1WLCA

Congerin ii y16s/t88i double mutant
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
134
structure length
134
Chain Sequence
DRAEVRNIPFKLGMSLTVGGVVNSNATRFSINVGESTDSIAMHMDHRFSYGADQNVLVLNSLVHNVGWQQEERSKKFPFTKGDHFQITITFDTHTFYIQLSNGETVEFPNRNKDAAFNLIYLAGDARLTFVRLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Congerin II
publication title In vitro evolutionary thermostabilization of congerin II: a limited reproduction of natural protein evolution by artificial selection pressure
pubmed doi rcsb
source organism Conger myriaster
molecule tags Sugar binding protein
total genus 29
structure length 134
sequence length 134
ec nomenclature
pdb deposition date 2004-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00337 Gal-bind_lectin Galactoside-binding lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1wlcA00
2GNTA 4YM2A 1MS0A 3D5OA 1AX0A 1KDKA 1ULGA 2A3WA 2EXKA 2ZKNA 1KQRA 3T2TA 2AYHA 3AZYA 4Q27A 4RL7A 1YIFA 2AREA 1JXNA 5GZGA 1OQ1A 3W59A 2D44A 4AYUA 2E6VA 5IK4A 2ZHMA 3DUIA 4DRVA 1WLWA 2AR6A 2EXHA 1RINA 2GN7A 2YMZA 1AX1A 3AZZA 2NMOA 1VAMA 1UN1A 1Y7BA 2OUJA 4GKYA 3KM5A 5T52A 2UWBA 4M3CA 1UX6A 3V0BB 1LGCA 4FPEA 2DVGA 2EXJA 2NYYA 5E8AA 4XJ9A 2A7AA 4DRRA 4P14A 1QNWA 4BM8A 1JN2P 5KXCA 5GZFA 2UURA 2PHWA 1AXKA 4ITCA 4H55A 1F9KA 4AVVA 1S1AA 1Z0HA 2OUHA 4D69A 1I1EA 4DPNA 3WDVA 5DUVA 4ATFA 1NXD1 3ATGA 2PHFA 1PZ7A 4ZXKA 3M2MA 1CN1A 3WDXA 3ZXFA 4RA0A 4FPOB 3WDYA 1CPNA 2PHXA 4DS0A 1UPSA 4NOTA 3CNAA 3Q9OA 1X50A 1S0EA 3WUDA 4YM3A 1DQ2A 1UZYA 4YW4A 3N7JA 3NV3A 2DV9A 5CAZA 1Z78A 4Q1RA 2ZGNA 3VKOA 3WDUA 3PVOA 1FV3A 1GLHA 2W39A 3WOGA 5CA6A 1GZCA 5JDBA 2ZACA 3AK0A 2YV8A 1S0BA 1KJLA 1LHOA 1PZ8A 1UKGA 4Y24A 1CIWA 1C4RA 4LBJA 2D6KA 2ZABA 1B09A 1F5FA 4Y22B 2D6PA 3USUB 1C1FA 2YZ4A 3LCPA 1IS6A 1MS1A 4XZPA 3R4UA 3IPVB 2DURA 2VU9A 3ZXLA 2XG3A 3JUUA 4M00A 1J1TA 2CWMA 1W6QB 3LSDA 3FUQA 4JC1A 1JYCA 2P34A 4YFWA 4FOYA 3AP6A 2ZHLA 5L73A 1QDCA 1YI7A 2Z42A 3AYAA 4Y1UA 4YGEA 2W52A 4FPYA 1PZ9A 3WV6A 1KDMA 2VW1A 4LBQA 5T5PA 1DYPA 3JU9A 4Q1PA 1GKBA 1JHNA 3UK9A 4DFSA 1AF9A 2ZGSA 4XMAA 4XTPA 1BXHA 1DZQA 2DUPA 4XMIA 1WBFA 3PMEA 3UJOA 5JMCA 5H9SA 1MS9A 2Q5TA 1RITA 3SISA 1GNZA 2DUQA 3AX4A 5JOZA 1S0FA 2ZGPA 3D6EA 1ENQA 3ZYPA 2ARXA 1W6NA 4FP3A 4XYXA 2JJ6A 3N36A 1AX2A 1N47A 4R9DA 2GMPA 5H9PA 2PHTA 3NV1A 1V6NA 2ZGUA 1SBEA 1U0AA 2WT1A 5EXOA 3AYEA 2B7YA 5DZEA 4WVWA 4XXAA 4YLZA 1MVEA 2YXSA 2GMMA 3SNMA 2P3IA 3VUOA 1A8DA 2ZGKA 1O4YA 5DUWA 3NV4A 3A0KA 3SH4A 1IOAA 3WG4A 2V5YA 3AZWA 1CR7A 1YYNA 3ZXKA 2JECA 4NO4A 4K21A 5JOWA 4UW4A 3AXDA 1APNA 1CESA 2JKBA 3NWKA 2ZGRA 2CL2A 1SBDA 4KBBA 1GZ9A 3N35A 1G9BA 2P3JA 1V6IA 3B9CA 1QF3A 2NZ9A 2A6XA 5GLZA 2LALA 3AZXA 5KXDA 4FOVA 2A6ZA 1CVNA 2WNEA 1CPMA 1KITA 5EYYA 3RMXA 1DFQA 3IKWA 1VALA 1W6OB 4FQ4A 1GZWA 4FOWA 5T5JA 1LOCA 1IKQA 4R9CA 2ZGTA 2GNMA 2ZAAA 3O5SA 2DVBA 1SCRA 4WVVA 1WW4A 3FLPA 2WJSA 3OGGA 4YGCA 4ASMB 1QKQA 2E7QA 2GMEA 2PHRA 5T50A 1WLDA 4ZKTB 1KJRA 1LOFA 2D6MA 1V6JA 1FAYA 2OVUA 4M3CB 1DIWA 1SBFA 3GNEA 3ENRA 1HDKA 1LESA 2A3XA 2GN3A 3BODA 5T54A 4C1WA 1RIRA 2CNAA 3OBRA 1OFSA 5T5OA 1C57A 1ZM1A 5CB7A 3U4XA 2NM1A 4YGBA 1QGLA 4PBOA 3ZSJA 1MS3A 4BMBA 2TEPA 4BOWA 5HCBA 4BMEA 3WG2A 1ULFA 1AXZA 4XE9A 5SV8A 5H9RA 4ISRA 3D4KA 3VKLA 1W6PA 1XQNA 1HKDA 4BQ1A 1R1ZA 1YO8A 1SLTA 2R0HA 4BLJA 5IUQA 1LOAA 2AUYA 5H9QA 2R1BA 2R1DA 2R16A 1DQ0A 2W68A 3ZSMA 3GALA 3B00A 3AZVA 3RMYA 2UWAA 5GLUA 4XIKA 2WT2A 3M1HA 3PVNA 1SLBA 1SLIA 1WUVA 4FPCA 1D2SA 4FPKA 3IM0A 4W65A 3V0BA 3OJBA 4BLIA 5KXEA 1W6MB 1O4ZA 2GNBA 2D6OX 3OPZA 4YW1A 1TEIA 4Y1XA 1V6MA 4JCKA 2C9AA 4LBLA 1V6LA 3PJQA 1NLSA 2D3PA 2EXIA 1DYKA 4JRAA 4UW5A 3SH3A 3ILRA 4AWDA 1MACA 4LBKA 1UZZA 4I30A 3W58A 2ZMKA 1G7YA 1YRZA 3RG0A 3ZSKA 2V73A 3OY8B 3FUOA 2D3RA 2ZGQA 2DTWA 4YM1A 5IK7A 3WZ1A 1DLLA 2NN8A 4XJWA 4XJAA 2G4IA 5DXDA 5JLVA 1QU0A 1ULCA 1WW5A 1N3OA 1AJOA 1F31A 3M3OA 3I8TA 3OBTA 1SACA 3AJZA 4IQPA 3T1LA 3V0AB 2EIGA 1IKPA 2ES3A 1LHUA 3T1MA 4YZ2A 5F9TA 1FATA 1GNHA 1ONAA 3ILFA 1QDOA 3FFZA 3ASIA 3FBYA 2A70A 1N3PA 2DVFA 2ERFA 4YZ3A 2D6LX 1LECA 4WZFA 1WBLA 2WSUA 3N7MA 1DQ1A 4Y22A 2R49A 5GZCA 1LEMA 1LU1A 2FHRA 2E51A 1LENA 3POWA 1AZDA 2D7FA 4Y20B 3POSA 3WNXA 1LGNA 3ZXJA 3V65A 2CTVA 1VLNA 1W6QA 2ZGOA 4GWNA 1SLLA 3NV2A 3R4SA 1MZ5A 3B3QE 4Y1ZA 2I2SA 4XXPA 4FPFA 1WLCA 4XOGA 1IS3A 1BYHA 4XHBA 5CNAA 1UMZA 2JE7A 1CQ9A 4Y26A 3FLTA 1A78A 2VXRA 3BIWE 5FREA 2CYFA 4Q8KA 2AGSA 3O0VA 3OYWB 4K20A 1I3HA 4YFZA 4UW3A 3RRDA 2R0FA 3APBA 2JDZA 5DG1A 1LEDA 2NMNA 3RSJA 2DU0A 3AP7A 3WHTA 1DQ4A 4XBQA 1N1TA 4GKXA 5F5QA 2A6YA 4ISQA 1URXA 2A6VA 1ULEA 2EALA 1G9FA 2VY0A 4ATEA 2PELA 4YW3A 4CTEA 5JOYA 4YG3A 4TZDA 1AXYA 5HCFA 2ZGMA 1LOGA 3WG1A 1AJKA 2OW4A 2W08A 5DUXA 5BYNA 5IK5A 1SFYA 2WQZC 5E88A 1UAIA 5DUUA 1LU2A 3RS6A 1FX5A 1EPWA 3AP5A 4FP2A 5GLTA 2UU8A 4PCRA 2D43A 1BZWA 1ENSA 3MPPG 4YG0A 1GV9A 1ENRA 4DQAA 1Q8SA 4HL0A 2DU1A 2ZMLA 2FMDA 3MW3A 3WLUA 2VW2A 4CRQA 1WW7A 1JYIA 3FLRA 4Q8LA 1QOOA 1LHVA 3AP4A 1SCSA 5LK5A 4TYSA 4YZ4A 1CJPA 1D0HA 4FOQA 5GZDA 2VW0A 3C2UA 4FPLA 3WVJA 1QOSA 2VH9A 2KM2A 5DZGA 4AGRA 3UJQA 3VKMA 1MS8A 1SLCA 1G9AA 2ZA9A 4AGGA 1DQ5A 4XTMA 4FVVA 1HQLA 3VKFC 3A4UA 4P9XA 