 1N1SA 5GM0A 4QHOA 4C90A 5C33A 1FAYA 4MH0E 1B35C 2ILMA 2W5FA 2BEOA 4R9AA 5FYHA 4JRAA 4I2OA 1ULCA 4NRQA 2RDQA 2D40A 2BOIA 2Y26A 4PBOA 1SLBA 3RRDA 1OH4A 2TBVA 5AC91 3RSJA 1WLWA 2VM9A 2YFZA 3N9QA 3OPTA 4TN7A 4YYOA 4QGNA 3UGHA 4FVVA 4CEWC 1RUD2 4XVHA 4JGYC 4B7EA 3KB5A 1UXZA 3MIEA 1SPPA 1NQDA 1CGPA 2W39A 2ZTNA 2JXAA 3WNMA 1JHJA 2D6KA 3NAPA 1IPKA 1UY2A 1WBFA 2RM23 1OUXA 3PU3A 1TQ5A 4D0QA 1HV0A 3SCFA 4BWOA 5L9VA 3KS7A 1AL22 1V6LA 1XC6A 4R8HA 1EV13 3U4SA 1ZRDA 1YXWA 1V00A 2DVGA 3LKJA 1FPN3 2HEVF 3QBQA 3ZXFA 3HQXA 1SDDB 3H1YA 4K21A 3I4IA 4LBKA 5K0UB 3TAYA 1W9TA 1GNYA 5FZGA 5KHIA 1R1A1 4K1ZA 3VKFC 2WINB 3LA3A 4HFSA 4QQHA 4GULA 1H6YA 4PF5A 2EIDA 3E5XA 2RS51 2DCYA 2J1SA 1RUI3 1KQRA 1W3XA 4LITA 3SQOA 3VDAA 2ZX4A 4XETA 3HQUA 1ZRCA 1N3OA 5FZ0A 1ND2C 1EAH2 2PA7A 4HVQA 3NV2A 4TZDA 1JHNA 1XB9A 2PFWA 1J83A 4N9HA 3O1SA 4QX0A 4LHSA 1TEIA 3HN3A 3K3NA 4B4QA 5EXOA 3INAA 1PGW1 4ONUA 2AYHA 3WQ0A 5JSPA 2WO3A 1CPMA 1WMEA 2WABA 2RMU2 3BIWE 1J1LA 2O14A 1LHOA 1QQP2 3NKTA 1QJEA 4MV2A 4OUMA 5FY9A 4C0HA 4GAZA 5KR7A 3N7KA 5K4LA 5FK8A 5FXZA 2Q8EA 2DCTA 2ZHKA 1G9CA 1VBE1 3BI3A 1NCRA 2VQ0A 1XNBA 2EICA 1RUF2 2VTFA 1BBT1 1HQWA 1XYOA 3AYCA 4COUA 4LUMA 1NCQC 2OW4A 4E8DA 1AL23 2BGOA 2QVSB 3E6DA 5A7OA 3U0ZA 3I59B 3MFCA 4EN6B 1K45A 4OVEA 3AX4A 1UY4A 3JD73 5CAZA 3CO2A 3CZUA 1QJU3 2HWD2 1V9U3 1OXCA 2CWSA 4IGPA 4CDWA 5ABJA 1QJY3 3ZXKA 1E5RA 1H6XA 1WD3A 1MS8A 4PJYA 4R9CA 4Y33A 5GZEA 2Q8CA 1DF0A 2B9UA 1M4WA 3IDAA 2WWSA 2QQVA 4LIUA 4UAPA 2PHXA 4YSFA 5KC5A 5CG9A 3H7JA 5JOZA 4KQ7A 2RS52 1AXZA 4DUWA 4L11A 3NV1A 1W6QA 1Y4WA 1RUJ1 3RI8A 4J25A 1RHI2 3FJSA 4QDQA 4EQVA 3WUDA 2ZJCA 2IXCA 5H9PA 3C3VA 2VMHA 2MHFA 5FMCA 3WD5A 4DNYA 3OD0A 3HD8B 1W2TA 5LA1A 1IS5A 3AZWA 4IL7A 5KXBA 3GCWA 2P37A 3WP3A 1WCKA 1DQ1A 2EAAA 4GMP1 5E89A 1W04A 2RMU3 2VXJA 3AXEA 1RMU1 3KCCA 4QQLA 1QQP1 1CAWB 1ULGA 4K20A 2RS31 1WGPA 3ZYIB 4XAEA 1NOVA 1CAVB 1I3HA 3K46A 1AR71 2YU1A 2E33A 4IEOA 3AFGA 4BHPA 3MF9A 4YRDA 3PMSA 1FV2A 3W58A 3ZXEA 1RUF1 1QOOA 2IWGB 1RIRA 4YM2A 2OPKA 4K8FA 1A78A 1YQ5A 3V0BB 3N7MA 5J3UA 3WR0A 4BXSV 2L9LA 2VL4A 2ZGSA 3FLRA 4QU1A 5FAXA 4XJWA 4I02A 3M7AA 3OEBA 3WDUA 1SLAA 1J59A 3AMHA 1OA4A 3CMGA 4FPGA 4ORFA 4AQ6A 3LDBA 4R52A 1ZRFA 2GALA 3VBHB 5HPOA 3POEA 5GZCA 1J84A 1US2A 4R9BA 1GV9A 4LLFA 2VZSA 3SHRA 3RZGA 1H9WA 3RMXA 5FPLA 4ZKTB 1FI2A 3I2IA 4NE9A 5CA6A 2BERA 5EPAA 4PQ9A 1RUI2 4XFHA 2P4EA 4HG6B 1RHI3 1WKYA 2WT1A 1W0PA 5APAA 3VBHC 4CCEA 2X53S 1S0CA 4KG8A 3ZFFC 3NMBA 1UW8A 3RI9A 3BOWA 1QMJA 3PVNA 1ULFA 4GB31 4QGMA 1D4M2 3VZOA 5JPMB 4CDUB 4JTNA 4GWMA 2ZEYA 2D5FA 2UY8A 2YHJA 5SV5A 2E63A 1QJY2 2VU9A 3ENRA 5A70A 5IHRA 4OQ8A 4YGBA 1W6QB 3I2FA 3SISA 1W8NA 3POWA 4CDUC 4PLMA 3LEIA 4Q4Y2 1LGBA 1QWRA 2RS53 3MLKA 4AEJA 3N9PA 2ENRA 2VVDA 1JMUB 5IVBA 1ST8A 4XFAA 1VBA2 4Y5Z0 5C71A 3VBFA 1V6OA 4ASKA 1UQXA 5FZBA 1MS3A 1ALYA 3ZXJA 2Z42A 5L36A 4TTGA 4M3CA 1FNYA 1O4YA 5HBAA 1Q3EA 3ST7A 1KS4A 4NHKA 4JRLA 2CAVA 