1WLCA

Congerin ii y16s/t88i double mutant
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
134
structure length
134
Chain Sequence
DRAEVRNIPFKLGMSLTVGGVVNSNATRFSINVGESTDSIAMHMDHRFSYGADQNVLVLNSLVHNVGWQQEERSKKFPFTKGDHFQITITFDTHTFYIQLSNGETVEFPNRNKDAAFNLIYLAGDARLTFVRLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title In vitro evolutionary thermostabilization of congerin II: a limited reproduction of natural protein evolution by artificial selection pressure
pubmed doi rcsb
source organism Conger myriaster
molecule tags Sugar binding protein
molecule keywords Congerin II
total genus 29
structure length 134
sequence length 134
ec nomenclature
pdb deposition date 2004-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00337 Gal-bind_lectin Galactoside-binding lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1wlcA00
3VKMA 2A5ZA 5EYYA 2C5DA 2JECA 3B69A 1UN1A 3AFKA 1LGNA 4U2AA 2E6VA 5HCFA 3V0BA 4LBNA 3MPPG 3N7KA 4FPFA 2A3WA 3WDXA 2GMPA 5HCAA 4XZPA 3U4XA 1LOFA 1MS3A 3WNXA 1HLCA 4NOTA 3O12A 5EXOA 1QKQA 1NXD1 1V6IA 2VUAA 2ZGRA 3WV6A 1GANA 1C57A 1CN1A 2DUOA 3M3CA 2V73A 1AXKA 4M3CE 1JHNA 4ASMB 4AYUA 1Q8QA 2B7YA 3W58A 3WDYA 1JN2P 4RA0A 2P3JA 2ZGOA 3AP5A 4M3CF 2DVDA 2H0BA 2P3KA 1FV2A 1QOSA 1W6NB 1CVNA 3AZZA 2A6VA 4D69A 1LEDA 2D3RA 1AXYA 3AYDA 3SH3A 1RIRA 2DTYA 3R4SA 3UJQA 2D3PA 3AJZA 3OBRA 4YZ1A 2JKBA 4LBOA 3A4UA 1WBLA 3SH4A 4PF5A 2DWRA 1H9WA 1G86A 1B09A 1W6OB 4Q8KA 1LHWA 1G9DA 3BIWE 2AR6A 2A3XA 2ERFA 2R16A 3O0XA 5DXDA 3ZXEA 3SNMA 2D44A 1SLBA 2E7QA 1ULFA 3V0AB 3AYEA 1CR7A 1LEMA 4XILA 5GLVA 5H9PA 1IKPA 1LECA 1CJPA 4RL7A 3JUUA 4UW3A 4FPKA 1KDMA 4XHXA 4YW2A 1DFQA 2UWBA 5T5JA 4R9BA 3W59A 3AXDA 4HANA 1V6OA 4Q2FA 3VKNA 1W6OA 4YZ5A 3WHTA 1CESA 4FP2A 1N1VA 3USUB 3V65A 1Y7BA 2XB6C 3O0WA 3NWKA 1GKBA 4FPYA 1DQ0A 2Q5TA 3BOPA 4I30A 1OQ1A 3ATGA 2DYCA 3V0AA 3LCPA 2NP0A 1MS5A 2VW1A 1FX5A 1FYUA 1LHVA 3D6EA 4XJZA 3WUDA 4BOWA 3DGTA 2HYKA 2DV9A 3AP7A 3KM5A 3O5SA 4ITCA 1AX1A 2AGSA 2WT1A 4DPNA 2A7AA 2WJSA 3INAA 5JOYA 1GNHA 3ZYRA 1Z0HA 1S0CA 3POSA 2PHFA 2Z42A 4NO4A 4P9XA 4XYXA 1LU1A 1AX0A 2FMDA 1IKQA 1DGLA 2D6LX 3WG2A 2CNAA 1VALA 2WSUA 4TYSA 2V5YA 2PHXA 4GKYA 3WDUA 1HDKA 2GMEA 1LOFC 1SLLA 5GLTA 5HCBA 2DVAA 2VU9A 1YIFA 1Z78A 2A6XA 3POWA 1FV3A 1VIWB 3V64A 3MW2A 3V0BB 4XIOA 5E8AA 4Y1XA 2YXSA 2ARBA 1W0PA 2NMNA 4Z8BA 3N7LA 2P34A 1KITA 3RMXA 1LESA 4GWMA 1PZ8A 1V00A 1DIWA 5T54A 1N1TA 2UWCA 1W6MB 1MS9A 1IS5A 3TB0A 2OVUA 3USUA 2DVFA 1WBFA 2DTWA 3ZXFA 1SBFA 1SACA 4Q1PA 1H9PA 2E53A 2PHWA 2NZ9A 1UZZA 5JLVA 5GZEA 2GALA 4WVVA 2PHTA 4Y20B 1DBNA 3JU9A 1PZ7A 2ZGNA 4YG3A 3SISA 1GZ9A 1W6QA 3M3EA 1QOOA 3AK0A 4XXPA 5EYXA 2GMMA 3M3QA 2YMZA 3ZXJA 5T5OA 4AGVA 4Y22A 4YZ3A 2PELA 3LSEA 2DUQA 5GLUA 3ENRA 3MW4A 4XMAA 5DUUA 4AGGA 2UU8A 3VV1A 2DU1A 3MW3A 2R0HA 1A78A 1GV9A 2UWAA 2NYYA 3PMEA 3AZWA 4Y1YA 2AH2A 4DRRA 2A6WA 1MZ6A 3N36A 4XTMA 4YLZA 2GN7A 5JOZA 1RINA 5JOWA 4FPEA 4Y20A 5T5PA 5GZFA 4DQAA 1FNYA 4M01A 2D6OX 3R05A 4XOGA 4WZFA 2EIGA 3AX4A 2P3IA 1HQWA 5DUWA 4XDQA 1SLTA 5CNAA 4BQ1A 4ATEA 2ZKNA 3AYAA 2D43A 4UW6A 2R1BA 1JYIA 1D0HA 4MYEA 5CB7A 3ILNA 2DUPA 4R9DA 1RITA 5DUVA 1LTEA 1WW6A 4FPHA 4YFWA 4XJWA 2JD4A 2W68A 1MVEA 4SLIA 4DS0A 2R49A 2ZGLA 3ZXLA 1LOBA 5GZCA 1WLWA 4FPOB 4WV8A 5BYNA 2DVGA 1ENRA 5F9TA 1S1AA 3N3HA 3QCWA 3WDVA 3A0KA 4YW4A 2D6PA 3WG1A 1WW5A 3BODA 3RS6A 3SH5A 4ZXKA 1KQRA 1UL9A 3ZPYA 3AP9A 1JUIA 3PJQA 4XE9A 4BLIA 1KRIA 1WCSA 4TZDA 1DYPA 3I4IA 4BLJA 2LALA 1FNZA 1HQLA 1I3HA 5GLZA 2KM2A 5KXCA 2FHRA 1QOTA 2DU0A 2LTNA 2JDZA 2ZGMA 4F83A 1WD3A 3IMNA 1GZWA 2ZMNA 2JE7A 1MS8A 2WT0A 3H0OA 1C4RA 1S0GA 1W6MA 5JMCA 2ZZJA 4GA9A 3DUIA 2AREA 1N47A 4FPJA 3ZXKA 5DZGA 4XJAA 4WVWA 3BTAA 3OGGA 1V6MA 4LBQB 3D4KA 1KDKA 2VW0A 4XJ8A 3WZ1A 1R1ZA 3A0NA 1N1YA 2GNMA 1DYKA 3WG4A 5JOXA 1H30A 1VAMA 3GALA 4ZKTB 3T1LA 1LHNA 3ZSLA 1GZWB 1N3PA 2WQZC 3GNEA 1QU0A 2D7FA 2VY0A 5DG1A 5E89A 4Y1VA 4YGDA 3AXEA 1A3KA 1BJQA 3R4UA 4ATFA 3IKWA 1W6PB 1QNWA 2ES3A 1QDCA 1LGCA 1CQ9A 2WLQA 3OY8B 1D2SA 3AJYA 1AF9A 1LENA 4LBQA 1Q8OA 1CPMA 5CA6A 4GXLA 4LBMA 1EPWA 1MS0A 2CWMA 2CWSA 3FUQA 3N7MA 3PVNA 4K21A 2JJ6A 1G9FA 1O4YA 2ZGQA 3FLPA 4P14A 4YGBA 4FOWA 2ZBJA 5JVVA 1SCSA 1J1TA 1Q56A 2ZGUA 3T2TA 5IK4A 1JBCA 3D5OA 3M3OA 4YG6A 2A75A 1QNYA 1GYKA 1CPNA 2D6KA 3AZYA 4L8QA 3IN9A 1FAYA 1KJRA 2PHRA 1LOGA 1JXNA 1SFYA 3OYWB 1W6PA 2OUHA 4KBBA 1ZM1A 1VAVA 3KQRA 1VLNA 4CZSA 5CBLA 1HKDA 1F9KA 4K1YA 2A6YA 4XTPA 3OJBA 2ZMKA 4JC1A 1WLDA 4W65A 4YZ2A 4Y24A 3WDTA 1IS4A 1ENQA 2YROA 5GM0A 3OPZA 3N7JA 1QDOA 3C2UA 3PVEA 4YZ4A 3HMYA 4GKXA 1X50A 4LBJA 4XBLA 2E7TA 2ZHKA 1UKGA 4FQ4A 4IQPA 4ISQA 1UAIA 5H9QA 3OYWA 2R1DA 2GNBA 4LBQD 5IK5A 1IS6A 1I1EA 2CL2A 1YXWA 2D6NA 2NM1A 1WW7A 4YM2A 3OY8A 3I8TA 3NV4A 2AYHA 3B01A 2GNDA 4LBKA 1DZQA 4K20A 1ULEA 1ONAA 1S0FA 2CY6A 1C1FA 4XJUA 3AZVA 3SITA 5KXEA 2A6ZA 1DLLA 3AYCA 4FQZA 4XBQA 1SLIA 3B3QE 4FPGA 1BQPA 2YZ4A 3WUCA 3ZSJA 2EXKA 4JRAA 5T52A 1YO8A 5LK5A 4M3CA 4YM1A 1SBDA 2D6MA 2VH9A 5DUXA 4ISRA 3L2YA 2W52A 2YV8A 2A70A 2ZGSA 1Q8VA 5GLWA 1LJ7A 3O0VA 3ZVXA 3FUOA 4AVSA 1UZYA 4K1ZA 2ZAAA 4PQ9A 3UJOA 5CAZA 1N3OA 1SCRA 4BMEA 3FBYA 1ULCA 2NMOA 1LHOA 1OFSA 1V6KA 4PCRA 