1V6KA 2GALA 3SLIA 1MS4A 1SLAA 2DTYA 4M3CF 1LJ7A 5T55A 1W6PB 2DYCA 1W6OA 4GXLA 3VV1A 2P37A 4M3CE 3WG3A 1LOBA 1H9PA 2AH2A 2XB6C 3WDTA 4AVSA 2ZHKA 2PHUA 3PVEA 5IT6A 1LODA 1V00A 1ULDA 2WSVA 4UW6A 3BTAA 4XDQA 2RHPA 1G8WA 2D6NA 4XBNA 4AGVA 4GALA 4SLIA 1BJQA 1N1SA 1LTEA 3HN1A 4P9WA 3DGTA 2A5ZA 1JUIA 3O0WA 4FPHA 2DUOA 2YY1A 3IMNA 1GYKA 1FV2A 1DQ6A 5GALA 1A3KA 3TAYA 2EF6A 1LHNA 3SITA 1JBCA 3M3CA 1QMJA 4Q2FA 1UL9A 2DWRA 4Y1YA 4R9BA 2HYKA 4YW2A 1MVQA 5GJ6A 3B01A 1LULA 1OKQA 3ZSLA 4XBLA 1DHKB 1HQWA 1LGBA 3AYDA 1Q8QA 3LSEA 5GM0A 5JOXA 4MYEA 3HR9A 1G9CA 1N1VA 5GLVA 2GDFA 4YZ1A 4FPJA 3WDWA 3R05A 3USUA 4CZSA 3N7LA 1G9DA 2DVDA 1VAVA 1G86A 1MS5A 5AVAA 4YZ5A 4YGDA 5EYXA 1N3QA 4M01A 4Q26A 1BQPA 3ILNA 3N7KA 1AVBA 3ZXEA 2CY6A 1Q8PA 3KQRA 1S0IA 3V64A 5KXBA 2ENRA 1JW6A 1MZ6A 4LBQB 1VIWB 2C5DA 4C1XA 3ZYRA 1FYUA 2WT0A 1DBNA 2ARBA 4XHXA 1S0DA 5FRAA 4XIOA 4LBOA 3H0OA 4Y1VA 3QCWA 2E7TA 1S0GA 1WD3A 1W6MA 2ZMNA 1LOEA 2DVAA 3B69A 1QNYA 4FPGA 4YM0A 3WHUA 2EAKA 5GZEA 5CBLA 1H9WA 2ZGLA 3I4IA 1IS4A 3MW2A 1W6NB 2VUAA 4FQZA 2ZHNA 4R9AA 1KRIA 3UL2A 2BQPA 2WLQA 4PF5A 3OY8A 2A3YA 1FNYA 1W0OA 3IPVA 4AVTA 5GLWA 4YW5A 3O0XA 4F83A 3INAA 3M3EA 4XJ8A 4LBMA 1Q8VA 5T5LA 3TB0A 2P3KA 2A75A 1YXWA 5EWSA 4GA9A 1Q8OA 4K1YA 1GBGA 1ZA4A 2E53A 4P9YA 3V0AA 1LOFC 4PBPA 3MW4A 4BPZA 2A6WA 4PQ9A 4WV8A 3POYA 4OZXA 1WD4A 1S0CA 1QOTA 2SLIA 3N3HA 4Z8BA 3A0NA 4U36A 3ZPYA 3WUCA 2JD4A 3HMYA 2UWCA 3BOPA 1BKZA 1WCSA 5HCAA 1GICA 2NP0A 1DGLA 3WCRA 5E89A 4Y20A 4XJUA 2ZBJA 3AXEA 3ZVXA 1LHWA 2JE9A 3VKNA 1GZWB 2A71A 1W0PA 1V6OA 4U2AA 3O12A 5DG2A 3WCSA 4LBQD 4XILA 3QLQA 1H30A 2WKKA 2ZZJA 1FNZA 4YG6A 2AENA 2SBAA 1IS5A 2YROA 3OYWA 3L2YA 4K1ZA 2D3SA 5DZFA 1Q56A 4XJZA 1JOJA 3AJYA 3RQ0A 3AP9A 2LTNA 3AYCA 1GSLA 1HLCA 2P2KA 1C1LA 1WW6A 3SH5A 2H0BA 4LBNA 1LCLA 1GANA 1MR5A 2CWSA 4GWMA 1CONA 1N1YA 3AFKA 3MEPA 2GNDA 5JVVA 5IK8A 4L8QA 3M3QA 1S0JA 3IN9A 4HANA
chains in the Genus database with same CATH superfamily
3Q8EA 4S2DA 3GHMA 4ES9A 5IHRA 4PIZA 2HWC3 5F3CA 4XF1A 2VOWA 5FBZA 1C3HA 4RL7A 1YIFA 1JS9A 2AREA 3AKPA 4KG0A 2W3JA 5FLIA 3ZFFC 4AG4A 5IK4A 2E6VA 1ZZBA 2ZHMA 1RUF2 2ZX3A 2WL1A 4D6RA 2R072 4DO0A 5JSPA 3AZZA 3VZLA 4W4ZA 4NIDA 2VUJA 4M3CA 1R1A1 2Y38A 1B35C 2HJIA 1TQ5A 4RR3B 4YVWA 2RDSA 2MEV3 3F2ZA 2NYYA 4IEPA 4X8PA 2IXKA 2VTXJ 5E8AA 1L3JA 3I2DA 5EQUA 5CKQA 4DRRA 5ISLA 3LQCA 4MXWA 4D8MA 1JN2P 1OSGA 3JD73 3T4HB 1C8M3 5E1RA 2P6HA 4D69A 1BMV2 3WX5A 2ATFA 2K9ZA 5HXMA 3THTA 5DUVA 1HW5A 2WBKA 5FXXA 3PMSA 4EWAA 3ATGA 2PHFA 4CDQC 5CU1A 1PZ7A 3ZXFA 2E31A 3PNAA 5CFCA 4FPOB 4DS0A 1UY2A 1UPSA 3CNAA 2YC2A 1HJGA 2XBO3 5FZDA 2BOJA 3C7GA 5FR3A 3PUHA 2JWPA 4YW4A 3NV3A 2DV9A 2OPKA 1Z78A 2YBPA 3QD6A 2ZGNA 5IJRA 3PVOA 1J3PA 1JYXA 3DPRB 1OLQA 1Z7S1 5AC92 4IGOA 2VCBA 4Y4RA 5LRRA 5FTTC 3CU7A 5JDBA 2JEMA 1RUH2 2YV8A 4GJZA 4CDWA 5LBEA 1UKGA 4RD7A 3ZYIB 1C4RA 1JTZX 1RGSA 2EIEA 2R063 4EN6B 5IVBA 3UGFA 4HKLA 2EAAA 5A1AA 5LY1A 2Y8KA 1VBD1 2D6KA 2ZABA 4YRDA 4E8DA 1JYTA 1Y4WA 5FY7A 1IGOA 5LZ6A 5I0RA 5JSOA 1NXMA 2P3YA 4XZPA 2FZ2A 3NQHA 1AR83 2DURA 2B8MA 2ARCA 3IPVB 3JUUA 3ZXLA 2CWMA 2RJ2A 3DYOA 4N7UA 2BU9A 3LSDA 5A6QA 3GJBA 3NAPB 5C8CA 3AP6A 2ZHLA 3MBWA 4QX3A 4YGEA 1UY3A 4FPYA 2VUCA 3MIFA 2QE3A 1PK6C 1PNFA 1JHNA 1ZZCA 2XWBB 1BXHA 2VCMA 5FWJA 3HQRA 1UZWA 5H9SA 4AEKA 1MZFA 3LA2A 2EICA 2DCKA 3HNYM 1MS9A 1RUF3 1RITA 2Q5TA 3DYMA 1OFNA 3SISA 2DUQA 1R1A2 2R073 3D6EA 1RHI1 4XYXA 3VLBB 1OUSA 2JJ6A 3MIHA 4GB33 5CIRA 4AE2A 1AX2A 4KQ7A 1W2AX 3ON7A 3EMRA 3CZUA 4IW3A 1I5PA 4XF9A 2R32A 4NHKA 2F4LA 5F5CA 3SNMA 5A32B 2GMMA 3VUOA 2P3IA 1A8DA 1YI9A 4TLGA 1O4YA 1DGWX 4IE4A 5DUWA 5L9BA 4YARA 1UYXA 1SPPB 2R6QA 2V5YA 2Q1MA 4NO4A 3HWJA 5JOWA 5A7WA 5FUNA 3AXDA 1KFXL 1GNYA 3I2HA 3H1MA 4NE9A 3ZKYA 3OGVA 4YW6A 4UFHA 2CL2A 4CCEA 4N43A 3HBKA 1W2UA 4IEWA 1G9BA 1QJX1 2P3JA 1V6IA 1NA1A 3GF6A 3KCYA 5C9AB 2E26A 2GC0A 4GH4A 1Z7S2 1X7NA 2W95A 1FI2A 2A6XA 4AW7A 2VZOA 1WZXA 2RR11 4CDXB 3ZFGC 1HV0A 4ZU4A 1CVNA 3RMXA 1CPMA 5AC93 3LOBA 3VHRA 4EN8B 1DFQA 2X05A 2HKXA 1RUH3 4FQ4A 5A3PA 1VBD2 1VBC2 4FFFA 1AUYA 1GZWA 4FOWA 5T5JA 1LOCA 2XJTA 3MZHA 5K0UC 1GWKA 2ZAAA 4H14A 5FPBA 1NZIA 4UT5A 2RVAA 1BVVA 2DVBA 1DF0A 1L7RA 1UKRA 4BU2A 4WVVA 5F6KA 5CFDA 4YGCA 2VMGA 1W9FA 3LDKA 4MVTA 1RUE2 1GQGA 4Q0PA 1LOFA 3FC0A 1SDDB 1W39A 1V6JA 4OUSA 3GNEA 5D8AA 1OC1A 5D2AA 2A3XA 2HWB1 2J1SA 1RIRA 4QX1A 4QDSA 2CNAA 3FZ3A 5T5OA 5A3TA 2DCJA 4AI8A 3AKTA 3CLPA 3D82A 2TEPA 2FBEA 4BMEA 2YBKA 3WY6A 1ULFA 3NNFA 2VNVA 4PI0A 5H9RA 4ISRA 3D4KA 2WWJA 1RHI2 2WUHA 2JDAA 3CJIB 2WWUA 2W87A 1SLTA 1R1A3 1VP6A 2ZTNA 5BUVA 1ZVFA 1QIQA 2JDPA 1PGL1 2R1BA 1JODA 1ZZ9A 4O61A 1LNSA 1R093 1T2XA 2B5HA 2E32A 2R16A 1DQ0A 3B5LB 3CZJA 4YYOA 3OB8A 3AMPA 1EUTA 4Q4Y3 2WAAA 3WQ1A 3RMYA 4G9SB 4QWNA 4XIKA 1F2NA 3DXTA 3PVNA 4JGYA 2X5IA 3NMBA 3VDAA 1I6XA 4BHPA 4FPCA 1D2SA 3MUZ1 4HSJA 4W65A 4OI0A 3M4FA 1FT9A 1ALYA 2UYBA 3OJBA 4BLIA 3OPZA 5KXEA 2D6OX 1QJX2 4L97A 1AYN2 5D1IA 4QQ2A 1RUI1 3D3AA 4UW5A 5FMOL 4JRAA 1CZSA 1OD5A 2D97A 4XEZA 4JVAA 1MACA 1XYOA 4HXCA 3U4SA 4AWDA 5CISA 1W8FA 5FWEA 3W21A 3RG0A 1ZRIA 1PMJX 3NRUA 3FUOA 2D3RA 4K9SA 1UXXX 1HB4A 2NN8A 2K46A 1GOFA 1OQDA 3E97A 4XJAA 5DXDA 1VBD3 1VBC3 