3BIEA 3NAPC 1AJKA 4GKXA 1XU1A 2WT0A 3ZX7A 4QB1A 3TEWA 3AKTA 5I93A 1MS0A 1LJ7A 2RS13 1W05A 2X09A 3GZEA 4UFJA 3ZPOA 2VVFA 3EJKA 2PHWA 2ZZJA 3FBYA 4HKLA 3I59A 4CTEA 5A1LA 4RGAA 1DYKA 4GKYA 5FZ4A 1O4TA 3JBG2 1D4M1 3T0BA 4QX5A 4DPNA 1GQGA 3I3EA 2CU5A 4O9EA 5J98B 3MLJA 3AKQA 1SLIA 2O8OA 2D3PA 4QU2A 2A70A 3R0RA 4A6OA 1QJY1 3A0NA 1W6NB 1H2MA 4ES9A 1S4CA 4B7KA 1OF3A 3MW3A 2WLPA 1TVGA 3O12A 3MW4A 5HCHA 1SFNA 1GQPA 1PX4A 3PUQA 3PUIA 1CONA 1HQNA 4KH9A 3JD71 4MZUA 2LM3A 1PVC1 4GXLA 4A41A 1RTVA 2YPDA 3H42B 4JV4A 1AYM2 3T1LA 1C8NA 2EIEA 2Z2SB 3I2GA 3KT4A 3LEKA 4C1XA 1AL0G 2BUKA 4HL0A 5CKQA 1KFUL 4Z2AA 1RUC2 4CU8A 4CEWB 2Y60A 2ZEWA 1PO12 2RR12 3NNFA 2CTVA 3OD4A 3RZJA 3OGGA 2JDNA 2CGPA 1YQCA 4O9GA 2ZKLA 4QPGC 2X5IA 3FHAA 2A6YA 2ZKNA 1RL3A 2VGDA 4Q8LA 4WM7B 4XBLA 3HOBA 4GMP3 5D8AB 4DRVA 2BNNA 3HT2A 2VE1A 3SEPA 1HRI1 1PGL2 1N47A 2DWRA 1AYM1 1C1LA 4R4ZA 4X8PA 4EN0A 1ND3B 1PHMA 1GFF2 2VUAA 4INDA 3ZXLA 3ON7A 2JE7A 3MPBA 4XURA 5IVJA 3WP4A 4N53B 5FYBA 4IV1C 1AUYA 3B5LB 3PUHA 2PLV3 3WSOA 1JUHA 3MYXA 4NR1A 2FD8A 4W6XA 4BQ5A 2ZGPA 3B94A 3L2YA 4AAPA 5JOWA 2VBBA 5CFCB 3W5NA 4RS5A 2YG0A 5FYYA 2IFWA 1LB2A 2BBAA 3OF1A 4HANA 3VBUA 5KHJA 2GAUA 1ND2A 5FO9B 1LKNA 4W6YA 2QNKA 4UFIA 1H1IA 4TWTA 1GP6A 4LQRA 4CP9B 5I91A 5DXDA 2C24A 2HWB3 4IE6A 1X9PA 2K46A 3I2DA 2A73B 2IFRA 5GKAC 5FZEA 2ET1A 4A7YA 3EYPA 4NHMA 5C4WA 4Q4X1 2V09A 2WWJA 4EZHA 3BKZA 1UMHA 2G9ZA 1DLCA 3WUCA 5K8SA 4C8DA 3IPVA 1C8M1 3VV1A 3KHCA 4PHZA 1UIJA 2ZHNA 2Z4FA 3E97A 1LULA 1AXKA 1PIV1 2E7QA 2WZR2 1O3QA 1Y9GA 1UIKA 4IQPA 1LU2A 4Q4X3 3N7LA 2J1VA 3M3IA 3POJA 3ZPYA 3QH6A 3RYPA 2VD7A 3JBG3 1X8EA 2DUPA 4MX3A 5H9SA 1IKPA 3N9NA 4IV1B 4Z2WA 5A80A 2EIGA 2ZGKA 4JAAA 4JGYA 3J26N 3RZZA 3H1MA 2AUYA 2XL9A 1UU4A 3UKTA 3WNNA 1ZZBA 1KJLA 3JUUA 4LR4A 4D94A 3ABZA 2XJQA 1JZ4A 3BTXA 4HVOA 3WOGA 1WW6A 4NIAA 2X8KA 4UYBA 4AFDA 4FXGB 1HV1A 4HSLA 4OFGA 1A8DA 1S2EA 3MLLA 5EZWA 2B7YA 4RYDA 1G9AA 3AMMA 5BPXA 4AAXA 2HYXA 5EYYA 3ZN4A 4F7ZA 2IZWA 5K7PA 4H7MA 1ULPA 2BNMA 4COWA 1PK6A 3AB0A 2Y6HA 1VBB1 1POV3 3FFZA 2DVBA 1MQTC 3ACGA 5I8SA 4AK3A 1XYNA 4PQQA 3R4UA 3NKGA 2JG8A 1Y9MA 3GCXA 2ZX0A 2DV9A 1SZBA 3NNJA 1I5ZA 4LOSA 1BBT3 3ZFEB 1ZZ8A 3TBDA 1ASJ2 4P02B 4XYXA 1OVSA 1ZZ9A 2Y6JA 4LKSA 1GWLA 4ZONA 5KC6A 4PCRA 2WZR1 4LBOA 5A7PA 4HT1T 2OPWA 5A7QA 1RVF2 2WDBA 1POV1 1D4M3 1AHSA 2LTNA 1U5IA 2ARBA 4RSUA 3VLBB 5FO8B 3AMNA 3MW2A 4AEDB 1PZ9A 2XPJA 4KGQA 3T30A 2XVLA 4L99A 1KS5A 3VGIA 5BY5A 1HIXA 1J3RA 3WW1A 4EE2A 5LA9A 1UOJA 5DDJ3 1CJDA 3AP9A 5IVYA 2BRTA 4IV3C 5A7NA 3QD6A 1VBC1 3DYOA 2QKDA 2QQPA 2LS6A 5FYTA 1DIWA 5FPAA 2J22A 3S30A 2HKXA 1AR61 1ONAA 4OHWA 4UW5A 5FP9A 2WC2A 1J58A 2R0FA 4ZZ8A 3D82A 4LK6A 4HPKA 1KDKA 1SACA 1W6OB 4LO8A 4NWWA 1H0BA 3AVSA 3DGTA 3C7GA 4RR3A 5FYUA 1MACA 2ZGQA 5GLWA 1QH7A 2WQ8A 4BISA 4Q4V1 1VE0A 3WNPA 4JHZA 3ZYJB 4OUSA 1X36A 4FPFA 1K12A 4Y1ZA 2QE3A 5LCWL 4META 4Z92B 4XDPA 1ZA7A 4MGQA 2W1WA 2MEV2 4FPJA 1W9YA 2OYZA 1DQ5A 