2VXRA 4R9CA 1DHKB 3PVOA 3SLIA 3CNAA 4OZXA 4R9AA 2GDFA 2EXHA 2DURA 5FREA 3VKOA 1MZ5A 1OKQA 2SBAA 1S0BA 5DG2A 4HL0A 1PZ9A 3HR9A 1CONA 1DQ1A 2JE9A 5GALA 2ZA9A 4GALA 5GZGA 3VKFC 3LSDA 1MS1A 1WW4A 2D3SA 1BYHA 3HN1A 3QLQA 5EWSA 1UMZA 2ARXA 1G7YA 1BXHA 3ZSKA 5L73A 1W6NA 2W08A 4Y26A 1LOEA 3M2MA 2AENA 3ZSMA 1C1LA 3FLTA 1JYCA 5AVAA 5T55A 1MR5A 3T1MA 4Q8LA 2P37A 1F5FA 2VW2A 3WLUA 2YY1A 1AVBA 5T5LA 3VUOA 5GJ6A 2TEPA 1WUVA 1BKZA 3WCSA 1AXZA 1G8WA 4P9YA 2ZHMA 2RHPA 4PBOA 4Q1RA 4DFSA 4M3CB 4BMBA 1GBGA 4U36A 4H55A 3RSJA 2NN8A 3N35A 1MVQA 2CTVA 1G9BA 2BQPA 2GNTA 4AWDA 2R0FA 4BM8A 2ZACA 2WT2A 5KXDA 1QGLA 1LOAA 3NV2A 1S0EA 2W39A 2C9AA 2ZHNA 1GICA 4YGEA 3RRDA 2ZGKA 4YG0A 1IS3A 5SV8A 3WCRA 1LHUA 1SLCA 1BZWA 3RQ0A 1DQ4A 1DQ2A 3IPVA 4Q26A 1MS4A 3MEPA 4XIKA 1Q8SA 5H9RA 1LU2A 5DZFA 4FOQA 5IK7A 1JOJA 1LCLA 1W0OA 3AP4A 4AVTA 2XG3A 1DQ5A 4XJ9A 1WD4A 4YW5A 5F5QA 4LBLA 3NV1A 3ASIA 5DZEA 4C1XA 2P2KA 4CTEA 3UL2A 2EXIA 2ENRA 1ULDA 1U0AA 1URXA 2AUYA 4GWNA 3AP6A 1FATA 1S0JA 1UPSA 3ILRA 5JDBA 2GN3A 4FPCA 4BPZA 3WVJA 4YW1A 1N3QA 1O4ZA 2E51A 3WOGA 1WLCA 1LOCA 2ZGPA 1ENSA 4Y1ZA 4C1WA 1N1SA 1F31A 3ILFA 2A71A 1TEIA 3AZXA 3FFZA 4YM3A 1MACA 4YGCA 4YFZA 3B9CA 1AZDA 2CYFA 1V6LA 1LULA 1NLSA 2OUJA 2I2SA 4UW4A 1UX6A 1S0IA 4FPLA 4M00A 2ZABA 5E88A 1SBEA 4UW5A 4FOVA 4FP3A 2SLIA 3IPVB 1XQNA 4YM0A 4XMIA 1IOAA 5IUQA 5T50A 4AGRA 4P9WA 1V6JA 2EAKA 4YW3A 3TAYA 4Y1UA 2WKKA 2EXJA 1GSLA 4XBNA 1Q8PA 3FLRA 4Q27A 4AVVA 1YYNA 2WNEA 1W6QB 2G4IA 1ULGA 3POYA 5KXBA 3RMYA 4Y22B 4XHBA 5FRAA 1V6NA 2A3YA 3OBTA 3ZYPA 5IT6A 1G9CA 1QF3A 1ZA4A 3B00A 1GZCA 1SLAA 1A8DA 3WHUA 5IK8A 5H9SA 1DQ6A 1AJOA 3Q9OA 1JW6A 2DVBA 2ZMLA 4XXAA 3WG3A 3RG0A 1AJKA 2WSVA 1LGBA 4FVVA 2UURA 1GNZA 1KJLA 4FOYA 2OW4A 4JCKA 4CRQA 5GZDA 1APNA 2ZGTA 3WDWA 2PHUA 1QMJA 3NV3A 2EF6A 2EALA 1CIWA 2ZHLA 3IM0A 4PBPA 3APBA 1GLHA 1LODA 1YRZA 4DRVA 1AX2A 1YI7A 3M1HA 3VKLA 1G9AA 3UK9A 1S0DA
chains in the Genus database with same CATH superfamily
2A5ZA 5JI7A 2WZ8A 1RJ8A 1VBC2 1HB1A 4PT6A 1XNCA 3RYPA 2VOTA 2EIDA 5HCFA 1KGYA 4LBNA 2PA7A 4CDWA 1QWRA 1SEFA 3B9IA 3I2DA 4EYUA 1LOFA 3WNXA 1HLCA 4NOTA 3O12A 1BEV2 2Q8OA 3SCGA 4HOOA 4NHMA 4UFLA 5FMOL 2WFF2 2RM23 1CN1A 1PK6B 2DUOA 3KF3A 2V73A 1AXKA 1ODMA 3VN4A 4EV0A 2P6CA 1PO23 4JRLA 3KT1A 1HJGA 1BK1A 4FFIA 1PVC2 4YSFA 5E6HA 2ZGOA 4COYA 2P3KA 1QOSA 4GJZA 3RI8A 1Q3EA 2D3RA 4ET7A 4AEDC 2VCAA 4YZ1A 4NIIA 4B4PA 3H8XA 4HVQA 4LIUA 3PUIA 2Q1MA 4FCAA 2RE9A 2XKOA 1UQXA 5FY5A 3VZMA 1RUD1 3ZFFB 1UU5A 4IEWA 1YQ2A 1RJ7A 3H1YA 1OF3A 4Q4Y3 4XCAA 3WR0A 1DZTA 4CCOA 3I3MA 2R16A 4JX0A 1ZRCA 5DXDA 3D0SA 3ES4A 4A7KA 2OPKA 2WUHA 4OUMA 1IKPA 1F15A 2LM3A 2WZR3 4Z92B 1NCRB 4RL7A 5C9AB 2YBPA 2DCZA 2WA4A 4LKSA 4XHXA 1ULOA 5T5JA 3D0JA 1V6OA 3LA3A 1S2BA 5BNNA 1W6OA 5HPOA 1W9YA 4RS5B 1CESA 4YVWA 4FP2A 5I8YA 4JVAA 2DCKA 4IE4A 3F2ZA 2XB6C 3KCYA 3VDDA 3NWKA 1JOPA 1DQ0A 1K12A 1SDDB 2JDNA 3BOPA 3RNSA 4KU8A 3WX5A 1UU6A 3ZIWA 3RVHA 2MEV3 1ZX5A 3O7OA 4LO8A 2JG9A 4P02B 2VW1A 1FX5A 2WO2A 3P3NA 3VBSC 1X33A 3VBFB 2J1TA 1ZZ8A 2DV9A 3KM5A 2AGSA 2VTXJ 1O7FA 3BPSA 4IESA 4JQTA 1Z0HA 4BQ5A 1SMVA 2ZEXA 1S0CA 3AKSA 3IDEA 3POSA 3RYKA 4XUPA 2FMYA 4CEWC 4Z2WA 5KHKA 1IKQA 1AYM1 2D6LX 1DF0A 3WG2A 1W9TA 1VBE2 2WSUA 2Y6LA 4TYSA 4XABA 2GMEA 1LOFC 2XL9A 4G3YC 2OZJA 1HV0A 4LTAA 5GLTA 4IEQA 2VU9A 3THDA 2A6XA 3POWA 3V64A 3PL0A 1EYBA 3S30A 4Y1XA 2YXSA 1GP5A 3FC0A 4O7XA 1BVP1 4OULA 4BDVB 4Z8BA 4BQYA 1KITA 3A23A 1ZRFA 3SMHA 4GWMA 1PZ8A 1U5YA 4CCLA 4A3ZA 4YRDA 5FPXA 3BTZA 1DIWA 2FCVA 3V56A 4W8JA 1CAXB 3RJRA 1DZRA 3ZSEA 4YYOA 2BNMA 5D8AA 3UNPA 4Q1PA 1W99A 5FBZA 4Q29A 1OD3A 1GOFA 2E53A 2XBO3 3NRUA 2VE1A 5GZEA 2PHTA 1OMIA 3FX3A 1PZ7A 3SISA 3LFMA 5LA0A 3OEAA 5KHJA 3OBAA 3VL9A 3ZXJA 3KT4A 4YVSB 3GF6A 5I8SA 4Q4W2 3VDBA 1CAWB 1O8SA 4IV3C 3DL3A 3ENRA 3MYXA 4IV1B 3OF1A 1VBE3 4XMAA 1ND2B 4PLMA 3VBUA 1JZ5A 1G9CA 3VV1A 4HSLA 4R4ZA 1ZREA 3T2QA 4QGLA 1A8MA 4Q0VA 2JKXA 3AZWA 4JGZB 2A6WA 1RINA 4FPEA 5T5PA 3W21A 4YVWC 2W95A 3VDCA 3BU0A 5FZBA 3AL5A 4M01A 2LW8A 5FO7B 3NW4A 1GMMA 1EAH2 2ADDA 1CAWA 3AX4A 4MOAA 3WNPA 3OBZA 4LIVA 4EN7B 5JMOA 1J84A 2ZKNA 4H14A 4W6YA 3JZVA 4UW6A 5L36A 2R1BA 1DGRA 1UOBA 5DDJ2 3VBSA 5LW9A 1XNTA 3FHIB 4QB6A 2YBKA 4XACA 2WS92 3ZFGB 5LRSA 5BY5A 4OMCA 5F6KA 3T0DA 1WW6A 1YEWA 5CZKA 4XJWA 3POEA 1RMU2 2W68A 4DS0A 4SLIA 5IVBA 2ZGLA 4NHYA 3CDZB 2QNKA 3GZTB 1LOBA 4FPOB 2WWUA 2DVGA 3LB9A 1X9PA 3NJZA 4AZZA 1PO21 3PUHA 4H2AA 3QCWA 5T3NA 2XUEA 3WDVA 5C3SA 2D40A 3TEZA 5A1AA 3BODA 3CMGA 4Q4X2 4RSUA 2XKPA 2WS91 1UL9A 3ZPYA 5FO8B 2IXLA 3PJQA 1C3HA 2ZAHA 2BBVA 2ARCA 3QACA 1DYPA 5GLZA 3J4UH 3RDIA 5FPVA 1Y43B 1QOTA 2KR2A 5IATA 3MI8A 1PNFA 4F83A 5D8AC 4O61A 4AXOA 5AFEA 4LKFA 2WRAA 3S7EA 3KV6A 1MS8A 3I3DA 1C4RA 2ZZJA 4HPKB 3ST7A 4K7JA 3WNOA 1IGOA 1L3JA 1CAVA 4NPLA 5ERLA 4LO6B 1OA4A 2VNOA 1KDKA 4XJ8A 1R1ZA 3AMPA 3SKVA 5LBEA 1W8NA 1GOHA 2CAUA 1MPXA 1YJLA 1H30A 3AKTA 4B7EA 3GALA 1PVC3 2WO1A 5JOXA 3T1LA 4LJHA 4ES8A 1HRI2 1HIXA 2OS2A 4JDMA 1AL0G 3O1MA 1AL23 2VY0A 5DG1A 4Y1VA 4MG2A 1A3KA 3R4UA 3ZKUA 4CDQA 1V9U2 4GMP0 1F2NA 4DOUA 1D2SA 1PMIA 1R083 2EIEA 1W05A 3VHNA 4FTBA 1J58A 4J1WA 5DN2A 3PVNA 4K21A 4P14A 5FY1A 5JPMB 4LITA 3N9PA 2W91A 4FOWA 