1WLFA

Structure of the n-terminal domain of pex1 aaa-atpase: characterization of a putative adaptor-binding domain
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
167
structure length
164
Chain Sequence
b'GGAVVTVAFTNARDCFLHLPRRLVAQLHLLQNQAIEVASDHQPTYLSWVEGRHFNENVAEINRQVGQKLGLSSGDQVFLRPCSHVVSCQQVEVEPLSADDWEILELHAISLEQHLLDQIRIVFPKAVVPIWVDQQTYIFIQIVTLMPAAPYGRLETNTKLLIQP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peroxisome biogenesis factor 1
publication title Structure of the N-terminal Domain of PEX1 AAA-ATPase: CHARACTERIZATION OF A PUTATIVE ADAPTOR-BINDING DOMAIN
pubmed doi rcsb
source organism Mus musculus
molecule tags Protein transport
total genus 42
structure length 164
sequence length 167
ec nomenclature
pdb deposition date 2004-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09262 PEX-1N Peroxisome biogenesis factor 1, N-terminal
A PF09263 PEX-2N Peroxisome biogenesis factor 1, N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.20 Mainly Beta Beta Barrel Barwin-like endoglucanases Barwin-like endoglucanases 1wlfA01
3.10.330.10 Alpha Beta Roll Vcp-like ATPase; Chain A, domain 2 Vcp-like ATPase; Chain A, domain 2 1wlfA02
5C18A 3HU1A 4GA5A 3QQ7A 2V45A 3IR7A 1K83A 2DMRA 5DYGA 1S3SA 2JV2A 4CRZA 1SIWA 1TWAA 5C1BA 2E2HA 1PT0A 3QQ8A 5EPPA 3GTKA 1G8JA 2JIMA 3IR5A 2JIPA 2WAQA 4QIWA 1DMSA 1PPYA 5FTLA 1KQFA 1TWCA 1IW7D 1TWGA 4AAYA 1SFOA 1Y5IA 1Y4ZA 2JIRA 4KDLA 2WB1A 1TMOA 3TM7B 3DMRA 1Y1VA 2V3VA 1E18A 2JA7A 1I50A 1Q16A 4C2MA 2R93A 4GA6A 5FTKA 1WCMA 5B6CA 3HU3A 2C45A 1QDNA 4DMRA 2NVYA 2VPWA 2YUJA 2E7ZA 4KDIA 4AONB 2NVXA 3IR6A 1E32A 1WLFA 4AOKB 4CS0A 2EEOB 3H0GA 1VC3B 3GTMA 1FDIA 2VPZA 4AZDA 2JA6A 3HKZA 1ZC1A 3O5AA 1EU1A 2VUMA 5DYIA 3CF2A 2VPXA 3QC8A 1UHDA 1PT1A 1CZ5A 1DMRA 5T5MD 3GTQA 4D7ZB 2VPYA 4CRYG 3GTPA 1YLEA 3GTGA 4AYBA 1AW8B 2NAPA 1PYUB 1R7RA 5GLFA 2R7ZA 4KODA 3GTOA 3OUGA 3FKIA 1Y1WA 2NYAA 1E60A 2PMZA 5T5ID 2JIQA 2R92A 5FTNA 1FDOA 3TIWA 3HU2A 2E2IA 2B63A 4KLNA 1QCSA 3PLXB 3ML1A 1I3QA 2KI8A 2PJHB 1H5NA 1PYQA 1PQEA 4KO8A 1G8KA 5FTJA 1E61A 1E5VA 1CZ4A 1TWFA 1AA6A 2JA5A 5FTMA 3GTJA 1PQFA 2YU9A 1R9TA 1CR5A 2Y0SA 1TWHA 1KQGA 2IV2X 3CQZA 1PQHA 2JIOA 3QWZA 1OGYA 1H0HA 1R27A 3GTLA 1UHEA 4RV0A