2ZGTA 2R1BA 2C9KA 4QXBA 3WW2A 4DY5A 4I0WB 1RXGA 3SMHA 1OLQA 3ZN6A 1MQTB 3O7OA 4UI9L 3VZKA 4LKEA 1FOD3 2ZACA 1Z7S1 2F4PA 3BTAA 3ZSKA 3AZZA 1QNYA 1OURA 1NA1B 1EAH3 1NX9A 2BVBA 1YJKA 5C9AC 5I0SA 4IEUA 4WVZA 2P1BA 4CDXC 5FPBA 3WHUA 1PVC3 2ADEA 2QFEA 5F3IA 3T1MA 1L7LA 1VBE2 1Z78A 2P3IA 2W68A 2VCBA 1CX4A 5FTTC 2VW0A 5A7WA 1S2KA 1AZDA 4YW2A 4Q2FA 4FAHA 1DQ0A 4LHKA 1HB1A 5FCCA 2IXKA 4JGZB 1HN0A 1W9WA 2GZWA 3DKWA 3KV4A 2NM1A 1NXMA 1T6GC 1UY3A 1PMIA 3DYPA 4Q0SA 3TWIA 4CDWC 5LEJA 3RMYA 5LW9A 2UWCA 1ND3C 1OOPA 4IXLA 3PIGA 2VBDA 3VBSB 2Y64A 1WCDJ 3HJRA 4M00A 3ZFGA 1NCQA 1OUSA 1VB4A 2YPJA 1RVF3 1SLTA 4XAAA 5DN2A 3JBG1 4DXSA 3EHKA 1NCRC 4DQAA 1POV0 2VC9A 1ZBE3 3K77A 4CYDA 2W87A 4U36A 2PMWB 2PHTA 2Q0AA 3FZ3A 4DFSA 3WG1A 1MPXA 2P2KA 1SLLA 3DXUA 3T0AA 4XF3A 2BBVA 1EUTA 5GALA 1D2SA 5J96B 1A3KA 2ZGRA 2D93A 2JDKA 4XFBA 4XMAA 3TN91 5CKNA 4ZHNA 5FR3A 3VDDC 1TMF2 1VIWB 2VMCA 2P17A 2OUJA 4LO5B 3W59A 2WS93 1TZOA 4BIOA 1UOBA 2HWF2 3PUAA 3T2PA 5C4WC 1O3TA 1H1AA 1X8MA 3N36A 3ZMOA 4GWJA 1RUG1 4AG4A 1CZTA 1UPIA 2ZX3A 4JTOA 4AI0A 4I3GA 1RUI1 4AYUA 4BB3A 4WVMB 1UO9A 4Q4W1 5C3QA 4JCKA 4GH4C 3WDXA 4CCCA 3T2TA 3N9LA 4GB32 4PDWB 1FX5A 1GBGA 5KXDA 3RPQA 2WQZC 3VBSA 5CFDB 5EV7A 4FCAA 4EWAA 2WFF2 1ZBA2 1JTZX 2UYAA 2H0BA 1RXFA 2D3RA 2FCVA 2QZ2A 2W95A 3ZDSA 5FZHA 1UKGA 4BIFA 4AI9A 3IN9A 1WLDA 1DYOA 2BNOA 4IGOA 1GUIA 4OHYA 1AR93 3OGSA 1TNFA 1V6MA 4QPGB 5HV0A 1JOJA 1G6NA 4QPIB 3UETA 4AQTA 4XJUA 2PAEA 1YUDA 4YGDA 1BKZA 2CY6A 4BE3A 4W50A 1RUE2 3OGVA 3N35A 2A71A 2X5IC 4LK7A 5FRAA 2QDRA 1ND3A 1OOPC 2FZ1A 4QPGA 3KVAA 4WZCA 2F6BA 1TG7A 3K48A 2E9QA 4AI3A 4AFAA 5A1FA 1G9BA 1U5XA 2PN5A 4MXVA 2JG8B 1VBD3 2WO2A 2MPFA 4XCBA 4KBBA 3M2MA 3CLPA 1RUD1 4YW1A 4NIDA 3USUA 3HVDA 5A32A 4KWLA 4P5HA 3RJRA 2WQ4A 2R1DA 5JZGB 1W3VA 3VN4A 3TNPB 5E8AA 2ADDA 5FZOB 4R9DA 5FZMA 5KXCA 3UK9A 3JZVA 3E5UA 4MO3M 2V5DA 1L7QA 1S1AA 1S0GA 3OBZA 4M0NA 2BQPA 4ZU7A 5BNOA 3Q9OA 2FHRA 1H30A 3GM8A 4K1YA 3CJIB 2RJLA 2QZ3A 4NUBA 1BCXA 1CAUA 4LTAA 1H2KA 4DOUA 1DFQA 3OG2A 5ANQA 5BNOB 2E7TA 5FYVA 1F31A 4ITCA 1G9DA 5F5AA 4IEVA 4M3CF 2ZZQA 3PUSA 3H3LA 3ZXGA 1MS1A 2F4LA 2QQLA 1R1A2 3VHOA 4RR3C 3E6BA 4XABA 2R071 2GC3A 3PHMA 3I3MA 1LEDA 3F95A 4UFKA 3VDDB 3B02A 3ILRA 3J7NA 3PNAA 4QMAA 2QUOA 1DG6A 2ZOEB 1HB4A 1OA3A 2MNGA 5FQ0B 1IHMA 2G1MA 4Z82A 5C70A 1CIYA 4JQTA 5J37A 3WHTA 4OQ9A 4Z07A 1VB2A 3EO6A 2PELA 2R073 5ISLA 1PO23 4BZ4A 5A3WA 1S0FA 4FTBA 2JJ6A 2AGSA 4LKFA 2QQUA 5DAQA 1PGW2 3I3QA 3AL6A 4I01A 4YZ1A 1XE7A 3TB0A 1ZZ7A 3F2ZA 4GH4B 3O1MA 2J1EA 3HR9A 3J7LA 2B4KA 1UYPA 1NY72 3A4UA 1KFXL 1BBT2 1BYHA 4LEJA 5BV6A 2QQKA 2ZBJA 3KZ4C 4PDWC 3V56A 3I7DA 2EF6A 4UW3A 2BP6A 4LT5A 3ITQA 2P5BA 3H0OA 4I30A 5JIAA 5JXHA 3QOPA 4GJYA 3ES1A 1FMD3 1SHWB 2VECA 2HWE2 3AMPA 2WZ8A 5JVVA 3VD3A 3WP5A 1AR62 3B3QE 2VMGA 5FBZA 4FI9A 3KF3A 3SCGA 3T4HB 3ZOIA 1RUNA 1VMFA 1BEV2 1VBC2 3I3DA 2JG8C 4JGZC 3WY6A 3ZYGA 3W9AA 1MZ6A 2EXJA 3KHBA 2HWD1 4GMP0 4AVAA 