1WLFA

Structure of the n-terminal domain of pex1 aaa-atpase: characterization of a putative adaptor-binding domain
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
167
structure length
164
Chain Sequence
GGAVVTVAFTNARDCFLHLPRRLVAQLHLLQNQAIEVASDHQPTYLSWVEGRHFNENVAEINRQVGQKLGLSSGDQVFLRPCSHVVSCQQVEVEPLSADDWEILELHAISLEQHLLDQIRIVFPKAVVPIWVDQQTYIFIQIVTLMPAAPYGRLETNTKLLIQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the N-terminal Domain of PEX1 AAA-ATPase: CHARACTERIZATION OF A PUTATIVE ADAPTOR-BINDING DOMAIN
pubmed doi rcsb
source organism Mus musculus
molecule tags Protein transport
molecule keywords Peroxisome biogenesis factor 1
total genus 42
structure length 164
sequence length 167
ec nomenclature
pdb deposition date 2004-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09262 PEX-1N Peroxisome biogenesis factor 1, N-terminal
A PF09263 PEX-2N Peroxisome biogenesis factor 1, N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.20 Mainly Beta Beta Barrel Barwin-like endoglucanases Barwin-like endoglucanases 1wlfA01
3.10.330.10 Alpha Beta Roll Vcp-like ATPase; Chain A, domain 2 Vcp-like ATPase; Chain A, domain 2 1wlfA02
1PQHA 2JIMA 2JIRA 3HU2A 2E7ZA 1AA6A 4AONB 2PMZA 5T5MD 3OUGA 2VPYA 5FTLA 1WCMA 3ML1A 1I50A 2PJHB 4CS0A 2VUMA 2E2IA 1R9TA 1Y1WA 5FTKA 2V3VA 1FDIA 5FTNA 1E32A 1TWFA 2R7ZA 4CRZA 1PPYA 3GTMA 1IW7D 3FKIA 1FDOA 2NAPA 2VPZA 5DYIA 1H0HA 3HU3A 1E60A 2IV2X 3GTJA 4KO8A 1G8KA 2YU9A 1DMRA 1Y5IA 2C45A 2VPWA 2WB1A 5B6CA 2KI8A 3GTOA 1E5VA 3HU1A 5FTJA 1QCSA 3PLXB 3QQ7A 2NVYA 1WLFA 3TM7B 3H0GA 5DYGA 2JIPA 2WAQA 4KODA 1S3SA 1PQFA 3O5AA 3GTPA 3GTGA 4KDLA 1I3QA 1YLEA 1CZ5A 3TIWA 3IR6A 1SIWA 3IR7A 3GTKA 3DMRA 3IR5A 2EEOB 1E61A 1KQGA 1DMSA 2JA6A 2YUJA 1PYQA 3GTLA 2NVXA 1SFOA 4CRYG 4D7ZB 1TWCA 2V45A 2E2HA 1E18A 1Y4ZA 1PT1A 3QWZA 1PQEA 4GA6A 4QIWA 4DMRA 2R92A 1TWGA 1H5NA 3CQZA 4KLNA 2JA7A 2Y0SA 4KDIA 2B63A 1R7RA 1Y1VA 3QC8A 1UHEA 1G8JA 1CZ4A 2VPXA 1TMOA 4AZDA 5C18A 1VC3B 2DMRA 2JIOA 3QQ8A 2NYAA 1UHDA 5C1BA 5GLFA 1K83A 4AOKB 1OGYA 1TWAA 3CF2A 1AW8B 1PT0A 2JV2A 1QDNA 4AAYA 2R93A 1R27A 1PYUB 2JA5A 4GA5A 1ZC1A 4RV0A 1TWHA 1Q16A 1EU1A 3GTQA 4C2MA 5T5ID 4AYBA 5FTMA 3HKZA 2JIQA 5EPPA 1CR5A 1KQFA