3H3LA 1J1TA 3T2TA 2ZGUA 3VD9A 1TZOA 1VE0A 3OPTA 5LRRA 3A7QA 1VBB1 1VRH1 1FAYA 1R092 2ATFA 3U10A 4KBBA 1ZM1A 4GH4C 3KQRA 4M0NA 3RZJA 3J7NA 1P8JA 1HKDA 1F9KA 3FWEA 2RR11 3OJBA 4I01A 2ZMKA 4MZUA 4UF0A 1VB2A 4D8MA 3CO2A 3M7AA 3WDTA 3ZN6A 1O3TA 1WCKA 2PQQA 2WNOA 2YROA 4N43C 5EIYB 2X5IB 3OPZA 1QDOA 1F35A 4F7ZA 2F6BA 4N9IA 5BNPA 3K4AA 1OOPA 1UKGA 4NAMA 5H9QA 2J1VA 3DECA 2OIIA 1I1EA 4Z2AA 5FYCA 3VZJA 2CL2A 3ZM8A 2NM1A 3HEIA 2XGXA 1CX4A 3HNYM 4YM2A 4YW7A 1OF4A 1VMJA 3OY8A 4CCNA 3NV4A 4BE3A 5M0TA 1QY4A 2YGMA 3LEKA 4AHYA 1XC6A 1S0FA 1D2QA 4WBBA 1C1FA 4IEOA 5IYYA 2PMWB 1DLLA 4L92A 1QEXA 1A34A 2BU9A 2BVVA 4HSJA 4IGPA 1BQPA 3ZSJA 2EXKA 1UY3A 4XCBA 5T52A 1JZ8A 1POQA 2D6MA 1FI2A 5DUXA 1ND2A 1PIV2 2Y0OA 4I2OA 4LO4B 1Q8VA 2PAKA 3LIHA 5C5UA 3ZVXA 1UX7A 1I9RA 2ZAAA 5I0UA 1CX1A 2CHHA 5K0UB 2B45X 4S2DA 3VD4A 4BMEA 2K2SA 3RZHA 3LWCA 4MUVA 5K9YA 2RV9A 4R9CA 2V4VA 3PVOA 3AKPA 4XUTA 4W6XA 4QPIC 3CLPA 1SQ4A 4AI1A 3BYWA 5D2AA 3KV9A 5FK7A 5FREA 3VKOA 1W8WA 5CKNA 4MGTA 2WR9A 2WWJA 5D21A 4G4FA 4TLGA 1WGPA 4IGQA 1C8NA 1CONA 1WKYA 2FCUA 5EJZB 3WNMA 1FMD1 1UOJA 2ZA9A 1W8TA 1YQCA 4GALA 5FY9A 3VKFC 5FPUA 3LSDA 1MS1A 1WW4A 2D3SA 4CU9A 1BYHA 2JENA 1V0AA 5FOBB 3WXPA 1JYNA 1BXHA 2RS32 3I3EA 5K0UA 1W6NA 1H2MA 4JDOA 4KGQA 3AL6A 4YARA 4N9HA 3FLTA 4CXWA 4LHLA 4NRPA 3ZYJB 1O6UA 2VW2A 3WLUA 2QQIA 1AVBA 3VZLA 3VUOA 1PVXA 2YU2A 2Q4SA 1WUVA 1ZBE3 1BKZA 2BOIA 4DUVA 1G8WA 2QDNA 2YUEA 2HBUA 2ZHMA 4NIGA 4DFSA 3A22A 4AQTA 3VGIA 4QB2A 4A6SA 1IPKA 4N43A 3ZO0B 4H55A 4AFAA 1XSQA 4EWAA 5BUVA 3RSJA 5LCWL 1MVQA 1ST8A 4YWAA 1G9BA 1UY0A 2BQPA 3GJAA 1HB4A 2K0GA 4AWDA 3BN6A 2PFWA 4WM7B 2R0FA 3PTRB 2ZACA 2HWD3 1PNGA 3MGUA 2XXZA 3BIEA 2C9AA 3BVCA 4RGGA 1K5JA 2FDIA 2Q30A 4FFGA 4YG0A 1IS3A 3WCRA 1REDA 1BZWA 4NIHA 4PF1A 2VZRA 2YB7A 3N9QA 4LQRA 1Q8SA 4I0AA 3UESA 3KQ4B 1LR5A 4B1LA 2WZR1 4QXCA 3H8RA 5KR7A 2XVLA 2VOVA 1EV12 2MEV2 4MGIE 1H4GA 4WM8B 4AVTA 2VBDA 4ARYA 4WM7A 4YW5A 3K77A 3U11A 1NCQA 1RUH1 3NV1A 3UETA 5DZEA 4C1XA 4CTEA 4EJRA 4CXYA 4J1XA 3JCIA 1ULDA 4JGYC 5C8CC 1AR91 3WSOA 2AUYA 4XQ4A 1FATA 2WNVA 1S0JA 4AFMA 1PK6A 2PXJA 2HWD2 2RS13 4BPZA 2C1FA 2O0OA 2WWSA 1ZYBA 2WZR2 1OLME 5F1RA 4GB32 2R041 3MUZ1 4ZHNA 2QQJA 4E8DA 1F31A 2GZWA 2A71A 3ILFA 2WL1A 2J1SA 4QPGB 3I7DA 3NKGA 3T30A 3B9CA 4AEKA 4META 4LO7A 1XNBA 1HW5A 4N53A 1RUG3 1W90A 2HEWF 1X8MA 5CG8A 2ARAA 2I2SA 3K4ZA 3ALQA 2AEYA 4QKFA 4LK7A 4PDWB 4CP9B 2SLIA 4XMIA 1HB2A 1NT0A 2HH9A 4IUGA 4AGRA 1Q5OA 1V6JA 1JUHA 1SHWB 1UW8A 2EAKA 3HVDA 2WKKA 4WZCA 1OI6A 4Y1UA 1W3XA 4XBNA 3FLRA 5F37A 2BNOA 4MXWA 1YQ5A 4BCUA 1YYNA 1HJFA 1POV1 1W6QB 2G4IA 2WNEA 2GSYA 3E97A 3HQRA 4BQ4A 5I0RA 5FV3A 4JGZC 3POYA 3S6PA 1D4M1 3MIDA 3RMYA 1JZ3A 1Q43A 1PGL2 3ZX7A 4I3PA 3P3PA 2WS93 2VNVA 3WHUA 1A8DA 5IK8A 1DQ6A 3VBHB 3Q9OA 3MIFA 4LPLA 5L9BA 3WG3A 1AJKA 2XHNA 4EE2A 2UURA 1K45A 4HT1T 3ZYBA 1ENXA 3MF9A 5FP4A 5L7OA 3PVBB 2PHUA 2HWF2 4HKWA 4HZFA 5J96B 2EALA 1LNSA 2JX9A 5EPAA 2ZHLA 4PBPA 1NQJA 4M4PA 4OMDA 1IG3A 4Z1VA 4UFHA 4URAA 4EROA 1LODA 2YPJA 4YNIA 2XLFA 3G7DA 1CJDA 1W04A 4L2NA 5F5IA 4AVBA 4S2FA 5K8SA 1G9AA 1RUC2 1S0DA 3VKMA 2C5DA 2GP3A 3AFGA 3I3QA 4JGYA 5F7UA 3AFKA 3R4DB 1HB3A 2FDJA 2GC0A 4U2AA 1PGSA 3Q8CA 5F3EA 5C7GA 1OKOA 4N8MA 2VUDA 3WDXA 1HRV1 2GMPA 4UOJA 3O1TA 3TEWA 2J1EA 4A4AA 2MNGA 4HETA 1MS3A 2HWE2 5LATA 2RS31 5DABA 4B4RA 3CZUA 3ZYIB 1QQP2 2IWGB 1C57A 4B8EA 5JXHA 2C24A 4QX7A 5ACA2 4URTA 1UZVA 1OBNA 3TN91 4ASMB 4AYUA 4D7TA 2H6BA 3ZYFA 3W58A 3WDYA 4NWWA 1XNDA 2WN3A 2CDPA 2OX0A 3AP5A 3POFA 5HI0A 3AZZA 4NIAA 5EJ1B 2A6VA 3CIHA 1AXYA 3AYDA 5FMDA 1RIRA 3UJQA 4ZU7A 2D3PA 2P4EA 3GDBA 1RUF2 3H8UA 4LBOA 3IWZA 2BVBA 5FYIA 1NKGA 4AFCA 4CCMA 1G86A 4OHXA 1QJX1 4QQPA 1LHWA 1PHMA 3TWIA 1G9DA 2Q8EA 3ZDVA 2QQVA 4WVZA 3BIWE 1O91A 2AR6A 2H0VA 2VVEA 3O0XA 4Q4X1 1F8VA 1KFUL 3SNMA 5ABJB 1OPMA 2E7QA 2WO7A 5C9AA 3AKQA 5H9PA 2FDFA 4AK3A 1OUSA 1W2TA 1QJU1 4XFAA 1V9U3 1WMDA 2TBVA 2HWB1 3NNGA 4FPKA 4YW2A 2RDNA 2XWBB 2D5FA 3Q8BA 2GU9A 2ET1A 4G9SB 4BYYA 3USUB 2HKXA 5CADA 4ASKA 3WEZA 3T0BA 4AEDB 2VOXA 4CP0A 2VNRA 5DDJ1 5FXVA 5A1FA 1CZVA 2VZUA 1OA2A 3ATGA 2DYCA 3FHAA 3OD0A 4I30A 4NE9A 1OOPC 3ZFFC 3ECQA 5FP9A 1MS5A 4CCEA 1FYUA 2XUMA 3WUDA 1C8M3 2D97A 3AP7A 1OQDA 1VR3A 3WNNA 3O5SA 1GWLA 1EAH1 1H1AA 2V09A 3ETQA 4INDA 4DPNA 3INAA 5A6XA 2BTVC 1T6GC 3VD7A 3ZYRA 1XU1A 2VOWA 1O3RA 4CEYA 2XR4A 1UXZA 2PHFA 1ODNA 4RYDA 5FKCA 2FMDA 1V9U1 1W3VA 2JDAA 1ASJ2 3E1F1 1ZBE1 4HK8A 1JOBA 1D4M3 1H6XA 2JG8A 2BEOA 4RS5C 1HDKA 5CKQA 3WDUA 2XJVA 4J6GA 4IV3B 1FOD1 4IV1C 1Z78A 5FPLA 2Q0AA 1VIWB 4QX1A 2RS53 5FWEA 5IWFA 3V0BB 1PX3A 1UWWA 2OT7A 2NQYA 3EQEA 1RVF2 5E8AA 3I2OA 5BPXA 4ZY9A 1GP6A 3RMXA 1VBC1 3GBWA 4N53B 4DXZA 3S0MA 1Y9GA 3NNFA 4L0PA 5BNNB 2YU1A 4PJYA 2RM22 1OFNA 2DBNA 2OVUA 3QBQA 1WBFA 3ZXFA 1B35B 4OHYA 1AR63 1SBFA 4QPIA 3U07A 1Z7S2 1ASJ1 1H9PA 1SZBA 4MSVA 1UZZA 2IC1A 3ES1A 2Y6HA 4BQWA 1BEV1 1ZBA2 3NKTA 4IV3A 2ZKLA 3NAPC 4WVVA 2E32A 4L99A 4NR1A 2YHJA 1DBNA 2ZGNA 3SXWA 3WHTA 1W6QA 1RVF1 1UIJA 5C3QA 2A73B 3VDAA 2YMZA 3K3NA 3RWNA 1HRI1 4AGVA 5K0UC 4CE8A 1C28A 4LXLA 2RS11 2PELA 1AUYA 4NWVA 3S5QA 3ZPOA 5CFDB 2UU8A 4OYUA 4HLTA 2HWF1 3W20A 4CP1A 2DU1A 2VTXA 3MW3A 1AR93 