2W1SA 1MQTA 1URXA 2BGCA 4IV3B 4Q4V2 4YM1A 4EWEA 1HRI2 2WLQA 4X6QB 3ZFFA 1GKBA 1XE0A 2BTVC 5DAXA 1IS3A 2WFPA 1LAJA 1GMMA 3I8TA 3BUCA 4LBLA 1F35A 2VCCA 2GNDA 2XWJB 2YC0A 1HX6A 3M3OA 3JB4C 1KGYA 4G3YC 4I09A 4RHV1 3WV6A 5FMBA 1H2NA 2XHKA 2GC2A 3BN6A 4IE0A 1YRZA 2JDPA 2RDNA 3RDIA 1W8TA 2ZEXA 1FNZA 3JD72 4QDSA 1WLTA 2HWC2 4LULA 4W65A 2DFCA 1VP6A 4YPJA 2AR6A 4UXAA 1W9SA 1UXXX 1O91A 1PO13 1NY71 2RR13 2W1UA 3W5MA 2WO7A 3D0JA 1AR81 3IIIA 1GU3A 1UYZA 4UF0A 4W6WA 3AZYA 4J6GA 5CNAA 1DGLA 1R082 3UYJA 2PHFA 2VTXJ 4C0BA 2WZEA 3MUY1 2XLFA 3O1UA 3AJYA 2Q8DA 3VHPA 1Q8VA 2O0OA 5FP8A 3CQOA 5C9AA 5JXJA 1ZVFA 3VKOA 1PO22 3KSCA 4KL1A 4XHXA 3PU8A 1HRV3 5GLUA 2IVJA 1EPWA 3O1VA 5CIRA 5IAVA 5C8WA 3PIJA 3WF2A 1HJGA 2ORXA 2LUWA 1W99A 5L9BA 2XBO2 2BVVA 2Y38A 4A4AA 1TME2 4PLOA 1E57A 3C8XA 1LOEA 3K51A 2B8MA 1W2NA 4QQPA 5KHGA 1O5LA 1CN1A 2DF7A 4FTSA 1QNWA 3N3HA 4A7KA 4FQ4A 1K5JA 1IKQA 4CU6A 5FQ0A 1Q8PA 5I0DA 1CZVA 2WNEA 2ZABA 3UKNA 1VBD1 4XF0A 2BPA2 5KHHA 2KM2A 3AZVA 5CG8A 4AL9A 3UKVA 4COYA 1MR5A 4FBFA 4NHYA 1DGWX 3I97A 4OHXA 4U2AA 2JD9A 3GHMA 2D7FA 4Y24A 4AGGA 2ZX1A 1M06G 5FMDA 2JKXA 4H55A 2I2SA 3KWVA 1QJX1 1QIQA 2WYSA 5E6HA 2C4XA 4BQ4A 3GXUA 2AREA 3TNQA 5FPZA 3TN92 4LO4B 1Y9QA 5BXXA 4C91A 1CR7A 1VRH3 2IXJA 3EXUA 5F6KA 5CISA 3BTYA 2RM22 2D6OX 2HEYF 3H9AA 2AEZA 4OLLA 4XACA 4D6SA 1GNHA 4LBNA 1P8JA 2JENA 1CQ9A 2A6XA 2O8QA 1YIPA 2PXJA 2ZGMA 1VMHA 2HWF3 2WJSA 1PO21 3MZHA 4F3JA 4PT6A 4YW3A 1UMZA 5BNOC 1MZEA 1PZ8A 4DB5A 3M8LA 4ISRA 5IWFA 4BK5A 4AFMA 1TME3 1GZWA 4FOQA 2A3XA 4MGYE 2HJIA 5F39A 2ETEA 4DS0A 4LOTA 1ZRIA 4A45A 3HNYM 3S0MA 4OUEA 1RB8G 4XQDA 4NPLA 4L97A 3POGA 2W2IA 4XZPA 5GZFA 3RJ2X 2BU9A 2VZVA 1VBD2 3H8UA 5FZOA 3IDBB 2JKBA 4FFHA 2VMEA 1MZ5A 5FYSA 1OQ1A 1NZCA 3PDQA 3BGAA 5A7SA 1BHGA 1N1TA 2VZTA 2HWC3 4OI4A 2CHHA 3K2OA 4HN0A 1ZRRA 3GDBA 4K9SA 3VBFB 4B8EA 5FZ9A 3WNXA 3ATGA 5CFCA 5FP7A 4HONA 4B1MA 1COV2 1G86A 5LK7B 4BM8A 4ZS3A 3THTA 5L7OA 4JDNA 5FKBA 3LIHA 3WT3A 1AYM3 3BCWA 5C3RA 5KXEA 4CEWA 3P1IA 3LGRA 4DY3A 1O4ZA 4QPIA 4CXWA 1TE1B 2UWBA 1AYN2 5F32A 1YC61 4CPBD 5FIXA 3VBSC 1RUC3 3A7QA 3M4FA 5GJ6A 5C3SA 5F9TA 3PLQA 2JE8A 4Q4W3 4XJZA 4JZRA 5EQUA 2WYFA 1ULOA 4BMBA 2MEV3 1F2NA 3WINE 5DUWA 2LRPA 4NAMA 4HZFA 2Q1ZB 2XH6A 4Q0QA 3VBRA 1UZVA 3DPRA 3MF6A 4IW3A 1VRH2 5FJHA 2XONA 4AI1A 1REFA 2XJUA 5LK5A 4KGGA 2DURA 3BB6A 4Q29A 4CEYB 3OCPA 4QX2A 2J42A 2FBEA 1VAMA 2OT7A 4QX8A 3VBUC 1O5UA 2SLIA 2JDYA 2C5DA 4CCJA 1VMJA 1JU4A 4NHLA 2XJSA 4RS5C 3AXDA 1UZZA 5C4WB 1R1A3 1IQAA 3J7HA 3N9MA 1MEC2 3MIBA 1YFXA 2BFUL 2IXLA 2W46A 3OEAA 2YC4A 3NV3A 2V5YA 2Y6GA 3ZR5A 1NCQB 3TYJA 1UKRA 1OOPB 2VOVA 3MV11 4P5YA 3ZXAC 1SBEA 4RGKA 1UU5A 1GOHA 4H2AA 4IEWA 3TRSB 4JX0A 1TNRA 4DZGA 1RC6A 3U75A 5FUPA 1T6BX 4XZUG 1JYVA 2GH8A 4CCDA 4NPRA 1C8M2 1WW5A 1TMF1 5DUXA 5FYIA 4G4FA 5I0RA 4MHRA 2D6PA 4Y1YA 4IEPA 3GBGA 4QQ2A 4Y4YA 5EJZB 5DAPA 3WDVA 1CVNA 1VPHA 2QQNA 3KCXA 4IGQA 3WQBA 4CDQB 5F1RA 1H9PA 