5JLVA 3BIEA 1N3OA 1ULCA 3M3OA 3ZFFA 4QHOA 3OBTA 4LITA 3AJZA 4DXTA 3T1LA 4BISA 4AFMA 1ODMA 4P00B 5K7PA 4NPLA 4R52A 3Q8CA 5EJZB 4D6QA 1GNHA 4YVSB 1C5HA 4HZFA 3VDDB 2VZQA 2ZOEB 4I01A 1QDOA 3Q8BA 3FFZA 4MGIE 4CEYC 1RUE3 1B35A 2HWB2 1W28A 3VZMA 1YIPA 2Z2SB 1LECA 5IFTA 1WBLA 4RQPC 1DQ1A 1XNDA 5BNNC 1LEMA 2ZEXA 2FQPA 3IAQA 2D7FA 5E16A 3POSA 4QPIC 3BTZA 1V70A 4IV3C 5A1FA 3ZIXA 3WINE 4XCAA 2JE8A 2PHLA 3ZN5A 1E5SA 1ZNPA 4GWNA 4AFBA 3WSOA 4OQ8A 1OH4A 1MZ5A 1OVSA 3B3QE 4Y1ZA 4CDQA 2I2SA 5FK7A 2YU2A 4LPLA 4FPFA 3AC0A 1RHI3 3THCA 1U5YA 5A6ZA 4LXLA 2C1FA 1PGL2 2OIIA 4RHV2 5FREA 1IPSA 2VXRA 2VD7A 4UF0B 2QQMA 1Q43A 3C7OA 3OYWB 2VC9A 4UW3A 2RG4A 2KXLA 2R0FA 5IVFA 2JDZA 1HRI1 3T3YA 4BQWA 1EAH1 4QHZA 4CP0A 3EHKA 5HCHA 2DU0A 3AP7A 3IZOA 5FCCA 5K4LA 3UESA 5ABJC 2H6CA 4IE5A 4HVOA 4CCJA 2ILMA 2A6VA 4CUGA 1ULEA 1PHMA 2EALA 2VY0A 3C8XA 1X8MA 3JBG3 5FZGA 3JQXA 1NCRB 4MHRA 2VZPA 4YG3A 2XHNA 3KCCA 5DABA 1J58A 2VAUA 1RUI2 1UMIA 3IIAA 4PJYA 3T2QA 3WG1A 5BYNA 5DUXA 3BKZA 2P17A 1QJX3 3GZEA 3RS6A 1W9YA 1AYN3 1W8OA 2QQWA 2Z5WA 4MGYE 1FX5A 3AP5A 4I3PA 1O3SA 3IT8A 4QT6A 1BZWA 5F3EA 1WCDJ 4O9EA 3KVBA 1GV9A 3RVHA 3EJKA 1JZ4A 3O1VA 2W1WA 3MW3A 3U14A 2QZ3A 2VW2A 2VZ1A 3I2KA 4YNIA 5CEHA 4IV1B 1PK6A 3T2OA 1SCSA 4TYSA 1MZEA 4YZ4A 2R041 4FOQA 5GZDA 1OXCA 3T0AA 3DKQA 5FZOA 5JZGB 5BNPB 3C2UA 1SMVA 4UFKA 1W06A 4GIQA 2KM2A 1ZYBA 2CSGA 1YNAA 1O59A 2DCTA 2ZA9A 4AGGA 5FZEA 2VVEA 4JGZB 4JTNA 3WF1A 2NLRA 3SLIA 4CCNA 1S4CA 1SLAA 2PYTA 4XFBA 1W6PB 1WMDA 2DYCA 3B93A 5FV3A 1UY1A 3HOBA 1XB9A 3WDTA 3EB7A 4D3WA 2BJSA 2PHDA 3ZDVA 2AEYA 5C4WC 5IT6A 1L7QA 2WO1A 5FKCA 1ULDA 4COWA 2VZUA 4UW6A 1UY4A 2C0ZA 5C3PA 1UOJA 2D6NA 1UIKA 3J26N 4GALA 4N9HA 4MG2A 3U10A 3GXUA 5FQ0B 2A5ZA 4FPHA 3T4VA 4HFSA 2QDNA 3B94A 4N53C 1CAVA 3DKWA 3JXSA 4CUBA 4IUGA 1W03A 1GYKA 5I93A 3GDBA 2EF6A 4QGMA 3MGUA 3ZSEA 1C28A 1JBCA 4HVQA 4Q2FA 2PA7A 4RHV3 2HLEA 4R9BA 1S55A 5GJ6A 1HRI2 2JXAA 1EYBA 1DHKB 1EAH2 5JOXA 3WF0A 2MPFA 5EJ1B 1XNBA 2WZR1 5F3IA 3ZFGA 2W47A 2VZ3A 4BQXA 1UMHA 4DB5A 2YFUA 5FY4A 4UFIA 1EP0A 5EYXA 4NWWA 4O7XA 4NMIA 4Q26A 3ILNA 1AVBA 3CIHA 1V9U2 4BWOA 2IXCA 3WW1A 3BTYA 5K0UA 3KQRA 1S0IA 4URAA 1RUI3 1JW6A 2MHFA 2JD9A 3Q8AA 3UV9A 1GP6A 4B7EA 1VBB1 4JRLA 1DZTA 5F2WA 2VOKA 1FYUA 1REDA 4XHXA 3CL1A 1QQP2 4AEJA 5FRAA 3LB9A 4JDMA 4Y1VA 4QX0A 3KB5A 3ZN4A 4N8MA 2D93A 4TLFA 3H1WA 1LOEA 1YCIA 4FI9A 2VOTA 1H2LA 4CCKA 1RC6A 3WHUA 4D7YA 4PDWB 4COUA 1H9WA 3I54A 4G3YC 1H8TB 2ZGLA 3MW2A 4MX3A 2CAUA 4I3GA 4QKFA 3ZYJB 4QPYA 2BQPA 1R64A 4PF5A 3NNJA 2HH9A 1FNYA 1HN0A 1W0OA 2GH8A 3M7AA 4RYDA 4EWDA 4KGQA 3ME2A 4MADA 4C0BA 3FBMA 3M3EA 1UO9A 5A3OA 1Q8VA 2ZEZA 3ZMOA 2P3KA 1DDLA 5JXGA 2A75A 1YXWA 4IGPA 2X09A 2OZJA 1Q8OA 5I0TA 1ZA4A 1XNCA 4P9YA 3HD8B 3FN9A 3I3QA 1PX3A 1Y3TA 3ACFA 4NRQA 4Q0VA 1F35A 1HRV1 1I9RA 4OZXA 3C7FA 1HN1A 2OZ6A 1QJZA 3I3BA 4LJHA 5FY5A 2FDKA 4OMDA 5CYYA 2UWCA 3MUY1 3U37A 3V56A 4A7KA 1FOD2 5HCAA 5IVJA 3W5MA 1DGLA 1FMD1 3OEBA 5G04L 2PFWA 1W99A 3J7MA 1ULOA 2RDQA 5KHIA 1HRI3 1EAH3 3MYXA 4AI3A 4PHZA 4U2AA 4LO6B 4DINB 1RUNA 4KU7A 4MLOA 3QLQA 1H30A 4FFHA 1TVGA 3H9AA 3ZFEB 2OS2A 4Q4V1 4MGZE 3VBRB 5FZHA 1W8ZA 1ASJ1 2DBNA 2VBPA 1IS5A 1J83A 2VOVA 3L2YA 3NJXA 5FO8B 1V9U3 1VBB2 3PTYA 5DZFA 3NO8A 4AFCA 2XJSA 4RR3C 5JXHA 4E2QA 1OQEA 5BNQA 2FDFA 4RGAA 3ZXAC 1OI6A 5BNOC 3VZNA 2UYAA 2CWSA 1QQP3 4KU8A 1ZBA2 4CEYA 3T0DA 2HWC1 1Q3EA 5A3LA 1AR61 2XONA 4RQPA 4E4ZA 1S0JA 5BNNA 2RDRA 3NNGA 2GNTA 2V72A 4QPIA 3GCWA 1MS0A 2WFF2 4YM2A 1AX0A 4IV3A 2GC2A 1ULGA 1J59A 2EXKA 1O3QA 2ZX4A 3I59B 3AZYA 4Q27A 4UFJA 1JXNA 2E9QA 1HX6A 3W59A 5FOJB 2D44A 5FZ0A 3GHNA 4AYUA 5BV6A 3O1OA 4X6RB 1XSRA 1VPHA 2MEV1 4XPVA 2WABA 3DPRC 2ID4A 3RZGA 2YMZA 4OHVA 4QM8A 5TSWA 1XNAA 3JD71 1HJFA 5FP3A 1IQDC 2NMOA 1UN1A 1Y7BA 4LO8A 1C8M1 1VRBA 3HJRA 4IESA 4NHMA 1HV1A 3UGGA 2UWBA 2ZZQA 3KV4A 3LIGA 1I5ZA 1LGCA 2DVGA 4AVCA 2A7AA 3RWKX 4PLOA 1RL3A 4QX2A 4P14A 1QNWA 4QXBA 3KF3A 4Y5SA 4IE6A 5DAQA 3THPA 4XURA 4EROA 5ABJA 5GZFA 3KHBA 4BXFA 5FMBA 1S1AA 1ST8A 1I1EA 4MHUA 2XBO1 3LWCA 4DPNA 2BV4A 3WF2A 5CKMA 1UU4A 2CAVA 1NXD1 3RJRA 1FOD3 3NAPC 5L7OB 2WN2A 4ZXKA 4QB6A 3WDXA 1K5MB 4ZY9A 4NOTA 4AQTA 3FHAA 3IMMA 3WUDA 1SZBA 2JX9A 1DQ2A 5LBCA 4NROA 2BFUL 4Q4V2 3R4DB 4M4RA 2Y64A 2B4KA 1ASJ2 4QX5A 2Q8EA 1POQA 2XLAA 2WO2A 4AOCA 3MHZA 5CA6A 2LW8A 3WXPA 1LHOA 1OLME 1VB2A 2JKXA 1DLCA 1AR81 1OKOA 2OQ7A 4DUVA 4Y5Z0 4CEWB 1ND3B 4HOOA 2XJPA 1QEXA 4OYUA 4Y22B 3N4MA 4JKLA 3WQ0A 1C1FA 2YZ4A 5FAXA 1EUUA 2HWC2 3MICA 3CQOA 2A73B 2G9ZA 3WEZA 3ZMNA 3R4UA 3TEYA 1AR62 1O8PA 1ZBA3 2XLFA 4OUMA 1AHSA 4TTGA 2BGCA 5C4WA 4YFWA 2RS12 4FOYA 1VMFA 4FAGA 4KWLA 1QDCA 2Z42A 3P3PA 1BHGA 4MGSA 1ZREA 2WFF3 2RMU2 1YLLA 1WWYA 3BYWA 4XUPA 1GKBA 2VMEA 3W5NA 1RUF1 4A44A 3UK9A 5LW9A 2DCYA 2R071 4N53A 4UWDA 3ES1A 4XTPA 3HIFA 2MEV2 1OD3A 5C9AC 4XMIA 4Q0QA 1XC6A 2HBUA 4GB31 5EFUA 5AVPA 1JHJA 5JMCA 1X82A 2F17A 2L9LA 4CDXC 3H3UA 3RZHA 1C8M2 1HB1A 1YQ2A 2P4EA 2OX0A 2WA3A 2JDMA 1GNZA 3ZR6A 1ENQA 1NYWA 4L92A 5KHKA 5LB6A 1W6NA 2VZTA 4FP3A 4AVAA 3VD7A 2RV9A 3N36A 4H7MA 3A22A 1N47A 2VZSA 5JR7B 4OUEA 4D7SA 1V6NA 3LA3A 2NP0A 1U0AA 3VHNA 1XNKA 1UPIA 2B7YA 2B39A 3AYEA 2FCTA 2HWE1 4KI5M 4XXAA 4YLZA 