1WLDA

Congerin ii t88i single mutant
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
134
structure length
134
Chain Sequence
b'DRAEVRNIPFKLGMYLTVGGVVNSNATRFSINVGESTDSIAMHMDHRFSYGADQNVLVLNSLVHNVGWQQEERSKKFPFTKGDHFQITITFDTHTFYIQLSNGETVEFPNRNKDAAFNLIYLAGDARLTFVRLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CONGERIN II
publication title In vitro evolutionary thermostabilization of congerin II: a limited reproduction of natural protein evolution by artificial selection pressure
pubmed doi rcsb
source organism Conger myriaster
molecule tags Sugar binding protein
total genus 30
structure length 134
sequence length 134
ec nomenclature
pdb deposition date 2004-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00337 Gal-bind_lectin Galactoside-binding lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1wldA00
1WW7A 1CJPA 3MPPG 3POWA 1CQ9A 4YGBA 1V00A 1LECA 3I8TA 4AGVA 1DIWA 3AZZA 2EXJA 2HYKA 2W08A 1G9AA 4XE9A 1GNZA 1AF9A 3AP4A 1RITA 1VLNA 1IKPA 2D43A 5DG1A 5KXDA 1IKQA 1DQ2A 2SBAA 2UWBA 4Y1UA 4BPZA 1QOTA 1X50A 3AYCA 1KQRA 3AJYA 4I30A 5KXBA 5H9QA 2V5YA 3VKOA 3VV1A 1LHOA 2PHRA 1ULGA 1JBCA 1VIWB 2WNEA 3OJBA 2BQPA 3WHUA 2NYYA 5DZGA 4BQ1A 3V0AB 1DBNA 3OYWB 1DQ1A 1MS9A 1CPNA 1FATA 4MYEA 3D5OA 1SLIA 2ZGSA 4YW4A 1GZWB 4LBNA 1WD3A 1JYCA 3SH4A 2ZBJA 4WZFA 1VAVA 2EF6A 4AYUA 1G7YA 1W6QB 2GDFA 4TZDA 1LHWA 5DUXA 5GZGA 5JOXA 2ZMKA 2NM1A 4K1ZA 1ENSA 2E51A 1MS1A 2PELA 3N35A 4U2AA 1WD4A 4FPLA 3V65A 4YM3A 3UJQA 3BIWE 2ARXA 4LBKA 4Y1XA 1N1SA 5T50A 4JRAA 3INAA 4YFZA 2DU0A 2DUQA 4PF5A 4R9BA 1GZ9A 3WG3A 4LBQD 3ZSLA 3ILRA 1YO8A 5T5JA 3GNEA 4R9AA 3FUQA 4XJ9A 2DYCA 3AZXA 3LCPA 2AREA 1AX1A 2D3RA 1WLCA 2DVGA 5GZEA 4M3CF 3U4XA 3V0BB 4CRQA 2EALA 1ULFA 2VW2A 4YG3A 2D7FA 2UU8A 1UAIA 3ZSMA 3ILNA 1SACA 1W6OA 1DHKB 4NOTA 3FUOA 1O4ZA 5GLTA 3RMYA 3FLPA 2JE7A 1S0BA 2LTNA 3APBA 1I3HA 3IMNA 1MS5A 4YGDA 4FOWA 3VUOA 3IKWA 1LENA 1URXA 2D6PA 2R0HA 3O0XA 1WBFA 2E6VA 1C4RA 2XG3A 4LBOA 4P9YA 4M3CB 3IPVA 4ZXKA 2WLQA 4AVVA 1FV2A 5E89A 3IM0A 3TB0A 4ATEA 2CY6A 4C1XA 1BQPA 1FX5A 1EPWA 4DS0A 2VY0A 5JMCA 1KJRA 3HR9A 3M3OA 4P9XA 3FBYA 2VXRA 1QU0A 5CBLA 2PHXA 2ZHKA 3ZSJA 3WNXA 2JD4A 1ENRA 1AVBA 1S0DA 4YW1A 2P3IA 3RG0A 4FPEA 2FHRA 5GZDA 4D69A 4FPCA 3C2UA 4ITCA 5DUWA 3AYAA 3CNAA 2E7QA 1IS3A 1Y7BA 3OY8B 4PQ9A 3SNMA 1MS4A 1N1YA 1Z0HA 5T5OA 2KM2A 4PBPA 1FYUA 4YZ1A 4H55A 5GLWA 1UMZA 3AZWA 2I2SA 1MZ5A 4FVVA 1GYKA 5JDBA 1FAYA 4UW4A 3ZXEA 5H9RA 5JLVA 1JN2P 2JECA 2C9AA 4AGRA 4DRRA 3PJQA 1QOSA 5JOWA 3WCSA 4LBLA 1FNZA 1KITA 3M1HA 4UW5A 4FP2A 1AXKA 1VAMA 2GMPA 4XZPA 3WV6A 4BOWA 4LBQB 2W39A 3AFKA 5DXDA 4ZKTB 1Z78A 1Q8QA 2NZ9A 1HDKA 1Q8SA 3NV4A 3A4UA 4Y22B 4FOVA 3HMYA 4YGEA 4Y20B 1JXNA 4XJAA 3M3EA 1H9WA 3SH5A 1DQ4A 2EXIA 3AXDA 3WHTA 2R49A 2DVBA 1OFSA 3MW4A 2YROA 1N3QA 3R4UA 1QDCA 4XYXA 1SCSA 2R16A 4GKYA 4WVWA 4YM2A 3WG4A 1SLCA 3MW3A 4XTMA 3BOPA 1LU2A 2ZMNA 1CR7A 2ARBA 1LGCA 3AP7A 5DUVA 2DUOA 1J1TA 2DU1A 3UK9A 3WDXA 1AX0A 3I4IA 2A6VA 3VKFC 3N7JA 2D6LX 3OBTA 2VW1A 1ONAA 3ZYRA 2P3JA 2Q5TA 1LOFC 4XDQA 1YIFA 3WUCA 1W6PA 1S0GA 1D2SA 2AYHA 2A7AA 1A8DA 1BZWA 2ZACA 1CONA 3SISA 2RHPA 1WLWA 3KQRA 1MVQA 2P37A 4GWMA 1C1LA 4XIKA 1PZ8A 1QDOA 4BMBA 1W6MA 3W59A 1V6OA 1G86A 4JCKA 2A3WA 3NV1A 2WSVA 4M01A 2OUJA 2DWRA 4SLIA 2PHWA 4XXAA 1MR5A 3D6EA 2NMOA 1MVEA 3JUUA 4P14A 5T5PA 2D6MA 3T1LA 3WG1A 5KXEA 4GXLA 2OW4A 1LHUA 3AP5A 1UKGA 5T55A 1QNWA 4M00A 2OVUA 1KRIA 3FLRA 1LHVA 2WT1A 1ENQA 2ZGMA 4YGCA 3RRDA 4F83A 2VW0A 5F9TA 1W6NA 1LJ7A 4XOGA 4Q8KA 1S0CA 3B00A 3VKNA 1Q8PA 1GV9A 2JE9A 4DQAA 5GM0A 3PVNA 2WSUA 5JOZA 4YW2A 3OBRA 4KBBA 1JHNA 2B7YA 1O4YA 1LTEA 2YXSA 1AJKA 5E8AA 3SH3A 2CWSA 3AYEA 4P9WA 3V64A 4CTEA 1MS8A 1CESA 5T54A 1WW6A 1N1VA 1HQWA 3WDYA 2GMEA 3JU9A 1GICA 1LEMA 4UW3A 3LSDA 2PHFA 3VKLA 2ENRA 4PCRA 1ULEA 1BYHA 3IN9A 5T52A 1AZDA 1LOFA 2EXKA 3N7LA 4CZSA 1Q8OA 4M3CA 2NP0A 4XJUA 2ZGPA 3N7KA 3SLIA 3WLUA 4FQZA 2R1DA 1V6JA 1DQ0A 3ZXLA 2PHTA 1W0OA 4Y1YA 1UX6A 3M3QA 1B09A 3VKMA 3ATGA 4TYSA 5IK4A 4ISQA 3PVOA 1N1TA 2ZMLA 1ZA4A 3ZXFA 1YXWA 5IK5A 2VH9A 3ZXJA 4Q8LA 2ZABA 1UN1A 4WV8A 5EYXA 2A70A 3WVJA 5DUUA 1SFYA 2DVDA 5HCBA 3T1MA 4YG0A 2DTYA 4HL0A 1R1ZA 4K20A 2D6KA 2GNBA 3FFZA 4FOYA 4FPHA 1SLLA 5T5LA 1KDMA 1LOEA 5H9PA 1SLBA 3GALA 3LSEA 1D0HA 2NMNA 1OQ1A 2GNTA 2EIGA 2A75A 4AVTA 2E53A 1WLDA 3L2YA 3MW2A 2DTWA 1W6OB 2ZGUA 1GLHA 5DZEA 3BTAA 3WCRA 1LOCA 3WDWA 2FMDA 4XXPA 5L73A 1QKQA 2A6YA 1JW6A 1V6KA 2E7TA 2EAKA 3FLTA 4LBQA 4PBOA 4XIOA 5JOYA 1LGBA 1DGLA 2A6WA 2G4IA 1MS0A 2WT0A 1LODA 1V6LA 3AXEA 2WJSA 2ZHLA 4FPOB 4Q1PA 5CNAA 3IPVB 1AXYA 4GA9A 5GZCA 1I1EA 2OUHA 1IS4A 1ULCA 2ZKNA 2PHUA 1LEDA 2ERFA 2AUYA 1RIRA 3USUA 3N7MA 1F9KA 4OZXA 1RINA 3O12A 1IS6A 2DVAA 4Q27A 4ASMB 1LOGA 2EXHA 1WW5A 4M3CE 5GALA 1S0IA 5GJ6A 1LOBA 1MZ6A 2GN3A 3AK0A 3TAYA 1XQNA 3R4SA 1G8WA 4L8QA 5CA6A 2VUAA 4YM1A 2P34A 5BYNA 3R05A 2D3SA 2D3PA 3RS6A 4YZ3A 1S1AA 3M2MA 2Z42A 3AX4A 1C57A 1CVNA 1LU1A 4XHBA 1G9BA 4FP3A 2YV8A 3WOGA 5GZFA 2D6OX 1TEIA 3Q9OA 3V0AA 1UZYA 1V6MA 2GMMA 5IK8A 3WDVA 4IQPA 3OYWA 2ZAAA 5GLVA 1CN1A 1LGNA 1V6NA 4XTPA 4YZ5A 1KDKA 3SITA 4XILA 4LBJA 2ZHNA 4GWNA 1G9FA 1GZWA 5IK7A 1UL9A 3NV2A 4XBNA 