1GOGA 2P3JA 4P9GA 1W0OA 2WNUC 4NRPA 2D6LX 2DBIA 2JIGA 4EYUA 5C8CC 3GJAA 4DUXA 3J8F2 5F3GA 2B46X 3AYDA 2G4IA 4UBHA 5JPNB 2ZMLA 2W3JA 1WA6X 1XQNA 2HWB2 2VMIA 1R092 4GALA 3SLIA 4E4DX 5CFDA 1KD7A 1K42A 5EYXA 2XXZA 1MEC3 4LHNA 1JZ6A 4M4RA 4CDQC 2Y8KA 5A1AA 3C7HA 4OULA 1CAXB 4FPLA 4YFWA 4AVTA 4E4HA 1OQEA 2UWAA 5D8AC 3HBKA 1L3JA 2XQXA 4WV8A 2QCSB 2P6CA 4IERA 1QXPA 2EXKA 5LBEA 1O59A 3L9JT 2DVDA 3VDCA 2WIIB 1AVBA 1C5IA 2A3YA 3J4UH 3MICA 2B42B 2VZUA 5F3EA 3VHNA 2WA4A 5ABJC 3IZOA 2JEMA 2XKPA 1IOAA 2I45A 2ZMNA 5LB6A 2HWB1 2Z79A 3H7YA 1YCIA 2D44A 4D6RA 2R041 2BDRA 4D6QA 1YQ6A 5D1IA 1ASJ3 4Q0VA 1RVF1 5FXVA 3LFMA 1JS9A 4R4XA 3RS6A 4BJ0A 1UNBA 1SQ4A 4P9YA 4Q0UA 4W8JA 1GP4A 3DN7A 4ZY9A 4AHWA 4WM8B 4Q5OA 1LHNA 1OFNA 4CP9A 4IDZA 3CIHA 2GNTA 4YNIA 4Y20B 3G7DA 3ZSLA 2EVXA 3NJVA 3WVJA 2CV6A 2QJVA 3T3YA 3U07A 4B3NA 5BNQA 1ZZCA 5F2SA 3LDRA 4F83A 3D0SA 5A3MA 3I2JA 3MFAA 3IDEA 4XUNA 2FDHA 3WW3A 5FOJB 1XBFA 2E26A 2CGOA 2YY1A 3LEMA 3M3QA 4XF9A 2FCTA 3QACA 3RVHA 1XXNA 1FOD1 5A3TA 2PQSA 3HNBM 2V4AA 5AC93 4CUGA 4Y3OA 5A3OA 4IEZA 4AF9A 1N1YA 1UYYA 2ZHLA 2QQOA 3JQWA 4MG2A 4WM7A 3T4VA 4HKOA 3ZN6B 5IK4A 4NRMA 3GBFA 1W6MA 5ANNA 2RM21 4DEVA 3D6EA 3BALA 1GP5A 4BPZA 4XE9A 4LE3A 1DGRA 4LPLA 3ZN5A 3ZVXA 3B00A 4DO0A 5J36A 2ZGUA 1LNSA 1W6MB 1W8UA 2PHDA 1U0AA 4HKWA 3K4AA 4QPYA 4GQ7A 2W91A 5F5IA 4ZU5A 1JBCA 2WNVA 1JZ3A 3AP7A 5ABJB 1V6KA 3T08A 3O1OA 1W8HA 4AQSA 3E1F1 4CP1A 2Y34A 3PVOA 3ZO0B 3KT7A 5I0TA 5FY5A 5J09A 3LEGA 3ACHA 3PMEA 2UURA 2XGXA 3PURA 4JDOA 4XDOA 3LE0A 5JXGA 1XYPA 4P9IA 4AFBA 1GNZA 1NLSA 3VKMA 2Q30A 4HPKB 2BW8A 4YW7A 1XU2A 2R30A 1RGSA 2ZHMA 5IFPA 4GA9A 1PO11 1NCRB 2RR11 5LBCA 2P3YA 4TLFA 1EV11 1QHDA 1W6NA 5FYMA 1O8SA 2Z5WA 4Q1RA 2K9ZA 2J7MA 4L8QA 3LOIA 1YFUA 4N9IA 1LTEA 4XIKA 4YVWC 1JUIA 3ME2A 3SC7X 5CB7A 4XC9A 2SBAA 2YU2A 1XNCA 3V64A 1W2UA 2IUWA 2R072 5FMOL 3RZKA 2QQMA 1XRUA 2E51A 3KM5A 2E31A 1BK1A 3FC0A 2WSVA 3OSDA 4CP0A 1OF4A 4MGTA 3A23A 4YZ4A 3LWCA 1CAWA 3J7MA 1CPNA 5G05L 2GP5A 5CKMA 1ND2B 2DTWA 4ES8A 1BQPA 1ULEA 4Q4Y3 2HWF1 3RYRA 5F8PA 1UZYA 1UL9A 4TSVA 4XQ4A 4BCUA 4HMZA 4ATFA 4CXXA 5K0UA 4XPVA 1RUH1 3PTRB 1E5HA 4ISQA 5KBFA 3PJQA 1LOGA 1S0IA 3B7MA 2RVAA 1W8ZA 4G9SB 4XOGA 3H8XA 3H3UA 4L0PA 1JW6A 1LOAA 4NVPA 2VH9A 1SEFA 4QXCA 2PHUA 1RUH3 1SPPB 4A6SA 2O1QA 2FMYA 1W2AX 1WWYA 5LASA 2CDPA 3WQ1A 1AX1A 1WZXA 3JCIA 3ZKUA 4DINB 3SH4A 1LOFA 4CVUA 3PVBB 4UBGA 2OVUA 3L2HA 1HQLA 2VY0A 4UFHA 2YUEA 4N43A 2WNOA 4MXWA 4L92A 2FDIA 2XBO1 3LCPA 1DQ4A 4IEYA 4JGYB 1FYUA 4LXLA 4EZ4A 5JSOA 1JODA 4Y20A 3CZJA 2YGMA 3BPZA 3OUJA 1O8PA 2D6MA 3AZXA 4KBZA 4QHZA 4QB6A 2WAOA 4HK9A 3LSEA 4K40A 1ENQA 1I6XA 2XBO3 3WZ1A 5L73A 3MIHA 4FFGA 4LO7A 4Y1UA 3OY8B 2YYOA 1ODMA 1LHVA 4XF4A 5E88A 2A6ZA 3GBWA 4LORA 3USSA 3ZIWA 2XUMA 3O0VA 4YWAA 2TUNA 5F7UA 2E32A 4A2UA 1S0BA 1E5SA 1XPWA 5H9RA 4FP2A 4CUBA 4OMCA 4L9BA 4NJ4A 5HCAA 2P6HA 1OKQA 4Y5TA 5IT6A 2RMU1 3B93A 2ARXA 4GD4A 5G04L 2XMLA 1VJ2A 3H1WA 