1MVEA 5DZEA 1ACCA 4W6XA 1PM7A 2ZGKA 2XLGA 3WP3A 2A1XA 4OZOA 4DUWA 3SH4A 1WGPA 1ZRCA 2VVFA 3WG4A 4ASLA 1YYNA 3ZXKA 1W3XA 2JECA 2JB4A 4UW4A 1APNA 2JKBA 3N9MA 1VBA2 2XJUA 2ZGRA 3GM8A 4JKKA 5LBFA 3RFRA 2D40A 1Y9QA 4KBBA 5FO7B 5AC91 4KH9A 3MFCA 1SHWB 3B9CA 2DF7A 1QF3A 4BQYA 3I3DA 2NZ9A 3UGHA 5GLZA 1QJY1 3AM2A 3N9NA 2RJKA 2ZX0A 3AZXA 1C8NA 2ORXA 4TN7A 1RB8G 1O5LA 2WNEA 1AR82 2Q1FA 2IVJA 3CMGA 3CJIC 1CAUB 1QJEA 1VALA 1W6OB 4ZS3A 5I0DA 1AL22 1GFF2 1AR71 1J3QA 1WMEA 4UXAA 3J9SA 4OULA 1BK0A 1F4AA 4COVA 1TNRA 1T6BX 3TEZA 1SCRA 1WW4A 1AR63 2IXHA 3FLPA 2BW8A 3JB4C 4ASMB 2GMEA 4XUTA 5FUIA 2VJXA 2IVIB 5C3RA 2RS13 1C5IA 1FAYA 4M3CB 1GQPA 4GULA 4QGNA 1US2A 3QACA 1LESA 2RMU3 4YVWB 5F3GA 5T54A 1OURA 3OBRA 1OFSA 1IG3A 3E1F1 4MZUA 3R0RA 4GB32 4CUAA 2NM1A 4YGBA 1JZ2A 3ZSJA 3U4XA 4CXYA 3E6CC 4KWJA 2CGNA 1COV3 1CX4A 4Q4W1 5CG8A 3SKVA 1R091 2P6CA 5SV8A 2XHKA 1HKDA 4N9IA 4BQ1A 1AYM1 2WN3A 1R1ZA 4Q4Y1 4OI2A 3SCFA 3EYPA 2PTMA 2J7MA 1LOAA 2BGOA 4WBBA 2R1DA 1Y9MA 2RE9A 3ZSMA 3GALA 5FYZA 4AQSA 3OEAA 3B00A 2HWE2 4FXGB 4BIFA 5FZCA 3ZXGA 4CU9A 5DMYA 4XVHA 3RNSA 4AEMA 4K6BA 1V0AA 4YVSC 3T2PA 3VDDC 3NKTA 1A34A 2BRTA 2HEWF 3HN3A 3M1HA 2JG8B 3BPSA 5JI9A 4LKSA 1RTVA 1ZRDA 2VM9A 3IM0A 4RR3A 1UY0A 5C3QA 5ERLA 3OUJA 4EN7B 5BNOA 2D98A 3NNLA 1NOVA 1UD1A 2TBVA 1VBA3 4Y1XA 3SQOA 3T30A 3O14A 3PJQA 2D3PA 2EXIA 1DYKA 1QJY2 5LEJA 1D2QA 2AACA 3ILRA 4E9KA 2VECA 1VBC1 4QMAA 4XETA 1G7YA 3GZTB 1OBNA 5B2GB 2QQOA 2VG9A 3AKRA 2VE1A 4LO5B 1POV3 1W8UA 3BVCA 4QKNA 4AI2A 5C7GA 5JXJA 5IK7A 2QQPA 1AR72 1DLLA 3WZ1A 3S5AA 1YUDA 1AL23 1XOYA 1WW5A 1F31A 1AJOA 2PMWB 3I8TA 1OLMA 3SKJE 1OOPB 1RUE1 1XRUA 2AC1A 1XE8A 4P5HA 1LHUA 3HAGA 2YB7A 4YZ2A 4BQ2A 3DPRA 2VMFA 5J98B 3H8XA 2R7EB 2WZ8A 1QXPA 2XMLA 2O8QA 2W5FA 4CXWA 3QOPA 4CUCA 2D6LX 1NCRC 4WZFA 2WSUA 3JQWA 3N7MA 4F7ZA 5GZCA 4G4FA 2FHRA 4IEOA 2E51A 3POWA 4CCOA 2VZVA 4MGKE 3RPQA 4RS5B 2BTVC 3H8UA 4FO9A 1OF3A 4Q4W2 3VDBA 1R092 2CTVA 2J1TA 2Y26A 1SLLA 1WCQA 5EP9A 3NV2A 5F8PA 5FP4A 1AYM2 3NAPA 2WNOA 3POGA 4Q4Y2 3JB8A 1O5UA 4XOGA 1IS3A 1TE1B 5HV4A 1UMZA 1CAWA 4XABA 3ZPOA 1U5ZA 5JZGC 5A3UA 2F6BA 3AMNA 2C4XA 3RRDA 4QQOA 3JBG1 3VZKA 2ZEYA 3APBA 2VQAA 4QPGC 2HWE3 4GH4B 5IAXA 1LEDA 2NMNA 5FMOS 4ET7A 5GKAC 4JGZC 2GZWA 3J8F2 3WHTA 3NVCA 1DQ4A 1AYN1 4GKXA 3AMHA 5LEKA 2TUNA 3OGJA 1YEWA 4WM7B 4MXVA 2JDUA 3E5XA 2P1BA 3HQUA 4QDRA 5JOYA 1AXYA 1W2TA 5HCFA 1PO23 2ZGMA 1LOGA 4YPJA 1AJKA 4XF3A 2OW4A 2V4VA 2JG9B 4ARYA 1O4TA 1QJU3 4FP2A 2FCUA 2UU8A 4PCRA 1QJY3 5EJ3A 3U07A 3VBOB 5A32A 3MPPG 1Q8SA 4CRQA 5C3SA 2FMDA 4QQHA 1SPPA 2BOIA 5FMCA 2W92A 3ZR5A 1QOOA 2QUOA 5IW0A 3WT3A 2QTWB 5LK5A 1AR73 5FPLA 3KS7A 2QQJA 5A7SA 3O1RA 4LR4A 3NJZA 4FPLA 1QOSA 2VH9A 4AI1A 5C9AA 5DZGA 2OPWA 2IZWA 1UIJA 1XJAA 4LA2A 5FP8A 4CDXA 1HQLA 2F4PA 5F32A 2BDRA 1W8WA 4P9XA 3PIJA 5FY1A 1XYPA 2G9GA 5FYIA 4M3CF 5FZ6A 4BB3A 3WG3A 1BK1A 1H9PA 4AVSA 2H6BA 1EV12 2GSYA 2IUWA 4PQQA 3BOWA 4NIGA 4E27A 1ZX5A 2LM3A 1ODNA 2WO3A 2WSVA 4B4QA 2RHPA 4S2GA 5A6XA 4R4XA 4AGVA 1BJQA 1LRHA 4Q4W3 1CWPA 1BCXA 4RHV1 4XFCA 5FY0A 1JUIA 1WA4A 1VR3A 1K5JA 5DAXA 3TEXA 3LKJA 1RUOA 1JUHA 4IXLA 4BZ4A 1AYM3 4JGYB 5KC6A 1GQHA 1U5XA 4HSLA 1A3KA 2V5DA 3M3CA 3TWIA 2ZEWA 1CAXA 3JBG2 4PDWC 4KNCA 5J7MA 1NCQB 5KHJA 1GZTA 1H8TC 1HQWA 1LGBA 3POEA 3LSEA 1Q8QA 2XVGA 2FZ1A 4FSJA 5FP9A 2VBBA 4GWJA 3WR0A 4YZ1A 4FPJA 1NG0A 1J84A 4CZSA 3ZIWA 3CJIA 1GP5A 3J8F3 2DVDA 3N7LA 3ST7A 1G86A 1DG6A 1MS5A 3LPGA 1N3QA 3N9QA 1W9SA 3KD4A 4A45A 4M01A 3N7KA 3ACHA 4C90A 4IDZA 4TXWA 1JZ8A 2CY6A 1G6NA 1XE0A 4MV2A 5DDJ3 5IWFA 4AEDB 2X8KA 1MQTB 3GYDA 2ENRA 3GZAA 3LF7A 2ZPXA 3VD9A 4CDUB 1XSQA 3SEPA 4LLFA 2CU5A 4LBQB 4LKFA 4XQDA 1NLQA 1DBNA 2ARBA 3VBSC 2Y60A 1Y43B 5JI7A 4CYDA 4LK7A 4AZZA 3H0OA 2CGPA 5A7NA 3QCWA 3ZO0B 4XFAA 1WD3A 1YQ5A 3VBFB 3MPBA 4YM0A 2UY8A 2OQ6A 3I4IA 4DY3A 4XFFA 1VJ2A 2VUAA 2WZEA 2ZHNA 4QHBA 5CG9A 3UL2A 2WLQA 3JZVA 2VNRA 4NRPA 4DY5A 2A3YA 2CHHA 2XL9A 4MGTA 3MV11 4JQTA 1ULPA 2ZKLA 3O0XA 5GLWA 3ZFEC 3INAA 4O65A 4AAXA 3VN4A 3VBRC 3KT7A 4EN9B 5EWSA 1EV13 3J4UH 3ZYBA 3S57A 1GBGA 3TBDA 3K3NA 4XC9A 1X9TA 1YQ6A 1NAEA 4BPZA 2A6WA 2YDEA 4PQ9A 4WV8A 5EZWA 1XBFA 3J7NA 3JCIA 1WD4A 2B9VA 1TNFA 3KZ4C 3POYA 4YVSA 3VDDA 1QOTA 4I0WB 3N3HA 2J42A 3EBRA 3ZPYA 2ADDA 4UI9L 1PO12 3BOPA 3PU8A 1GICA 3KF5A 1HB2A 4XFHA 3WCRA 5E89A 1M4WA 3PUAA 4XJUA 5D21A 4CCLA 2WINB 2XDVA 1ZA7A 2Y6HA 5F2SA 3BCWA 3AXEA 5FZAA 5SV5A 2XUMA 3DL3A 3H3ZA 2JE9A 3ACIA 3AVSA 3LOIA 1E5RA 2A71A 3CKHA 3LEKA 5FUPA 1V6OA 1V9U1 1VMHA 4XF4A 4XQWA 4LBQD 2VVDA 4BXSV 3SEEA 4QQLA 1FNZA 5FYYA 4BK4A 5I8YA 5FYUA 3VBHB 4UF0A 5C5TA 3OYWA 4ZZ5A 1QQP1 5J96B 4V1PA 2VULA 3KV9A 4F3JA 5FK8A 4KG8A 3RQ0A 2V4AA 2E63A 5FZ3A 2LTNA 1HIXA 1HLCA 2P2KA 4IEUA 2H0BA 4IGQA 1HB3A 1LCLA 3MF9A 4L2NA 4EZ4A 4GWMA 4I09A 3ZX7A 4DMIA 4QXHA 2WS91 3RI8A 1NCRA 2YU1A 3A23A 4L8QA 5C71A 3IN9A 1DGRA 3MIEA 4AAPA 1QXRA 1KEXA 1XE7A 1K5MC 1KDKA 2WLPA 4TSVA 1PVC1 1K12A 2ZKNA 4HLTA 3UKVA 3BU0A 2AYHA 2QBXA 4CP2A 4PLNA 2QKDA 5GZGA 4GMP1 5I8TA 2DFCA 1OQ1A 4I02A 2X53S 4AHWA 1KGYA 4ORFA 1H8VA 3USSA 1SFNA 3K46A 3UNPA 1RUD2 1VBE2 3DUIA 3U75A 1T6GC 1WLWA 2AR6A 3BTXA 2EXHA 1RINA 4WVMA 1AX1A 5JZGA 2IXJA 2P5BA 3LDBA 