5F5QA 4YW5A 3WZ1A 1W6QA 4Y1VA 5GLZA 2DUPA 3O0WA 1WW4A 3ZYPA 2P2KA 3O0VA 2D44A 5CB7A 1F31A 4FPKA 4FPGA 4Y26A 4YG6A 1YI7A 2ZGKA 4AVSA 4BLJA 4DFSA 1BXHA 4Z8BA 2H0BA 3RMXA 1LCLA 4GALA 5SV8A 2W68A 5IT6A 2ZHMA 1SCRA 5EYYA 2GNMA 1DFQA 1SLTA 4W65A 2SLIA 1GZCA 1MACA 4ATFA 2GN7A 4YZ2A 2JJ6A 1S0JA 1FV3A 1JUIA 3PVEA 1DQ6A 1LESA 1U0AA 3V0BA 4XMAA 1C1FA 1W6PB 1YYNA 3N36A 4Q26A 3AZYA 4JC1A 4ISRA 4BLIA 4XHXA 3WUDA 1WCSA 2CTVA 1ULDA 1YRZA 4LBMA 4YM0A 2ZA9A 3DUIA 3B9CA 1W6MB 2AR6A 4GKXA 2ZGLA 3OPZA 4R9DA 5LK5A 5H9SA 2A3XA 5HCFA 1DYKA 3ILFA 4NO4A 1UPSA 3WDTA 3PMEA 2R0FA 1OKQA 1IOAA 1BKZA 4Y24A 2CNAA 2DVFA 4HANA 1CIWA 1HLCA 4FPJA 2A71A 2CYFA 4C1WA 3HN1A 2CL2A 1PZ9A 1QGLA 1GBGA 1SBDA 2P3KA 1H30A 1ZM1A 2ES3A 1AX2A 2DURA 1DYPA 3QLQA 4XMIA 2C5DA 1W6NB 1WBLA 1LULA 4K1YA 4FOQA 3DGTA 3O5SA 1W0PA 3POSA 3ASIA 1Q8VA 4R9CA 5AVAA 3NWKA 3M3CA 3B69A 2XB6C 2W52A 4DRVA 2A5ZA 3AJZA 2JDZA 3QCWA 3OY8A 1H9PA 3ENRA 4XJWA 1KJLA 1QNYA 4XBLA 3WDUA 2JKBA 2ZGRA 5FREA 1AJOA 1GNHA 1BJQA 5JVVA 3T2TA 1DLLA 3WG2A 1N3PA 4K21A 3UJOA 1LOAA 3B01A 1HKDA 1MS3A 2NN8A 2ZZJA 3OGGA 3N3HA 4Y1ZA 2A6XA 1HQLA 5GLUA 3AP9A 1CPMA 1JOJA 1PZ7A 3A0KA 3ZSKA 1NLSA 1WUVA 4YW3A 2WQZC 1Q56A 5IUQA 2AH2A 3A0NA 4FQ4A 1A78A 5DZFA 4FPFA 4Y22A 3W58A 1DQ5A 1AXZA 1V6IA 4Q1RA 1A3KA 1S0EA 4Y20A 3ZXKA 3AYDA 5CAZA 5FRAA 3BODA 2GNDA 1UZZA 2UWAA 4YLZA 1S0FA 2LALA 2ZGNA 3NV3A 3MEPA 3UL2A 1QOOA 1F5FA 2TEPA 2A6ZA 4BMEA 5DG2A 2AGSA 3RSJA 2V73A 1SBEA 1QF3A 1G9CA 1VALA 2AENA 4WVVA 2YZ4A 1NXD1 3KM5A 4AGGA 1GSLA 2CWMA 3RQ0A 2ZGQA 5EXOA 1IS5A 2ZGTA 2YMZA 4Q2FA 1GKBA 4YFWA 1QMJA 4AWDA 2WT2A 4RL7A 2DV9A 3D4KA 5E88A 2R1BA 3AP6A 3POYA 1LHNA 2UURA 1GANA 1DZQA 1JYIA 4DPNA 4XBQA 5KXCA 3ZVXA 4BM8A 2UWCA 3B3QE 5HCAA 2D6NA 1SLAA 1G9DA 1SBFA 4XJ8A 4RA0A 4YZ4A 4FPYA 2A3YA 2YY1A 4UW6A 3AZVA 3ZPYA 3H0OA 4U36A 2GALA 2ZGOA 1N3OA 4XJZA 3USUB 1APNA 1FNYA 2WKKA 1N47A 5EWSA 2VU9A
chains in the Genus database with same CATH superfamily
5JXJA 3MF6A 2VUJA 2ZXQA 3MPPG 3VD9A 1OUXA 1UXZA 1UOGA 2BJSA 3PTRB 4PI2A 2O8QA 4B4PA 2W08A 3N9MA 5K9YA 1ENXA 5FZ1A 2Y6LA 3CLPA 2CU5A 1O6UA 4XQDA 3T2QA 4ES8A 5JIAA 1HB1A 2WNVB 3VBOC 1IPJA 2RJKA 5C7GA 3MUZ1 2VTXA 3BU0A 1TME2 1VP6A 1X82A 2IVIB 2SBAA 2XVLA 2UWBA 4Y1UA 2XBO2 1QEXA 1KQRA 3I2KA 5FYBA 3TEWA 3VV1A 1LHOA 1ULGA 3JZVA 3B02A 2K2SA 2WNEA 1C8M1 4L11A 2DBNA 2BQPA 1KFUL 2QQWA 3WHUA 2NYYA 4R8HA 1IQAA 1DBNA 3LIGA 3OYWB 1MS9A 1SFNA 2PTMA 3I2HA 4K8FA 4QPGB 5FUPA 1AL23 4YW4A 2ZGSA 2WINB 3BN6A 3ZYGA 1PIV2 1JYCA 5FPZA 2ZBJA 3WNLA 1EPZA 3CQOA 4JGYB 2GDFA 2QKDA 3DXTA 5DUXA 4K1ZA 1RUG2 3N35A 1HB3A 3OUHA 4PT6A 1NUKA 3V65A 4E2QA 4YM3A 1XBFA 4PQQA 3J8F2 4LBKA 1R092 4FTBA 5T50A 1N1SA 4CPBA 1RJ7A 3INAA 2YPJA 4AHWA 3BTXA 2QQNA 2VQTA 3ZSLA 1UOFA 4RS5A 5FYYA 4DB5A 3GNEA 4O7XA 1M06G 1RUJ2 1RHI2 1QH7A 2G19A 5LBBA 2BP6A 2AREA 2WIIB 2H0VA 3WSOA 3PUSA 4INDA 4CRQA 4BQ2A 5HXMA 1H6XA 4JZRA 5FZCA 3V56A 2EALA 3VZNA 2ZX1A 1UAIA 1YQCA 3ILNA 5LEKA 4QXKA 1H8TA 1W6OA 4NOTA 3FUOA 1O4ZA 4P9LA 1RMU2 5K8SA 2HEYF 1IPSA 3FLPA 5EZWA 2GC0A 4Z2WA 1TME1 2LTNA 5LA1A 1I3HA 1OLRA 2WYSA 2XBO1 2XJQA 1QIQA 1XNKA 3H8UA 4FOWA 4P9JA 1LENA 1URXA 2D6PA 5IFPA 1W39A 3O0XA 2AC1A 2E6VA 4P9YA 3WNOA 4M3CB 1BVP1 1NOVA 2Y6JA 1FV2A 1VJ2A 2OX0A 3HQUA 3KV6A 4ONUA 1OH3A 4UFHA 4ATEA 4C1XA 4CYDA 2VQAA 1BEV3 4X6QB 2VY0A 2X29A 3HJRA 2WS92 3M3OA 4P9XA 3WNNA 4AEDC 1RYYA 2D93A 4CU9A 4L97A 3ZLIA 5FDBA 5FPUA 1PIV1 1W8WA 4EWDA 4Q0VA 3P3NA 4IW3A 2IXHA 2QVSB 4TLGA 5BUVA 4RGGA 3KT7A 3RG0A 1PK6B 1RUG1 2ZX0A 2FHRA 3C7GA 5GZDA 5DUWA 4ITCA 2R7EB 5A32B 3SNMA 2E7QA 3VL9A 3VBOB 2GP3A 5A1AA 4AEMA 3J8F1 4CCEA 1R091 1NAEA 1I5PA 4PBPA 5C4WB 2B9UA 3CBNA 4DIQA 5CEHA 2I2SA 1C8NA 5JDBA 4Z1VA 5AFEA 3ZFGA 1RUJ1 1RHI1 1HRI3 4UF0B 5H9RA 2E63A 3PUAA 2RMU3 2WYFA 3KS7A 5FWJA 3M1HA 5DMYA 4KQ7A 2ARCA 1RUNA 1MEC3 3WV6A 4HPKA 5CFCC 1BK1A 3OGRA 4AGRA 3K4ZA 4QKBA 1Z78A 3DL3A 4MZUA 1Q8QA 1QH6A 1Q8SA 1RMU1 5FYSA 3SKJE 4CXWA 4FOVA 1ZA7A 2WWSA 3HMYA 2WWUA 3UYJA 2A1XA 3ZFFB 5CKQA 4YVSA 2OS2A 1DQ4A 1FMD3 4ZS2A 4ZZ8A 1OFSA 3MW4A 1Z7S3 4WVWA 5AC91 3O1TA 2IXKA 4W6YA 2IUWA 2IXIA 5A3PA 1CAUB 2RDSA 4NE9A 2ARBA 2BWAA 2IXCA 1OA4A 4N53A 2WS91 2DU1A 1C5IA 1QWRA 3A22A 4LKDA 3UK9A 2QZ2A 2A6VA 4UFLA 4WM8A 2D97A 4XVHA 4NWVA 4KH9A 1FXZA 2VW1A 1ONAA 4C91A 4QGNA 2Q5TA 4XDQA 5KHJA 2WZR3 3OF1A 2VMCA 4RR3B 4AQ6A 4QX7A 2QQLA 2WRAA 4XFCA 1AR83 4PJYA 4BU2A 2BNMA 3IMMA 4QM9A 3SISA 4AAXA 2QQKA 2IC1A 4Y4YA 2W1WA 1PZ8A 5FPVA 4AFAA 5DAQA 1V6OA 3AMNA 3Q8BA 4JCKA 5FR3A 5A3TA 2WSVA 3BU7A 5IWFA 4KWJA 3VDBA 2PHWA 2W0XA 3ITQA 4XXAA 2NMOA 4EV0A 5BNOC 5JZGB 3JUUA 4GJYA 4P14A 4QQLA 4RGAA 4XW3A 3T1LA 1RUC2 3WG1A 5KXEA 3IWZA 1U5ZA 4KWKA 5T55A 5FLIA 5K7PA 4AFMA 4QX8A 4KNCA 2YU2A 2YBPA 4AEDB 4N7UA 4C8DA 2ZGMA 4F83A 4XOGA 4YVWB 1J83A 3EQEA 4AHYA 5FMBA 1O3RA 1OXCA 1Q8PA 2GSYA 2BERA 2OXBA 3KCXA 4WBBA 5F5CA 1ZBE3 3DKQA 3IZOA 3TN93 1RC6A 2CWSA 4L2NA 1KEXA 1AR92 4A3ZA 1IPKA 3LE0A 1N1VA 3K3OA 3TRSB 5FO7B 1GICA 1LR5A 4LO7A 4UW3A 3H8XA 3CJIC 3WW2A 3GCWA 1C5HA 2I45A 5C3OA 1OVSA 5JWPA 2ET1A 1JI6A 4PCRA 4WVMB 1UZ0A 1JODA 2J42A 5A3NA 4CZSA 4IXLA 5FWEA 4QGMA 4D7SA 2ZGPA 3WLUA 5CFCB 4D7TA 5FP8A 1DQ0A 4M4RA 5LA0A 3BB6A 5DN2A 