1JI6A 3OB8A 5IVCA 3PJYA 2R0HA 5M0TA 1ENSA 5FPUA 2ZGOA 1YFYA 4RL7A 3MIDA 4XF1A 4W4ZA 5T5LA 3R05A 3FUOA 1KJRA 5ACA3 1LHUA 4MGZE 3VBFC 3ETPA 4KMQA 4XHBA 3I54A 3R4DB 3UJOA 2GMEA 1Q56A 4XXPA 4XJ8A 4E9KA 3TEZA 3K4DA 5C6CA 2B5HA 1V0AA 2EA7A 3ES4A 2GC1A 5ACA1 2XVKA 1GZTA 4CDUA 3WX5A 4IE7A 4NMIA 1C28A 4RQPA 5LEKA 2RDRA 5LA2A 3LSDA 1N1VA 3AP5A 3MGUA 1F9KA 4M3CE 1VALA 4XFIA 3FMGA 1AYN1 4YM3A 1QDOA 1Y43B 3ZMNA 5IVEA 1US3A 2ZMKA 5FYCA 3RGBA 3U78A 5BNNA 4NHXA 4UWDA 4XEZA 2XR4A 4QKBA 3BU7A 3VBHA 5DZEA 3ZR6A 5CBLA 3RWKX 4XUTA 4YG0A 1AX2A 1OT5A 1SFYA 2FMDA 2RS32 2JE9A 3FLTA 4GZ9A 3B9IA 3NJZA 4PIZA 3AJZA 3N7JA 1YNAA 2G19A 3VZMA 4PIXA 3NNMA 4QKNA 5DMYA 1IPSA 3V0BA 5T54A 2H6CA 4ZS2A 3UL2A 3DL3A 2JG9B 1HKDA 2VZ3A 1WCQA 1XNTA 1CAVA 4HXCA 5LY1A 3GZUC 1BEV1 2BGPA 4KWKA 1B09A 1DLLA 5FPVA 1HXS1 2WKKA 2G9GA 4N53A 2VCAA 1VBE3 2OXBA 2D98A 1VBB2 4YW5A 1OLRA 2JB4A 3VD7A 1W03A 3DPRB 3B01A 3POFA 5A33B 1W8WA 2Q5TA 4J1XA 3VB9A 5B2GB 3HPNA 3O1RA 4E2GA 1OMIA
chains in the Genus database with same CATH topology
2D97A 4XFGA 4P9WA 5D8AA 1EAH1 4AVVA 1HXS3 3FWEA 1DU3D 1COV3 3THPA 3GZAA 3CJIC 2HWE3 1GZ9A 4YZ5A 1CAXA 5A3LA 3WG3A 2R16A 3MDPA 4MUVA 4N7IA 4LO6B 1IS6A 2Z69A 3GYDA 3IBMA 2VG9A 4KNCA 4EV0A 3CNAA 1KDMA 4YG6A 3O0XA 1RUD3 4E2SA 1AXYA 4BQ1A 1DZRA 4N53C 4F8AA 5KHKA 1WBLA 3J8F1 1ZBE1 2JG9C 2RS12 4Y22A 4XFCA 3LOBA 4FPHA 1OA2A 2NP0A 1KRIA 3GNEA 2R32A 4WM8C 5DG1A 2CWMA 3WDYA 1YHFA 1CJPA 2B45X 2GDFA 2FQPA 3GF6A 5HCFA 3HAGA 4ZXKA 4OI0A 3HBZA 2VNOA 1FMD1 1F8VA 3IPVB 1LGCA 5CU1A 4AEMA 4YFZA 3JQXA 5JR7B 1UD1A 3TN93 2IXHA 3LA2A 3SNMA 3VBOA 1ENXA 2WSUA 2YMZA 4RFT0 4AFCA 1QJX2 1QGLA 4D69A 3POSA 4XW3A 2NYYA 5J7MA 3MIGA 4N43B 4AI8A 3OJBA 2DVFA 3AYEA 3S7IA 2C9AA 4YW4A 5T5OA 3ZN6A 4AHXA 2ZAHA 1DGWA 1DYPA 1DHKB 1UU6A 2OUHA 3M3CA 1G8WA 4LBMA 3WQ7A 4QM9A 2WNVB 3AMQA 4AGVA 4I0AA 4LLOA 2XJRA 1LRHA 3IM0A 4PIYA 1RUC1 2QDNA 5JAXA 2EALA 2H0VA 3KGZA 1MS5A 4DRRA 3GZTB 4LA2A 3QCWA 3LAGA 2JDZA 3VUOA 1QOTA 5L7OC 5E16A 3ZIXA 1LESA 5AVAA 2VVEA 2PTMA 1O3SA 3ECQA 4LE4A 5CFCC 4QHBA 4AE2A 3NAPB 2CYFA 3V65A 4Q27A 1R091 1QF3A 3VL9A 1B35A 1SMVA 3O5SA 1H4HA 1SBFA 2KA3A 2R063 2GH2A 1FPN1 4YVSC 3RWNA 1FV3A 4FQZA 4AXOA 4P9XA 4B4RA 4EROA 5GZGA 1VAKA 3VKNA 2VQAA 2KXLA 3WDTA 1LOCA 1F5JA 1N3QA 4N43C 2WFF1 2XLGA 3QH7A 1X82A 1BMV2 2WT2A 2WZPP 5AFEA 2V73A 2VPVA 4FPOB 4YZ3A 1DDLA 2BFUS 3ZSMA 1SLCA 2D6NA 2RJKA 5I8YA 4FTEA 1YFWA 5HXVA 3ASIA 2ET7A 3NW4A 1VLNA 1BVVA 2HWE1 1ZBA3 1PGSA 2YZ4A 1MS4A 4V1PA 1EV12 1VBC3 1KXGA 2JX9A 1QXRA 4J1WA 2A5ZA 1NG0A 2DYCA 1AR92 3MIFA 4GWNA 4HETA 2GN7A 1NXD1 1QQP3 4ASMB 1WLCA 2ATFA 5GLZA 3ALQA 4CDQA 3QLQA 1SCSA 2YXSA 1RJ8A 5BNPB 3NSTA 4PLNA 1A8MA 2W08A 2VW1A 1BMV1 1YJLA 1K5MA 2UY9A 3DUIA 1HRV2 3AYAA 1H1MA 2HWC1 1LOBA 1W6PB 5L7OB 2I07B 5DDJ2 2WNUA 4E4SA 3LB9A 1V6IA 4KG0A 4FPYA 2FZ2A 1NA1C 1XNDA 5T50A 5C9AB 4HN1A 1RJ7A 2NMNA 2VOKA 4E27A 1RHI1 4BH9A 3IT8A 4Z8BA 2HEWF 3B69A 1D0HA 2WNVC 