2OUJA 4GKYA 5LBBA 3CO2A 1UX6A 4QPGA 2MNGA 2EA7A 3V0BB 4CEWC 1BBT1 1ND3C 4JGZA 4XJ9A 3VDCA 4B1MA 1FOD1 3ACGA 4K8FA 4LLOA 3FWEA 3ZFGB 4BM8A 3CDZB 5KXCA 4CVUA 2PLV1 1O91A 2UURA 5A3WA 1AXKA 1OA3A 2VQUA 4H55A 4HT1T 4L0PA 1J3RA 1YQ8A 4BIOA 3MIGA 1PO13 4GWIA 4ATFA 5JIUA 2ARAA 3ECQA 3KWVA 3B9IA 4BMBA 3O1MA 4NUBA 3BGAA 4LK6A 2K0GA 1RVF3 2BBAA 2PHXA 3RZLA 4A6SA 1X50A 2C9KA 1S0EA 5LASA 1E57A 5FQ0A 4YM3A 1UZYA 3RYPA 2I07B 4LEJA 3SXWA 3G7DA 2YYOA 1DYOA 1FV3A 1HQNA 1GP4A 2W39A 3WOGA 3ZN6B 3FFQA 4NHYA 1PGW2 2WDBA 4MO3M 4P5YA 3PURA 4XACA 4B1LA 4FXKB 1YFXA 1S0BA 2BWAA 1KJLA 1REEA 3D8CA 1PZ8A 5LA0A 2VOXA 4Y24A 1OA2A 2W1QA 1ZBA1 1WMFA 4LBJA 4BQ3A 1B09A 1OHFA 5JIAA 3BALA 3KV5A 3USUB 3I2JA 4CP9B 2WS92 2WFF1 2VU9A 5FY9A 2HEYF 4NIIA 4M00A 1W6QB 3OSDA 4CCMA 4FTSA 4JC1A 1JYCA 2FCVA 4AFAA 1PVC2 1YI7A 4LKEA 2VTFA 4Y1UA 2XJRA 4LT5A 4V2VA 1W9WA 4QKBA 5LK7B 2Q8DA 1DYPA 4DEVA 2OA2A 2ZGSA 2HWF1 3KLSA 4INDA 2J1UA 4XMAA 1DZQA 2DUPA 4PT6A 4A2UA 4I2OA 5FMDA 3PMEA 2ETEA 3UJOA 3X29B 5LCWL 3VHOA 1RUD3 1VBE3 1YQCA 2BNMA 4PDWA 3AX4A 5JOZA 3P5BA 1H8TA 2VMHA 2ARXA 3H7JA 3DCQA 3ZYPA 1RUJ2 4S2HA 1BBT2 5K8SA 5J37A 1JYWA 1PX4A 1RUG1 2XL7A 2G9FA 3PHMA 4R9DA 1H6YA 2GMPA 2PLV2 3F95A 3K4DA 5H9PA 1OT5A 3NV1A 3AMQA 4WM8B 4RFT0 4E8CA 2WQ8A 2ZGUA 5I0SA 4OFGA 3ITQA 4R8HA 1SBEA 2WT1A 3NL1A 4QKDA 5EXOA 1UF2C 2BFUS 5I0UA 4WVWA 2C6SA 2YXSA 2WO7A 3M8LA 4Q5OA 5KHHA 1AL0G 4UBGA 4XAEA 3A0KA 4FAHA 1BEV1 1NE4A 1NQDA 2ORZA 1CR7A 4DXSA 2VXJA 2VMIA 4K21A 3RI9A 4NPRA 1W05A 4Z2WA 3U1XA 1CESA 3NWKA 2WQ4A 3VBSA 1TMF1 1SBDA 4LOSA 2B42B 2J1EA 4QX7A 3N35A 4IL7A 4HPKB 1QWRA 1YWKA 4LHSA 4X6QB 2BBVA 4PF1A 4LQRA 3EQEA 3LEGA 3WW4A 1KITA 1ND2B 2YPDA 3KT1A 4KMQA 5FZMA 1PM4A 4M0HA 4META 4UBHA 3TNPB 1TME1 3O1TA 1IKQA 2J1AA 2ZGTA 2RDNA 2RS11 1CX1A 3O5SA 5AFEA 4ZHNA 1X8EA 5A80A 5CVRA 3ZFEA 4Z2AA 3VBRA 4HK8A 2WS93 2FDHA 2RMU1 3C7HA 3VZJA 3BN6A 2WJSA 3OGGA 4CSWA 2E7QA 4ZKTB 1SFPA 4JDNA 1WLDA 2RS51 5FPVA 1SEFA 5T50A 1KJRA 2JG8C 2D6MA 1PVC3 2ZAHA 1NZCA 1COV1 4QAWA 1DIWA 1SBFA 2Y6KA 3ENRA 2HWF2 1HDKA 4QX8A 3BODA 4EE2A 4LIVA 3I2IA 1L7LA 4KWKA 3KVAA 4GMP3 3ZLIA 4C1WA 3S0MA 1ZM1A 1VAKA 5CB7A 3WNKA 3AKSA 3DYPA 4PBOA 2WA4A 4E2SA 5HCBA 3WG2A 4DXRA 5CKNA 1AXZA 4JQRA 4KGGA 3I2GA 5DAPA 3LDRA 1SQ4A 4GD4A 3VKLA 1XQNA 2RJLA 3HEIA 1F8VA 3VL9A 1JOPA 1RUG2 5FXZA 3IAPA 4BLJA 4AQ2A 5F37A 4LE4A 5IUQA 1RUJ3 3I59A 1BBT3 5FZ1A 5FDBA 5H9QA 5F5IA 2W68A 2PLV3 1OOPC 2IXLA 1NE6A 4LOTA 1W8NA 4XUQA 2BVVA 2XOMA 1BEV2 4SBVA 2UWAA 3K75B 1VBA1 1H4HA 4XCBA 5GLUA 2XUEA 3PTRB 2WT2A 1CJDA 3OUIA 4W50A 4OQ9A 5FZLA 5JMOA 1SLBA 1SLIA 1WUVA 5DPNA 1TMF2 1GOGA 1W6MB 2GNBA 4YW1A 1TEIA 3SCHA 4JCKA 3FL7A 2DBIA 1POV1 5A7PA 1V6LA 1UWWA 1WA6X 2IWGB 1NLSA 3NKGA 4A41A 4RS5C 4BJ0A 4K40A 1JZ5A 4RSUA 4A3XA 5IAVA 3ELNA 2PQQA 5B4XA 1AL21 4COYA 4I30A 3VBUB 4HKWA 2QQKA 1YRZA 2V73A 2WNUB 3OY8B 2JDYA 1DGRN 4CU8A 1K5MA 4C0HA 2ZGQA 1TME2 4YM1A 5F39A 2LS6A 2FDGA 3WNLA 5FZ4A 2G4IA 5C33A 4FTBA 4IQPA 1QJFA 1SACA 4XF0A 4AI9A 3CEWA 2JIJA 2EIGA 3DECA 4FT8A 5A1LA 3V0AB 4LTAA 1FATA 4AHYA 5FFOC 1ONAA 2RS52 3ILFA 1GU3A 1F15A 4UOJA 1VE0A 2XQXA 1LR5A 4LORA 2BGPA 1IZ3A 2BEOA 1COV2 4WM7C 4HBNA 3KGLA 5CZKA 2A70A 5A33B 4CEWA 1ND3A 2WYFA 3WP5A 2YUEA 2ZX1A 4Y22A 2HWF3 4Y20B 4LMFA 2JG9C 4XQ4A 3PLQA 4XDPA 3B02A 2VCCA 3LEMA 3AMMA 1LGNA 5G05L 5FZBA 4XZUG 2Q8CA 1VLNA 1XU1A 3VBOC 1ZRRA 1R081 4YSFA 2BP6A 3R4SA 4W8JA 1S2KA 4Z07A 2BNNA 3BPZA 2K2SA 4XXPA 2W9XA 5CNAA 1BYHA 4XHBA 4CPBD 2UY9A 1RMU1 1RUG3 1O7FA 2JE7A 1CQ9A 1CD3G 3D0SA 4LO7A 2Q30A 2CYFA 4ZONA 3MDPA 3T08A 3MO4A 4I0AA 4YFZA 4NN0A 1EY2A 5FLJA 2XKOA 3LA7A 2BUKA 5DG1A 1UZVA 5FZ7A 1PO21 3RSJA 3AB0A 4CCCA 1BEV3 4XBQA 1N1TA 2WNVB 1QJU1 1XYNA 3GZUC 1GWMA 4ISQA 2W91A 4JTOA 4ATEA 5FPUA 4TZDA 2B45X 1TMF3 2W08A 3RZZA 4Q29A 3ROUA 5IK5A 1UAIA 5DUUA 4WVZA 5AFBA 4ONUA 1JYNA 3ETPA 1QH6A 1S2EA 2D43A 4H7LA 4IE0A 4YG0A 1UW8A 3E6BA 4DQAA 5ACA2 4NWVA 5FZ9A 1JYIA 3WLUA 5J1XA 3RZJA 2FDIA 2PAMA 3FLRA 3AP4A 1LHVA 2XH6A 1TME3 1CJPA 4CXXA 1JZ7A 3M70A 2W1SA 1NCQC 4FBFA 4AGRA 3VKMA 2Z4FA 1MS8A 1DQ5A 4FVVA 3O1SA 3VKFC 4F8AA 2J1RA 3H42B 1PMHX 2YFZA 5LA1A 1V6KA 2RS53 4MXWB 4DZGA 3L9JT 4P9JA 4D7TA 1LJ7A 1POV0 3OOXA 1CAUA 1W6OA 2CDOA 5LA2A 2P37A 1LOBA 2PHUA 5A6YA 3PVEA 1LODA 3VHPA 1HXS2 4AEDC 3CHXA 4BH9A 1MQTC 3BTAA 1YJKA 1PMIA 2EIDA 3E5UA 5CFCB 4Q4X2 4CDUC 4B3NA 4J1XA 1R082 5EIYB 3THDA 3HBZA 1N1SA 1LTEA 5HXVA 3H8OA 3DGTA 4AVBA 3FMGA 2BNOA 2YY1A 2ZXQA 3IMNA 1RMU2 2QVSB 3FHQA 4MH0E 3K48A 5KBFA 4IERA 1DQ6A 3I3EA 1LHNA 3SITA 3MFAA 1QMJA 4LHNA 3VBFC 1UL9A 2DWRA 4Y1YA 4KL1A 2HYKA 2O0OA 3J8F1 1MVQA 3TNQA 4CDWB 1RUC1 5BNOB 1DZRA 4P9LA 1PO22 5LA9A 3RGBA 4MYEA 5FIXA 5FXWA 5DDJ1 3R05A 1A6CA 2O14A 3CF6E 1NY72 1QJU2 1U5IA 3PDQA 5C70A 3SC7X 4ZZ8A 1G9DA 3WNPA 3EO6A 2VNOA 3HPNA 3POJA 5AVAA 4YZ5A 4YGDA 4OI1A 1CGPA 1ENXA 1BQPA 3OBZA 3ZXEA 5CADA 1JMUB 5C8CB 1LB2A 5KXBA 5FXVA 1JI6A 1IHMA 1FPN2 2IFRA 1RXGA 1VIWB 4C8DA 1JYVA 5K9YA 2WT0A 1PIV1 2YG0A 2JENA 1GOHA 3W9AA 1RXFA 3ZOIA 4XFIA 1H4GA 4XIOA 4AI0A 5ACA3 2JG8A 4JV4A 2HEVF 3P6BA 2QCSB 4LULA 3TOJA 3UYJA 3OPWA 4LA3A 3B69A 2B46X 1QNYA 4FPGA 2FDJA 1H1AA 1YHFA 2EAKA 2IC1A 3LAGA 1H2MA 5GZEA 3TN91 