4I0WB 2WC2A 2MEV2 4TYSA 4OI2A 4FFGA 1N1TA 5J36A 2QE3A 1E5IA 2VH9A 4A7ZA 3ZXJA 4Q8LA 2ZABA 1UN1A 5EYXA 4F8AA 3R6SA 2J1TA 2FBEA 4A41A 1VMFA 1RXFA 4Q4V2 4MSVA 3FJSA 4EJRA 2ZEWA 4CP1A 3N9PA 1RUC1 5A6QA 1K45A 4LK6A 4AEJA 3LGRA 5A3MA 1OURA 3U10A 2D6KA 3FFZA 4FPHA 4BH9A 5IVYA 5FIXA 5T5LA 2BBAA 4LO8A 4XUNA 1SLBA 2LROA 2NMNA 3KGLA 1JHJA 4YRDA 3T2OA 3VBSC 3ZKYA 1NCRB 5FZAA 3AMHA 5FY0A 2A75A 5J09A 1NYWA 2R042 4QKFA 1F5JA 2JKXA 1EV13 3ZM8A 1MZEA 2DTWA 3ES1A 2ZGUA 5HPOA 4TWTA 2J1AA 2OA2A 2YPDA 5FZBA 3WD5A 1H0BA 4ZONA 2A6YA 1JW6A 3SQOA 1HRV3 1LGBA 3K48A 1AR91 2A6WA 4NIGA 1YJKA 2WT0A 1E5SA 1UCXA 3GZAA 3W5MA 2AACA 4L92A 4UAPA 2ZHLA 4FPOB 4J1XA 2BGPA 4P9GA 4DINB 1IS4A 5BNOB 2BWCA 2VMDA 2ERFA 2TUNA 2YDEA 3CDZB 1XE0A 2DVAA 2RDNA 4Q27A 2EXHA 4M3CE 5GALA 1B35B 4CCOA 1AR72 3C3VA 1LOBA 2GC1A 2GN3A 1PO13 1O91A 2V72A 3AK0A 3KV9A 4W6WA 3FBMA 1AYN3 1G8WA 2MEV1 1EP0A 4QPIC 5FXXA 3VDDC 1ZRFA 3LOIA 4KGGA 3N4MA 2F17A 3E6BA 2O8OA 4PDWC 5FZ0A 4HSJA 1JYXA 4Q4Y3 3MYXA 4P5YA 1PGL2 3RZJA 5BYNA 2PA7A 2PHDA 1K5MC 4Q4X2 4Q4V1 3OG2A 5FYCA 3RS6A 2Y0IA 4AI1A 1CZTA 1WCDJ 3M2MA 4JHZA 4AE2A 4ZU5A 1C57A 1CVNA 1W06A 1TMF2 4FT8A 1O7FA 3IAQA 4FP3A 1GWLA 4META 5FJHA 5BNNC 3AVSA 1POV1 2W91A 2YV8A 4IGPA 1JU4A 1ZRDA 3OSDA 1ULOA 2PLV2 3J7HA 4CPBD 4AZZA 1XC6A 4XF9A 1UZYA 1OKOA 3WDVA 3OYWA 3NRUA 4Q5OA 2R041 2XGXA 3ABZA 2BV4A 2XMLA 1J1LA 4QPGA 4GH4C 1OT5A 3NJYA 4UYBA 3C7EA 2RS52 3LOBA 1OD3A 5F5QA 1NZCA 2W1UA 1W2UA 4HSLA 5AVPA 1WW4A 3O1RA 3JXSA 2VUDA 1O3TA 4HBNA 1CAWB 2HYXA 1HB4A 1YI7A 1Q43A 2BGCA 3KF3A 3C8XA 3POFA 3KF5A 3VBUB 3KWVA 2ATFA 5J3UA 4D3WA 3O1VA 1UNBA 2RS33 4K3UA 3VD5A 2SLIA 1UX7A 4XUQA 3NSTA 3K3NA 1HV0A 1UY1A 3JBG2 1SQ4A 1W3VA 1AR71 1JUIA 3OEBA 3ZN6A 5A3WA 3VBSB 1DQ6A 1QJX3 2VNRA 4XMAA 1C1FA 1FOD3 2VE1A 3N36A 3AZYA 5JI9A 3H1WA 3TEZA 3WUDA 5FZ9A 4QQHA 3MDPA 5A3UA 1A8MA 1BVVA 1RUF2 1PGL1 4YM0A 4NRMA 2ZA9A 3DUIA 5LK5A 4Q4X1 3OPZA 2ORXA 2A3XA 2JB4A 3AL6A 2W92A 3ILFA 2WFPA 4NO4A 2CGNA 5FZFA 3PMEA 2XJVA 2H6CA 4KWLA 2DVFA 3GZUC 3ZDSA 1TMF1 3LAGA 5IVVA 5LZ6A 4HANA 5FUIA 3THTA 4IEZA 3B94A 1HLCA 5HV0A 2A71A 2CYFA 2PLV1 4C1WA 4NAOA 3P5BA 4CDXB 1GBGA 5FKCA 1H30A 4GB33 1VRH2 3G7DA 5FP3A 3H8OA 5JXGA 1HXS3 3QLQA 1GP5A 1XSQA 3WQ1A 4YW7A 5A7WA 1DDLA 1W6NB 5I0RA 1PGSA 2RS51 1BK0A 2MNGA 2D40A 4HN1A 5C3SA 1OHFA 2IXLA 4L0PA 4LMFA 3I3DA 2FDGA 2W52A 3WW1A 4PDWB 3UGGA 1SG3A 5A32A 2R30A 3UT0A 3VBOA 1H9PA 2HEWF 4CEWB 4AK3A 3S6PA 1KJLA 1K5MB 1XB9A 4W8JA 5C4WA 3TNQA 3ZFEC 4XBLA 4D0QA 3WDUA 1O3QA 1QXRA 3U11A 2QQPA 1RUH3 5SV5A 4O65A 1GNHA 4CVUA 2UY8A 1HJFA 5JVVA 4A6OA 5BNNB 1RUD2 3NO8A 4UF0A 5FMOL 2WO7A 3UJOA 2HWB2 1UYZA 3JBG1 2NN8A 1IG0A 1W9WA 2PAMA 2ZZJA 3OGGA 5LY2A 3N3HA 4Y1ZA 1H8TB 3SCHA 3BIEA 3TYJA 4N8MA 3HWJA 2EIDA 5GLUA 1I5ZA 3GXUA 3ZSKA 1PO22 4PIYA 4PF1A 3MIDA 3POBA 4GH4B 3J7LA 1U5YA 2PQSA 3HBKA 3KSCA 2AH2A 1RUF1 4LKSA 4CP9B 3ES4A 3ZFFA 2XOMA 4OI1A 4UFKA 2XJTA 1NQDA 1X8MA 3QOPA 5FRAA 4DRRA 4LO6B 2QCSB 5JXHA 2RS13 3H3LA 3VBHC 2ZGNA 1E5RA 4TN7A 4C0BA 1QOOA 4RGKA 4Q29A 2WNUC 5FY1A 5FY8A 2BPA2 2A6ZA 4BMEA 4IE5A 1VRH1 2VPVA 2H6BA 2QQMA 2Y38A 3NNJA 3THCA 4WVVA 2YZ4A 1NXD1 4RQPC 4XETA 2W87A 3CL1A 5JR2A 4CA9A 3ZKUA 1BLZA 5LA9A 2I74A 5EXOA 2LM3A 2ZGTA 4NRQA 1O8PA 4G4FA 3GZEA 5C71A 4AWDA 1O5LA 4V2VA 2HEVF 2VVDA 3POYA 1DZQA 1GWKA 2LUWA 1WMEA 3ZFGB 4BM8A 1K42A 1R1A2 4LOTA 2VZ3A 3ZIXA 1NLRA 5HCAA 2D6NA 5L19A 1SLAA 4YW6A 1YFXA 3NVCA 4RHV2 1F4HA 3Q8CA 4Z82A 1US3A 5E1RA 4U36A 1RUD1 1C8M3 1N3OA 3FX3A 2HWB1 3SEEA 3USUB 3VL8A 5JZGA 2IFRA 2YC4A 1JZ6A 2ZOEB 1WW7A 1YFWA 4JQRA 4MXVA 4XF4A 4YGBA 1JS9A 3VHRA 1V00A 3LPGA 5ERLA 2B4KA 1PO21 3AZZA 5FMOS 4AEDA 5F1RA 2VOTA 3MF9A 2EXJA 3ZOIA 3OBZA 4LJHA 4D6QA 3KB5A 3I3EA 4JDMA 2BBVA 1RITA 4B1LA 5K4LA 1JYTA 1VLNA 4KGQA 5LRRA 3D3AA 1MPXA 3PMSA 4QHOA 3KHCA 1DQ2A 3K75B 3I3BA 4CU6A 5K0UC 1ZZ7A 3ZFEB 2VZQA 4I30A 3GZTB 5H9QA 2V5YA 3W21A 1C28A 1CWPA 4X8PA 1G6NA 2PN5A 1JBCA 1VIWB 5E16A 2VL4A 3OJBA 3PU3A 2XJSA 4BQ1A 5DZGA 3LZZA 4WVMA 2WUHA 5FZHA 1GZTA 1DQ1A 4NHLA 5FY7A 4LR4A 4NN0A 1UIKA 3D5OA 4KMQA 5J48A 4AVCA 5CFCA 4LBNA 4CTEA 1HJGA 2EF6A 2JG9B 1G7YA 1W6QB 3AKSA 5JOXA 5I0UA 4BQ4A 2NM1A 4U2AA 2XL9A 3D0JA 1R1A1 1TME3 1WD4A 4S2HA 2WLPA 1XNBA 2XBO3 2L9LA 4RHV1 4HVOA 2ARXA 2CV6A 4Y1XA 2B9VA 1WMFA 4Y5Z0 1PMIA 2BFUL 2HBTA 5CFDC 3ILRA 2WNUB 1CAXB 4R9AA 2XJPA 3FUQA 1UU5A 4GIQA 4IL7A 2DYCA 5CIRA 4IE7A 5FY4A 5BY5A 2P6CA 4UT5A 1WWYA 2DVGA 5GZEA 3VHNA 3V0BB 1TVGA 2Y34A 1PIV3 1YJLA 4COYA 1ULFA 3AL5A 4DY3A 2D7FA 1RUG3 5I8YA 3ZSMA 4AI9A 4XURA 5GLTA 5KHHA 1UY4A 2BGOA 2DBIA 2JE7A 3J8F3 4HK8A 4NPMA 1R093 3BKZA 2JXAA 2Q8DA 4CDWC 1MS5A 4YGDA 3TBDA 3SCGA 4AFCA 3WF3A 3IKWA 5J96B 4I2OA 2R0HA 1RXGA 1EY2A 2VOWA 2IVJA 1DF0A 1UWWA 4LBOA 3I7DA 1C4RA 4LPLA 4IV3C 5L7OC 1ZZ6A 1RUJ3 1RHI3 2WLQA 1F2NA 1W8NA 4UI9L 3IM0A 2ZX3A 1KD7A 3BTZA 3AMQA 5BNOA 4BWOA 1BQPA 4XUTA 4DS0A 4JKLA 3MLKA 3KGZA 3FBYA 1H1MA 3PHMA 2Y33A 2VTXJ 1QU0A 3RGBA 2PHXA 1YC61 1B35A 3PIGA 1ENRA 1FPN2 5FZ4A 1RMU3 4FPEA 4FI9A 2XH6A 2BEOA 3C2UA 2JX9A 5CADA 3CNAA 1UU6A 2JD9A 1IS3A 3OY8B 3POJA 4CCNA 1N1YA 2TNFA 3WR0A 1QXPA 2V4VA 5LWBA 4YZ1A 5GLWA 1VBE2 5AC93 4RD7A 2WO3A 2XVKA 4YARA 1GYKA 1NT0A 1WA4A 