2NPIA 1I1EA 1V9U2 2PHLA 4YGCA 2UYBA 4FOWA 4Q8KA 3ZYPA 2P3KA 5EWSA 4A7ZA 4WM7C 3MEPA 2XKOA 3POYA 5JZGA 5GLTA 1WMFA 2C1FA 4LBQB 4XJ9A 5FLJA 1Q43A 3VKLA 2XJVA 4GIQA 4QD2A 3WCRA 1HRV1 5EFUA 2VNRA 3ZXDA 4QGLA 1H8TA 2CL2A 2ERFA 3ZSEA 1VR3A 1RUH2 1W6PA 1SCRA 4N7UA 3KQRA 4RA0A 5DUUA 5DZGA 3AFKA 3ETQA 4DMIA 3WW4A 4S2HA 3VZNA 1EYBA 2VXRA 4XFFA 1BEV3 2VW2A 1WW7A 3ZFEC 1PZ7A 1AF9A 3J9SA 4MGIE 4QPIC 4BA6A 1YIFA 4OHVA 4AQ2A 2PQQA 1EPZA 5JIUA 1OI6A 1GICA 5GLVA 5DUVA 3SITA 4AEDC 4UW4A 5T3NA 4LHLA 1ZA4A 3AKSA 5DZFA 1D2QA 2RHPA 4CEYA 1MS9A 5HCBA 1MVEA 1QXJA 4LA3A 2H6BA 4X8NA 3VZJA 1FT9A 3OTFA 3IKWA 3EBRA 5I8TA 4CRQA 4SLIA 3FBMA 2R043 2UU8A 5JOYA 2DUOA 1COV1 1G7YA 1OD5A 4YVSB 1RUJ3 3ZFFB 1JN2P 4XTPA 1VBA3 4YVWB 3AP6A 3M1HA 4FPEA 3O0WA 1CD3G 4CDXB 1C8M3 2R49A 1HW5A 4N90A 2DU1A 4CEYC 4LBJA 1JYCA 2BYVE 5LRRA 1OPMA 3UV9A 1AJOA 3NWKA 1GANA 1IGOA 4OI2A 5FO7B 4AEDA 5LRSA 4S2DA 1EY2A 1GZCA 1VAVA 1S2BA 2ZA9A 4AEKA 1Z0HA 2AH2A 5K0UC 2A7AA 3G6JB 2XL7A 5JOXA 3RYKA 1Q8SA 3VZLA 2MEV1 3WG4A 4FSJA 1FPN2 4FT8A 1OSGA 4M0HA 5FFOC 3ZFEA 2RS33 5EJ3A 3B9CA 1X33A 2PAMA 5BNPA 4E4ZA 1GQHA 1NLRA 1A6CA 1LCLA 2LALA 1V6JA 1JYIA 4GH4A 1KITA 2NLRA 4WZFA 1U5ZA 4JC1A 1OHFA 3EQEA 4YVWA 3HWJA 1YO8A 4B4PA 5GZDA 2Y0IA 4AVBA 5JI7A 3NV4A 3HN1A 2WL1A 3IDCB 3X29B 4ASLA 2WS91 4NOTA 5BNPC 1RUOA 3VDDA 3WG2A 3VBOC 1HXS2 1REEA 2JICA 1WMDA 2PHRA 1RUJ2 3FLPA 4WVWA 2D3SA 3SH5A 2CNAA 4AWDA 3IIAA 4EN7B 2DCJA 4X6RB 3OYWB 4HVRA 1ZM1A 1S55A 4EJRA 5FMOS 4H3WA 1ENRA 3M3EA 3MPPG 1U12A 1QY4A 5H9QA 3OBRA 2W0XA 1J3QA 3E5QA 4HBNA 1AR72 4Y1VA 4FXKB 2IC1A 2VOWA 2WZR3 1NA1A 5IK5A 1VRH1 5FDBA 4IEQA 3P3NA 3USUB 1H8TB 3OBTA 1W39A 2Q1MA 1BZWA 1RUG3 1OQDA 1QJX3 3WLUA 3IMNA 4RS5B 4JGZA 1Q8QA 4COVA 5JWPA 3R4SA 1AL21 5DDJ1 3LZZA 1Z7S3 2GMPA 1CAUB 3BODA 1ZNPA 2OZJA 3HMYA 3CJIA 4I0BA 2OIIA 2A6WA 2TEPA 4QM8A 1FMD2 4QXKA 1YWKA 1BJQA 4HLTA 4SBVA 5CADA 4WVMA 3WCSA 5FLIA 1YYNA 5IK8A 1H4GA 4LNVA 5IUQA 1DZQA 3WDWA 3NVCA 1X50A 1IZ3A 1RUE1 4XILA 3RQ0A 1QKQA 4D3WA 2RE9A 1D0GA 1OFSA 4K7JA 3CL1A 5A33A 3ELNA 5BYNA 1ASJ1 4RR3B 4P9JA 2ZS6B 2JD4A 1R083 2GU9A 4S2FA 4XMIA 4YARA 4IV3A 2GNBA 5AC92 5ACA2 1UN1A 1YLLA 2ZAAA 4JDMA 4MSVA 4RD7A 2NN8A 3PVEA 3LA7A 1K5MB 3M70A 3VBUB 1GLHA 1PNGA 5CFDC 1ZX5A 4YM0A 1F5FA 2VNGA 1BXHA 1SDWA 1R081 2Y0OA 1H8TC 3ROUA 2GC0A 2CGNA 2WNUB 4ZU4A 4D7SA 4AVSA 4XQWA 5C8CA 4YG3A 4Q26A 4XTMA 3JB8A 4XDQA 1RUG2 2BWCA 1NYWA 1PK6C 1FXZA 2PLV1 4YVSA 1UCXA 2X5IB 2B39A 2G9FA 5IK7A 1UPSA 3HT1A 2R042 3JU9A 4K6BA 4KWJA 2CAUA 4EN8B 5JDBA 1UX6A 4RGGA 4AGRA 2YGLA 3U11A 4QT6A 1PM7A 3NL1A 2YV8A 3VL8A 3WP6A 3KGLA 4P14A 4Y1XA 1I9RA 5AFBA 2GNMA 5T5JA 4AVCA 2GMMA 3N4MA 1PGL1 2EXHA 1Z7S2 2R061 1HDKA 1H2LA 4OZXA 3AM2A 2D43A 4NO4A 3VBRB 3VBOB 1K5MC 5AVPA 1D4VB 4TYSA 1FOD2 4D7YA 1DQ2A 1Y3TA 1G9FA 2W52A 3PTYA 1RITA 5TSWA 4AHYA 3VBRC 4IESA 3APBA 1R1ZA 1ZREA 1FATA 1V6NA 1H8VA 5F6LB 3ILNA 3H3ZA 2ZGLA 1IPJA 5C8CB 2BWAA 2GN3A 4AI2A 1GSLA 