chains in the Genus database with same CATH superfamily
5C18A 2XDPA 1L8FA 2ENGA 3HU1A 4GA5A 3MB5A 3SUMA 3QQ7A 2V45A 5EQJB 3X2OA 3IR7A 4UC4A 4FERA 2Q1DX 1K83A 2DMRA 5DYGA 1S3SA 5CD1A 2JV2A 4CRZA 1SIWA 1TWAA 5C1BA 1ZYRD 2E2HA 1PT0A 3QQ8A 5EPPA 2PWYA 1HD5A 3GTKA 1G8JA 2JIMA 3IR5A 2JIPA 2WAQA 4JS7A 4QIWA 1DMSA 1PPYA 2MM0A 2YVLA 5D6WA 5FTLA 1BW4A 1KQFA 1OA7A 1SMYD 1TWCA 1IW7D 1TWGA 3X2GA 2GF7A 3FPRA 4AAYA 1SFOA 1Y5IA 1Y4ZA 2JIRA 4KDLA 1TMOA 2WB1A 3TM7B 3DMRA 2A69D 1YNJD 1Y1VA 3M3GA 2V3VA 1E18A 2JA7A 2PICA 3ENGA 1Q16A 3X2KA 1I50A 5D6XA 4C2MA 2R93A 2BE5D 1BW3A 4GA6A 5CCBA 2Q19X 5FTKA 3ZGZA 2CW0D 4L48A 1WCMA 5B6CA 3HU3A 2C45A 1QDNA 4FG2A 4DMRA 2PJJA 2NVYA 3SUJA 2VPWA 2HCZX 2YUJA 2GAEA 2E7ZA 2A6HD 4KDIA 2KY9A 5GLXA 2A6ED 4AONB 3IR6A 1E32A 1WLFA 4AOKB 4CS0A 2EEOB 3H0GA 2NVXA 1VC3B 3GTMA 1FDIA 2VPZA 2QQSA 3X2NA 4AZDA 2JA6A 3HKZA 4FIBA 1ZC1A 3O5AA 3X2HA 1EU1A 3X2JA 2AE0X 2VUMA 1I9GA 1N10A 5DYIA 3X2LA 3CF2A 2VPXA 3QC8A 1UHDA 5H4UA 1PT1A 1CZ5A 1DMRA 5T5MD 3GTQA 2GFAA 4D7ZB 2VPYA 4JP6A 4CRYG 5D6YA 3GTPA 1YLEA 3GTGA 4JJOA 1O54A 5CCXA 4AQ7A 4AYBA 1AW8B 2NAPA 3SUKA 2Q1CX 1PYUB 1R7RA 4JCWA 5GLFA 2R7ZA 4KODA 3GTOA 3OUGA 3FKIA 4AS1A 3ZJVA 2MM2A 1Y1WA 2NYAA 2B25A 3CZBA 1E60A 2PMZA 5T5ID 1OA9A 2JIQA 2R92A 4JP7A 4NOHA 5FTNA 1FDOA 3TIWA 1WC2A 2KQAA 3HU2A 2Q1AX 3LHDA 2E2IA 2B63A 4KLNA 5GM9A 1QCSA 3PLXB 5ERGB 3SULA 2O5JD 3ML1A 1I3QA 4AVRA 2A68D 2KI8A 2PJHB 1H5NA 1PYQA 1PQEA 4ENGA 4KO8A 3ZJTA 3X2MA 4ARCA 3X2PA 3LGAA 2G6GA 4ZM7A 1G8KA 5FTJA 1E61A 2PI8A 2QQRA 4CQNA 1E5VA 2PNWA 1CZ4A 3X2IA 1TWFA 1AA6A 2JA5A 5FTMA 3GTJA 3BQBA 4FFTA 2Q18X 1PQFA 2YU9A 4ARIA 3D30A 1R9TA 4FG4A 1CR5A 2Y0SA 1TWHA 3FPUA 1KQGA 2IV2X 3CQZA 1PQHA 2JIOA 3ZJUA 2LW6A 3QWZA 1OGYA 2G5DA 5GLYA 2BH0A 3FPTA 1H0HA 1R27A 3GTLA 1UHEA 4RV0A 1YNND