chains in the Genus database with same CATH superfamily
1PQHA 2G5DA 3CZBA 2JIMA 1OA7A 2JIRA 4JJOA 2Q19X 2QQRA 3HU2A 4FG2A 2E7ZA 1AA6A 4AONB 2PMZA 5T5MD 3OUGA 3X2HA 1BW4A 3FPTA 1WC2A 2VPYA 5FTLA 1WCMA 2A69D 3ML1A 5D6XA 4ENGA 2CW0D 1I50A 5D6YA 5ERGB 2PJHB 2MM0A 4CS0A 2VUMA 2E2IA 2ENGA 2G6GA 1R9TA 5FTKA 1Y1WA 4FIBA 2V3VA 1FDIA 3FPUA 3MB5A 5FTNA 4AQ7A 1E32A 1TWFA 2R7ZA 1HD5A 3X2OA 4CRZA 1PPYA 3GTMA 1SMYD 2LW6A 1IW7D 3FKIA 2XDPA 2Q18X 1YNJD 4JP7A 1FDOA 2NAPA 2VPZA 5DYIA 3SUKA 1H0HA 3HU3A 3X2KA 1E60A 2IV2X 3GTJA 4KO8A 2A68D 1G8KA 4ARCA 2YU9A 1I9GA 1DMRA 1Y5IA 2C45A 2VPWA 2WB1A 5B6CA 2KI8A 1N10A 3GTOA 5GLYA 1E5VA 3HU1A 2PICA 5FTJA 2QQSA 1QCSA 3PLXB 5EQJB 3QQ7A 2NVYA 1WLFA 4FG4A 3TM7B 3H0GA 5DYGA 2JIPA 5CCBA 2WAQA 4ARIA 4KODA 5CD1A 1S3SA 1PQFA 3O5AA 3GTPA 3GTGA 4KDLA 1I3QA 2PNWA 1YLEA 4FFTA 1CZ5A 3SUMA 1YNND 3TIWA 3IR6A 1SIWA 3IR7A 3ZGZA 3GTKA 4JP6A 3DMRA 3SUJA 3IR5A 2BE5D 2EEOB 1E61A 2Q1CX 1KQGA 2BH0A 1DMSA 2YUJA 3X2GA 2JA6A 3ZJTA 4NOHA 1PYQA 3GTLA 2NVXA 4AS1A 5D6WA 3ZJVA 1SFOA 3FPRA 4CRYG 4D7ZB 1TWCA 2V45A 2E2HA 1E18A 1Y4ZA 1PT1A 3QWZA 1PQEA 4GA6A 4QIWA 4DMRA 2R92A 3BQBA 1TWGA 1H5NA 2A6ED 3CQZA 4KLNA 3X2NA 2JA7A 2Y0SA 4KDIA 2O5JD 2B63A 3X2JA 1R7RA 1Y1VA 3X2MA 3QC8A 5H4UA 1UHEA 2PI8A 1G8JA 1CZ4A 5GM9A 2VPXA 1OA9A 1TMOA 2KQAA 4AZDA 2MM2A 5C18A 1VC3B 2Q1DX 2PWYA 3X2IA 4UC4A 2DMRA 2HCZX 2GF7A 2JIOA 3X2PA 4L48A 4JS7A 4FERA 3ZJUA 3QQ8A 2NYAA 1UHDA 5C1BA 3M3GA 5GLFA 3X2LA 1K83A 2YVLA 4AOKB 1OGYA 1TWAA 3CF2A 1AW8B 2B25A 2Q1AX 1PT0A 1ZYRD 2JV2A 1QDNA 3SULA 3D30A 3ENGA 4AAYA 2R93A 1R27A 2A6HD 4JCWA 1PYUB 1BW3A 2PJJA 2KY9A 3LGAA 2GFAA 2JA5A 5CCXA 4GA5A 1ZC1A 4RV0A 1L8FA 1TWHA 2AE0X 2GAEA 1Q16A 4AVRA 1EU1A 3GTQA 3LHDA 4ZM7A 4C2MA 4CQNA 5T5ID 4AYBA 5FTMA 5GLXA 3HKZA 2JIQA 5EPPA 1O54A 1CR5A 1KQFA