5A32B 1LOFC 2XJPA 4P9LA 5T52A 1TMF3 4Y22B 2XLAA 4I3PA 1BVP1 1XE8A 4Q4X2 1RMU2 1DZTA 3FUQA 4KU7A 2Q4SA 1WW4A 4XXAA 3KT1A 1NE4A 4M01A 2JECA 4S2GA 1PVXA 4L2NA 1AR82 2YDEA 4WVVA 4NWVA 2DUQA 5I0UA 4Q4W2 5FPXA 1Q5OA 1QDCA 2K0GA 1JH5A 2ZGNA 1QOSA 2ZPXA 3A0KA 4IETA 1PIV2 2WFF3 3AP4A 2TNFA 4CZSA 3O14A 5SV8A 2ZCWA 1GZWB 4ATEA 3DF0A 3SH3A 1MZFA 1C4RA 1PK6B 1C1FA 1DQ6A 1QJU1 1YI7A 2WA3A 3KD4A 4BOWA 4CDXA 1LECA 4PBPA 3E6CC 1C57A 2PYTA 4B29A 1DBNA 3SXWA 3URFA 1N3PA 3UJQA 4H14A 4OHZA 3GALA 4CP2A 4BMEA 3BOPA 2A75A 3SCHA 5F5QA 1LODA 3WXPA 3DV8A 5T5PA 2GSYA 5K9YA 4BLJA 2DU0A 3D8CA 2NZ9A 1CIWA 4Y26A 3ZFGB 2PAKA 1MEC1 1S0JA 3GHNA 2XJTA 4XBNA 4A3XA 4AHZA 1S0EA 4FPKA 3S6PA 5HI0A 5BNNB 1RUE3 1J1TA 2YROA 4OI1A 1RUF3 4LBQD 3S7EA 1B35B 4COZA 2VOXA 5JCTA 2E7AA 4K3UA 3TOJA 2OA2A 2EAKA 3J8F3 1QJU2 2HWD3 1AR83 2DTYA 5L19A 3KMHA 2VUJA 1ZZ6A 1V70A 2DFBA 3P3PA 4MXWB 4NN0A 4YZ2A 2P34A 2ES3A 1MVQA 4D7TA 1OPOA 2VULA 5T55A 4FP3A 3R6SA 4YLZA 4LBQA 4HK8A 1LEMA 2R6QA 3KLSA 4RHV3 1AR91 2A6VA 2K2SA 2XVGA 2AENA 3OPZA 4RQPC 5J48A 1REDA 3FE5A 4MVTA 3V0AB 1LR5A 4QQOA 5JZGC 1W6OA 1VBB3 4XBQA 1R093 4FPCA 3ILFA 3FHIB 1UAIA 1PNFA 4Q0PA 4FAGA 4DXZA 4UW6A 3CU7A 1NE6A 1EP0A 3RG0A 1J3PA 2E53A 1WD4A 3ZFGC 5FOBB 4WM8A 1GYKA 1YI9A 3D5OA 3KCYA 3MI8A 1U5YA 1PVC2 1ZBE2 2JG9A 3HIFA 1WCSA 5JLVA 4XJAA 1ZYBA 2X29A 3U4XA 1DGRN 1HLCA 4Q4V3 2PLV2 1S0DA 3D4KA 1QU0A 2N7GA 1CESA 2DCZA 3CEWA 5FREA 1XNKA 3U10A 1LENA 2RS11 4RHV2 1V9U1 1WA4A 1AR63 1APNA 1WUVA 4BLIA 4MGKE 2OZ6A 1AYN3 3CJXA 3V0AA 4URTA 4KU8A 3FFQA 4PDWA 2DVAA 3H50A 5JMCA 1JXNA 5CVRA 1NQJA 2ZX2A 1C5HA 4WBBA 4XIOA 4C1WA 1O3RA 2IXIA 2XWBB 1UF2C 3AKPA 4RQPB 5FLHA 4EN9B 1LU1A 3ACLA 2Q8OA 1C3HA 1IS4A 3OYWA 4Q1PA 3ZYRA 2NQYA 4M3CB 3OGJA 2A3WA 4HSJA 2NMOA 4IV1A 2R062 2I74A 4MLOA 2E6VA 3IWZA 4FOYA 4BYYA 3NO8A 4H7LA 5DG2A 4CDWB 3AKRA 3AK0A 1X7NA 1TME1 1HRI3 2D5HA 2C0ZA 1QH6A 4Q4Y1 4JQRA 4MYEA 4E2QA 4GB33 1AR73 1GR3A 1LHWA 3OY8A 1VBA1 3RNSA 1RMU3 1ULDA 2WS92 2XB6C 4LUKA 5E1RA 1O7FA 4JVAA 5BNNC 4FO9A 1SBDA 3VHRA 2XG3A 4IEXA 4AW7A 5BUVA 1Y7BA 5KWRA 1LGNA 1RINA 1ZBA1 1QJZA 4Z1VA 3FX3A 2EXIA 1Q8OA 4EWDA 5JSRA 3CF6E 2HYKA 1AX0A 2DCKA 3C2UA 4FOVA 4YGEA 3DPRC 3ZSJA 1PIV3 2AZ5A 1N1SA 5GM0A 4C90A 5C33A 1FAYA 4MH0E 1B35C 2ILMA 4R9AA 2BEOA 4I2OA 4JRAA 1ULCA 2D40A 2Y26A 4PBOA 1SLBA 3RRDA 2TBVA 5AC91 3RSJA 1WLWA 4YYOA 4QGNA 4FVVA 4CEWC 1RUD2 4JGYC 4B7EA 3KB5A 3MIEA 1NQDA 1CGPA 2W39A 2ZTNA 2JXAA 2D6KA 3NAPA 1IPKA 1WBFA 2RM23 1TQ5A 1HV0A 3SCFA 4BWOA 3KS7A 1AL22 1V6LA 4R8HA 1EV13 1ZRDA 1YXWA 1V00A 2DVGA 3LKJA 1FPN3 2HEVF 3QBQA 3ZXFA 3HQXA 3H1YA 4K21A 3I4IA 4LBKA 5K0UB 3TAYA 5KHIA 1R1A1 4K1ZA 3VKFC 2WINB 3LA3A 4HFSA 4QQHA 4GULA 4PF5A 3E5XA 2RS51 2DCYA 1RUI3 1KQRA 2ZX4A 4XETA 1ZRCA 1N3OA 1ND2C 1EAH2 2PA7A 3NV2A 4TZDA 1JHNA 2PFWA 4N9HA 1TEIA 4B4QA 5EXOA 3INAA 1PGW1 4ONUA 2AYHA 3WQ0A 5JSPA 1CPMA 1WMEA 2RMU2 3BIWE 1J1LA 1LHOA 1QQP2 3NKTA 4MV2A 4OUMA 4C0HA 3N