chains in the Genus database with same CATH topology
5C18A 2XDPA 3HU1A 4GA5A 3MB5A 3QQ7A 2V45A 5EQJB 3IR7A 4UC4A 2Q1DX 1K83A 2DMRA 5DYGA 1S3SA 5CD1A 2JV2A 4CRZA 1SIWA 1TWAA 5C1BA 1ZYRD 2E2HA 1PT0A 3QQ8A 5EPPA 2PWYA 3GTKA 1G8JA 2JIMA 3IR5A 2JIPA 2WAQA 4QIWA 2MM0A 1DMSA 1PPYA 2YVLA 5D6WA 5FTLA 1KQFA 1SMYD 1TWCA 1IW7D 1TWGA 2GF7A 3FPRA 4AAYA 1SFOA 1Y5IA 1Y4ZA 2JIRA 4KDLA 1TMOA 2WB1A 3TM7B 3DMRA 2A69D 1YNJD 1Y1VA 2V3VA 1E18A 2JA7A 2PICA 1I50A 1Q16A 5D6XA 4C2MA 2R93A 2BE5D 4GA6A 5CCBA 2Q19X 5FTKA 3ZGZA 2CW0D 1WCMA 5B6CA 3HU3A 2C45A 1QDNA 4DMRA 2PJJA 2NVYA 2VPWA 2YUJA 2GAEA 2E7ZA 2A6HD 4KDIA 2KY9A 2A6ED 4AONB 3IR6A 1E32A 1WLFA 4AOKB 4CS0A 2EEOB 3H0GA 2NVXA 1VC3B 3GTMA 1FDIA 2VPZA 2QQSA 4AZDA 2JA6A 3HKZA 4FIBA 1ZC1A 3O5AA 1EU1A 2VUMA 2AE0X 1I9GA 5DYIA 3CF2A 2VPXA 3QC8A 1UHDA 1PT1A 1CZ5A 1DMRA 5T5MD 3GTQA 2GFAA 4D7ZB 2VPYA 4CRYG 5D6YA 3GTPA 1YLEA 3GTGA 5CCXA 1O54A 4AQ7A 4AYBA 1AW8B 2NAPA 2Q1CX 1PYUB 1R7RA 5GLFA 2R7ZA 4KODA 3GTOA 3OUGA 3FKIA 4AS1A 3ZJVA 2MM2A 1Y1WA 2NYAA 2B25A 3CZBA 1E60A 2PMZA 5T5ID 2JIQA 2R92A 4NOHA 5FTNA 1FDOA 3TIWA 2Q1AX 3LHDA 3HU2A 2E2IA 2B63A 4KLNA 1QCSA 3PLXB 5ERGB 2O5JD 3ML1A 1I3QA 2A68D 2KI8A 2PJHB 1H5NA 1PYQA 1PQEA 3ZJTA 4KO8A 4ARCA 3LGAA 2G6GA 1G8KA 5FTJA 1E61A 2PI8A 2QQRA 4CQNA 1E5VA 2PNWA 1CZ4A 1TWFA 1AA6A 2JA5A 5FTMA 3GTJA 3BQBA 2Q18X 1PQFA 2YU9A 4ARIA 1R9TA 1CR5A 2Y0SA 1TWHA 3FPUA 1KQGA 2IV2X 3CQZA 1PQHA 2JIOA 3ZJUA 2LW6A 3QWZA 1OGYA 2G5DA 3FPTA 1H0HA 1R27A 3GTLA 1UHEA 4RV0A 1YNND
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5C18 A;  3HU1 A;  4GA5 A;  3QQ7 A;  2V45 A;  3IR7 A;  1K83 A;  2DMR A;  5DYG A;  1S3S A;  2JV2 A;  4CRZ A;  1SIW A;  1TWA A;  5C1B A;  2E2H A;  1PT0 A;  3QQ8 A;  5EPP A;  3GTK A;  1G8J A;  2JIM A;  3IR5 A;  2JIP A;  2WAQ A;  4QIW A;  1DMS A;  1PPY A;  5FTL A;  1KQF A;  1TWC A;  1IW7 D;  1TWG A;  4AAY A;  1SFO A;  1Y5I A;  1Y4Z A;  2JIR A;  4KDL A;  2WB1 A;  1TMO A;  3TM7 B;  3DMR A;  1Y1V A;  2V3V A;  1E18 A;  