1A78A 2WIIB 3UGHA 2P17A 2UWAA 2AH2A 5FUIA 4UFKA 4ZS3A 3T09A 3N36A 4X6QB 4YLZA 2GN7A 4DQAA 2VUCA 4KG0A 4FXGB 5CG9A 2D6OX 3R05A 2QQNA 2VBBA 4B1MA 3LD8A 4HN1A 2IXKA 4Q4V1 1PMJX 1HQWA 2P3IA 3DKWA 3Q8FA 4LHSA 5CNAA 5DUWA 4DEVA 5A70A 3VBOB 3AYAA 3ZYHA 4BQ2A 2D43A 4XFHA 4QKNA 5BNOA 5CB7A 1PO11 1CAUA 2DUPA 3QD6A 1NY71 3VDDB 1RITA 4KQ7A 5DUVA 5D8AB 4RHV1 2YDEA 4D6SA 3SC7X 5IAXA 1L7RA 4FPHA 3RZZA 4HG6B 4XFCA 4RR3A 2WBKA 2F17A 2FZ1A 5EFUA 3O1OA 1GWMA 4R8HA 2R49A 1W8FA 4I0BA 4HKLA 3ZXLA 1W2AX 1FPN1 5GZCA 1WLWA 4WM7C 3C7FA 1EUTA 4K3UA 1PM7A 3OGSA 4YW4A 2D6PA 3W5MA 1CAUB 2CGOA 4PLNA 3TNPB 1PO12 4AQ6A 2VR4A 4PLOA 5C8CA 4ZXKA 5J7MA 1JHJA 3OEBA 4K8RB 4LLFA 1JUIA 5FP3A 4OI4A 2IUWA 1VBA2 4XE9A 1KRIA 1S2EA 1US3A 3TYJA 5C3OA 2LALA 5C71A 1I3HA 1NA1C 2KM2A 4JKKA 3DYMA 2DU0A 2JDZA 2ZXQA 3POJA 1UY2A 5JIUA 2LS6A 4LMFA 5LZ6A 1GZWA 3EJKA 1UZ0A 4XF4A 2JE7A 2XLAA 2XQXA 3C7EA 3KD4A 4X8NA 4DXRA 2WT0A 4QGNA 1J3QA 1S0GA 4TWTA 4LOTA 1W6MA 5FMBA 5JMCA 4GA9A 5C8CB 2IVJA 2XWJB 1O59A 4XJAA 2RJ2A 5HXVA 4OLLA 5FZFA 2Y34A 1W06A 1H1MA 3WZ1A 5IVEA 4CDQC 4EQVA 1L7LA 1N1YA 4BQXA 5FQ0B 3U14A 3BTXA 4ZKTB 3EYPA 1LHNA 1IQAA 2N7GA 1QU0A 3HT2A 1WCDJ 2RVAA 5E89A 4XF0A 2BZDA 3WW3A 3AXEA 4QPGC 2Z69A 3VZKA 1UZWA 5FZAA 1Y4WA 3MDPA 1QNWA 2BFUL 2Q1ZB 4P9JA 3OY8B 3KV5A 5C5TA 3AJYA 1LENA 1X82A 4PI2A 4Q4V3 2QTWB 2WQ4A 1CPMA 5A32A 3I2HA 4IEUA 3JD71 4LBMA 1MS0A 2CWMA 3FUQA 2IFWA 1G9FA 4YGBA 4COVA 3S7IA 5FP8A 3QH7A 5JVVA 4MXVA 4UFMA 1Q56A 5IK4A 3M3OA 4HKOA 2JXAA 1WA6X 4NHKA 1BBT2 1NZCA 1QXJA 1XOYA 2A75A 1CPNA 2QZ2A 3AZYA 5FZ7A 4MGZE 3WQ1A 1KJRA 5J37A 4LULA 3OYWB 4RR3C 3D82A 4NPRA 4OI2A 3VBSB 2G9ZA 1VAVA 3VBFC 5C3RA 4SBVA 3ZFGA 1PGW1 4TLFA 4CU6A 1VBD2 2A6YA 3R6SA 2QQPA 2PLV2 3H3UA 4AOCA 1HRI3 3B93A 1W0NA 3PNAA 2GH2A 1ENQA 1NXMA 2DCJA 4IEZA 4XC9A 4KWLA 4A45A 5IFPA 4GMP3 1XSRA 3PVEA 3HMYA 1UNBA 4GKXA 3VB9A 3WF1A 4FQ4A 2Y60A 2X09A 2G9GA 3IB3A 4MV2A 3OYWA 2R1DA 5CKMA 3LAGA 4KGGA 1AL22 1DGWA 1UYXA 1YXWA 2D6NA 2FQPA 2ZEYA 5J48A 1DP0A 5K4LA 4QPIB 2KD7A 5FZ1A 1R64A 2BV4A 2OPWA 1V70A 3I8TA 3SEEA 2DF7A 3B01A 1KD7A 2E31A 3O1PA 4AVAA 4AFDA 3MV11 1CZSA 4MHRA 1QJY1 2CY6A 3SITA 5KXEA 2A6ZA 3GBFA 4GH4B 2G19A 4Q4Y1 4XBQA 3LPFA 4AI3A 1SLIA 3B3QE 4FPGA 4AL9A 5GZGA 1COV2 3QH6A 3URFA 5HV0A 4QWNA 4M3CA 4YM1A 1SBDA 2GAUA 2VH9A 4ISRA 5JXGA 2R043 3VBRB 5LK7B 2W52A 1CGPA 2R072 2VCCA 4AVSA 3ZR6A 2BW8A 3FUOA 4PQ9A 4XEZA 2QZ3A 5FZ8A 4UXAA 5FUPA 5CAZA 1SCRA 4UBHA 3U78A 3FBYA 1ULCA 2W1UA 3NJYA 4PCRA 5FXXA 1JZ2A 4GAZA 1QIQA 2VXRA 3BU7A 4E2QA 1COV3 1C8M1 2BGPA 3OOXA 4R9AA 5FPAA 2QDRA 2GDFA 5FJKA 1MZ5A 4DMIA 1S0BA 4HL0A 3I2GA 3LOIA 2JD9A 3SCHA 2VPVA 2ZZQA 5LA9A 1DQ1A 1H2KA 5GALA 4NHXA 2BGCA 3J8F3 3T4HB 4W4ZA 3WP6A 4WM8A 4CUBA 3QLQA 3N4MA 2ARXA 1G7YA 5L73A 3J8F1 5A33A 1O8PA 3ZSMA 4LT5A 1C1LA 5F3GA 3VD3A 1MR5A 4MGSA 3IIIA 1RUH2 1F5FA 3I59B 2H6CA 1BHGA 2XJRA 4A44A 5FPZA 3S5AA 1BBT3 4AI2A 2TEPA 4L9BA 1JMUB 5FJHA 1AXZA 4P9YA 3JQXA 4I3GA 1FOD2 4PBOA 2VZVA 1O5UA 4NN0A 4BMBA 3IDBB 2ET7A 3PUAA 3DPRB 4D6QA 5KC6A 4H3WA 3JBG2 3N35A 1MEC2 3DV8A 1AYN2 3GHNA 2CTVA 1VBB2 1ZZBA 5L7OB 1RVF3 2GNTA 2J1RA 2JDKA 3K48A 5JIAA 4CEYC 5DAPA 5A33B 4BM8A 2YC2A 2VMDA 2WT2A 3ZOIA 1DYOA 3EHKA 2ZHNA 3THPA 2VC9A 1YIPA 1X7NA 2VTFA 2RDSA 1WMEA 2XDVA 1ASJ3 1SLCA 3WY6A 1SFPA 1ZBA1 3IPVA 3K3OA 3LPGA 3MEPA 4Q26A 4XIKA 1UOGA 4NMIA 5CVRA 3WF2A 3BALA 3CJIA 2RDRA 4MO3M 3OD4A 5IK7A 4FOQA 1JOJA 3G6JB 4QX3A 2HWE3 1R081 1NYWA 2VZQA 3C7GA 5GLUA 3T4VA 1DQ5A 2GC1A 1UU4A 1WD4A 2WNVC 3GZEA 4ASLA 2RMU1 1VRH2 3HQUA 3MPBA 4EZ4A 4PDWC 5I0SA 4NPMA 4CA9A 3ASIA 2R062 2P2KA 3HQXA 4GULA 2EXIA 3RI9A 5AFBA 3A21A 1PGL1 2VD7A 3CKHA 1URXA 2VJXA 3K4DA 4GWNA 3H8OA 3NAPA 4IEYA 4AW7A 4YW6A 3ILRA 4FPCA 3VBHA 1UY1A 4XQWA 1NUKA 3J7HA 3TN92 3WVJA 1WZXA 2Q1FA 4N53C 4QX5A 3JB4C 3WOGA 5SV5A 1JYTA 1VMFA 4AHWA 2YFUA 1R082 2ZGPA 5BNNC 1N1SA 3AZXA 5LA2A 2RMU2 5A3WA 1MACA 4YFZA 4NIDA 4OQ8A 4XW3A 1AZDA 1W8HA 2P5BA 2R061 3I54A 1V6LA 1NLSA 4WM8C 4ARXA 4EZHA 2QKDA 2BERA 3I2JA 5KHHA 3GCXA 1CAXA 4FPLA 4M00A 4RD7A 1SBEA 4BH9A 2W94A 4FP3A 4YM0A 4QDQA 2BDRA 1WCQA 1S55A 5LA1A 1A6CA 4OQ9A 5T50A 4V1PA 2QQUA 5LEKA 4P9WA 3NO8A 2AACA 4XETA 1ZVFA 4Q0QA 2EXJA 2VXJA 1JODA 1JYXA 5JAXA 4FI9A 4KL1A 5BNOC 1SPPB 2JIGA 5BV6A 4Z82A 4R4XA 4LUKA 2PN5A 1K5MA 5KXBA 5A3LA 1E57A 3PMSA 2Z4FA 1V6NA 2A3YA 4QD2A 3UKVA 2IVIB 1GZCA 4W6WA 2VZOA 5H9SA 3NNLA 1T6BX 1AJOA 2A1XA 2VQUA 4GIQA 4XQDA 5ACA1 2W2IA 1UIKA 2DVBA 4XXAA 1M06G 1S4CA 4QXHA 3GBGA 4FVVA 1COV1 2X29A 3KZ4C 5A7WB 3MHZA 4JCKA 3WQBA 2ZGTA 1R1A2 4DNYA 2VOKA 3NV3A 1VRBA 1AR61 1CIWA 1WWYA 5AVPA 2XONA 2HEYF 2BWCA 3DXTA 2CV6A 1O4TA 5F5CA 3HPNA 4DRVA 1AX2A 4BXFA 3AMNA 5J36A 2ADEA 3PIGA 2WZEA 4PDWA 2VL4A 3VKLA 1H0BA 4LA3A 1FOD3 1WCUA 2JG8B 2JICA 2VUJA 5A7NA 5B4NA 2BUKA 2JECA 3EBRA 1UN1A 3RZMA 3JQWA 2CAVA 4XVHA 1H8TA 3GZAA 3V0BA 2JB4A 3VBHC 1AR62 3N7KA 1NCQB 4FPFA 4Y3OA 5C3PA 4DXTA 5AC92 1UYPA 3HBZA 3LIGA 2VCBA 4XUOA 5HCAA 1XXNA 4XZPA 3U4XA 4QX8A 5FYSA 3K75B 5LEJA 3NNJA 5F2SA 1NXD1 1V6IA 2FDHA 1TVGA 3E5QA 1GANA 1NA1B 4D0QA 1L7QA 3M3CA 4C90A 2IZWA 4M3CE 1JHNA 5TSWA 2QQKA 1GU3A 2D5HA 1M4WA 5G04L 1JN2P 1OLRA 1RUE3 4RA0A 2P3JA 2RDQA 4M3CF 4LKDA 