4UW4A 4EWAA 3CJIA 2WS93 3RZHA 1OH4A 1MZFA 2BFUS 5CG8A 1FNZA 3KHBA 4WM7C 4FP2A 1AXKA 1OA2A 4LO4B 1XYOA 3THDA 2XQRA 2B39A 3AFKA 5DXDA 2XKOA 1OOPC 2X5IC 4CCKA 4ES9A 3OUIA 3A4UA 4Y22B 4F3JA 1A6CA 1A34A 3U07A 3BPZA 4Y20B 3DN7A 3JQXA 4HXCA 3M3EA 4KG8A 1F35A 2EXIA 4NIAA 3N9LA 3UKVA 1CAWA 3FZ3A 1NE4A 2BVVA 4LKEA 4DEVA 1QJU2 3MBWA 1QDCA 5AFBA 4XYXA 3RZGA 4GKYA 3H8RA 4YM2A 1PX3A 1UY3A 3A23A 4XTMA 3BOPA 5DUVA 2DF7A 2DUOA 1J1TA 4ZHNA 1AX0A 3I4IA 4I02A 5FOJB 4XCAA 1FPN1 2FZ2A 3VBSA 3T2PA 3WW4A 5FLHA 1LOFC 1S0GA 3ZN5A 3WQ0A 4LUKA 1A8DA 1BZWA 2Q8OA 3VDCA 3EB7A 3HEIA 4QDQA 2RHPA 1WLWA 1YUDA 5C6CA 1VBD2 2EIEA 3P6BA 3BOWA 4GWMA 4BMBA 2XWBB 4UBGA 5FO9B 3NMBA 4RYDA 1VBE1 3CF6E 3I3QA 2P17A 4QHZA 4S2FA 5JSPA 2A3WA 3RZMA 4M01A 3NJZA 4G9SB 4K9SA 1MR5A 5LBFA 4R4ZA 5ACA2 4D8MA 4TSVA 5L7OB 5ABJC 1YQ6A 2DCYA 5T5PA 1J59A 1Q3EA 5C5UA 1DGRN 4AQ2A 3AP5A 4JGZB 4CDXA 4E8CA 5IW0A 1QNWA 4FSJA 3FLRA 4YGCA 4AQTA 3S7IA 4AI0A 1H2NA 2VMHA 1W6NA 3OB8A 1LJ7A 5BNQA 3OGVA 1S0CA 1GMMA 3B00A 2WWJA 4HKWA 2HBUA 3O1SA 2JE9A 1GV9A 4DQAA 1WMXA 3C7FA 2QQUA 2JDKA 1SDWA 2J1SA 4PDWA 4XQ4A 1QJU1 4YW2A 5E8AA 3V64A 1AJKA 3JB8A 4CEWA 3VBFC 5A6XA 5C3QA 1CESA 1K5MA 1WW6A 3NAPC 4HETA 4FAGA 2Z5WA 3LB9A 2R6QA 3JU9A 1UW8A 5IAVA 1RUC3 3VZMA 1STMA 2JIGA 3ZN6B 5L36A 4LIUA 3VKLA 1JYVA 5F5IA 5BNNA 2DCKA 2ENRA 4M0NA 3FC0A 1BYHA 2Y6KA 5T52A 3D8CA 2EXKA 3N7LA 2YGMA 1Q8OA 2BOIA 2W94A 4KBZA 4NROA 4XJUA 4LTAA 2NP0A 4Y3OA 1LNSA 1X9TA 4FQZA 1VBA2 1ND3B 3M3QA 1GR3A 1OOPB 1O4TA 1YQ8A 2VBBA 4GH4A 4CDUC 5IK4A 1VBD1 2ZMLA 4CDQC 4EN9B 4CP9A 2KXLA 3ZXFA 5A1FA 5G05L 5IK5A 5ISLA 4Y5TA 3A7QA 3Q8AA 4Z07A 5KHIA 1GFF2 1AR93 3T3YA 1WCKA 4OULA 1KFXL 4WV8A 4HFSA 2A70A 5E6HA 2RJLA 1D4VB 1OBNA 2VG9A 5ACA1 4NHXA 2RJ2A 2DVDA 3PLQA 1OLMA 5CVRA 5HCBA 1XNDA 2B46X 3OD0A 4N90A 4XF0A 2JDAA 3POIA 4JRLA 5D8AC 5A7WB 3RZLA 2GNBA 4FOYA 4JKMA 1NA1C 1W0NA 1SLLA 5FPBA 3VBRC 4EYUA 1OC1A 1QXJA 3GALA 3WXPA 4DY5A 1JH5A 3I2OA 2W47A 5FZEA 2OT7A 3T08A 1REDA 2MEV3 1W90A 1WLDA 3T09A 3LWCA 4KU8A 4QMAA 3LD8A 3MW2A 5BV6A 5KR7A 1GLHA 5DZEA 2KD7A 1LOCA 5KHGA 1POQA 2FMDA 2RV9A 4XXPA 3ZR5A 3FLTA 4XIOA 2WDBA 2QQVA 4Q4V3 4GD4A 3S7EA 1YHFA 2WJSA 1D4M2 4QDSA 3IPVB 1XYNA 3WINE 1F4AA 5FQ0B 1POV3 3T4VA 1LEDA 2OZ6A 4XPVA 3OTFA 3USUA 2WL1A 2Z69A 3N7MA 4OUMA 5FYIA 4MOAA 3E5QA 1IS6A 3CMGA 3AC0A 4EWEA 1S55A 2R043 2ZPXA 1VBA1 4PLMA 2XJRA 4NVPA 5IVBA 1ZX5A 4UFMA 4BE3A 3CKHA 4CXYA 3AKQA 1BHGA 4BQ5A 3WQ7A 4LA3A 2VZ1A 3Q8FA 3T0BA 4YYOA 4ET7A 4FAHA 2P34A 2FDKA 4DOUA 3GJBA 4EE2A 2QDNA 1PGW2 2FCVA 4ZU4A 2GAUA 3VBFB 4YZ3A 5C5TA 2Q1FA 3NAPB 3AX4A 3ZFEA 4XC9A 4XHBA 1G9BA 5JPNB 2VMEA 2Y8KA 2QTWB 3I2IA 5JSRA 2ZX4A 3B93A 2VZTA 1H4HA 4I09A 5GZFA 2QFEA 3Q9OA 3ACIA 4PHZA 3RI9A 1JZ3A 5B2GB 1AR73 2VZUA 4Q0QA 2GMMA 4XUPA 3FHIB 4IQPA 1AYM2 4QXBA 5KC6A 1YQ5A 3GCXA 5D21A 4LBJA 2ZHNA 4LXLA 3GYDA 2WO2A 1VAKA 4XBNA 2JG9A 3AKRA 4YW5A 1W6QA 2DUPA 3O0WA 5F3GA 4DUWA 4Q4X3 4AFDA 5CB7A 4GAZA 4UBHA 4CCDA 1F31A 4FPKA 5FZOB 2CGPA 4BLJA 3C7HA 1BXHA 5LA2A 2H0BA 1D4M1 2JG8C 5IVJA 1R64A 1X33A 4MG2A 1TMF3 5SV8A 1YI9A 2W46A 2ZHMA 4QWNA 3RWKX 1XU2A 2GNMA 1D0GA 2PLV3 1SLTA 2WZ8A 2WNUA 4UFIA 1CAXA 1MACA 4ATFA 4A2UA 3UGHA 1NA1B 4YZ2A 3CEWA 4JQTA 5F6LB 3PVEA 2VNVA 4OQ9A 2JWPA 4RQPA 3V0BA 4MGTA 1CX1A 2RS53 3MLLA 1W6PB 2FQPA 1NQJA 3I2JA 4PLOA 5F2SA 4ISRA 5FZGA 1CAVB 1W8ZA 4OHYA 1Y9QA 1WCSA 1OVPA 1ULDA 4CSWA 1LB2A 4E2SA 4N43C 1NKGA 3U0ZA 1UU4A 4IEWA 4R9DA 3MV11 3VZKA 5FV3A 1PGW1 2ZGLA 1ZZ9A 5HCFA 5JR7B 2Q8CA 1UPSA 2QJVA 2XWJB 1IG3A 2CNAA 2GP5A 4QB2A 3KQ4B 2YB7A 3JBG3 3H50A 3HN1A 2VQ0A 3O7OA 1PX4A 1W8FA 5C70A 2P3KA 1ZM1A 2VMIA 3EHKA 1AYM1 2CHHA 5ANQA 1W28A 4XMIA 3ECQA 5KHKA 2C5DA 2XONA 1LULA 4FOQA 3O5SA 3VHOA 1WA6X 1WGPA 3ASIA 1RUF3 4UFJA 4XABA 5AVAA 3NWKA 1SPPA 3QH6A 3B69A 2WZPP 2C1FA 2QDRA 3BALA 4QT6A 5FZDA 1HX6A 3OY8A 1GOFA 3KCCA 4XJWA 2YYOA 1QQP2 1RUE2 2VC9A 2VCAA 4JKKA 4QQOA 2JKBA 2RR12 4LQRA 3TWIA 4K7JA 2VZRA 3BI3A 3T2TA 1DLLA 4QKNA 1N3PA 1VRH3 1MQTC 2C26A 2E33A 1HKDA 5FXWA 1EUTA 2BTVC 3CZJA 4AI3A 5A70A 2WR9A 5HBAA 4PIZA 4NIHA 1JOJA 3A0KA 2GZWA 3KZ4C 1RJ8A 1K12A 4O9EA 1GP6A 1Q56A 1UQXA 4MHUA 5DZFA 2QBXA 4FPFA 4Y22A 4JX0A 2HWE2 5FY5A 1AXZA 1UIJA 1V6IA 2WFF2 4Y20A 4HOOA 3UV9A 2BNOA 3ZO0B 5LY1A 4XEZA 1S0FA 1OA3A 3GHNA 2C9KA 3I2GA 1W3XA 4Y5SA 3UL2A 1RUD3 4HVQA 1XE7A 2TEPA 4H7LA 4FFFA 2HWB3 3POSA 2WBKA 4C0HA 3PUIA 1H1AA 1BMV2 1G9CA 1SBEA 1QF3A 4HLTA 1NX9A 4NHMA 2XUMA 1VALA 3PVBB 1NXMA 1SDDB 3KM5A 3NNMA 1PO23 2CWMA 3RQ0A 3IDAA 1JTZX 1IS5A 4Q2FA 1XNCA 1HV1A 1FI2A 1JOPA 5FZIA 3T0DA 1SMVA 1HN0A 2EAAA 3K2OA 3D4KA 3WT3A 1U12A 3AP6A 2UURA 1GANA 4IE4A 4LNVA 1QQP1 2VZPA 5A80A 1RUE1 2WAOA 3CJIB 3U14A 5LK7B 2RR11 2R072 2Y0OA 2OQ7A 3DCQA 4XFFA 4CDWA 4FPYA 3NKGA 2A3YA 4IEXA 3I49A 3VZJA 3SMHA 4UW6A 3AZVA 4E4DX 5A1LA 5DPNA 2KA3A 3MIEA 4V2WA 5L7OA 3K51A 1FNYA 1DCSA 2HLEA 3KT1A 3WX5A 3E5XA 4JGZA 4LKFA 4I3PA 1GUIA 1OI6A 3POWA 1UPIA 3UNPA 3NW4A 3TEXA 4AGVA 1DIWA 3LF7A 1OQDA 2Y6HA 4LIVA 2BVBA 5A3OA 4RSUA 1G9AA 2J1UA 1GWMA 1GNZA 2HWE1 2WFF1 2ZEXA 5A6ZA 3AP4A 2PAKA 2XQXA 1R1A3 5F3CA 3AVRA 1RVF2 4GZ9A 1IHMA 4XF1A 1LKNA 1IKPA 1TG7A 2D43A 3PTYA 4RHV3 1WKYA 4QX3A 5DG1A 1HQNA 3B9IA 