4NJ4A 3UETA 2QDRA 5J09A 5JXIA 4B8EA 1ZBE2 5JSRA 1OVPA 3DV8A 3NJVA 1EV11 3E5QA 4NPMA 3IPVA 3M3IA 4CE8A 2XR4A 1WCKA 1SG3A 1CAWB 1ZRFA 3OGRA 3KQ4B 5F5AA 5FYHA 3VBHC 5KWRA 1D0GA 4W6YA 2LROA 5DAWA 1P8JA 2AEZA 4L99A 1OOPA 1HXS3 4IV1C 3GGLA 3MW4A 4NAMA 1AR91 4PBPA 5A7WB 4XUNA 2WIIB 4Q4X3 1W8HA 3GCXA 3I97A 3QBQA 2YBSA 1R083 2ZX2A 1D4VB 2DDUA 2SLIA 4N43B 4PLMA 4A4AA 4YWAA 3A0NA 3H50A 4Z8BA 5BNPC 3WUCA 4DXZA 1NA1B 3I7DA 1RMU3 1STMA 5BY5A 5DQ0A 4A42A 4DIQA 3K2OA 4GZ9A 1BKZA 4EWEA 5F7UA 2W94A 1K3IA 1RUC2 2LRPA 2QZ2A 4P9IA 2VPVA 2ZBJA 3HQXA 4RS5A 3EXUA 3WQ7A 4J1WA 5DDJ2 4BK5A 1GZWB 2G19A 3A7QA 5FZ8A 1W0PA 1UYZA 1BVP1 3QH6A 3C3VA 1D4M1 1X36A 3OD0A 4LHKA 5FYVA 3WCSA 4NIHA 2WKKA 1RJ8A 3H1YA 2JDKA 1UCXA 2Y6JA 3LZZA 5J48A 5CFDB 4B4RA 1OA4A 1E5HA 2SBAA 4E2GA 4Z1VA 2YROA 1YFYA 3PU3A 4HVRA 4NHXA 3TRSB 2D3SA 2WAOA 5JPNB 4URTA 5FPXA 2BPA2 1PIV2 3N9PA 4CCDA 1JOJA 3AJYA 5D8AB 3VZOA 1FPN3 3AP9A 2JIGA 3AYCA 4OHYA 1GSLA 2VL4A 2YC4A 1WW6A 3OCPA 1GANA 4QB2A 3S6PA 3ZXDA 4WM7A 1RYYA 3FHIB 1W9TA 3RZMA 4OI4A 1XXNA 3KMHA 3TN92 1ZZ6A 3RDIA 2AENA 2QNKA 2JG9A 2KA3A 4HANA 2VQTA 1MEC1 3IDEA 3D5OA 1IG0A 1OUXA 2XWJB 5FYSA 2A3WA 3TEWA 1KQRA 3T2TA 4RN5A 3VBOA 1K42A 1ZBE3 3FE5A 2X10A 2BYVE 4IEYA 3KV6A 4D6SA 2QQLA 4AXOA 5LWBA 2W1UA 4JKMA 1DP0A 4RGGA 2NQYA 4A7ZA 4V2WA 4DRVA 4UFMA 3WW3A 1IQAA 5FY8A 3H8RA 2GN7A 2FMYA 1VAMA 1XPWA 1AR92 1CAXB 2X5IB 3AL5A 3KM5A 4NVPA 4UYBA 4XFGA 5T52A 1H0BA 3HNMA 3RYKA 2PAEA 4AFDA 4FPEA 1PO11 2EXJA 5KHGA 4OHZA 2XKPA 3GJAA 4JHTA 4XDOA 1RVF1 5DN2A 2PHWA 4ITCA 4AVVA 1F9KA 4L11A 1Z0HA 2OUHA 2GC3A 2R30A 4S2FA 3WDVA 1CZTA 4GAZA 3MLKA 3WNMA 5IFPA 4BQ5A 1RUC3 1CN1A 3M2MA 4CP1A 4RA0A 3WDYA 1CPNA 4HONA 3NJYA 2XJVA 1UU6A 3Q9OA 4UFLA 4ARXA 1D4M2 2W2IA 3ZFFB 3VL8A 1NQJA 3UT0A 1IPJA 2ET7A 3N7JA 5CAZA 3BU7A 4Q1RA 3VKOA 3WDUA 1JU3A 1NT0A 2Y33A 1GLHA 1TZOA 3S30A 3G6JB 4OHXA 1GZCA 3IDBB 3ZYHA 1ZZ8A 2ZACA 3AK0A 1NCQA 4HK9A 2D5FA 3K51A 1CIWA 4AHXA 1UZ0A 1B35B 3OGSA 4RGKA 2RR12 5L9RA 5A3MA 3I3MA 1PIV3 1Z7S3 1F5FA 1H1MA 2D6PA 3POFA 3LCPA 4WM8C 1IS6A 4L9BA 1MS1A 1J1LA 2XG3A 5FZFA 1DU3D 1J1TA 3AKQA 5E6HA 4ZPIA 4LIUA 3FUQA 1H6XA 3R6SA 1MEC2 2P34A 3HVDA 2CGOA 4AEDA 3TN93 4CDQB 3KHCA 2C26A 5L73A 1MQTA 1X9PA 2Y6GA 3AYAA 2W52A 1PZ9A 3WV6A 4CDUA 1KDMA 1WCUA 2VW1A 2V09A 2WYSA 4LBQA 1U12A 2D5HA 3JU9A 5T5PA 1RUD1 1US3A 1OH3A 1VBE1 4Q1PA 4DFSA 5C5UA 1AF9A 2HYXA 4NRMA 2I45A 2ZCWA 2OXBA 2J1VA 1WBFA 1UOGA 4QB1A 3VBFA 3CBNA 5JCTA 3MIBA 1O6UA 4R4ZA 1KFUL 1S0FA 2ZGPA 1W8TA 1ND2C 1W04A 3H7YA 1AR93 2WC2A 4JZRA 2QQNA 1VMJA 3WNNA 4DNYA 3VGIA 3PL0A 1RVF2 1Y9GA 4QM9A 2PHTA 3PUQA 1PGSA 2VZRA 1WLTA 4LNVA 3BUCA 3I2OA 2QJVA 1YC61 1UQXA 4OCTA 2CV6A 5F1RA 4CU7A 3NV4A 2WR9A 2EVXA 1IOAA 3WNOA 2YHJA 3AZWA 2PN5A 3VB9A 1PK6B 3LD8A 4XAAA 1RJ7A 3S7EA 3W20A 5A70A 2YC0A 1PGW1 4JHZA 3QH7A 5FZOB 1GZ9A 3RWNA 3LIHA 1D4M3 1XU2A 4EYUA 5C8WA 4E4DX 1TG7A 2VTXA 3LFMA 4CA9A 3C7EA 2LALA 5EHDA 5KXDA 4FOVA 2A6ZA 2AZ5A 5EYYA 3IKWA 4HKOA 2QQVA 3ZKUA 3AVRA 2RR13 5L7OC 1SDWA 4R9CA 2GNMA 2XPJA 2RM21 4QD2A 3ZYFA 4E4SA 3ZM8A 5A7OA 5FJKA 4P9GA 3RZKA 2GH2A 3VBHA 3DXUA 4N7IA 1QKQA 2LUWA 2PHRA 4WVMB 2E33A 1MEC3 1CAVB 2Y34A 1KS5A 4IV1A 3P1IA 4LUMA 4BCUA 5IVCA 2OVUA 4QPGB 5FYTA 1QXJA 2GN3A 5BNPA 4UAPA 1C57A 4AK3A 4LO4B 1QGLA 3A21A 1MS3A 1BLZA 4BOWA 1RUJ1 1IPKA 2ET1A 4OHWA 5L9VA 3MLJA 1QY4A 1VB4A 4XE9A 4Y5TA 4NAOA 3VBUC 2HWB3 2WWSA 5HI0A 1W6PA 3MV01 4MOAA 2WNUC 1EPZA 1YO8A 2HBTA 3O1UA 2R0HA 4P02B 4FTEA 2AUYA 4C91A 4M4PA 4AF9A 5K0UB 4H3WA 1UOFA 3TYJA 5HPOA 3UKNA 3NW4A 2N7GA 3PUSA 3AZVA 5EPAA 3H3LA 2OYZA 1XNTA 1YFWA 4E4HA 1GUIA 2EIBA 4ASKA 1K45A 1UX7A 1H1IA 4FPKA 3V0BA 1W2NA 4W6WA 1O4ZA 3IBMA 3E6DA 1X33A 3NNMA 2H0VA 3RYRA 5JUVA 4PIYA 1V6MA 4LBLA 2C9AA 1GMMA 4QQPA 5T3NA 3SH3A 4COZA 4BDVB 4EZHA 2VCAA 1W0NA 5KR7A 3WQBA 4LBKA 5I8SA 5IATA 1UZZA 3W58A 4QXCA 2ZMKA 4YW7A 3ZSKA 3VD4A 2G1MA 4B7KA 1O8SA 3SMHA 5A7QA 2DTWA 4ZU5A 3HT2A 4XJWA 4DEQA 1W3VA 3B7MA 2HWD1 2RM22 3WF3A 1QU0A 5LATA 3AFGA 2I74A 3S7IA 1IKPA 2ES3A 1CIYA 1W90A 1S2BA 3P3NA 3POIA 3T1MA 3K4AA 3N9OA 4FFGA 4AHZA 5FYCA 5F9TA 2R042 3ZN6A 4M0NA 5I91A 4IEZA 4PI2A 4IEVA 2BWCA 2RS31 2TNFA 2WNVC 3ASIA 3FBYA 3POBA 4B29A 2YGMA 3N9LA 4GQ7A 1N3PA 2DVFA 2ERFA 3OPTA 3LFIA 4IETA 4YZ3A 4A7YA 4LHLA 3WP4A 2Q8OA 4LE3A 2R49A 5L19A 4Q0UA 1LU1A 4HN1A 3RJ2X 1LENA 3USUA 1AZDA 1O3TA 4CP9A 5IVEA 5ANNA 5EV7A 3WNXA 4WZCA 2ZJCA 4AR2A 3ZXJA 3BB6A 3V65A 1W6QA 2ZGOA 3WP6A 5BPXA 1JZ6A 3KT4A 2XVKA 3LPFA 5J3UA 1WLCA 1O3RA 4GJYA 2Y6FA 4ES8A 4Y26A 3HT1A 3FLTA 1A78A 1OPMA 2JB8A 3BIWE 2VUDA 3GBGA 4Q8KA 2AGSA 3GBFA 3O0VA 4GMP0 3VBSB 1JH5A 3KSCA 1I3HA 4K20A 5IVYA 1UYYA 5LY2A 3J7LA 4KBZA 4FFIA 1JOBA 3SHRA 1NLRA 2YPJA 4YVWC 2PAKA 1GWLA 3IWZA 3LGRA 4QDQA 2QFEA 1NUKA 1DCSA 1REFA 3PJYA 4JX0A 4EJRA 5JR2A 5F5QA 2A6YA 2XGXA 4PIXA 1URXA 4CEYB 4CTEA 1G9FA 3DEMA 2PELA 2WZR2 2B9UA 4YW3A 4LUKA 5DAVA 5FPZA 4RQPB 5BNNB 2XVLA 2O8OA 4WM8A 3PIGA 4Y3OA 4QPIB 1SFYA 2WQZC 1PNGA 5E88A 2VQ0A 1LU2A 5CFCC 3KGZA 4IV3B 2Z79A 1EPWA 1LAJA 5ANQA 5GLTA 4Y4YA 2GU9A 1ENSA 2BERA 2X29A 4J6GA 5JWPA 3ALQA 1NKGA 4EV0A 1ENRA 4IE7A 3ZDSA 1VRH1 3J7HA 2ZS6B 2DU1A 2ZMLA 4HL0A 5KC5A 2VR4A 4DOUA 1WW7A 4QXKA 2GC1A 