chains in the Genus database with same CATH topology
1PQHA 2G5DA 3CZBA 2JIMA 2JIRA 2Q19X 2QQRA 3HU2A 2E7ZA 1AA6A 4AONB 2PMZA 5T5MD 3OUGA 3FPTA 2VPYA 5FTLA 1WCMA 2A69D 3ML1A 5D6XA 5D6YA 2CW0D 1I50A 5ERGB 2PJHB 2MM0A 4CS0A 2VUMA 2E2IA 1R9TA 2G6GA 1Y1WA 5FTKA 4FIBA 2V3VA 1FDIA 3FPUA 3MB5A 5FTNA 4AQ7A 1E32A 1TWFA 2R7ZA 4CRZA 1PPYA 3GTMA 1SMYD 2LW6A 1IW7D 3FKIA 2XDPA 2Q18X 1YNJD 1FDOA 2NAPA 2VPZA 5DYIA 1H0HA 3HU3A 1E60A 2IV2X 3GTJA 4KO8A 2A68D 1G8KA 4ARCA 2YU9A 1I9GA 1DMRA 1Y5IA 2C45A 2VPWA 2WB1A 5B6CA 2KI8A 3GTOA 1E5VA 3HU1A 2PICA 5FTJA 2QQSA 1QCSA 3PLXB 5EQJB 3QQ7A 2NVYA 1WLFA 3TM7B 3H0GA 5DYGA 2JIPA 5CCBA 2WAQA 4ARIA 4KODA 5CD1A 1S3SA 1PQFA 3O5AA 3GTPA 3GTGA 4KDLA 1I3QA 2PNWA 1YLEA 1CZ5A 1YNND 3TIWA 3IR6A 1SIWA 3IR7A 3ZGZA 3GTKA 3DMRA 3IR5A 2BE5D 2EEOB 1E61A 2Q1CX 1KQGA 1DMSA 2YUJA 2JA6A 3ZJTA 4NOHA 1PYQA 3GTLA 2NVXA 4AS1A 5D6WA 3ZJVA 1SFOA 3FPRA 4CRYG 4D7ZB 1TWCA 2V45A 2E2HA 1E18A 1Y4ZA 1PT1A 3QWZA 1PQEA 4GA6A 4QIWA 4DMRA 2R92A 3BQBA 1TWGA 1H5NA 2A6ED 3CQZA 4KLNA 2JA7A 2Y0SA 4KDIA 2O5JD 2B63A 1R7RA 1Y1VA 3QC8A 1UHEA 2PI8A 1G8JA 1CZ4A 2VPXA 1TMOA 4AZDA 2MM2A 5C18A 1VC3B 2Q1DX 2PWYA 4UC4A 2DMRA 2GF7A 2JIOA 3ZJUA 3QQ8A 2NYAA 1UHDA 5C1BA 5GLFA 1K83A 2YVLA 4AOKB 1OGYA 1TWAA 3CF2A 1AW8B 2B25A 2Q1AX 1PT0A 1ZYRD 2JV2A 1QDNA 4AAYA 2R93A 1R27A 2A6HD 1PYUB 2PJJA 2KY9A 3LGAA 2GFAA 2JA5A 5CCXA 4GA5A 1ZC1A 4RV0A 1TWHA 2AE0X 2GAEA 1Q16A 1EU1A 3GTQA 3LHDA 4CQNA 4C2MA 5T5ID 4AYBA 5FTMA 3HKZA 2JIQA 5EPPA 1O54A 1CR5A 1KQFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PQH A;  2JIM A;  2JIR A;  3HU2 A;  2E7Z A;  1AA6 A;  4AON B;  2PMZ A;  5T5M D;  3OUG A;  2VPY A;  5FTL A;  1WCM A;  3ML1 A;  1I50 A;  2PJH B;  4CS0 A;  2VUM A;  2E2I A;  1R9T A;  1Y1W A;  5FTK A;  2V3V A;  1FDI A;  5FTN A;  1E32 A;  1TWF A;  2R7Z A;  4CRZ A;  1PPY A;  3GTM A;  1IW7 D;  3FKI A;  1FDO A;  2NAP A;  2VPZ A;  5DYI A;  1H0H A;  3HU3 A;  1E60 A;  2IV2 X;  3GTJ A;  4KO8 A;  1G8K A;  2YU9 A;  1DMR A;  1Y5I A;  