4LEJA 2MPFA 1W8TA 2ET7A 1H2LA 3AYCA 3MV01 5KXBA 2E9QA 3WEZA 3VKOA 2FDFA 5A6YA 1BMV1 3ZN4A 2ZEYA 5FZ7A 3VD3A 5CYYA 1MQTB 4LOSA 2YFZA 3ZYFA 4JV4A 4KU7A 3I2FA 3E5UA 1CPNA 4Q0UA 5FLJA 3ZDVA 1FATA 4GWIA 2D5HA 4MYEA 2VCMA 3HAGA 1T6BX 3SH4A 3LPFA 4SBVA 2VCBA 1VAVA 4BQYA 1ND3A 1XNTA 3GM8A 1OOPA 2X09A 5GZGA 1UOJA 1ENSA 2PELA 1MS1A 1ZZ8A 4QX0A 5FP4A 4FTEA 4AEKA 2WZEA 1GU3A 3UJQA 2K9ZA 2R071 3BIWE 3O1OA 1JU3A 4IEQA 3ON7A 2E7AA 4LA2A 2PFWA 2DU0A 3U78A 4PF5A 4R9BA 2ZZQA 1GZ9A 1UYPA 5T5JA 4NUBA 3AZXA 3ELNA 5FXVA 4IEUA 4QPIB 4E4SA 1WLCA 2J1EA 3AKPA 3VDDB 1UF2C 4MGZE 4M3CF 3OUJA 5EJ1B 4IEOA 3PUHA 1PHMA 1VB4A 4YG3A 5DDJ2 4DXSA 4NJ4A 1V9U2 4XF3A 1SACA 2D5FA 4URTA 1RVF1 3RMYA 4AI2A 3F95A 1E57A 3WW3A 3NQHA 4BK5A 4JTNA 3APBA 4A4AA 4BQXA 3IMNA 2CAVA 4J25A 3RJ2X 3VD7A 2XG3A 3KVBA 4ZXKA 2ETEA 2P1BA 3IPVA 2P3YA 5E89A 3HBZA 2VULA 4NR1A 1GQPA 3VB9A 5FQ0A 1EPWA 3LKJA 5JMCA 4ZZ5A 1TE1B 3HR9A 1W9YA 2JDHA 2VXRA 3POEA 1WCQA 5CBLA 2ZHKA 3ZSJA 4URAA 3L9JT 3WNXA 2JD4A 1W9FA 3JCIA 4D6RA 1AVBA 1S0DA 4JTOA 4BIOA 5CG9A 2Y60A 4YW1A 2AEYA 1J3RA 4MGKE 3MIGA 3J4UH 2HWF2 3QH7A 4FPCA 4Q4W2 4UXAA 3EYPA 3NNFA 3AYAA 3UGFA 4ARXA 5C3PA 1Y7BA 4P02B 2G9FA 3DPRC 1VE0A 4X6RB 5F2WA 1YFYA 1MS4A 4MV2A 2KM2A 2V09A 2KR2A 3DKWA 5FP7A 1JZ2A 4H55A 3SHRA 2C24A 1KXGA 3VBFA 1MZ5A 1PMJX 4IERA 5A7PA 2P6HA 3NAPA 1UO9A 3ZXEA 4M0HA 5JLVA 1JN2P 2JECA 5JOWA 3NJVA 2R062 1DP0A 1CD3G 2IFWA 3WCSA 4AAPA 4LBLA 2E31A 4J1WA 1FPN3 1VAMA 2GMPA 4AFBA 3LA3A 5DDJ1 2W39A 1V9U1 2XR4A 4GMP0 4QGLA 4K6BA 5EPAA 4ZKTB 4H3WA 1HDKA 1QJFA 3NV4A 2VBDA 4EN0A 2G9ZA 4CDUA 5C8CC 3X29B 4CDQA 2JDPA 3SH5A 1H9WA 3FE5A 3WHTA 5F37A 4W4ZA 1VBE3 2R49A 2DVBA 4B29A 5FZOA 2YROA 3R4UA 4OYUA 1PVC2 4OHVA 1QJY2 4B7KA 2R16A 3IT8A 5LCWL 5FBZA 3WG4A 5JXIA 1DGWA 2F6BA 1VRBA 1YIPA 3MW3A 1LU2A 2ZMNA 1CR7A 1LGCA 3AP7A 1QJEA 5D8AA 5CU1A 4ZY9A 3VBRA 3HQXA 1NA1A 3VHPA 1CZVA 2YC0A 5EJZB 4KI5M 3N7JA 5KWRA 1AL0G 3SXWA 3OBTA 2HH9A 1YIFA 2P5BA 2QQOA 1W6PA 4JDNA 4QKDA 1D2SA 2AYHA 3WUCA 2HWF1 4Q4W1 2A7AA 1CAVA 1GOHA 4QB1A 2ZACA 1CONA 2WN3A 3KQRA 4GMP1 2P37A 1C1LA 1QDOA 1QJU3 4E4ZA 2B45X 2PXJA 2X53S 2VM9A 3LDKA 4ARYA 1G86A 3H7JA 3BCWA 2ID4A 2G9GA 3NV1A 4IGOA 1AHSA 4W50A 4SLIA 5HI0A 3MI8A 3D6EA 3JD72 2RM22 4CU7A 2R061 2LRPA 4I3GA 4JVAA 4LHSA 1GQGA 3DYMA 3I2DA 2P4EA 3L2HA 3HT1A 1ZRCA 4M00A 2OVUA 1R082 3EXUA 3OGJA 1OPMA 3ZR6A 2VW0A 4R4XA 2FCTA 2CSGA 1KS4A 3HNBM 1VBD3 1TQ5A 3VKNA 1JZ5A 5GM0A 4OFGA 3PVNA 5JOZA 4QAWA 1D2QA 3VBHB 5FPXA 1P8JA 3OBRA 3OPTA 1PVC1 2B7YA 1O4YA 1LTEA 1QJY1 4HK9A 4IEPA 5F8PA 3SH3A 4P9WA 5GKAC 1MS8A 3TNPB 5ACA3 2XDVA 4RFT0 3WDYA 2XJUA 4AVBA 2GMEA 3HT2A 1LEMA 4OHXA 2W95A 3LSDA 4OZOA 4RQPB 4IEYA 4TLFA 5A7SA 4S2DA 1Y4WA 3M3IA 3LDRA 2ORZA 1XPWA 3IN9A 5A3LA 1AZDA 2FD8A 4KWUA 4CU8A 3KCYA 2ZS6B 1X8EA 3SLIA 3RFRA 2R1DA 4EN7B 5F3EA 4EN6B 3GDBA 2PHTA 2WNOA 3MIFA 1O59A 3SKVA 3TOJA 1B09A 1YNAA 2NLRA 3ATGA 3B7MA 4EZ4A 1US2A 4ISQA 3PVOA 3M70A 2XKPA 3WY6A 5EHDA 3QACA 4ZXEA 1YXWA 5FZ8A 4XDPA 2V5DA 2HKXA 4N9IA 2WNVC 2RG4A 1H2KA 3JD71 4Y33A 2RM21 3T1MA 2VAUA 3N9OA 3ETQA 2O1QA 4IV1C 2NPIA 3PDQA 2XLGA 2Y6GA 4HL0A 1R1ZA 2Y64A 4KL1A 1RUI2 5FPAA 5FYVA 4LO5B 5H9PA 3RJRA 2ZAHA 1R081 3EMRA 3LSEA 2HWD2 2GNTA 2EIGA 3VN4A 1SPPB 3QD6A 1VBA3 2YGLA 4XAAA 2YU1A 4AVTA 3S30A 2BW8A 2PAEA 3VZLA 1JOBA 4CUBA 2WA4A 3BTAA 3WCRA 5JMOA 1H4GA 4HVRA 5K0UB 1QKQA 1OUSA 2E7TA 3DEMA 1V6KA 4LBQA 4QQPA 2Q8EA 1UYXA 1ZBA2 4XFGA 3W5NA 4LE3A 4JGYC 2GH8A 1M4WA 5JCTA 1QHDA 3H7YA 2W5FA 1MS0A 5I8SA 2CGOA 3RVHA 1V6LA 4A6SA 1EYBA 1HIXA 5LEJA 1HN1A 1AXYA 2XLFA 2YFUA 4GA9A 4IUGA 5FTTC 5GZCA 1I1EA 2ZKNA 4LK7A 1IGOA 2PHUA 4MGIE 1RIRA 2X10A 3OGSA 1RINA 3O12A 4ORFA 3ZMOA 1JZ4A 4R52A 3E1F1 4A42A 4ASMB 5FY9A 2YC2A 1WMDA 1WW5A 2FMYA 3SCFA 4IDZA 1S0IA 3TAYA 5FOBB 1XQNA 4GULA 3QBQA 3H42B 5B4NA 5B4XA 1J3QA 5CA6A 4QX2A 4OLLA 3WQBA 3PUQA 1O3SA 2VUAA 3RYRA 4YM1A 1DGRA 4BYYA 5CFDB 2JDYA 3OD4A 5IYYA 1D4M3 4P00B 3R05A 4LLFA 2XLAA 2D3PA 4AF9A 2BDRA 2GC3A 1OLME 2Z42A 3DF0A 2E26A 3H3ZA 3DYOA 3LEKA 5FP9A 1RUI1 1IZ3A 3WOGA 2D6OX 1TEIA 1MQTA 2HWD1 4FBFA 5GLVA 2ZAAA 5LRSA 1LGNA 1V6NA 3WP6A 4RN5A 5JIUA 4GWNA 1XJAA 1G9FA 3NV2A 1LAJA 4CDWB 2ZEZA 2BZDA 2P2KA 1UYYA 1ZBA1 3O0VA 4AL9A 2D44A 2W1QA 3LEGA 4IV3B 1PK6C 4QPWA 3H9AA 4Y26A 3EBRA 4DFSA 3PL0A 3RMXA 1K5JA 1EAH2 4GALA 4QM8A 4D6SA 3NJXA 1SCRA 2Y6FA 5C4WC 2Q30A 1DFQA 1E5HA 4IV1B 4W65A 3P3PA 3GBWA 2VR4A 4B4RA 3D0SA 1ZRRA 2GN7A 1AYM3 3S0MA 1VBB2 5FYHA 1SEFA 4LLOA 4QPIA 4ZU7A 3VDDA 1YFUA 2DCTA 1U0AA 2J7MA 1AR62 1YYNA 4Q26A 4BLIA 2VD7A 2CTVA 1XOYA 4LBMA 1YWKA 1IQDC 5DAWA 1RB8G 4GKXA 3B9CA 1W6MB 1J58A 3ORJA 5JI7A 4N9HA 5JUVA 3ZFFC 4DMIA 3MFAA 3DXUA 5CZKA 4Y24A 1X9PA 4P9IA 4XAEA 4XFIA 1CX4A 1RUOA 4WM7B 4MGSA 4FPJA 4MVTA 1GP4A 3T30A 4CCLA 4CEYC 1ASJ2 1PZ9A 1QGLA 2FDHA 1SBDA 3HNYM 1W8OA 1AX2A 2X5IB 3IIIA 1DYPA 3AMMA 3IAPA 1Y9GA 4PI0A 1NCQC 2HWC2 1PVXA 5FMDA 1OFNA 3ZSEA 1WBLA 5I8TA 4K1YA 2OIIA 1T6GC 1BBT2 1W0PA 2VVEA 3AFGA 2VTFA 3DGTA 3EJKA 2JDNA 1NLQA 1Q8VA 3HN3A 1Q5OA 4XZUG 4XCBA 3M8LA 2CDOA 3M3CA 3SC7X 2XB6C 2A5ZA 3AJZA 3QCWA 4RR3C 4EQVA 3ACLA 5FYUA 1UMIA 1CJDA 5C3RA 1EAH1 2BNNA 3FL7A 2I07B 2Z4FA 4E2GA 1RL3A 4WZCA 4FXKB 5BNPC 1JMUB 