1WMXA 3ES4A 4Q8LA 1KS4A 1WKYA 2HWD2 5APAA 1F4HA 3VD3A 1D0HA 1OLRA 2VW0A 3AL6A 4XW3A 4CDWC 1UYPA 2RM23 4HPKA 4K8RB 3WVJA 5HV0A 4JAAA 4DUXA 4D94A 3UJQA 1G9AA 1SLCA 3LEIA 5FZKA 4XTMA 4X8NA 2ADEA 4EN0A 3ABZA 2R043 3A4UA 5IYYA 1KD7A 2GALA 2RS32 5ABJB 1MS4A 5T55A 2DTYA 1ND2A 4GXLA 3VV1A 1QH7A 1UU5A 4M3CE 4EQVA 1UXZA 2AH2A 2XB6C 2ZHKA 1YFUA 3ZYGA 2WZPP 3OBAA 4OLLA 1V00A 5C8CC 4QPWA 1YJLA 2WFPA 4XDQA 1G8WA 4XBNA 2C24A 5FLHA 1D7PM 5J36A 2GAUA 2BZDA 4SLIA 4AQ6A 4O9GA 3MI8A 2JDNA 2DFBA 3HN1A 4P9WA 3OD4A 1W2OA 3MLLA 3O0WA 2VO5A 2DUOA 4BQ4A 5FYMA 4ZU7A 1FV2A 1H2NA 1HRV2 5GALA 2BVBA 4IEQA 4NR1A 4LKDA 3TAYA 4A6OA 1H2KA 3FX3A 4JDOA 4BYYA 3U11A 2DCZA 3U78A 4YW2A 3B01A 1LULA 1OKQA 3ZSLA 4XBLA 3U0ZA 4HETA 3WF4A 3AYDA 2Q0AA 3DF0A 3IDAA 3L2HA 5FP7A 5GM0A 3HR9A 1PVXA 1G9CA 1N1VA 4Q0SA 2GDFA 5GLVA 2JICA 2Q4SA 1FMD2 3DN7A 3WDWA 5A3NA 1A8MA 2Y0OA 1JU4A 1UOBA 2IFWA 5FPAA 4Z92B 4CU6A 3K4ZA 2J22A 3KCXA 1VAVA 1CZVA 1NX9A 1OF4A 1GR3A 2Y6LA 4MGQA 1M06G 2WZR3 4NIAA 5C4WB 3OTFA 5L7OA 5BXXA 1Q8PA 2VNGA 5IVVA 3V64A 5ACA1 1MZ6A 3T09A 4MSVA 1Q5OA 2R061 2C5DA 4C1XA 4CPBA 3I49A 3ZYRA 1VRH2 4I0BA 3HNBM 4N43C 2CDPA 4N53B 1S0DA 2XXZA 2Y0IA 3S5QA 4HG6B 3OUHA 2NPIA 1NA1C 4LBOA 4QU2A 1OMIA 4GH4C 3SCGA 2E7TA 1VBB3 1S0GA 3BI3A 1W6MA 2ZMNA 4Z82A 2DVAA 2HWD3 1E5IA 4NHLA 4QU1A 5CBLA 2VGDA 2QQUA 2Z69A 1IS4A 2GP3A 3K77A 5C3OA 1W6NB 3WD5A 3NSTA 3K3OA 4FQZA 2O1QA 4OVEA 4R9AA 1QHDA 1KRIA 2OKXA 3VBUA 3LE0A 4FCAA 2WNUA 3OY8A 3O7OA 3IDCB 1HXS1 3OG2A 5JPMB 2RS33 2JDHA 4AVTA 4YW5A 4F83A 3ORJA 4XJ8A 3IIIA 4Q4X1 4LBMA 3Q8FA 4XUOA 3PVBB 5T5LA 3TB0A 3D0JA 1DGWA 4IEXA 2Q1ZB 5CFDC 2PQSA 4A3ZA 2VMDA 4GA9A 2FD8A 4HMZA 2YGLA 4K1YA 2E53A 4B4PA 2VBDA 3I2FA 3V0AA 1LOFC 4BA6A 3OF1A 5FO9B 5FOBB 5D8AC 1S0CA 3JD72 4U36A 4P08A 2XJQA 2JD4A 2GP5A 3HMYA 2PXJA 5A33A 4AL9A 3T0BA 4J25A 1LKNA 4K3UA 3VD5A 1HRV3 3MF6A 4ZS2A 1WCSA 5LRSA 1BMV1 4H2AA 4Y20A 1NY71 2VMCA 5FBJA 2IXIA 3ZVXA 2XBO2 1LHWA 4KWUA 5F6LB 3URFA 3VKNA 4N90A 1UNBA 2W0XA 4OMCA 3PUIA 4RFRB 1ZZ7A 1FMD3 3O12A 5DG2A 4HN0A 4XILA 4QGLA 3CJXA 2ZZJA 1KXGA 4BE3A 1OPOA 1FPN1 4YG6A 4D0QA 2OT7A 4ZXEA 3GBWA 2E7AA 3ETQA 4K1ZA 5L36A 4JGYC 3UKTA 2R062 2X5IC 2XQRA 2WRAA 1Q56A 1RUH1 3WW2A 1MPXA 5JAXA 1FXZA 4XJZA 5M0TA 4Q4V3 1JZ3A 3ACLA 3FJSA 3MIDA 1ASJ3 4K7JA 5C6CA 1C1LA 1VRH3 3SH5A 2KR2A 4LBNA 1MR5A 3IB3A 2WNVA 5FKBA 2QQIA 4TWTA 1CONA 1N1YA 2KD7A 3AFKA 3MEPA 1F5JA 1ZBE1 2GNDA 4MUVA 5FYBA 2W46A 5JVVA 5HBAA 5FJHA 5IK8A 4Y33A 5FZIA 3M3QA 3O1PA 5B4NA
chains in the Genus database with same CATH topology
4S2DA 3GHMA 4ES9A 4PIZA 2HWC3 4XF1A 2VOWA 5FBZA 1C3HA 4RL7A 1YIFA 2AREA 3AKPA 4KG0A 5FLIA 3ZFFC 4AG4A 5IK4A 2E6VA 1ZZBA 2ZHMA 1RUF2 2ZX3A 2WL1A 2R072 5JSPA 3AZZA 3VZLA 2VUJA 4M3CA 1R1A1 2Y38A 1B35C 2HJIA 1TQ5A 4RR3B 4YVWA 4A7YA 2MEV3 4IEPA 2NYYA 4X8PA 5E8AA 2IXKA 4DRRA 1L3JA 3I2DA 4MXWA 1JN2P 1OSGA 3JD73 1C8M3 5E1RA 4D69A 1BMV2 3WX5A 2ATFA 2K9ZA 3THTA 5DUVA 1HW5A 3PMSA 4EWAA 3ATGA 2PHFA 4CDQC 5CU1A 1PZ7A 3ZXFA 3PNAA 5CFCA 4FPOB 4DS0A 1UPSA 3CNAA 2XBO3 4YW4A 3NV3A 2DV9A 2OPKA 1Z78A 3QD6A 2ZGNA 3PVOA 1J3PA 3DPRB 1OLQA 1Z7S1 5AC92 5LRRA 5FTTC 3CU7A 5JDBA 2JEMA 1RUH2 2YV8A 4CDWA 1UKGA 4RD7A 3ZYIB 1C4RA 1JTZX 1RGSA 2R063 4EN6B 4HKLA 2EAAA 1VBD1 2D6KA 2ZABA 4YRDA 1IGOA 5I0RA 5JSOA 1NXMA 4XZPA 2FZ2A 1AR83 2DURA 2B8MA 3IPVB 3JUUA 3ZXLA 2CWMA 4N7UA 3LSDA 3NAPB 5C8CA 3AP6A 2ZHLA 4YGEA 4FPYA 3MIFA 2QE3A 1PK6C 1PNFA 1JHNA 1ZZCA 2XWBB 1BXHA 5H9SA 4AEKA 1MZFA 3LA2A 2DCKA 1MS9A 1RUF3 1RITA 2Q5TA 1OFNA 3SISA 2DUQA 1R1A2 2R073 3D6EA 1RHI1 4XYXA 3VLBB 2JJ6A 3MIHA 4GB33 5CIRA 4AE2A 1AX2A 4KQ7A 4XF9A 2R32A 4NHKA 3SNMA 5A32B 2GMMA 3VUOA 2P3IA 1A8DA 1YI9A 1O4YA 1DGWX 5DUWA 4YARA 2V5YA 2R6QA 2Q1MA 4NO4A 3HWJA 5JOWA 3AXDA 1KFXL 3H1MA 2CL2A 4N43A 1W2UA 4IEWA 1G9BA 1QJX1 2P3JA 1V6IA 1NA1A 3GF6A 3KCYA 5C9AB 2GC0A 4GH4A 1Z7S2 1X7NA 1FI2A 2A6XA 4AW7A 2RR11 4CDXB 3ZFGC 1HV0A 4ZU4A 1CVNA 3RMXA 1CPMA 5AC93 3LOBA 3VHRA 4EN8B 1DFQA 2HKXA 1RUH3 4FQ4A 1VBD2 1VBC2 1AUYA 1GZWA 4FOWA 5T5JA 1LOCA 2XJTA 3MZHA 5K0UC 2ZAAA 4H14A 1BVVA 2DVBA 1DF0A 1UKRA 4WVVA 5F6KA 5CFDA 4YGCA 2VMGA 4MVTA 1RUE2 1GQGA 4Q0PA 1LOFA 3FC0A 1W39A 1V6JA 4OUSA 3GNEA 5D8AA 2A3XA 2HWB1 1RIRA 2CNAA 3FZ3A 5T5OA 2DCJA 4AI8A 3AKTA 3CLPA 3D82A 2TEPA 2FBEA 4BMEA 3WY6A 1ULFA 5H9RA 4ISRA 3D4KA 1RHI2 3CJIB 1SLTA 1R1A3 1VP6A 2ZTNA 5BUVA 1ZVFA 1PGL1 2R1BA 1ZZ9A 1R093 2B5HA 2R16A 3B5LB 1DQ0A 4YYOA 3AMPA 4Q4Y3 3WQ1A 3RMYA 4G9SB 4XIKA 1F2NA 4JGYA 3PVNA 2X5IA 1I6XA 4BHPA 4FPCA 1D2SA 4OI0A 4HSJA 4W65A 3M4FA 1FT9A 1ALYA 2UYBA 3OJBA 4BLIA 3OPZA 5KXEA 2D6OX 1QJX2 4L97A 1AYN2 5D1IA 4QQ2A 1RUI1 4UW5A 5FMOL 4JRAA 1OD5A 2D97A 4XEZA 4JVAA 1MACA 1XYOA 4AWDA 3RG0A 3FUOA 2D3RA 4K9SA 2NN8A 3E97A 1OQDA 4XJAA 5DXDA 1VBD3 1VBC3 5JLVA 1N3OA 1ULCA 3M3OA 3ZFFA 3OBTA 3AJZA 3T1LA 4AFMA 5K7PA 4R52A 1GNHA 4YVSB 1C5HA 4HZFA 3VDDB 2ZOEB 4I01A 1QDOA 3FFZA 4MGIE 4CEYC 1RUE3 1B35A 2HWB2 3VZMA 1YIPA 2Z2SB 1LECA 1WBLA 4RQPC 1DQ1A 1XNDA 5BNNC 1LEMA 2FQPA 2D7FA 5E16A 3POSA 4QPIC 1V70A 4IV3C 3ZIXA 3WINE 2PHLA 3ZN5A 1ZNPA 4GWNA 4AFBA 1MZ5A 3B3QE 4Y1ZA 4CDQA 2I2SA 4FPFA 1RHI3 1U5YA 2C1FA 1PGL2 2OIIA 4RHV2 5FREA 2VXRA 1Q43A 3OYWB 