2HWC1 5FZHA 4CDXC 3T3YA 2WFF1 4D69A 2P6HA 3FL7A 4MGQA 3SH3A 1F5JA 2DTYA 3R4SA 3WP4A 1J3PA 3AJZA 3OBRA 4S2HA 4Y4YA 3A4UA 1REEA 5F6LB 2Y26A 3BPZA 2DWRA 2QE3A 1H9WA 1W6OB 1B09A 2W1QA 2XJPA 5FFOC 4Q8KA 4ZU4A 1VP6A 1Y9MA 1ZZ7A 2IFRA 2ORXA 1CAVB 1OSGA 2ERFA 2GP5A 2ZEWA 4LORA 5DAWA 5APAA 2QCSB 1Y3TA 3UKNA 5A3UA 5IVCA 2QVSB 1SLBA 4C0BA 3U0ZA 3S57A 3AYEA 1LEMA 4J25A 5FZKA 5FBJA 2TUNA 1AYM3 2W0XA 1CJPA 1H2NA 3JD73 4UW3A 5FP7A 1ULPA 4GZ9A 3KVBA 1KDMA 4GJYA 2XOMA 4P9GA 1DFQA 1BVVA 2J22A 3W59A 3AXDA 1YFYA 4HANA 5IVFA 3BKZA 4Q2FA 1H2LA 1TMF1 5E1RA 3VKNA 1TME2 3ZFFA 4CDUA 1BLZA 4YZ5A 3UYJA 1UMIA 4FSJA 1Y7BA 2R30A 3D3AA 5FYYA 3O0WA 4NROA 3E6DA 5JSPA 2B46X 1BEV3 4E4ZA 1STMA 4BU2A 5F32A 4I0WB 5KHIA 1NCRA 4A3XA 4RR3B 3D6EA 1HN0A 1LHVA 3JB8A 5KC5A 3E6CC 3E5UA 4JDNA 1UD1A 3DGTA 3H1MA 2PLV3 1ZRIA 2OYZA 5F3IA 2V72A 4ITCA 2HYXA 1AX1A 4BK4A 2A7AA 2WJSA 5JOYA 4CDUB 1GNHA 1JZ7A 3EO6A 1RUI3 4Y5TA 4QPYA 2WA3A 3HN3A 2Z42A 1CD3G 3C7HA 2UY9A 5FMOS 1LU1A 1HN1A 2EAAA 1AX0A 2PTMA 3KF5A 4FT8A 3BCWA 2CNAA 1VALA 5EJ3A 2V5YA 4LOSA 4GKYA 5C4WB 3LOBA 3DF0A 4P5HA 3LEGA 3IDCB 3MIBA 2DVAA 1YIFA 4FBFA 1FV3A 1RHI3 2X5IA 2ARBA 3T2OA 3ZIXA 2P34A 5FYZA 3L9JT 1YI9A 4S2GA 1OOPB 3AVSA 2KXLA 4EWEA 1V00A 4YVSA 1RXGA 5IHRA 1NLRA 3Q8AA 4Q4V2 5T54A 1H1IA 2CDOA 3GXUA 4OHZA 1W8ZA 1W6MB 1MS9A 3RWKX 3TB0A 3LA7A 3USUA 1NE6A 2DVFA 2R7EB 4CDXA 5JPNB 2C4XA 1RYYA 1OHFA 4PIZA 2YC4A 2PHWA 3H50A 1XPWA 5JLVA 2GALA 5L9VA 4LO5B 1NX9A 4IEXA 1IQDC 3VBOC 3JU9A 2VG9A 1J1LA 1K3IA 2C6SA 2P1BA 4RQPB 4YG3A 1GZ9A 3WW4A 5FQ0A 1QOOA 3L2HA 4XXPA 5EYXA 3M3QA 1JYWA 3OGJA 3MF6A 2RR13 4Y22A 3CBNA 1OXCA 1R093 3LSEA 4YZ3A 4Z07A 3DN7A 2DUQA 5FYVA 4D7YA 2HEVF 3SHRA 1OH4A 1VAKA 2BJSA 2X8KA 2HWB3 4KH9A 4OHVA 5IFTA 4NRQA 5FYTA 5A3TA 1AYN3 1DCSA 2R0HA 4CDWC 3PDQA 3KCCA 4Y1YA 4DRRA 1MZ6A 1GQHA 5JOZA 4QXKA 1PO22 2O1QA 3HIFA 4RQPA 4XOGA 4N7UA 4JTOA 1UMHA 2QQLA 1RUE2 2XJUA 4WZFA 4UWDA 3LA2A 3Q8EA 3ZFEC 4XDQA 3VBUB 4BQ1A 1RUG1 1NOVA 1JYIA 2BRTA 2WDBA 3CZJA 2WC2A 1W9SA 5A80A 5K7PA 1LTEA 1OLMA 3PUQA 2E9QA 3OUHA 2JWPA 4H7MA 2FDKA 4YFWA 1QJX2 2V4AA 2JD4A 5A7PA 5I0DA 1MVEA 3CJIC 3OUJA 1H8TB 1IZ3A 2HWC3 3H1WA 1GQPA 2JDUA 3CF6E 1S1AA 4H7LA 2FDGA 3N3HA 1XYNA 3LQCA 3UGGA 1O3QA 1PX4A 5FO9B 1NA1A 1DGRN 3RS6A 4HPKA 5FAXA 2V5DA 3SH5A 1H4HA 3MIHA 5C33A 1KQRA 5B2GB 2HJIA 3VLBB 4AAXA 2RJKA 4C91A 2R073 4BLIA 3RFRA 4TZDA 3I4IA 3JD72 2VO5A 1FNZA 1HQLA 1US2A 2WLPA 3HT1A 3RYRA 1VMHA 3U1XA 4DB5A 2XVGA 2ZGMA 3NL1A 3POGA 2OKXA 1BCXA 3ZDSA 4NRMA 1NE4A 1AR73 2JG9C 3JXSA 3MFCA 4KWKA 3WT3A 4EN0A 5EZWA 4TTGA 2EICA 3VBOA 1SDWA 5C8WA 3WW2A 3DUIA 2AREA 1N47A 4M4RA 3B7MA 4LK6A 4CU8A 2YYOA 4WVWA 4BXSV 2AZ5A 3BTAA 3GM8A 1V6MA 4LBQB 2RS12 2QQWA 5FYBA 4AEJA 4JV4A 4DY3A 3T0AA 2OQ7A 2YBSA 2WFF3 1DYKA 3E5XA 5CISA 4NVPA 3KGZA 5F39A 3J26N 3ON7A 1ZNPA 5FZ0A 4EN8B 1ALYA 1N3PA 2WQZC 3GNEA 5FLIA 1EY2A 2D7FA 3O1RA 5ABJC 5EQUA 2X10A 4D94A 2NPIA 1XE0A 1W2UA 3AKRA 4OCTA 2WN2A 4DXSA 3KHBA 3OCPA 1K5MC 1VBA3 2ES3A 3KMHA 1LGCA 1QDCA 4Q5OA 5FZEA 3ZN4A 5FMCA 3ZKYA 1AF9A 2R6QA 4LBQA 1Q8OA 3ACHA 3VZNA 3OGRA 5FZDA 2ORZA 1D0GA 5LY2A 1YCIA 1O4YA 2W5FA 3FLPA 5F3CA 3TBDA 2WO3A 2ZBJA 2VM9A 4FFFA 1Z7S1 4ZU5A 3VL8A 1JBCA 3D5OA 1MQTA 1GR3A 4JKLA 4QPWA 1QNYA 3I2KA 1JI6A 1XU2A 3IN9A 4L8QA 2HBTA 2PHRA 1LOGA 5DQ0A 1GZTA 1JXNA 4E2SA 2JDMA 4MVTA 3IAQA 5JXIA 1VBE1 1CZTA 4K1YA 4XTPA 2ZS6B 1GP4A 4JC1A 2R063 2ZOEB 4YZ2A 1NG0A 4KU7A 4XAEA 4KBZA 5FR3A 5GM0A 3PUSA 3ZXAC 5J09A 3C2UA 3RJ2X 4YZ4A 1YNAA 4XBLA 1X50A 1ZZCA 2B42B 2E7TA 5FYHA 2I07B 3ZMOA 4HBNA 5JWPA 5FZOB 2YG0A 1RHI1 3OGVA 5FZ6A 2ZX4A 5IK5A 2RS33 1OPOA 2D93A 4IE0A 3ZN5A 2XQRA 4C0HA 3DKQA 4OUSA 4UT5A 2ZTNA 4M0HA 1WLTA 4DIQA 1X9TA 2AYHA 2VMCA 2GNDA 4LBKA 1MZEA 1DZQA 4K20A 4P08A 1HX6A 4N7IA 1ONAA 4XJUA 3ZLIA 3AZVA 4QKDA 3ITQA 1HRV2 4QM8A 1FPN3 2ZX1A 1H8VA 1B35C 2XMLA 2YGLA 3AYCA 3C3VA 3PU8A 4MX3A 2HWE1 2VQ0A 1YUDA 4A6OA 4AQSA 3WUCA 5FZ3A 5HXMA 4JRAA 1BMV2 2Q8DA 4MLOA 2MPFA 4QXBA 5FY8A 3W5NA 3L2YA 1ZBA3 4HFSA 2W1WA 2A70A 2ZGSA 4PQQA 5FZCA 2Y64A 2ZEZA 1LJ7A 1UZYA 3HNBM 1PO13 3ACLA 1MEC1 3QOPA 5FLJA 1EUUA 1QJEA 3AMMA 3UJOA 4BWOA 1N3OA 5A6ZA 5FCCA 1C5IA 1V6KA 3ORJA 4KWUA 3SLIA 5FIXA 5DMYA 3B5LB 3DPRC 2EXHA 1SG3A 4IDZA 3CU7A 4AFBA 5L7OC 3HR9A 4I09A 4IEPA 2QFEA 2JE9A 3O1VA 4BQ3A 2Z79A 5E16A 5KXDA 1LKNA 2Y6GA 1XNKA 1YFWA 2Y6KA 3HN1A 5EWSA 5DAQA 3WW1A 1O5LA 1MQTC 3LFIA 2W08A 2AC1A 1JYVA 3M2MA 1RMU1 5F5AA 2AENA 2CGNA 1TME3 2PQSA 1JYCA 1LRHA 2W1SA 5AVAA 5T55A 2BOJA 3T1MA 2P37A 3VBRC 5CEHA 2PAMA 5FXWA 2Y38A 4QHBA 3TNQA 1RUF1 4FFHA 3WP5A 4LHNA 5GJ6A 4ZZ8A 3M8LA 1NCRC 4ZZ5A 2Q8CA 2PLV1 3HAGA 2RHPA 2ZX3A 4M3CB 4E4HA 2PHLA 2MHFA 5LWBA 4O9EA 4W50A 4OVEA 1S2KA 1RUE1 2NN8A 2DFBA 3CEWA 3WQ7A 1AR92 2JIJA 1YLLA 1JZ6A 2O8OA 1W9FA 4EN9B 3GZUC 3KGLA 1QGLA 1S0EA 2W39A 1GOGA 4YGEA 1GICA 3N9OA 4WVMA 5FUNA 1TMF3 2QUOA 1LAJA 4CCCA 2DBIA 3LF7A 3LDKA 3RQ0A 4LHKA 3I3BA 1DQ2A 5A6QA 4QU1A 4Q0UA 4AI0A 1MZFA 3AVRA 5H9RA 2XL7A 4CPBD 1T2XA 2DDUA 1LU2A 2OZ6A 4XF9A 1VPHA 1HXS1 4C8DA 2VCMA 2XJTA 1W39A 1LCLA 2TNFA 3PJYA 1W0OA 1J3RA 1RUH3 4QB1A 2XG3A 1JS9A 1R1A1 1SPPA 2ILMA 3RZKA 4LBLA 1XBFA 4Y5Z0 3I49A 4R52A 1UPIA 3UGFA 1ND3C 1C5HA 