5IAXA 4K21A 2Z2SB 2UY9A 1VBB1 1XYPA 1YCIA 4DZGA 1EUUA 2VZOA 1MS3A 1QY4A 5C8WA 1PMHX 5G04L 5AC92 4YNIA 5JZGC 1AR61 1W8UA 1HQLA 1CPMA 3URFA 1GOGA 1PZ7A 1RGSA 4NWWA 3O14A 4EN8B 4AXOA 1COV2 3C7OA 1WUVA 4YW3A 2J22A 4FQ4A 1A78A 4NPLA 2W1SA 2XXZA 1JZ7A 4D94A 2WA3A 3ZXKA 1QQP3 1VBC2 3AYDA 1RUE3 4YVWC 2ZKLA 4XACA 5LASA 1JYNA 2RR13 4HKOA 4YLZA 5ABJB 2EA7A 3NV3A 3MEPA 4LULA 4PIXA 3AM2A 4MLOA 4QD2A 4B3NA 1F5FA 1OQEA 3WF0A 1ODNA 1W05A 2VJXA 2Q1MA 1ASJ1 5DG2A 1PM4A 3CO2A 3RSJA 2V73A 1W99A 4IETA 3OCPA 2AENA 2HWC1 4F7ZA 1ND2C 1GSLA 3A21A 2Q4SA 3HQRA 1BBT1 4CCJA 3B5LB 3RZKA 3S5QA 2YMZA 3U4SA 3ZPOA 1GKBA 4YFWA 2HWE3 3UESA 2QZ3A 2UYAA 2WFF3 5FKBA 2DV9A 3DYPA 5CKNA 1JYIA 2R1BA 3KD4A 3RNSA 3ALQA 4DPNA 4BHPA 3HOBA 4AG4A 3ZVXA 1X36A 3LQCA 2UWCA 5KXCA 2O0OA 2RE9A 3WF2A 1SBFA 2XPJA 4YZ4A 2DDUA 4UWDA 3MUY1 2YY1A 3I3MA 2B5HA 2XHKA 3ZPYA 2GALA 4MHRA 5J98B 4A44A 4BZ4A 2ADEA 2BYVE 3VGIA 1N47A 4CEYB 4HZFA 3WDXA 1S2BA 4COZA 2LW8A 3ACGA 1CJPA 1CQ9A 4CDUB 1WZXA 1LECA 3I8TA 1NCQB 3J26N 4A7KA 4JAAA 4CDQB 1COV1 2ZTNA 2HYKA 2DCZA 3WP4A 4OUSA 3J7MA 4MGQA 1KGYA 4OVEA 1W2NA 4XE9A 3Q8EA 1AL22 1J84A 1NCRC 1U5IA 1WCUA 2CAUA 2PYTA 1AF9A 5F3IA 4AHXA 4Z2AA 1VBC1 1VPHA 4OMDA 3VBHA 2R073 3G6JB 3NL1A 5KXDA 3DPRA 1IKQA 4IEVA 1J3PA 4PLNA 3EO6A 5D8AB 5LW9A 4BPZA 5F32A 3VBRB 1QOTA 1W2OA 1X50A 3PJYA 2F4PA 3AJYA 3PU8A 4GWJA 4L99A 4G3YC 5BNPB 5M0TA 1PNGA 2PHRA 1ODMA 3OEAA 4QU2A 4B4QA 5J37A 2VXJA 3J7NA 4A45A 2QQJA 2W9XA 3M4FA 3V0AB 3AKTA 3I97A 1V0AA 1KS5A 5FXZA 5LB6A 3MGUA 5T3NA 4NRPA 2C6SA 2B42B 4MUVA 2ZJCA 1SLIA 1GZWB 3AMPA 1WD3A 1DYOA 4AYUA 1W2TA 4WZFA 4DUXA 2Y26A 4L9BA 2W3JA 4O9GA 1B35C 1RVF3 2VZSA 1LHWA 4OHWA 2V4AA 2OKXA 2ZMKA 4ASLA 4TZDA 2E51A 3E6DA 5CKMA 2YG0A 5C8CA 4FPLA 4P08A 3WF1A 4GJZA 3RDIA 3CU7A 1XXNA 1L3JA 1C3HA 3I59B 3E97A 4JRAA 2Q0AA 4YFZA 2DUQA 4JDOA 5IVEA 1T2XA 4LBQD 3WG3A 3LEMA 1YO8A 4XJ9A 3LFIA 5A7OA 3LCPA 2R32A 2PHLA 1AX1A 2D3RA 3KV5A 5APAA 4OUEA 1BEV2 3U4XA 5LATA 1F8VA 3FN9A 1ND2B 1S2EA 2WO1A 4MXWB 2VBPA 2VW2A 4BIFA 1AL21 3F2ZA 2UU8A 4DXTA 5EIYB 4LORA 1DHKB 5J7MA 5CISA 3U37A 3K4AA 1F15A 5K0UA 4K8RB 5FCCA 1XRUA 4OHZA 3KT4A 1YQ2A 1S0BA 3IDEA 2GC2A 2DCJA 5EFUA 5C9AC 5KC5A 3VUOA 2VMFA 5FUNA 1WBFA 2BOJA 3FWEA 1UZWA 2WABA 4AVVA 4BXFA 3TB0A 2CY6A 4CUAA 3VBUC 5LBEA 5FZLA 1FX5A 1HRI2 4KG0A 1KJRA 4XFHA 2VVFA 2Q1ZB 2RMU2 5DDJ3 4BCUA 4BXSV 4NMIA 2OYZA 1V9U3 2HJIA 1MEC2 2P3IA 4C90A 1I6XA 2ZX2A 4M4PA 1UMHA 4V1PA 2JG8B 2N7GA 4D69A 5HV4A 4PQ9A 4Y4RA 3OOXA 2VO5A 1Z0HA 5T5OA 2VNGA 5CFDA 1W9TA 1FYUA 1FMD2 2ADDA 1UMZA 3AZWA 1ST8A 1HB2A 1Z7S2 4FVVA 3T4HB 4XFAA 3RI8A 1FAYA 3E6CC 3WP3A 2CDPA 2C9AA 2GU9A 3KLSA 3PJQA 1QOSA 2QNKA 3IB3A 5DABA 1L7LA 1POV0 5F6KA 3WNMA 1BEV1 3MO4A 1YLLA 1ULPA 1KITA 2A73B 4UW5A 3CHXA 3VZOA 4XZPA 3ME2A 4BOWA 4LBQB 4JHTA 1W04A 5FAXA 4CDXC 3GGLA 3CIHA 4N43B 5FZKA 2HWF3 4Q4W3 5IVCA 1X7NA 3VDAA 2NZ9A 1OSGA 1H2MA 2AEZA 2VCCA 2WZR2 4FFHA 4GMP3 4YGEA 2VNOA 4HONA 1AR82 1JXNA 5BXXA 4XJAA 3O1UA 3AXDA 4COVA 4QPYA 3R4DB 4IV3A 3K4DA 1N3QA 1SCSA 4ZS3A 2WNVA 1LRHA 2VUCA 1SLCA 4RS5C 2R063 1W03A 4CEWC 4YWAA 3USSA 1VMHA 3JB4C 1HRI1 1NZIA 4N7IA 4IV1A 4CP2A 4TXWA 2J1VA 4BJ0A 4FO9A 2VOVA 4CXXA 4CUCA 5A33B 1ALYA 2JEMA 5FPLA 2RMU1 4QX1A 3VKFC 5KBFA 2JDMA 2D6LX 5F39A 3ZYRA 1MEC1 2P3JA 4OMCA 4B8EA 1UY0A 4OI0A 1H8TC 3PNAA 3K46A 2DFBA 4ZPIA 2IXJA 4AW7A 1MVQA 4XIKA 1W9SA 3GF6A 1PVC3 1QJY3 1FMD1 1W6MA 2OQ6A 2QQIA 4RFRB 3W59A 3LA7A 5C9AB 4JGYA 1ZBE2 1Z7S1 2YBKA 1H1IA 3THPA 2OUJA 2DWRA 3KV4A 5D1IA 1NE6A 1DLCA 3RWNA 5EQUA 3TN92 5I93A 5D2AA 3BTYA 1MVEA 5HCHA 4WM7A 2D6MA 5ANNA 1NG0A 3UKNA 4GXLA 2OW4A 1LHUA 1UKGA 3LA2A 4B7EA 4K40A 3POGA 1KRIA 2X5IA 1LHVA 2WT1A 1ENQA 3RRDA 4QXCA 1OF3A 1L7RA 3ZIWA 4BISA 4EZHA 5F9TA 4NAMA 2FDJA 4FXGB 2WZR1 4Q8KA 3M7AA 4HN0A 1AR81 2JB8A 3W9AA 1RTVA 1REFA 2WSUA 1SZBA 4IESA 5J1XA 2OPKA 5FK8A 1CZSA 2K46A 4KBBA 1JHNA 2YXSA 1UXXX 1XSRA 5DAXA 3AYEA 4AR2A 3BPSA 3JD73 2RM23 5T54A 1HQWA 3ZFGC 4DO0A 3MIBA 1V70A 4MADA 2PHFA 5FYMA 2BRTA 3J9SA 3OPWA 4FCAA 3MPBA 4MGYE 1ULEA 1R083 1LOFA 3VD4A 4GQ7A 3KVAA 4XUOA 4HT1T 4M3CA 3MFCA 1Y3TA 1TZOA 2PMWB 3N7KA 1ZVFA 2BU9A 1V6JA 3ZXLA 1W2AX 2UYBA 4BDVB 1W0OA 4Y1YA 5EP9A 1UX6A 3ACFA 3VKMA 2C4XA 1REEA 4YVSC 1EV12 1ZA4A 3ZXAC 4I0BA 1FT9A 3ZX7A 3S5AA 1UZVA 3D82A 4Q0SA 3FHAA 5JSOA 5FMCA 1ZBE1 5LBCA 4J6GA 3O1MA 1PK6A 1HRV2 2QUOA 3TN91 3WVJA 3ZXGA 4QB6A 1S4CA 5DUUA 3ROUA 4AVAA 1SFYA 5ABJA 1BCXA 4LT5A 3BUCA 3BVCA 4RS5B 1DU3D 2WQ8A 4N53C 4YG0A 3FMGA 2DTYA 3WP5A 4AQSA 1ZNPA 1S2KA 4QU1A 1TNRA 4K20A 4BQWA 5EJ3A 4WM8C 4E4HA 2YUEA 5DAVA 1KDMA 1LOEA 4NIIA 1D0HA 1OQ1A 3WNPA 2BUKA 5L9BA 3LIHA 1PNFA 3H1MA 3ZYHA 4A7YA 1VR3A 4ASKA 4Z92B 3S57A 2E53A 2PQQA 3L2YA 1JZ8A 2VMGA 3ACHA 2AZ5A 1PO12 2OPWA 2FDIA 1W6OB 1ACCA 1UKRA 1AYN2 3WDWA 4E9KA 4Q0PA 5L73A 2RDRA 2YHJA 4PBOA 2EAKA 1UOBA 2JG9C 4HKLA 1DGWX 4FFIA 4P5HA 5DAPA 5FK7A 5JOYA 1DGLA 2G4IA 4Q4Y2 3HD8B 1LODA 2DFCA 3AXEA 2WQ4A 5DQ0A 4Q1PA 5CNAA 1GNYA 4MO3M 2OUHA 3U75A 1O8SA 1RUI3 5L9VA 1ULCA 3BGAA 2WN2A 3BYWA 4DEQA 3T0AA 2AUYA 4NPRA 2HWD3 5FYZA 1F9KA 4OZXA 3ETPA 5L9RA 4XQWA 4CEYA 4LHKA 4COWA 4CCMA 1LOGA 1H8VA 2VQUA 1CAUA 5GJ6A 1AUYA 1H6YA 1MZ6A 3K77A 1NCQA 