2JA7 A;  1I50 A;  1Q16 A;  4C2M A;  2R93 A;  4GA6 A;  5FTK A;  1WCM A;  5B6C A;  3HU3 A;  2C45 A;  1QDN A;  4DMR A;  2NVY A;  2VPW A;  2YUJ A;  2E7Z A;  4KDI A;  4AON B;  2NVX A;  3IR6 A;  1E32 A;  1WLF A;  4AOK B;  4CS0 A;  2EEO B;  3H0G A;  1VC3 B;  3GTM A;  1FDI A;  2VPZ A;  4AZD A;  2JA6 A;  3HKZ A;  1ZC1 A;  3O5A A;  1EU1 A;  2VUM A;  5DYI A;  3CF2 A;  2VPX A;  3QC8 A;  1UHD A;  1PT1 A;  1CZ5 A;  1DMR A;  5T5M D;  3GTQ A;  4D7Z B;  2VPY A;  4CRY G;  3GTP A;  1YLE A;  3GTG A;  4AYB A;  1AW8 B;  2NAP A;  1PYU B;  1R7R A;  5GLF A;  2R7Z A;  4KOD A;  3GTO A;  3OUG A;  3FKI A;  1Y1W A;  2NYA A;  1E60 A;  2PMZ A;  5T5I D;  2JIQ A;  2R92 A;  5FTN A;  1FDO A;  3TIW A;  3HU2 A;  2E2I A;  2B63 A;  4KLN A;  1QCS A;  3PLX B;  3ML1 A;  1I3Q A;  2KI8 A;  2PJH B;  1H5N A;  1PYQ A;  1PQE A;  4KO8 A;  1G8K A;  5FTJ A;  1E61 A;  1E5V A;  1CZ4 A;  1TWF A;  1AA6 A;  2JA5 A;  5FTM A;  3GTJ A;  1PQF A;  2YU9 A;  1R9T A;  1CR5 A;  2Y0S A;  1TWH A;  1KQG A;  2IV2 X;  3CQZ A;  1PQH A;  2JIO A;  3QWZ A;  1OGY A;  1H0H A;  1R27 A;  3GTL A;  1UHE A;  4RV0 A; 
#chains in the Genus database with same CATH topology
 5C18 A;  2XDP A;  1L8F A;  2ENG A;  3HU1 A;  4GA5 A;  3MB5 A;  3SUM A;  3QQ7 A;  2V45 A;  5EQJ B;  3X2O A;  3IR7 A;  4UC4 A;  4FER A;  2Q1D X;  1K83 A;  2DMR A;  5DYG A;  1S3S A;  5CD1 A;  2JV2 A;  4CRZ A;  1SIW A;  1TWA A;  5C1B A;  1ZYR D;  2E2H A;  1PT0 A;  3QQ8 A;  5EPP A;  2PWY A;  1HD5 A;  3GTK A;  1G8J A;  2JIM A;  3IR5 A;  2JIP A;  2WAQ A;  4JS7 A;  4QIW A;  1DMS A;  1PPY A;  2MM0 A;  2YVL A;  5D6W A;  5FTL A;  1BW4 A;  1KQF A;  1OA7 A;  1SMY D;  1TWC A;  1IW7 D;  1TWG A;  3X2G A;  2GF7 A;  3FPR A;  4AAY A;  1SFO A;  1Y5I A;  1Y4Z A;  2JIR A;  4KDL A;  1TMO A;  2WB1 A;  3TM7 B;  3DMR A;  2A69 D;  1YNJ D;  1Y1V A;  3M3G A;  2V3V A;  1E18 A;  2JA7 A;  2PIC A;  3ENG A;  1Q16 A;  3X2K A;  1I50 A;  5D6X A;  4C2M A;  2R93 A;  2BE5 D;  1BW3 A;  4GA6 A;  5CCB A;  2Q19 X;  5FTK A;  3ZGZ A;  2CW0 D;  