3ACGA 1X36A 2WNUA 3UL2A 1XJAA 5AC91 1CWPA 5A7QA 2ENRA 4JKMA 4PI0A 1U0AA 4NUBA 1ZRDA 1PGW2 3AP6A 3FMGA 5JSOA 1UPSA 3IBMA 3MUY1 2GN3A 4CP9A 4CDQB 3ZXDA 3FJSA 4IXLA 4YW1A 1N3QA 1D4M2 4LUMA 4BB3A 2ID4A 1WLCA 1AHSA 1OH3A 1E5HA 1LOCA 1ENSA 2BWAA 3DPRA 3NVCA 4GMP1 4Y1ZA 4C1WA 5BNPC 1TEIA 3FFZA 4YM3A 2VMGA 1D4VB 3VD5A 3I2FA 2FZ2A 4OZOA 4YPJA 4XFFA 1GWKA 2MEV1 3KS7A 2OUJA 3DYOA 4QQHA 5DAXA 3THCA 2VZ3A 2Y6JA 3AMQA 3NQHA 1S0IA 2R042 2WNVB 4UW4A 1OUXA 5JSRA 5E88A 4UW5A 4FOVA 4RQPC 4CSWA 4LNVA 5CFCC 3IPVB 1XQNA 1C8M2 3FN9A 4GWJA 5IUQA 1GNYA 3ABZA 2QQMA 2E7AA 1W03A 1W8OA 1RUD2 4YW3A 3TAYA 3ZFEA 4HK9A 1Q8PA 3NSTA 4AVVA 4PIXA 1RHI2 4XZUG 4KI5M 4CDWB 3NMBA 1ULGA 1IG0A 1YC61 3KHCA 3KVAA 2WQ8A 4GB31 2X53S 4QAWA 4JTNA 4XHBA 3MV01 1YFUA 2JG8C 4IETA 5FRAA 2Y8KA 1FMD3 2K9ZA 2VMHA 4RS5A 4YVWB 3VHOA 5IT6A 2B39A 2JEMA 3B00A 4GQ7A 2JDPA 4AE2A 4QT6A 4L97A 1NY72 1JW6A 2ZMLA 5J98B 4QKBA 3PTYA 3RG0A 2WSVA 3U4SA 3BUCA 1LGBA 3HWJA 3ZFEB 1KJLA 1W28A 4FOYA 2BNNA 4CRQA 5CU1A 3OPWA 2B8MA 4RGKA 1QMJA 1I5ZA 4E4SA 3P1IA 1QHDA 4B29A 5A7OA 3PIJA 1FPN2 1QJFA 4RN5A 1TMF2 3T08A 3APBA 5ISLA 1GLHA 2VMIA 5LBCA 1KEXA 1TNFA 5C6CA 1QXRA 2L9LA 4ORFA 1RUF3 5BNOB 1DU3D 1YHFA 1YI7A 1H8TC 2FBEA 3M1HA 2BPA2 5IW0A 4AR2A 3K46A 1TNRA 3J7LA 3UK9A 5FZMA 4MADA 2WNUC 5EYYA 1UOFA 2DFCA 3FZ3A 3B69A 5JXJA 2RR12 4BK5A 4CVUA 1LGNA 3M4FA 3P6BA 4AI8A 2AEZA 2E6VA 2IXJA 2VQAA 5FTTC 3MPPG 4Q4W3 3IMMA 4P00B 2A3WA 2G1MA 4CU7A 2YPDA 1IHMA 5EXOA 2VBPA 1U12A 3LEMA 1QKQA 3N9MA 4QQOA 2VUAA 2XJSA 2ZGRA 3KSCA 3WV6A 2XJQA 4RFT0 1KS5A 2NLRA 3SQOA 2K46A 4KMQA 1Q8QA 3BOWA 2B7YA 2JG9B 4QU2A 3RPQA 1MEC3 4COZA 4P9IA 1IPJA 1BMV1 2DVDA 2H0BA 1AR82 1FV2A 1W6NB 4HVRA 1CVNA 2ZPXA 4LLOA 1LEDA 2B9VA 2C26A 2FD8A 2JKBA 4BA6A 1OVSA 4LE3A 4HVOA 1WBLA 3SH4A 4PF5A 4Y4RA 1TG7A 4GD4A 4UFJA 1D7PM 2RMU3 2E33A 1NCQC 2RG4A 4AEDA 2A3XA 3ZXEA 3MLLA 4CCJA 4RGAA 2D44A 5JUVA 3V0AB 4MHUA 1ULFA 5I0TA 4Q4W1 1CR7A 4XILA 2WAOA 5GLVA 4CDUC 3CQOA 4CUGA 2WYSA 4QMAA 5AC93 1LECA 1PK6C 3C8XA 3JUUA 1YQ8A 4QHOA 2UWBA 4QDRA 4R9BA 1PMHX 3TEYA 3H9AA 3USSA 2VULA 4WVMB 1RUD3 4QDSA 5GKAC 1W8UA 4QM9A 5C4WC 5FWJA 1N1VA 4K40A 1QXPA 2C9KA 3V65A 4XUQA 4PHZA 4CEYB 2HWB2 3KWVA 1AL21 1UY4A 1GKBA 4FPYA 1RUJ3 2Q5TA 2VAUA 1OQ1A 1EV11 5KHGA 3V0AA 3LCPA 2XBO1 2YFZA 2NP0A 2EIBA 1QH7A 2GH8A 3DEMA 1RUJ1 5IJRA 4XJZA 4CPBA 4D7SA 1GQGA 5D1IA 4HONA 4BOWA 4AHZA 2HYKA 2UYAA 1AR72 4PIYA 3ROUA 5JZGA 2WT1A 3MIGA 4RHV3 2B4KA 1XE7A 4IGOA 1QJU2 2CU5A 5I91A 2BP6A 4XDPA 2J42A 4MGKE 2VZSA 4NO4A 1E5IA 4P9XA 4XYXA 3HNMA 2X5IC 3MIEA 3DYPA 3NJVA 1DGLA 1B35A 4COUA 4JGZA 4JQRA 1F4HA 4GB33 1UXXX 3C7OA 2R32A 3RZLA 2PHXA 2J7MA 1DGWX 5BXXA 4YVSC 3RZGA 3J7MA 4A42A 5HCBA 1SLLA 4DZGA 4DUWA 3U75A 4CXXA 3POBA 5IAVA 1QJY2 2Y33A 3MW2A 3WF3A 5A3MA 1NZIA 1RMU3 4XIOA 4LEJA 5FZLA 1W0PA 2NMNA 5LB6A 3N7LA 4NHLA 4QX0A 1LESA 5J1XA 4JAAA 3UT0A 1N1TA 2UWCA 1TE1B 2CGPA 1IS5A 2HWF3 2VZTA 5F2WA 2DTWA 4AF9A 1SACA 3R0RA 4OHWA 1XE8A 1UYYA 2NZ9A 1VBD3 1EAH3 2PHDA 2VVDA 4Y33A 5B4XA 3FFQA 4DY5A 4K9SA 3DXUA 4QQ2A 4Y20B 4CEWB 1KXGA 1Y9QA 1RB8G 3M3EA 4IE5A 3AK0A 1GUIA 2GMMA 3AMHA 3VBFA 4F3JA 1KS4A 5T5OA 1XNAA 3ZFGC 4BIOA 4JZRA 4AGGA 3MW4A 5DUUA 1QJY3 3H42B 1UO9A 1CIYA 1GV9A 2NYYA 3PMEA 3TEXA 4CUAA 1TQ5A 2R071 5FY7A 1JU3A 4XTMA 5JOWA 4Y20A 5C4WA 5GZFA 1R1A3 4ONUA 1FNYA 1VB4A 4OFGA 4D6RA 4Q0SA 4HN0A 4E27A 4RHV2 1HXS3 3WINE 4A7ZA 3LGRA 1MQTB 1RXFA 2BBAA 2EIGA 3I2IA 4IL7A 4JHTA 5EP9A 5HV4A 3IAPA 5KBFA 1SLTA 5CFDA 4ATEA 4OUEA 1WMXA 3IIAA 2W47A 1RGSA 1D0HA 4MYEA 3ILNA 4E2GA 4R9DA 1DG6A 3ACIA 3GHMA 3JBG1 5CIRA 5FKBA 1QJZA 5JZGC 4QX2A 3NNMA 4ZPIA 1NLQA 1U5IA 1WMFA 4A2UA 1U5XA 2QJVA 3I97A 4BISA 5C9AC 5BYNA 4WV8A 3BGAA 2D98A 1W9WA 3J9SA 1YWKA 1ENRA 1PM4A 5FDBA 5F9TA 5L19A 5DDJ3 3A0KA 1ND3A 3WG1A 1WW5A 3MLKA 3D8CA 3VHPA 2B5HA 1HV1A 2Y6FA 3AP9A 4XUNA 1I5PA 5LY1A 1TME1 2ZCWA 1OC1A 1RUI2 1WCSA 4BLJA 1FT9A 2C0ZA 2UYBA 3LDBA 5KXCA 3NJXA 2FHRA 2RJLA 2LTNA 4DINB 1WD3A 3IMNA 5HBAA 2ZMNA 5FY0A 4BIFA 3ELNA 1OT5A 1SFNA 4D3WA 1E5RA 5LBBA 1VBA1 1J83A 3H0OA 3K2OA 1POV0 3CJIB 2XHKA 1EP0A 2O14A 4CDXB 3ZXKA 4FPJA 2DCYA 1YFXA 5DZGA 2ZX0A 4B4QA 4XPVA 3ZR5A 5FYMA 1QQP3 4UF0B 3OGGA 5ABJA 2Y0IA 2LRPA 4TSVA 3D4KA 2W9XA 2VW0A 5A32B 1VRH3 2JDHA 3A0NA 1NAEA 3VZOA 2GNMA 2X05A 3OTFA 3WG4A 5A3NA 1VAMA 5FYUA 1HQNA 3PLQA 5JR7B 2PYTA 3ZSLA 5BNPB 1GZWB 5FY4A 2JB8A 2WINB 3WF4A 4CYDA 1I6XA 1O3SA 5FZIA 4YGDA 5I8TA 2W3JA 1BJQA 4IV1A 5JR2A 4ATFA 3IKWA 2OXBA 1W6PB 4F8AA 3TRSB 1AYM2 1CQ9A 2WLQA 5FZ9A 3FE5A 5J3UA 3HOBA 4HXCA 3WP3A 1RUNA 1UCXA 5BNQA 5CA6A 5CFCB 2ZJCA 4GXLA 1EPWA 2CWSA 1UYZA 1POV3 5FPBA 3LKJA 3N7MA 2JJ6A 2ZGQA 3KV4A 1JH5A 4XFBA 1DLCA 1RUOA 1SCSA 3AM2A 1PVC1 2OQ6A 4X8PA 3MLJA 3T2PA 2FCTA 4YG6A 3WNLA 4E4DX 4FAGA 1GYKA 2D6KA 3O1UA 1LB2A 3VHRA 1SFYA 1W6PA 2OUHA 2YC0A 2VQTA 3ZYGA 3CL1A 4LE4A 1VLNA 1XYOA 4CZSA 5FLHA 5CBLA 1ZZ6A 4KNCA 4CCDA 4KG8A 4DEQA 1WLDA 2F4LA 3ACFA 4HMZA 2VMFA 4W65A 3HBKA 4Y24A 1H6YA 5C70A 4XURA 3ZMNA 1IS4A 1K5MB 1U5ZA 3IDAA 4IW3A 2EA7A 4FTEA 4UI9L 3N7JA 4GH4A 3EXUA 1VBC3 2P3YA 2VNGA 4LBJA 4QGMA 1VBD1 2ZHKA 4IQPA 3THTA 4CUCA 4ISQA 1UAIA 2RS51 2GNBA 2VMEA 4LBQD 1IS6A 3O1SA 1WW7A 4IEVA 1IPSA 1Z7S3 