2Z79A 3R4SA 4L8QA 3W20A 3UETA 2VZVA 5JPMB 1EV11 3LEIA 5FZMA 1ZBA3 3O1PA 3GBGA 1CGPA 1ZREA 4RR3A 4WVZA 1HRV1 4OI4A 3ZXDA 1NY72 2D3SA 4HMZA 1S1AA 4XFBA 3HPNA 1ZRIA 1ZZBA 1XU1A 3GBFA 1CIYA 1LU1A 4QDRA 3N9NA 4CE8A 5BNPA 4BK4A 2RS32 2OZJA 3V0AA 3DECA 3UKTA 1V6MA 3WF4A 5IK8A 4HPKB 1CN1A 4XTPA 4YZ5A 1KDKA 3SITA 1PO11 4XILA 1I9RA 1QJX2 3MICA 1AYN1 1GZWA 3RYKA 1FOD2 5IK7A 1UL9A 2JICA 4HG6B 3WZ1A 3GHMA 2XL7A 4Y1VA 5GLZA 4YVSB 3ZYPA 5I0DA 2IWGB 4OCTA 3IIAA 4Q4Y1 4FPGA 4YG6A 4AVSA 2ZGKA 4YVWA 3LDBA 4Z8BA 4E27A 2K0GA 2FCUA 3RPQA 1LCLA 4H7MA 1D7PM 4BQ3A 4MX3A 2W68A 3FFQA 3I59A 3RYPA 5IT6A 1DG6A 3ZYBA 5EYYA 4N53B 2ZCWA 1GZCA 3N9QA 4DNYA 4WM8B 1TNFA 2MHFA 2JJ6A 1QJZA 1S0JA 1FV3A 3U1XA 1LESA 4GB32 4CP0A 5JAXA 4NIDA 1ND2A 4D7YA 4MXWA 1HXS2 3IDCB 4JC1A 3DPRB 3P1IA 4XHXA 2ARAA 2VOKA 4DXZA 3NNLA 2TBVA 4LHLA 1YRZA 4IE0A 4NHKA 5IFTA 4QX5A 2AR6A 1NY71 3FHQA 4NHYA 5FZ3A 1SHWB 4XDOA 1EAH3 5H9SA 3DV8A 1SFPA 1DYKA 4AHZA 3MHZA 3WDTA 2R0FA 1OKQA 1IOAA 3ZMNA 1BKZA 4YPJA 1U5XA 1Y9MA 4O61A 5EV7A 3KMHA 1GQHA 2VECA 1CIWA 3MLJA 5HXVA 2RS31 1RUH2 3JQWA 1VBB3 2VOXA 1UY2A 2RDQA 2CL2A 4QXHA 1O5UA 4AOCA 4I0AA 2ES3A 2JIJA 1L7QA 3IBMA 4BA6A 1OD5A 5IATA 1OF4A 2DURA 3PURA 1AR63 5IJRA 3AB0A 5FO8B 1VB2A 1QJX1 5C8CB 1DZRA 5FJKA 1FOD1 3H1YA 2EICA 2X05A 2B8MA 3PIJA 2JE8A 4LITA 4R9CA 3H3UA 1NCRA 2JG8A 4I01A 5A7NA 4CUGA 4DRVA 2JDZA 4E8DA 5F7UA 2F4LA 3ENRA 3HNMA 4AI8A 5C33A 2X8KA 1QNYA 3CZUA 2JDUA 2ZGRA 3CJXA 3OBAA 5FREA 1WLTA 2RS12 1AJOA 3SEPA 1BJQA 1ASJ3 2IZWA 3HVDA 3WG2A 1OMIA 2FZ1A 1LOAA 3B01A 2LS6A 4OQ8A 2HWC3 2VGDA 2EVXA 4GB31 2A6XA 4BB3A 4YSFA 1HXS1 4QPGC 5FZ6A 1BBT3 1W8HA 3AP9A 4JGZC 5I91A 1DZTA 4EROA 2O14A 4N43A 1NLSA 2WQZC 1OLQA 3IDBB 5A7QA 1PM7A 3A0NA 4S2GA 4MH0E 5IUQA 5BPXA 2JENA 3W58A 1DQ5A 2G1MA 2D98A 4Q1RA 4LUMA 1VMJA 3GJAA 1A3KA 1S0EA 4W6XA 5FYTA 4X8NA 5CAZA 3BODA 2E32A 2XVGA 3WNKA 2GNDA 1UZZA 2EIBA 2UWAA 2GH2A 4H2AA 3ZYJB 2LALA 1JUHA 1RUH1 5IHRA 4LE4A 2AGSA 1ZYBA 2XHNA 2XUEA 1C8M2 1K3IA 5A33A 1XE8A 3I54A 4TTGA 4AGGA 1OPOA 1XNAA 2ZGQA 1HW5A 1COV3 2NQYA 5IVFA 3LFMA 3MZHA 5TSWA 1QMJA 4DUVA 1Y43B 3HIFA 2J1RA 2WT2A 3NKTA 4RL7A 3NNGA 4IE6A 1VBC3 4UOJA 5FBJA 2RVAA 4H14A 3RZZA 2YBSA 1ZZCA 5E88A 1LHNA 1ND3C 3MIHA 4QHBA 4XBQA 5I0TA 4A3XA 4COUA 4CCCA 3ZYIB 4FTSA 3B3QE 4B1MA 5I0SA 1JYWA 1G9DA 4XJ8A 5C9AA 2RS11 4RA0A 4IGQA 3R0RA 5F5AA 4QQ2A 2W2IA 3TEYA 3H0OA 2C0ZA 2ZGOA 4XJZA 3ST7A 3VLBB 1YEWA 4LHNA 1UD1A 1APNA 2WKKA 2WAAA 4DXRA 2ILMA 5EWSA 2VU9A 5FFOC 3VBUA
chains in the Genus database with same CATH topology
3MF6A 2VUJA 3MPPG 2O8QA 4B4PA 2W08A 5K9YA 1ENXA 3CLPA 4XQDA 4ES8A 5JIAA 2WNVB 3VBOC 1IPJA 2RJKA 1TME2 1VP6A 1X82A 2SBAA 2XVLA 2UWBA 4Y1UA 2XBO2 1KQRA 3VV1A 1LHOA 1ULGA 3JZVA 3B02A 2K2SA 2WNEA 1C8M1 4L11A 2BQPA 1KFUL 3WHUA 2NYYA 4R8HA 1IQAA 1DBNA 3OYWB 1MS9A 1SFNA 2PTMA 4K8FA 4QPGB 1AL23 4YW4A 2ZGSA 2WINB 3ZYGA 1PIV2 1JYCA 5FPZA 2ZBJA 1EPZA 4JGYB 2GDFA 2QKDA 5DUXA 4K1ZA 1RUG2 3N35A 3V65A 4E2QA 4YM3A 3J8F2 4LBKA 1R092 4FTBA 5T50A 1N1SA 1RJ7A 3INAA 2YPJA 4AHWA 3ZSLA 4RS5A 4DB5A 3GNEA 1M06G 1RUJ2 1RHI2 1QH7A 2AREA 2WIIB 2H0VA 4INDA 4CRQA 3V56A 2EALA 3VZNA 2ZX1A 1UAIA 3ILNA 5LEKA 4QXKA 1H8TA 1W6OA 4NOTA 3FUOA 1O4ZA 4P9LA 1RMU2 5K8SA 2HEYF 3FLPA 5EZWA 2GC0A 4Z2WA 1TME1 2LTNA 1I3HA 1OLRA 2XBO1 3H8UA 2XJQA 1XNKA 4FOWA 4P9JA 1LENA 1URXA 2D6PA 1W39A 3O0XA 2E6VA 4P9YA 4M3CB 1BVP1 1NOVA 4ONUA 1FV2A 1VJ2A 4CYDA 4ATEA 4C1XA 2VQAA 1BEV3 4X6QB 2VY0A 2X29A 2WS92 3M3OA 4P9XA 4AEDC 2D93A 4L97A 5FDBA 1PIV1 4EWDA 4Q0VA 3P3NA 2IXHA 2QVSB 5BUVA 4RGGA 3KT7A 3RG0A 1PK6B 1RUG1 2ZX0A 2FHRA 5GZDA 5DUWA 4ITCA 5A32B 3SNMA 2E7QA 3VL9A 3VBOB 4AEMA 3J8F1 1R091 4PBPA 5C4WB 2B9UA 2I2SA 1C8NA 5JDBA 4Z1VA 5AFEA 3ZFGA 1RUJ1 1RHI1 1HRI3 5H9RA 2E63A 2RMU3 3KS7A 3M1HA 4KQ7A 1RUNA 1MEC3 3WV6A 4HPKA 5CFCC 1BK1A 1Z78A 3DL3A 4MZUA 1Q8QA 1QH6A 1Q8SA 1RMU1 4FOVA 2WWSA 3HMYA 3ZFFB 4YVSA 1DQ4A 1FMD3 1OFSA 3MW4A 1Z7S3 4WVWA 5AC91 2IXKA 4W6YA 2IXIA 1CAUB 2ARBA 2BWAA 2IXCA 1OA4A 4N53A 2WS91 2DU1A 1C5IA 1QWRA 3UK9A 2QZ2A 2A6VA 4WM8A 2D97A 4NWVA 4KH9A 1FXZA 2VW1A 1ONAA 4C91A 4QGNA 2Q5TA 4XDQA 5KHJA 2WZR3 3OF1A 4RR3B 4AQ6A 4XFCA 1AR83 4PJYA 2BNMA 4QM9A 3SISA 2IC1A 4Y4YA 1PZ8A 4AFAA 1V6OA 3AMNA 4JCKA 2WSVA 3BU7A 4KWJA 2PHWA 2W0XA 4XXAA 2NMOA 4EV0A 5BNOC 5JZGB 3JUUA 4P14A 4QQLA 4RGAA 4XW3A 3T1LA 1RUC2 3WG1A 5KXEA 3IWZA 1U5ZA 4KWKA 5T55A 5FLIA 5K7PA 4AFMA 4KNCA 4AEDB 4N7UA 2ZGMA 4F83A 4XOGA 4YVWB 3EQEA 4AHYA 1O3RA 1Q8PA 2GSYA 3KCXA 4WBBA 1ZBE3 3TN93 1RC6A 2CWSA 4L2NA 1AR92 1IPKA 1N1VA 3TRSB 5FO7B 1GICA 1LR5A 4LO7A 4UW3A 3CJIC 3WW2A 1C5HA 2I45A 5JWPA 2ET1A 4PCRA 4WVMB 4CZSA 4IXLA 4QGMA 4D7SA 2ZGPA 3WLUA 5CFCB 4D7TA 1DQ0A 3BB6A 4I0WB 2WC2A 2MEV2 4TYSA 4OI2A 1N1TA 5J36A 2QE3A 2VH9A 4A7ZA 3ZXJA 4Q8LA 2ZABA 1UN1A 5EYXA 4F8AA 3R6SA 2FBEA 4Q4V2 4MSVA 3FJSA 4EJRA 4CP1A 1RUC1 4AEJA 3LGRA 5A3MA 3U10A 2D6KA 3FFZA 4FPHA 4BH9A 5T5LA 4LO8A 1SLBA 2NMNA 3KGLA 4YRDA 3VBSC 1NCRB 3AMHA 2A75A 5J09A 1NYWA 2R042 1F5JA 1EV13 1MZEA 2DTWA 3ES1A 2ZGUA 4TWTA 3WD5A 2OA2A 1H0BA 2A6YA 1JW6A 1HRV3 1LGBA 3K48A 1AR91 2A6WA 1YJKA 2WT0A 1UCXA 3GZAA 4L92A 2ZHLA 4FPOB 4J1XA 4P9GA 4DINB 1IS4A 5BNOB 2BWCA 