2C45 A;  2VPW A;  2WB1 A;  5B6C A;  2KI8 A;  3GTO A;  1E5V A;  3HU1 A;  5FTJ A;  1QCS A;  3PLX B;  3QQ7 A;  2NVY A;  1WLF A;  3TM7 B;  3H0G A;  5DYG A;  2JIP A;  2WAQ A;  4KOD A;  1S3S A;  1PQF A;  3O5A A;  3GTP A;  3GTG A;  4KDL A;  1I3Q A;  1YLE A;  1CZ5 A;  3TIW A;  3IR6 A;  1SIW A;  3IR7 A;  3GTK A;  3DMR A;  3IR5 A;  2EEO B;  1E61 A;  1KQG A;  1DMS A;  2JA6 A;  2YUJ A;  1PYQ A;  3GTL A;  2NVX A;  1SFO A;  4CRY G;  4D7Z B;  1TWC A;  2V45 A;  2E2H A;  1E18 A;  1Y4Z A;  1PT1 A;  3QWZ A;  1PQE A;  4GA6 A;  4QIW A;  4DMR A;  2R92 A;  1TWG A;  1H5N A;  3CQZ A;  4KLN A;  2JA7 A;  2Y0S A;  4KDI A;  2B63 A;  1R7R A;  1Y1V A;  3QC8 A;  1UHE A;  1G8J A;  1CZ4 A;  2VPX A;  1TMO A;  4AZD A;  5C18 A;  1VC3 B;  2DMR A;  2JIO A;  3QQ8 A;  2NYA A;  1UHD A;  5C1B A;  5GLF A;  1K83 A;  4AOK B;  1OGY A;  1TWA A;  3CF2 A;  1AW8 B;  1PT0 A;  2JV2 A;  1QDN A;  4AAY A;  2R93 A;  1R27 A;  1PYU B;  2JA5 A;  4GA5 A;  1ZC1 A;  4RV0 A;  1TWH A;  1Q16 A;  1EU1 A;  3GTQ A;  4C2M A;  5T5I D;  4AYB A;  5FTM A;  3HKZ A;  2JIQ A;  5EPP A;  1CR5 A;  1KQF A; 
#chains in the Genus database with same CATH topology
 1PQH A;  2G5D A;  3CZB A;  2JIM A;  1OA7 A;  2JIR A;  4JJO A;  2Q19 X;  2QQR A;  3HU2 A;  4FG2 A;  2E7Z A;  1AA6 A;  4AON B;  2PMZ A;  5T5M D;  3OUG A;  3X2H A;  1BW4 A;  3FPT A;  1WC2 A;  2VPY A;  5FTL A;  1WCM A;  2A69 D;  3ML1 A;  5D6X A;  4ENG A;  2CW0 D;  1I50 A;  5D6Y A;  5ERG B;  2PJH B;  2MM0 A;  4CS0 A;  2VUM A;  2E2I A;  2ENG A;  2G6G A;  1R9T A;  5FTK A;  1Y1W A;  4FIB A;  2V3V A;  1FDI A;  3FPU A;  3MB5 A;  5FTN A;  4AQ7 A;  1E32 A;  1TWF A;  2R7Z A;  1HD5 A;  3X2O A;  4CRZ A;  1PPY A;  3GTM A;  1SMY D;  2LW6 A;  1IW7 D;  3FKI A;  2XDP A;  2Q18 X;  1YNJ D;  4JP7 A;  1FDO A;  2NAP A;  2VPZ A;  5DYI A;  3SUK A;  1H0H A;  3HU3 A;  3X2K A;  1E60 A;  2IV2 X;  3GTJ A;  4KO8 A;  2A68 D;  1G8K A;  4ARC A;  2YU9 A;  1I9G A;  1DMR A;  1Y5I A;  2C45 A;  2VPW A;  2WB1 A;  5B6C A;  2KI8 A;  1N10 A;  3GTO