4TXWA 5A7WA 2Z5WA 1JTZX 1BBT1 5ANNA 3WQ0A 4XFIA 1OD5A 2QQOA 3EMRA 3MZHA 1YJKA 1RUG2 1ULEA 3UKTA 5FXZA 4CEWA 2WNUB 4FQZA 3WF0A 2HLEA 1RL3A 2GC3A 2YZ4A 3B94A 3SKJE 1YO8A 4TN7A 3H7JA 5LK5A 4AEMA 3OUIA 2LROA 4Y5SA 2IXCA 4N43B 1ZBE2 2YV8A 1E5SA 5GLWA 4ZS2A 2IXIA 1OLQA 3O0VA 2G9FA 4K1ZA 1ZZ9A 3OB8A 4ZXEA 3KLSA 1UKRA 3KB5A 3PU3A 2NMOA 3M70A 1LHOA 1OFSA 2HWD1 4AG4A 5L9RA 1ND2C 1REFA 5DAVA 2F4PA 1DHKB 5F8PA 5A7SA 3CNAA 1K42A 1OQEA 4OZXA 4IE7A 2DURA 2UY8A 3JBG3 1OKQA 2SBAA 4QQLA 4OI1A 2VECA 4FXKB 5DG2A 1PZ9A 2B9UA 1RUJ2 1EV13 3MBWA 3TOJA 4CP2A 5FZOA 3N9NA 4UFIA 3VBRA 4DO0A 4K8FA 2ZX2A 4O65A 1QH6A 4EWDA 1UMZA 5JCTA 3IZOA 3ZSKA 4AVCA 4UAPA 4Y26A 4MXWB 1LOEA 2EVXA 3H7YA 5IVYA 1F4AA 5EV7A 3VBUC 3WNKA 2W87A 3GGLA 3GYDA 3SEPA 5FOJB 4Q8LA 1UF2C 3HJRA 3LZZA 2YY1A 3SCFA 4AI9A 1DDLA 5T5LA 3H3ZA 5G05L 1NQDA 3UV9A 2J1AA 4ES9A 3ETPA 2KA3A 3J8F2 2E26A 3POIA 5LASA 3O14A 4Q1RA 3WCSA 3BI3A 1PIV1 3LE0A 4XFGA 1ZA7A 3RGBA 1GBGA 4U36A 4N90A 1ND3B 2GC2A 2WFPA 1ACCA 3E6BA 3LDRA 1RTVA 5A6YA 3MFAA 3MO4A 2J1UA 1QQP1 4QPGA 1AR83 3TN93 3EB7A 3ZXGA 4GWIA 1XB9A 5CYYA 1RC6A 3ZN6B 3NV2A 1LOAA 3HD8B 3I59A 4B7KA 5ACA3 4XF1A 2I45A 3N9LA 1RUC1 3RRDA 4KWJA 4L11A 4UBGA 5HCHA 2ZGKA 1OURA 5SV8A 1LHUA 1DQ4A 2E63A 1MS4A 3OG2A 5A1LA 4K6BA 1QJU3 1KFXL 5DZFA 4O9GA 2DCTA 2XPJA 3AP4A 1XYPA 1BK0A 2XH6A 4XJ9A 3DCQA 1W2NA 4Q4X3 4XAAA 4X6RB 3X29B 5F5QA 5FZ4A 4LKEA 2WABA 2OA2A 1QJX3 4MH0E 5EHDA 4COWA 4BHPA 4NAOA 5IVJA 2WYFA 4AQ2A 1AYN1 1JZ4A 4P5YA 3IT8A 1XRUA 2Z2SB 5JDBA 2LUWA 5LBFA 4RFRB 4IERA 1EPZA 1FXZA 1R091 5DPNA 1OVPA 3BB6A 5A3PA 2W92A 1O4ZA 1RUC3 2E51A 3WD5A 4CCKA 2BGOA 4FTSA 3K51A 1AR81 3M3IA 5CFCA 4YGCA 4V2WA 4JHZA 2CYFA 1AR71 4QHZA 5I93A 4IE6A 1LULA 3B02A 3LEIA 2VGDA 4V2VA 5A3OA 2WZPP 4DUXA 3AB0A 3NAPB 5ANQA 1HRV3 1PIV3 1UX6A 2WAAA 2I74A 2O8QA 4LR4A 2ZABA 4P9LA 3BTYA 3GJBA 3MICA 4NJ4A 4EN6B 4ZONA 5FZGA 1FMD2 4UYBA 4B3NA 2PAEA 1G6NA 1IOAA 3P5BA 1J59A 5IVVA 4JGYB 5FK8A 1ZRRA 3KT7A 2IXHA 5CFDC 2VVFA 1GSLA 4FO9A 4Q27A 2RS52 2VZ1A 3PHMA 3FBMA 1VJ2A 4LA2A 4A41A 2XLGA 2JDYA 3PURA 4Y22B 4E9KA 4FAHA 4Q0PA 2CSGA 3FHQA 3CHXA 3OBTA 3ZYPA 4XF3A 3KCXA 4A7YA 1QF3A 1YQ6A 1ZA4A 5KWRA 1SLAA 1RUI1 3GCWA 2W46A 3F95A 1JU4A 2BYVE 3AC0A 3OSDA 4AAPA 4OI0A 5JI9A 4AHXA 2XBO2 1GNZA 2BFUS 2JE8A 2OW4A 2RM21 1APNA 1W2OA 2VZPA 5GZDA 3WDWA 2EF6A 3ME2A 3VDDC 2ETEA 4BZ4A 1X8EA 2XVKA 4Q4Y2 1HXS2 4I02A 3IM0A 5JZGB 2QBXA 3U37A 1YRZA 2HWC2 3CJXA 4MGYE 4E8CA 3W9AA 1OA3A 1VBB3 4XDOA 1WA4A 4BJ0A 1GFF2
chains in the Genus database with same CATH topology
2A5ZA 5JI7A 1RJ8A 1VBC2 1XNCA 3RYPA 5HCFA 4LBNA 2PA7A 4CDWA 1QWRA 1SEFA 3B9IA 3I2DA 1LOFA 3WNXA 1HLCA 4NOTA 3O12A 1BEV2 2Q8OA 3SCGA 4NHMA 3UKVA 4CEYA 5FMOL 2WFF2 2RM23 1CN1A 1PK6B 2DUOA 2V73A 1AXKA 3VN4A 4EV0A 1PO23 4JRLA 3KT1A 1BK1A 1PVC2 4YSFA 2ZGOA 4COYA 2P3KA 1QOSA 3RI8A 1Q3EA 2D3RA 4AEDC 4YZ1A 4B4PA 4HVQA 2Q1MA 4FCAA 2RE9A 2XKOA 3VZMA 1RUD1 3ZFFB 1UU5A 4IEWA 1RJ7A 3H1YA 4Q4Y3 3WR0A 1DZTA 2R16A 1ZRCA 5DXDA 3D0SA 3ES4A 4A7KA 2OPKA 4OUMA 1IKPA 2WZR3 2LM3A 4Z92B 1NCRB 4RL7A 2DCZA 2WA4A 4XHXA 5T5JA 3D0JA 1V6OA 3LA3A 1S2BA 5BNNA 1W6OA 4RS5B 1CESA 4YVWA 4FP2A 5I8YA 4JVAA 2DCKA 3KCYA 2XB6C 3VDDA 3NWKA 1DQ0A 3BOPA 3RNSA 4KU8A 3WX5A 1UU6A 3ZIWA 2MEV3 1ZX5A 3O7OA 4LO8A 2JG9A 2VW1A 1FX5A 3P3NA 3VBSC 1X33A 3VBFB 1ZZ8A 2DV9A 3KM5A 2AGSA 1O7FA 4IESA 1Z0HA 1SMVA 3AKSA 1S0CA 3IDEA 3POSA 3RYKA 2FMYA 4CEWC 4Z2WA 5KHKA 1IKQA 1AYM1 2D6LX 1DF0A 3WG2A 1VBE2 2WSUA 4TYSA 2GMEA 1LOFC 2XL9A 4G3YC 2OZJA 1HV0A 4LTAA 5GLTA 4IEQA 2VU9A 2A6XA 3POWA 3V64A 1EYBA 3S30A 4Y1XA 2YXSA 3FC0A 1BVP1 4OULA 4Z8BA 1KITA 1ZRFA 3SMHA 4GWMA 1PZ8A 1U5YA 5FPXA 4YRDA 1DIWA 3V56A 1CAXB 3RJRA 1DZRA 3ZSEA 4YYOA 2BNMA 5D8AA 4Q1PA 5FBZA 4Q29A 2E53A 2XBO3 5GZEA 2PHTA 1OMIA 3FX3A 1PZ7A 3SISA 5KHJA 3VL9A 3ZXJA 3KT4A 4YVSB 3GF6A 5I8SA 4Q4W2 1CAWB 4IV3C 3DL3A 3ENRA 3MYXA 4IV1B 3OF1A 1VBE3 4XMAA 1ND2B 4PLMA 3VBUA 1ZREA 3VV1A 4HSLA 4R4ZA 4QGLA 1A8MA 4Q0VA 3AZWA 4JGZB 2A6WA 1RINA 4FPEA 5T5PA 4YVWC 4M01A 5FO7B 3NW4A 1EAH2 3AX4A 1CAWA 4EN7B 2ZKNA 4H14A 4W6YA 3JZVA 4UW6A 5L36A 2R1BA 1DGRA 5DDJ2 3VBSA 3FHIB 2WS92 3ZFGB 5LRSA 5BY5A 5F6KA 1WW6A 4XJWA 1RMU2 2W68A 4DS0A 4SLIA 2ZGLA 2QNKA 3GZTB 1LOBA 4FPOB 2DVGA 3LB9A 3NJZA 1PO21 3QCWA 5T3NA 3WDVA 2D40A 3BODA 4Q4X2 4RSUA 2XKPA 2WS91 1UL9A 3ZPYA 5FO8B 2IXLA 3PJQA 1C3HA 2ZAHA 2BBVA 3QACA 1DYPA 5GLZA 3J4UH 3RDIA 1Y43B 1QOTA 3MI8A 1PNFA 4F83A 5D8AC 4AXOA 5AFEA 3S7EA 1MS8A 1C4RA 2ZZJA 4HPKB 3ST7A 4K7JA 1IGOA 1L3JA 1CAVA 4LO6B 1OA4A 2VNOA 1KDKA 4XJ8A 1R1ZA 3AMPA 2CAUA 5JOXA 3AKTA 1YJLA 1H30A 4B7EA 3GALA 1PVC3 3T1LA 4ES8A 1HRI2 1HIXA 4JDMA 1AL0G 1AL23 2VY0A 5DG1A 4Y1VA 1A3KA 3R4UA 4CDQA 1V9U2 4GMP0 1F2NA 4DOUA 1D2SA 1PMIA 1R083 3VHNA 4FTBA 1J58A 4J1WA 3PVNA 4K21A 4P14A 5JPMB 4FOWA 1J1TA 3T2TA 2ZGUA 5LRRA 1VBB1 1VRH1 1FAYA 1R092 2ATFA 3U10A 4KBBA 1ZM1A 4GH4C 3KQRA 4M0NA 1HKDA 1F9KA 3FWEA 2RR11 3OJBA 4I01A 2ZMKA 4MZUA 1VB2A 3CO2A 3M7AA 3WDTA 3ZN6A 1O3TA 1WCKA 2PQQA 2YROA 4N43C 2X5IB 3OPZA 1QDOA 4F7ZA 2F6BA 4N9IA 5BNPA 1OOPA 1UKGA 5H9QA 2OIIA 1I1EA 3VZJA 2CL2A 2NM1A 2XGXA 1CX4A 4YM2A 3OY8A 3NV4A 4BE3A 1QY4A 2YGMA 4AHYA 1S0FA 1D2QA 4WBBA 1C1FA 