4UW3A 2KXLA 2R0FA 2JDZA 1HRI1 1EAH1 4CP0A 3EHKA 2DU0A 3AP7A 5FCCA 5ABJC 2H6CA 4HVOA 2ILMA 2A6VA 1ULEA 1PHMA 2EALA 2VY0A 3JBG3 1X8MA 3JQXA 1NCRB 4YG3A 3KCCA 1J58A 1RUI2 3IIAA 4PJYA 3WG1A 5BYNA 5DUXA 2P17A 1QJX3 3RS6A 1AYN3 4MGYE 2Z5WA 1FX5A 3AP5A 4I3PA 1O3SA 3IT8A 4QT6A 1BZWA 1WCDJ 4O9EA 1GV9A 3EJKA 3MW3A 2QZ3A 2VW2A 4YNIA 4IV1B 1PK6A 1SCSA 4TYSA 1MZEA 4YZ4A 2R041 4FOQA 5GZDA 5JZGB 5BNPB 3C2UA 1SMVA 4GIQA 2KM2A 1ZYBA 1YNAA 2DCTA 2ZA9A 4AGGA 2VVEA 4JGZB 4JTNA 2NLRA 3SLIA 1SLAA 4XFBA 2PYTA 1W6PB 1WMDA 2DYCA 3B93A 3WDTA 4D3WA 2PHDA 5C4WC 5IT6A 4COWA 1ULDA 4UW6A 2C0ZA 2D6NA 1UIKA 3J26N 4GALA 4N9HA 3U10A 5FQ0B 2A5ZA 4FPHA 4HFSA 2QDNA 3B94A 4N53C 1CAVA 3DKWA 5I93A 1GYKA 2EF6A 4QGMA 3MGUA 3ZSEA 1C28A 1JBCA 4HVQA 4Q2FA 2PA7A 4RHV3 4R9BA 1S55A 5GJ6A 1HRI2 2JXAA 1EYBA 1DHKB 1EAH2 5JOXA 2MPFA 1XNBA 2WZR1 3ZFGA 4DB5A 1EP0A 5EYXA 4NWWA 4Q26A 3ILNA 1AVBA 4BWOA 1V9U2 2IXCA 3WW1A 5K0UA 3KQRA 1S0IA 1RUI3 1JW6A 2MHFA 4B7EA 3UV9A 1VBB1 4JRLA 1DZTA 2VOKA 1FYUA 1REDA 4XHXA 3CL1A 1QQP2 4AEJA 5FRAA 3LB9A 4JDMA 4Y1VA 3KB5A 3ZN4A 4TLFA 2D93A 3H1WA 1LOEA 1YCIA 1H2LA 1RC6A 3WHUA 4D7YA 4PDWB 4COUA 1H9WA 3I54A 4G3YC 1H8TB 2ZGLA 3MW2A 4MX3A 2CAUA 4I3GA 3ZYJB 4QPYA 2BQPA 4PF5A 1FNYA 1W0OA 3M7AA 2GH8A 4EWDA 4KGQA 3ME2A 4C0BA 3FBMA 3M3EA 1Q8VA 3ZMOA 2P3KA 1DDLA 2A75A 1YXWA 2OZJA 1Q8OA 5I0TA 1ZA4A 1XNCA 4P9YA 3HD8B 1Y3TA 4Q0VA 1HRV1 1I9RA 4OZXA 2OZ6A 1QJZA 3V56A 2UWCA 4A7KA 1FOD2 5HCAA 1DGLA 1FMD1 2PFWA 5KHIA 1HRI3 1EAH3 3MYXA 4AI3A 4U2AA 4LO6B 4DINB 1RUNA 4KU7A 4MLOA 3QLQA 1H30A 3ZFEB 3H9AA 4Q4V1 3VBRB 4MGZE 1ASJ1 1IS5A 2VOVA 3L2YA 5FO8B 1V9U3 1VBB2 3PTYA 5DZFA 3NO8A 4AFCA 2XJSA 4RR3C 4E2QA 1OQEA 5BNQA 4RGAA 3ZXAC 1OI6A 5BNOC 3VZNA 2UYAA 2CWSA 1QQP3 4KU8A 1ZBA2 4CEYA 2HWC1 1Q3EA 5A3LA 1AR61 4RQPA 4E4ZA 1S0JA 5BNNA 2GNTA 4QPIA 4YM2A 1MS0A 2WFF2 1AX0A 4IV3A 2GC2A 1ULGA 1J59A 2EXKA 1O3QA 2ZX4A 3I59B 3AZYA 4Q27A 1JXNA 2E9QA 1HX6A 3W59A 5FOJB 2D44A 4AYUA 3GHNA 5BV6A 4X6RB 4XPVA 2MEV1 3DPRC 2YMZA 4OHVA 4QM8A 5TSWA 3JD71 2NMOA 1UN1A 1Y7BA 4LO8A 1C8M1 4IESA 4NHMA 1HV1A 2UWBA 2ZZQA 1I5ZA 1LGCA 2DVGA 4AVCA 2A7AA 4PLOA 1RL3A 4P14A 1QNWA 4EROA 5ABJA 5JSRA 3THPA 5GZFA 1S1AA 1I1EA 2XBO1 3LWCA 4DPNA 1UU4A 2CAVA 1NXD1 3RJRA 1FOD3 3NAPC 5L7OB 4ZXKA 3WDXA 1K5MB 4NOTA 4AQTA 3WUDA 2JX9A 1DQ2A 2BFUL 4Q4V2 3R4DB 1ASJ2 4QX5A 2XLAA 5CA6A 3WXPA 1LHOA 1VB2A 1AR81 4Y5Z0 4CEWB 1ND3B 2XJPA 4Y22B 3N4MA 3WQ0A 1C1FA 2YZ4A 5FAXA 3MICA 2HWC2 2A73B 3ZMNA 3R4UA 1AR62 1ZBA3 2XLFA 4OUMA 1AHSA 2BGCA 5C4WA 4YFWA 2RS12 4FOYA 4FAGA 4KWLA 1QDCA 2Z42A 3P3PA 1ZREA 2WFF3 2RMU2 1YLLA 1GKBA 1RUF1 3UK9A 2DCYA 2R071 4N53A 4XTPA 3ES1A 3HIFA 2MEV2 5C9AC 4XMIA 4Q0QA 5EFUA 4GB31 5AVPA 5JMCA 1X82A 4CDXC 3H3UA 1C8M2 2WA3A 1GNZA 1ENQA 1NYWA 4L92A 5KHKA 1W6NA 4FP3A 4AVAA 3N36A 4H7MA 1N47A 5JR7B 4D7SA 1V6NA 3LA3A 1U0AA 3VHNA 1XNKA 1UPIA 2B7YA 2B39A 3AYEA 2HWE1 5DZEA 4YLZA 4XXAA 1MVEA 4W6XA 1PM7A 2ZGKA 2XLGA 3WP3A 3SH4A 1WGPA 2VVFA 3WG4A 4ASLA 1YYNA 3ZXKA 2JECA 4UW4A 1APNA 2JKBA 1VBA2 2XJUA 2ZGRA 2D40A 1Y9QA 4KBBA 5FO7B 5AC91 4KH9A 3MFCA 3B9CA 2DF7A 1QF3A 2NZ9A 5GLZA 1QJY1 3AM2A 1RB8G 2RJKA 2ZX0A 3AZXA 1C8NA 1O5LA 2WNEA 1AR82 3CJIC 1CAUB 1VALA 1W6OB 1AL22 1GFF2 1AR71 1J3QA 1WMEA 4UXAA 3J9SA 4OULA 4COVA 1TNRA 1SCRA 1WW4A 1AR63 2IXHA 3FLPA 2BW8A 3JB4C 4ASMB 2GMEA 2RS13 1C5IA 1FAYA 4M3CB 4GULA 4QGNA 3QACA 1LESA 2RMU3 4YVWB 5T54A 3OBRA 1OFSA 4MZUA 3R0RA 4GB32 3U4XA 2NM1A 4YGBA 3ZSJA 3E6CC 4KWJA 2CGNA 1COV3 1CX4A 4Q4W1 5CG8A 1R091 5SV8A 2XHKA 1HKDA 4N9IA 4BQ1A 1AYM1 4Q4Y1 1R1ZA 4OI2A 3SCFA 2PTMA 1LOAA 4WBBA 2R1DA 2RE9A 3ZSMA 3GALA 4AQSA 4FXGB 3B00A 2HWE2 4BIFA 3ZXGA 3RNSA 4AEMA 4K6BA 4YVSC 3VDDC 3NKTA 2HEWF 3M1HA 2JG8B 5JI9A 1RTVA 1ZRDA 4RR3A 3IM0A 4EN7B 5BNOA 2D98A 1NOVA 1UD1A 2TBVA 1VBA3 4Y1XA 3O14A 3PJQA 2D3PA 2EXIA 1DYKA 1QJY2 5LEJA 1D2QA 3ILRA 4E9KA 2VECA 1VBC1 4QMAA 4XETA 1G7YA 3GZTB 5B2GB 2VG9A 3AKRA 4LO5B 1POV3 4AI2A 5IK7A 2QQPA 1AR72 1DLLA 3WZ1A 1YUDA 1AL23 1WW5A 1F31A 1AJOA 3I8TA 1OOPB 1RUE1 1XRUA 1XE8A 4P5HA 1LHUA 3HAGA 4YZ2A 3DPRA 5J98B 1QXPA 2O8QA 3QOPA 2D6LX 1NCRC 4WZFA 2WSUA 3JQWA 3N7MA 4F7ZA 5GZCA 4G4FA 2FHRA 4IEOA 2E51A 3POWA 4MGKE 3RPQA 4RS5B 2BTVC 3H8UA 4FO9A 4Q4W2 1R092 2CTVA 2Y26A 1SLLA 3NV2A 1AYM2 3NAPA 4Q4Y2 3JB8A 1O5UA 4XOGA 1IS3A 1TE1B 1UMZA 1CAWA 1U5ZA 5JZGC 2F6BA 3AMNA 3RRDA 3VZKA 4QQOA 3JBG1 3APBA 2VQAA 4QPGC 2HWE3 4GH4B 1LEDA 2NMNA 5FMOS 5GKAC 4JGZC 2GZWA 3J8F2 3WHTA 3NVCA 1DQ4A 1AYN1 4GKXA 3AMHA 5LEKA 2TUNA 3OGJA 4WM7B 4MXVA 3E5XA 5JOYA 1AXYA 5HCFA 1PO23 2ZGMA 1LOGA 1AJKA 4XF3A 2OW4A 2JG9B 1O4TA 1QJU3 4FP2A 2UU8A 4PCRA 5EJ3A 1QJY3 3VBOB 3U07A 5A32A 3MPPG 1Q8SA 4CRQA 2FMDA 4QQHA 1QOOA 2QUOA 3WT3A 5LK5A 1AR73 3KS7A 4LR4A 3NJZA 4FPLA 1QOSA 2VH9A 4AI1A 5C9AA 5DZGA 2IZWA 1UIJA 4LA2A 4CDXA 1HQLA 2F4PA 4P9XA 1XYPA 2G9GA 4M3CF 3WG3A 1BK1A 1H9PA 4AVSA 2H6BA 1EV12 2GSYA 3BOWA 4E27A 1ZX5A 2LM3A 2WSVA 4B4QA 2RHPA 4S2GA 4R4XA 4AGVA 1BJQA 1LRHA 4Q4W3 1BCXA 4RHV1 4XFCA 1JUIA 1WA4A 1VR3A 1RUOA 3LKJA 1JUHA 4IXLA 4BZ4A 1AYM3 4JGYB 5KC6A 1GQHA 1U5XA 4HSLA 1A3KA 3M3CA 3TWIA 1CAXA 3JBG2 4PDWC 4KNCA 5J7MA 1NCQB 5KHJA 1H8TC 1HQWA 1LGBA 3LSEA 1Q8QA 2XVGA 2FZ1A 3WR0A