A;  5GLY A;  1E5V A;  3HU1 A;  2PIC A;  5FTJ A;  2QQS A;  1QCS A;  3PLX B;  5EQJ B;  3QQ7 A;  2NVY A;  1WLF A;  4FG4 A;  3TM7 B;  3H0G A;  5DYG A;  2JIP A;  5CCB A;  2WAQ A;  4ARI A;  4KOD A;  5CD1 A;  1S3S A;  1PQF A;  3O5A A;  3GTP A;  3GTG A;  4KDL A;  1I3Q A;  2PNW A;  1YLE A;  4FFT A;  1CZ5 A;  3SUM A;  1YNN D;  3TIW A;  3IR6 A;  1SIW A;  3IR7 A;  3ZGZ A;  3GTK A;  4JP6 A;  3DMR A;  3SUJ A;  3IR5 A;  2BE5 D;  2EEO B;  1E61 A;  2Q1C X;  1KQG A;  2BH0 A;  1DMS A;  2YUJ A;  3X2G A;  2JA6 A;  3ZJT A;  4NOH A;  1PYQ A;  3GTL A;  2NVX A;  4AS1 A;  5D6W A;  3ZJV A;  1SFO A;  3FPR A;  4CRY G;  4D7Z B;  1TWC A;  2V45 A;  2E2H A;  1E18 A;  1Y4Z A;  1PT1 A;  3QWZ A;  1PQE A;  4GA6 A;  4QIW A;  4DMR A;  2R92 A;  3BQB A;  1TWG A;  1H5N A;  2A6E D;  3CQZ A;  4KLN A;  3X2N A;  2JA7 A;  2Y0S A;  4KDI A;  2O5J D;  2B63 A;  3X2J A;  1R7R A;  1Y1V A;  3X2M A;  3QC8 A;  5H4U A;  1UHE A;  2PI8 A;  1G8J A;  1CZ4 A;  5GM9 A;  2VPX A;  1OA9 A;  1TMO A;  2KQA A;  4AZD A;  2MM2 A;  5C18 A;  1VC3 B;  2Q1D X;  2PWY A;  3X2I A;  4UC4 A;  2DMR A;  2HCZ X;  2GF7 A;  2JIO A;  3X2P A;  4L48 A;  4JS7 A;  4FER A;  3ZJU A;  3QQ8 A;  2NYA A;  1UHD A;  5C1B A;  3M3G A;  5GLF A;  3X2L A;  1K83 A;  2YVL A;  4AOK B;  1OGY A;  1TWA A;  3CF2 A;  1AW8 B;  2B25 A;  2Q1A X;  1PT0 A;  1ZYR D;  2JV2 A;  1QDN A;  3SUL A;  3D30 A;  3ENG A;  4AAY A;  2R93 A;  1R27 A;  2A6H D;  4JCW A;  1PYU B;  1BW3 A;  2PJJ A;  2KY9 A;  3LGA A;  2GFA A;  2JA5 A;  5CCX A;  4GA5 A;  1ZC1 A;  4RV0 A;  1L8F A;  1TWH A;  2AE0 X;  2GAE A;  1Q16 A;  4AVR A;  1EU1 A;  3GTQ A;  3LHD A;  4ZM7 A;  4C2M A;  4CQN A;  5T5I D;  4AYB A;  5FTM A;  5GLX A;  3HKZ A;  2JIQ A;  5EPP A;  1O54 A;  1CR5 A;  1KQF A; 
#chains in the Genus database with same CATH homology