2ERFA 2TUNA 2YDEA 2DVAA 4Q27A 2EXHA 4M3CE 5GALA 1B35B 1AR72 3C3VA 1LOBA 2GC1A 2GN3A 1PO13 1O91A 3AK0A 4W6WA 3FBMA 1AYN3 1G8WA 2MEV1 1EP0A 4QPIC 3VDDC 1ZRFA 3LOIA 4KGGA 3N4MA 3E6BA 2O8OA 4PDWC 4HSJA 4Q4Y3 3MYXA 1PGL2 5BYNA 2PA7A 2PHDA 1K5MC 4Q4X2 4Q4V1 3RS6A 2Y0IA 4AI1A 1WCDJ 3M2MA 4AE2A 4ZU5A 1C57A 1CVNA 1TMF2 4FT8A 1O7FA 4FP3A 5BNNC 4META 1POV1 2YV8A 1ZRDA 2PLV2 4XF9A 1UZYA 3WDVA 3OYWA 2R041 2XGXA 1J1LA 4QPGA 4GH4C 2RS52 3LOBA 5F5QA 1NZCA 1W2UA 4HSLA 5AVPA 1WW4A 1O3TA 4HBNA 1CAWB 1YI7A 1Q43A 2BGCA 3VBUB 2ATFA 5J3UA 4D3WA 2RS33 4K3UA 2SLIA 3NSTA 1HV0A 3JBG2 1SQ4A 1AR71 1JUIA 3ZN6A 3VBSB 1DQ6A 1QJX3 2VNRA 4XMAA 1C1FA 1FOD3 3N36A 3AZYA 5JI9A 3H1WA 3WUDA 4QQHA 3MDPA 1A8MA 1BVVA 1RUF2 1PGL1 4YM0A 2ZA9A 3DUIA 5LK5A 4Q4X1 3OPZA 2A3XA 3ILFA 2WFPA 4NO4A 2CGNA 3PMEA 2XJVA 2H6CA 4KWLA 2DVFA 3GZUC 3ZDSA 1TMF1 3LAGA 4HANA 3THTA 4IEZA 3B94A 1HLCA 2A71A 2CYFA 2PLV1 4C1WA 4CDXB 1GBGA 1H30A 4GB33 1VRH2 3G7DA 1HXS3 3QLQA 3WQ1A 1DDLA 1W6NB 5I0RA 1PGSA 2RS51 2MNGA 2D40A 4HN1A 1OHFA 2IXLA 2W52A 3WW1A 4PDWB 5A32A 2R30A 3VBOA 1H9PA 2HEWF 4CEWB 4AK3A 3S6PA 1KJLA 1K5MB 5C4WA 3TNQA 3ZFEC 1O3QA 4XBLA 3WDUA 1QXRA 3U11A 2QQPA 1RUH3 5SV5A 1GNHA 2UY8A 5JVVA 5BNNB 1RUD2 3NO8A 5FMOL 3UJOA 2HWB2 3JBG1 2NN8A 2PAMA 2ZZJA 3OGGA 3SCHA 3N3HA 4Y1ZA 1H8TB 3TYJA 3HWJA 5GLUA 1I5ZA 3ZSKA 1PO22 4PIYA 3MIDA 4GH4B 1U5YA 3KSCA 2AH2A 1RUF1 3ES4A 3ZFFA 4OI1A 2XJTA 1NQDA 1X8MA 3QOPA 5FRAA 4LO6B 2QCSB 2RS13 3VBHC 2ZGNA 4C0BA 1QOOA 4Q29A 2WNUC 2BPA2 2A6ZA 4BMEA 1VRH1 2VPVA 2H6BA 2Y38A 4WVVA 2YZ4A 1NXD1 4RQPC 4XETA 3CL1A 2I74A 5EXOA 2LM3A 2ZGTA 4G4FA 4AWDA 1O5LA 2HEVF 2VVDA 3POYA 1DZQA 2LUWA 1WMEA 3ZFGB 4BM8A 1R1A2 3ZIXA 5L19A 1NLRA 5HCAA 2D6NA 1SLAA 1YFXA 3NVCA 4RHV2 4Z82A 5E1RA 4U36A 1RUD1 1C8M3 1N3OA 3FX3A 2HWB1 3USUB 3VL8A 5JZGA 2IFRA 2ZOEB 1WW7A 1YFWA 4JQRA 4MXVA 4XF4A 4YGBA 3VHRA 1V00A 5FMOS 1PO21 3AZZA 4AEDA 5F1RA 3MF9A 2EXJA 3KB5A 4JDMA 2BBVA 1RITA 1VLNA 4KGQA 5LRRA 3PMSA 1DQ2A 5K0UC 1ZZ7A 3ZFEB 4I30A 3GZTB 5H9QA 2V5YA 1C28A 4X8PA 1G6NA 2PN5A 1JBCA 1VIWB 5E16A 3OJBA 2XJSA 4BQ1A 5DZGA 3LZZA 4WVMA 1DQ1A 4NHLA 4LR4A 4NN0A 1UIKA 3D5OA 5J48A 4AVCA 5CFCA 4LBNA 4CTEA 2EF6A 2JG9B 1G7YA 1W6QB 3AKSA 5JOXA 5I0UA 2NM1A 4U2AA 2XL9A 3D0JA 1R1A1 1TME3 1WD4A 4S2HA 2WLPA 1XNBA 2XBO3 4RHV1 4HVOA 2ARXA 2CV6A 4Y1XA 1WMFA 4Y5Z0 1PMIA 2BFUL 5CFDC 3ILRA 2WNUB 1CAXB 4R9AA 2XJPA 3FUQA 1UU5A 4GIQA 4IL7A 2DYCA 5CIRA 5BY5A 2DVGA 5GZEA 3VHNA 3V0BB 1PIV3 1YJLA 4COYA 1ULFA 4DY3A 2D7FA 1RUG3 5I8YA 3ZSMA 5GLTA 5KHHA 2JE7A 3J8F3 4HK8A 1R093 2JXAA 4CDWC 1MS5A 4YGDA 3TBDA 3SCGA 4AFCA 5J96B 3IKWA 4I2OA 2R0HA 1EY2A 2VOWA 1DF0A 4LBOA 3I7DA 1C4RA 5L7OC 4IV3C 1ZZ6A 1RUJ3 1RHI3 2WLQA 1F2NA 3IM0A 2ZX3A 1KD7A 3AMQA 5BNOA 4BWOA 1BQPA 4DS0A 3MLKA 3KGZA 3FBYA 1H1MA 3PHMA 1QU0A 2PHXA 1B35A 1ENRA 1FPN2 1RMU3 4FPEA 2XH6A 2BEOA 3C2UA 2JX9A 5CADA 3CNAA 1UU6A 1IS3A 3OY8B 1N1YA 2TNFA 3WR0A 1QXPA 4YZ1A 5GLWA 1VBE2 5AC93 4RD7A 2XVKA 4YARA 1GYKA 1WA4A 4UW4A 4EWAA 3CJIA 2WS93 5CG8A 1MZFA 2BFUS 1FNZA 4WM7C 4FP2A 1AXKA 1OA2A 4LO4B 1XYOA 2B39A 3AFKA 5DXDA 2XKOA 1OOPC 2X5IC 4ES9A 3A4UA 4Y22B 4F3JA 1A6CA 3U07A 3BPZA 4Y20B 3DN7A 3JQXA 3M3EA 4KG8A 2EXIA 3UKVA 1CAWA 3FZ3A 1NE4A 2BVVA 1QJU2 5AFBA 1QDCA 4XYXA 4GKYA 4YM2A 4XTMA 3BOPA 5DUVA 2DF7A 2DUOA 1J1TA 1AX0A 3I4IA 4I02A 5FOJB 1FPN1 2FZ2A 3VBSA 3WW4A 5FLHA 1LOFC 1S0GA 3ZN5A 3WQ0A 4LUKA 1A8DA 1BZWA 2Q8OA 2RHPA 1WLWA 1YUDA 5C6CA 1VBD2 4GWMA 3BOWA 4BMBA 2XWBB 4UBGA 5FO9B 1VBE1 3CF6E 4S2FA 2P17A 5JSPA 2A3WA 4M01A 3NJZA 4G9SB 4K9SA 1MR5A 4R4ZA 5ACA2 5L7OB 4TSVA 5ABJC 1J59A 2DCYA 5T5PA 1Q3EA 1DGRN 4AQ2A 3AP5A 4JGZB 4CDXA 1QNWA 4FSJA 3FLRA 4YGCA 4AQTA 3S7IA 4AI0A 1H2NA 2VMHA 1W6NA 1LJ7A 5BNQA 1S0CA 3B00A 4HKWA 2JE9A 1GV9A 4DQAA 1SDWA 4PDWA 4XQ4A 1QJU1 4YW2A 5E8AA 3V64A 1AJKA 3JB8A 4CEWA 3VBFC 1K5MA 1CESA 1WW6A 3NAPC 4HETA 4FAGA 2Z5WA 3LB9A 2R6QA 3JU9A 1UW8A 3VZMA 1RUC3 3ZN6B 5L36A 3VKLA 5BNNA 2DCKA 2ENRA 4M0NA 3FC0A 1BYHA 5T52A 3D8CA 2EXKA 3N7LA 2YGMA 1Q8OA 2NP0A 4XJUA 4LTAA 4FQZA 1VBA2 1ND3B 3M3QA 1GR3A 1OOPB 1O4TA 4GH4A 4CDUC 5IK4A 1VBD1 2ZMLA 4CDQC 4EN9B 2KXLA 3ZXFA 5IK5A 5KHIA 4Z07A 1GFF2 1AR93 1WCKA 4OULA 1KFXL 4WV8A 4HFSA 2A70A 2RJLA 1D4VB 2VG9A 5ACA1 3PLQA 2DVDA 5CVRA 5HCBA 1XNDA 2B46X 3OD0A 4N90A 4XF0A 4JRLA 5D8AC 2GNBA 4FOYA 3VBRC 1NA1C 1SLLA 1QXJA 3GALA 3WXPA 4DY5A 1JH5A 1REDA 2MEV3 1WLDA 3LWCA 4KU8A 4QMAA 5BV6A 3MW2A 1GLHA 5DZEA 5KHGA 1LOCA 2FMDA 4XXPA 3FLTA 4XIOA 4Q4V3 3S7EA 1YHFA 2WJSA 1D4M2 3IPVB 1XYNA 3WINE 5FQ0B 1POV3 1LEDA 2OZ6A 4XPVA 3OTFA 3USUA 2WL1A 2Z69A 3N7MA 4OUMA 3E5QA 1IS6A 4EWEA 1S55A 2R043 2ZPXA 1VBA1 4PLMA 2XJRA 4NVPA 1ZX5A 4BE3A 3AKQA 3WQ7A 4LA3A 4YYOA 4FAHA 2P34A 4DOUA 2QDNA 1PGW2 4ZU4A 2GAUA 3VBFB 4YZ3A 3ZFEA 3NAPB 3AX4A 4XHBA 1G9BA 5JPNB 5JSRA 2ZX4A 3B93A 1H4HA 4I09A 5GZFA 2QFEA 3Q9OA 3RI9A 5B2GB 1AR73 4Q0QA 2GMMA 3FHIB 4IQPA 1AYM2 5KC6A 4LBJA 2ZHNA 3GYDA 1VAKA 4XBNA 2JG9A 3AKRA 4YW5A 1W6QA 2DUPA 3O0WA 4Q4X3 4AFDA 5CB7A 4UBHA 1F31A 4FPKA 2CGPA 4BLJA 1BXHA 2H0BA 1D4M1 2JG8C 1X33A 1TMF3 5SV8A 1YI9A 2ZHMA 1XU2A 2GNMA 1D0GA 2PLV3 1SLTA 2WNUA 1CAXA 1MACA 4ATFA 4A2UA 1NA1B 4YZ2A 3CEWA 5F6LB 3PVEA 4RQPA 3V0BA 2RS53