4L48 A;  1WCM A;  5B6C A;  3HU3 A;  2C45 A;  1QDN A;  4FG2 A;  4DMR A;  2PJJ A;  2NVY A;  3SUJ A;  2VPW A;  2HCZ X;  2YUJ A;  2GAE A;  2E7Z A;  2A6H D;  4KDI A;  2KY9 A;  5GLX A;  2A6E D;  4AON B;  3IR6 A;  1E32 A;  1WLF A;  4AOK B;  4CS0 A;  2EEO B;  3H0G A;  2NVX A;  1VC3 B;  3GTM A;  1FDI A;  2VPZ A;  2QQS A;  3X2N A;  4AZD A;  2JA6 A;  3HKZ A;  4FIB A;  1ZC1 A;  3O5A A;  3X2H A;  1EU1 A;  3X2J A;  2AE0 X;  2VUM A;  1I9G A;  1N10 A;  5DYI A;  3X2L A;  3CF2 A;  2VPX A;  3QC8 A;  1UHD A;  5H4U A;  1PT1 A;  1CZ5 A;  1DMR A;  5T5M D;  3GTQ A;  2GFA A;  4D7Z B;  2VPY A;  4JP6 A;  4CRY G;  5D6Y A;  3GTP A;  1YLE A;  3GTG A;  4JJO A;  1O54 A;  5CCX A;  4AQ7 A;  4AYB A;  1AW8 B;  2NAP A;  3SUK A;  2Q1C X;  1PYU B;  1R7R A;  4JCW A;  5GLF A;  2R7Z A;  4KOD A;  3GTO A;  3OUG A;  3FKI A;  4AS1 A;  3ZJV A;  2MM2 A;  1Y1W A;  2NYA A;  2B25 A;  3CZB A;  1E60 A;  2PMZ A;  5T5I D;  1OA9 A;  2JIQ A;  2R92 A;  4JP7 A;  4NOH A;  5FTN A;  1FDO A;  3TIW A;  1WC2 A;  2KQA A;  3HU2 A;  2Q1A X;  3LHD A;  2E2I A;  2B63 A;  4KLN A;  5GM9 A;  1QCS A;  3PLX B;  5ERG B;  3SUL A;  2O5J D;  3ML1 A;  1I3Q A;  4AVR A;  2A68 D;  2KI8 A;  2PJH B;  1H5N A;  1PYQ A;  1PQE A;  4ENG A;  4KO8 A;  3ZJT A;  3X2M A;  4ARC A;  3X2P A;  3LGA A;  2G6G A;  4ZM7 A;  1G8K A;  5FTJ A;  1E61 A;  2PI8 A;  2QQR A;  4CQN A;  1E5V A;  2PNW A;  1CZ4 A;  3X2I A;  1TWF A;  1AA6 A;  2JA5 A;  5FTM A;  3GTJ A;  3BQB A;  4FFT A;  2Q18 X;  1PQF A;  2YU9 A;  4ARI A;  3D30 A;  1R9T A;  4FG4 A;  1CR5 A;  2Y0S A;  1TWH A;  3FPU A;  1KQG A;  2IV2 X;  3CQZ A;  1PQH A;  2JIO A;  3ZJU A;  2LW6 A;  3QWZ A;  1OGY A;  2G5D A;  5GLY A;  2BH0 A;  3FPT A;  1H0H A;  1R27 A;  3GTL A;  1UHE A;  4RV0 A;  1YNN D; 
#chains in the Genus database with same CATH homology