 1PQH A;  2G5D A;  3CZB A;  2JIM A;  2JIR A;  2Q19 X;  2QQR A;  3HU2 A;  2E7Z A;  1AA6 A;  4AON B;  2PMZ A;  5T5M D;  3OUG A;  3FPT A;  2VPY A;  5FTL A;  1WCM A;  2A69 D;  3ML1 A;  5D6X A;  5D6Y A;  2CW0 D;  1I50 A;  5ERG B;  2PJH B;  2MM0 A;  4CS0 A;  2VUM A;  2E2I A;  1R9T A;  2G6G A;  1Y1W A;  5FTK A;  4FIB A;  2V3V A;  1FDI A;  3FPU A;  3MB5 A;  5FTN A;  4AQ7 A;  1E32 A;  1TWF A;  2R7Z A;  4CRZ A;  1PPY A;  3GTM A;  1SMY D;  2LW6 A;  1IW7 D;  3FKI A;  2XDP A;  2Q18 X;  1YNJ D;  1FDO A;  2NAP A;  2VPZ A;  5DYI A;  1H0H A;  3HU3 A;  1E60 A;  2IV2 X;  3GTJ A;  4KO8 A;  2A68 D;  1G8K A;  4ARC A;  2YU9 A;  1I9G A;  1DMR A;  1Y5I A;  2C45 A;  2VPW A;  2WB1 A;  5B6C A;  2KI8 A;  3GTO A;  1E5V A;  3HU1 A;  2PIC A;  5FTJ A;  2QQS A;  1QCS A;  3PLX B;  5EQJ B;  3QQ7 A;  2NVY A;  1WLF A;  3TM7 B;  3H0G A;  5DYG A;  2JIP A;  5CCB A;  2WAQ A;  4ARI A;  4KOD A;  5CD1 A;  1S3S A;  1PQF A;  3O5A A;  3GTP A;  3GTG A;  4KDL A;  1I3Q A;  2PNW A;  1YLE A;  1CZ5 A;  1YNN D;  3TIW A;  3IR6 A;  1SIW A;  3IR7 A;  3ZGZ A;  3GTK A;  3DMR A;  3IR5 A;  2BE5 D;  2EEO B;  1E61 A;  2Q1C X;  1KQG A;  1DMS A;  2YUJ A;  2JA6 A;  3ZJT A;  4NOH A;  1PYQ A;  3GTL A;  2NVX A;  4AS1 A;  5D6W A;  3ZJV A;  1SFO A;  3FPR A;  4CRY G;  4D7Z B;  1TWC A;  2V45 A;  2E2H A;  1E18 A;  1Y4Z A;  1PT1 A;  3QWZ A;  1PQE A;  4GA6 A;  4QIW A;  4DMR A;  2R92 A;  3BQB A;  1TWG A;  1H5N A;  2A6E D;  3CQZ A;  4KLN A;  2JA7 A;  2Y0S A;  4KDI A;  2O5J D;  2B63 A;  1R7R A;  1Y1V A;  3QC8 A;  1UHE A;  2PI8 A;  1G8J A;  1CZ4 A;  2VPX A;  1TMO A;  4AZD A;  2MM2 A;  5C18 A;  1VC3 B;  2Q1D X;  2PWY A;  4UC4 A;  2DMR A;  2GF7 A;  2JIO A;  3ZJU A;  3QQ8 A;  2NYA A;  1UHD A;  5C1B A;  5GLF A;  1K83 A;  2YVL A;  4AOK B;  1OGY A;  1TWA A;  3CF2 A;  1AW8 B;  2B25 A;  2Q1A X;  1PT0 A;  1ZYR D;  2JV2 A;  1QDN A;  4AAY A;  2R93 A;  1R27 A;  2A6H D;  1PYU B;  2PJJ A;  2KY9 A;  3LGA A;  2GFA A;  2JA5 A;  5CCX A;  4GA5 A;  1ZC1 A;  4RV0 A;  1TWH A;  2AE0 X;  2GAE A;  1Q16 A;  1EU1 A;  3GTQ A;  3LHD A;  4CQN A;  4C2M A;  5T5I D;  4AYB A;  5FTM A;  3HKZ A;  2JIQ A;  5EPP A;  1O54 A;  1CR5 A;  1KQF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...