4IEOA 1DLLA 4L92A 2BVVA 4HSJA 1BQPA 3ZSJA 2EXKA 5T52A 2D6MA 1FI2A 5DUXA 1ND2A 1PIV2 2Y0OA 4I2OA 4LO4B 1Q8VA 2PAKA 3ZVXA 1I9RA 2ZAAA 5I0UA 5K0UB 2B45X 4S2DA 4BMEA 2K2SA 3LWCA 4MUVA 5K9YA 4R9CA 3PVOA 3AKPA 4W6XA 4QPIC 3CLPA 1SQ4A 4AI1A 5FREA 3VKOA 4G4FA 1WGPA 1C8NA 1CONA 1FMD1 2ZA9A 4GALA 5GZGA 3VKFC 3LSDA 1MS1A 1WW4A 2D3SA 1BYHA 2JENA 5FOBB 3WXPA 1BXHA 2RS32 5K0UA 1W6NA 1H2MA 4JDOA 4KGQA 4YARA 4N9HA 3FLTA 4LHLA 3ZYJB 3WLUA 2VW2A 1AVBA 3VZLA 3VUOA 1PVXA 2Q4SA 1WUVA 1ZBE3 1BKZA 1G8WA 2QDNA 2YUEA 2ZHMA 4DFSA 4AQTA 3VGIA 1IPKA 4N43A 3ZO0B 4H55A 4AFAA 4EWAA 5BUVA 3RSJA 1MVQA 1G9BA 2BQPA 2K0GA 4AWDA 4WM7B 2PFWA 2R0FA 2ZACA 2HWD3 1PNGA 3MGUA 2C9AA 4RGGA 2Q30A 4YG0A 1IS3A 3WCRA 1REDA 1BZWA 1Q8SA 4I0AA 1LR5A 2WZR1 2XVLA 2VOVA 1EV12 2MEV2 4MGIE 1H4GA 4WM8B 4AVTA 4WM7A 4YW5A 3U11A 1NCQA 1RUH1 3NV1A 4C1XA 5DZEA 4EJRA 4CTEA 4J1XA 3JCIA 1ULDA 4JGYC 5C8CC 1AR91 2AUYA 4XQ4A 1FATA 2WNVA 1S0JA 4AFMA 1PK6A 2HWD2 2RS13 4BPZA 2C1FA 2O0OA 2WWSA 1ZYBA 2WZR2 5F1RA 4GB32 2R041 1F31A 2GZWA 2A71A 3ILFA 2WL1A 4QPGB 3I7DA 3NKGA 3B9CA 4AEKA 4META 4LO7A 1XNBA 1HW5A 4N53A 1RUG3 2HEWF 1X8MA 5CG8A 2I2SA 3ALQA 4PDWB 2SLIA 4XMIA 4AGRA 1Q5OA 1V6JA 1JUHA 1UW8A 2EAKA 4WZCA 4Y1UA 2WKKA 1OI6A 4XBNA 3FLRA 2BNOA 4MXWA 4BCUA 1YYNA 1POV1 1W6QB 2G4IA 2WNEA 2GSYA 3E97A 5I0RA 4JGZC 3POYA 3S6PA 1D4M1 3MIDA 3RMYA 1PGL2 1Q43A 3ZX7A 4I3PA 3P3PA 2WS93 3WHUA 1A8DA 5IK8A 1DQ6A 3VBHB 3Q9OA 3MIFA 3WG3A 1AJKA 2UURA 4HT1T 1ENXA 3MF9A 5L7OA 3PVBB 2PHUA 2HWF2 4HKWA 4HZFA 5J96B 2EALA 2JX9A 2ZHLA 4PBPA 1NQJA 4Z1VA 4EROA 1LODA 2YPJA 4YNIA 2XLFA 3G7DA 1CJDA 4L2NA 4AVBA 4S2FA 5K8SA 1G9AA 1RUC2 1S0DA 3VKMA 2C5DA 3AFGA 4JGYA 3AFKA 3R4DB 2GC0A 4U2AA 1PGSA 3WDXA 1HRV1 2GMPA 2MNGA 4HETA 1MS3A 2HWE2 2RS31 4B4RA 3ZYIB 1QQP2 2IWGB 1C57A 4B8EA 5ACA2 4URTA 3TN91 4ASMB 4AYUA 4D7TA 2H6BA 3W58A 3WDYA 4NWWA 1XNDA 3AP5A 5HI0A 3AZZA 2A6VA 1AXYA 3AYDA 3UJQA 1RIRA 4ZU7A 2D3PA 1RUF2 3H8UA 4LBOA 3IWZA 2BVBA 4AFCA 1G86A 4OHXA 1QJX1 4QQPA 1LHWA 1PHMA 3TWIA 1G9DA 4WVZA 3BIWE 1O91A 2AR6A 2H0VA 2VVEA 3O0XA 4Q4X1 1F8VA 1KFUL 3SNMA 5ABJB 1OPMA 2E7QA 5C9AA 3AKQA 5H9PA 4AK3A 1QJU1 4XFAA 1V9U3 1WMDA 2TBVA 2HWB1 4FPKA 4YW2A 2XWBB 2D5FA 2GU9A 2ET1A 4G9SB 4BYYA 3USUB 2HKXA 5CADA 4AEDB 2VOXA 4CP0A 2VNRA 5DDJ1 4I30A 1OA2A 3ATGA 2DYCA 3OD0A 1OOPC 3ZFFC 3ECQA 1MS5A 1FYUA 2XUMA 3WUDA 1C8M3 2D97A 3AP7A 1OQDA 1VR3A 3O5SA 1EAH1 1H1AA 2V09A 3ETQA 4INDA 4DPNA 3INAA 2BTVC 1T6GC 3ZYRA 1XU1A 2VOWA 1O3RA 2PHFA 2FMDA 1V9U1 1ASJ2 1ZBE1 4HK8A 1D4M3 2JG8A 2BEOA 4RS5C 1HDKA 3WDUA 2XJVA 4J6GA 4IV3B 1FOD1 4IV1C 1Z78A 2Q0AA 1VIWB 2RS53 3V0BB 3EQEA 2NQYA 5E8AA 1RVF2 5BPXA 3RMXA 1VBC1 3GBWA 4N53B 4DXZA 3S0MA 5BNNB 4PJYA 2RM22 1OFNA 2OVUA 3QBQA 1WBFA 3ZXFA 1B35B 4OHYA 1AR63 1SBFA 4QPIA 3U07A 1Z7S2 1ASJ1 1H9PA 4MSVA 1UZZA 2IC1A 3ES1A 1BEV1 1ZBA2 3NKTA 4IV3A 2ZKLA 3NAPC 4WVVA 4L99A 4NR1A 2YHJA 1DBNA 2ZGNA 3SXWA 3WHTA 1W6QA 1RVF1 1UIJA 2A73B 2YMZA 3RWNA 1HRI1 4AGVA 5K0UC 1C28A 2RS11 2PELA 1AUYA 4NWVA 5CFDB 2UU8A 4HLTA 2HWF1 4CP1A 2DU1A 3MW3A 1AR93 1A78A 2WIIB 2P17A 2UWAA 2AH2A 3N36A 4X6QB 4YLZA 2GN7A 4DQAA 4KG0A 4FXGB 5CG9A 2D6OX 3R05A 4HN1A 2IXKA 4Q4V1 2P3IA 1HQWA 3DKWA 5DUWA 5CNAA 3VBOB 3AYAA 2D43A 4XFHA 5BNOA 5CB7A 1PO11 1CAUA 2DUPA 3QD6A 1NY71 3VDDB 1RITA 5DUVA 5D8AB 4RHV1 2YDEA 4FPHA 3RZZA 4XFCA 4RR3A 2FZ1A 5EFUA 4R8HA 4I0BA 4HKLA 3ZXLA 1FPN1 5GZCA 1WLWA 4WM7C 4K3UA 1PM7A 4YW4A 2D6PA 1CAUB 2CGOA 4PLNA 3TNPB 1PO12 4AQ6A 4PLOA 5C8CA 4ZXKA 5J7MA 4LLFA 1JUIA 4OI4A 1VBA2 4XE9A 1KRIA 3TYJA 2LALA 1I3HA 1NA1C 2KM2A 2DU0A 2JDZA 5JIUA 1GZWA 3EJKA 4XF4A 2JE7A 2XLAA 3KD4A 4X8NA 2WT0A 4QGNA 1J3QA 1S0GA 4TWTA 1W6MA 5JMCA 4GA9A 5C8CB 2XWJB 4XJAA 5HXVA 4OLLA 1H1MA 3WZ1A 4CDQC 1N1YA 5FQ0B 4ZKTB 1LHNA 1IQAA 2N7GA 1QU0A 3HT2A 1WCDJ 5E89A 4XF0A 3WW3A 3AXEA 4QPGC 2Z69A 3VZKA 3MDPA 1GFF2 1QNWA 2BFUL 2Q1ZB 4P9JA 3OY8B 3AJYA 1LENA 1X82A 4Q4V3 2WQ4A 1CPMA 5A32A 4IEUA 3JD71 4LBMA 1MS0A 2CWMA 3FUQA 2IFWA 1G9FA 4YGBA 4COVA 3S7IA 3QH7A 5JVVA 4MXVA 1Q56A 5IK4A 3M3OA 4HKOA 2JXAA 4NHKA 1BBT2 1NZCA 1QXJA 2A75A 3AZYA 1CPNA 2QZ2A 3WQ1A 4MGZE 1KJRA 5J37A 4LULA 3OYWB 4RR3C 3D82A 4NPRA 4OI2A 3VBSB 1VAVA 3VBFC 4SBVA 3ZFGA 1PGW1 4TLFA 1VBD2 2A6YA 3R6SA 2QQPA 2PLV2 3H3UA 1HRI3 3B93A 3PNAA 2GH2A 1ENQA 1NXMA 2DCJA 4IEZA 4KWLA 4GMP3 3PVEA 3HMYA 4GKXA 4FQ4A 2G9GA 4MV2A 3OYWA 2R1DA 3LAGA 4KGGA 1AL22 1DGWA 2FQPA 1YXWA 2D6NA 5J48A 4QPIB 1V70A 3I8TA 2DF7A 3B01A 1KD7A 4AVAA 4AFDA 1QJY1 2CY6A 3SITA 5KXEA 2A6ZA 3GBFA 4GH4B 4AI3A 4Q4Y1 4XBQA 1SLIA 3B3QE 4FPGA 1COV2 3QH6A 3URFA 4M3CA 4YM1A 1SBDA 2GAUA 2VH9A 4ISRA 2R043 3VBRB 5LK7B 2W52A 1CGPA 2R072 4AVSA 2BW8A 3FUOA 4PQ9A 4XEZA 2QZ3A 4UXAA 5CAZA 1SCRA 4UBHA 3FBYA 1ULCA 4PCRA 2VXRA 3BU7A 4E2QA 1COV3 1C8M1 4R9AA 2QDRA 2GDFA 1MZ5A 4DMIA 1S0BA 4HL0A 3LOIA 3SCHA 2VPVA 2ZZQA 1DQ1A 1H2KA 5GALA 2BGCA 3J8F3 3WP6A 4WM8A 3QLQA 3N4MA 2ARXA 1G7YA 5L73A 3J8F1 5A33A 3ZSMA 4LT5A 1C1LA 1MR5A 1RUH2 1F5FA 3I59B 2H6CA 2XJRA 5FPZA 1BBT3 4AI2A 2TEPA 4L9BA 1AXZA 4P9YA 3JQXA 4I3GA 1FOD2 4PBOA 1O5UA 4NN0A 4BMBA 3IDBB 2ET7A 3DPRB 5KC6A 4H3WA 3JBG2 3N35A 1MEC2 3DV8A 1AYN2 3GHNA 2CTVA 1VBB2 1ZZBA 5L7OB 1RVF3 2GNTA 5JIAA 3K