 5C18 A;  2XDP A;  3HU1 A;  4GA5 A;  3MB5 A;  3QQ7 A;  2V45 A;  5EQJ B;  3IR7 A;  4UC4 A;  2Q1D X;  1K83 A;  2DMR A;  5DYG A;  1S3S A;  5CD1 A;  2JV2 A;  4CRZ A;  1SIW A;  1TWA A;  5C1B A;  1ZYR D;  2E2H A;  1PT0 A;  3QQ8 A;  5EPP A;  2PWY A;  3GTK A;  1G8J A;  2JIM A;  3IR5 A;  2JIP A;  2WAQ A;  4QIW A;  2MM0 A;  1DMS A;  1PPY A;  2YVL A;  5D6W A;  5FTL A;  1KQF A;  1SMY D;  1TWC A;  1IW7 D;  1TWG A;  2GF7 A;  3FPR A;  4AAY A;  1SFO A;  1Y5I A;  1Y4Z A;  2JIR A;  4KDL A;  1TMO A;  2WB1 A;  3TM7 B;  3DMR A;  2A69 D;  1YNJ D;  1Y1V A;  2V3V A;  1E18 A;  2JA7 A;  2PIC A;  1I50 A;  1Q16 A;  5D6X A;  4C2M A;  2R93 A;  2BE5 D;  4GA6 A;  5CCB A;  2Q19 X;  5FTK A;  3ZGZ A;  2CW0 D;  1WCM A;  5B6C A;  3HU3 A;  2C45 A;  1QDN A;  4DMR A;  2PJJ A;  2NVY A;  2VPW A;  2YUJ A;  2GAE A;  2E7Z A;  2A6H D;  4KDI A;  2KY9 A;  2A6E D;  4AON B;  3IR6 A;  1E32 A;  1WLF A;  4AOK B;  4CS0 A;  2EEO B;  3H0G A;  2NVX A;  1VC3 B;  3GTM A;  1FDI A;  2VPZ A;  2QQS A;  4AZD A;  2JA6 A;  3HKZ A;  4FIB A;  1ZC1 A;  3O5A A;  1EU1 A;  2VUM A;  2AE0 X;  1I9G A;  5DYI A;  3CF2 A;  2VPX A;  3QC8 A;  1UHD A;  1PT1 A;  1CZ5 A;  1DMR A;  5T5M D;  3GTQ A;  2GFA A;  4D7Z B;  2VPY A;  4CRY G;  5D6Y A;  3GTP A;  1YLE A;  3GTG A;  5CCX A;  1O54 A;  4AQ7 A;  4AYB A;  1AW8 B;  2NAP A;  2Q1C X;  1PYU B;  1R7R A;  5GLF A;  2R7Z A;  4KOD A;  3GTO A;  3OUG A;  3FKI A;  4AS1 A;  3ZJV A;  2MM2 A;  1Y1W A;  2NYA A;  2B25 A;  3CZB A;  1E60 A;  2PMZ A;  5T5I D;  2JIQ A;  2R92 A;  4NOH A;  5FTN A;  1FDO A;  3TIW A;  2Q1A X;  3LHD A;  3HU2 A;  2E2I A;  2B63 A;  4KLN A;  1QCS A;  3PLX B;  5ERG B;  2O5J D;  3ML1 A;  1I3Q A;  2A68 D;  2KI8 A;  2PJH B;  1H5N A;  1PYQ A;  1PQE A;  3ZJT A;  4KO8 A;  4ARC A;  3LGA A;  2G6G A;  1G8K A;  5FTJ A;  1E61 A;  2PI8 A;  2QQR A;  4CQN A;  1E5V A;  2PNW A;  1CZ4 A;  1TWF A;  1AA6 A;  2JA5 A;  5FTM A;  3GTJ A;  3BQB A;  2Q18 X;  1PQF A;  2YU9 A;  4ARI A;  1R9T A;  1CR5 A;  2Y0S A;  1TWH A;  3FPU A;  1KQG A;  2IV2 X;  3CQZ A;  1PQH A;  2JIO A;  3ZJU A;  2LW6 A;  3QWZ A;  1OGY A;  2G5D A;  3FPT A;  1H0H A;  1R27 A;  3GTL A;  1UHE A;  4RV0 A;  1YNN D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...