1WLFA

Structure of the n-terminal domain of pex1 aaa-atpase: characterization of a putative adaptor-binding domain
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
167
structure length
164
Chain Sequence
GGAVVTVAFTNARDCFLHLPRRLVAQLHLLQNQAIEVASDHQPTYLSWVEGRHFNENVAEINRQVGQKLGLSSGDQVFLRPCSHVVSCQQVEVEPLSADDWEILELHAISLEQHLLDQIRIVFPKAVVPIWVDQQTYIFIQIVTLMPAAPYGRLETNTKLLIQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peroxisome biogenesis factor 1
publication title Structure of the N-terminal Domain of PEX1 AAA-ATPase: CHARACTERIZATION OF A PUTATIVE ADAPTOR-BINDING DOMAIN
pubmed doi rcsb
source organism Mus musculus
molecule tags Protein transport
total genus 42
structure length 164
sequence length 167
ec nomenclature
pdb deposition date 2004-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09262 PEX-1N Peroxisome biogenesis factor 1, N-terminal
A PF09263 PEX-2N Peroxisome biogenesis factor 1, N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.20 Mainly Beta Beta Barrel Barwin-like endoglucanases Barwin-like endoglucanases 1wlfA01
3.10.330.10 Alpha Beta Roll Vcp-like ATPase; Chain A, domain 2 Vcp-like ATPase; Chain A, domain 2 1wlfA02
1E60A 4C2MA 2JIOA 5FTMA 3GTKA 1WLFA 3GTOA 3HKZA 2C45A 5GLFA 2JIRA 4CS0A 2IV2X 4KODA 1AW8B 5FTLA 2NVXA 3HU3A 1PQFA 2VPXA 1CZ5A 1Y1WA 2JA5A 1EU1A 2V45A 2PJHB 3GTJA 4AONB 1I3QA 3CF2A 3HU1A 5FTJA 1E18A 1FDIA 5T5MD 1TWGA 1WCMA 1Y1VA 2V3VA 1SIWA 4AZDA 4KDIA 3GTLA 4KLNA 1I50A 2R92A 5FTNA 2JA7A 2B63A 2WAQA 2JIMA 1PQEA 1DMRA 3ML1A 3QQ8A 1FDOA 3GTPA 3CQZA 1E5VA 1G8KA 1H5NA 1TMOA 3IR6A 1E32A 1DMSA 1TWAA 2VPYA 1R9TA 1R27A 1H0HA 3H0GA 2VPZA 3GTMA 4QIWA 4DMRA 1SFOA 1TWFA 1IW7D 2JIQA 5FTKA 2YU9A 2Y0SA 4CRZA 4KO8A 2DMRA 1S3SA 1KQGA 1AA6A 1OGYA 2R93A 1PQHA 1PYUB 5T5ID 2YUJA 5DYIA 4GA5A 3GTGA 3PLXB 3TM7B 3QQ7A 1KQFA 3GTQA 2WB1A 2JV2A 2PMZA 1QCSA 4GA6A 1YLEA 2NVYA 4D7ZB 1TWHA 1CR5A 3OUGA 2JA6A 3TIWA 1UHDA 2NYAA 3O5AA 1E61A 5B6CA 1PYQA 3IR5A 1PT0A 1R7RA 4CRYG 5EPPA 5C1BA 2E2HA 1ZC1A 1VC3B 3QWZA 1K83A 1UHEA 5DYGA 2E2IA 1CZ4A 4AAYA 1Q16A 1G8JA 2EEOB 2JIPA 2VUMA 4AYBA 3FKIA 1TWCA 4RV0A 3HU2A 3IR7A 2VPWA 1Y5IA 1PT1A 2KI8A 2R7ZA 5C18A 3QC8A 1Y4ZA 3DMRA 2NAPA 4KDLA 4AOKB 1QDNA 1PPYA 2E7ZA
chains in the Genus database with same CATH superfamily
3X2OA 4AS1A 1E60A 3X2HA 3ZJUA 4C2MA 2JIOA 5FTMA 3GTKA 1WLFA 3GTOA 3HKZA 4JS7A 2C45A 2QQSA 5GLFA 2Q19X 2JIRA 3ZGZA 3M3GA 4CS0A 2IV2X 4KODA 1AW8B 1WC2A 5FTLA 2NVXA 3HU3A 4L48A 1PQFA 2VPXA 2Q1DX 1CZ5A 1Y1WA 2GAEA 2JA5A 2MM0A 2Q1AX 5GM9A 4FG4A 1EU1A 2V45A 4UC4A 2PJHB 3GTJA 1N10A 4AONB 1I3QA 2KQAA 2BH0A 3CF2A 3HU1A 3X2KA 2PWYA 2Q18X 5FTJA 1E18A 1FDIA 5GLYA 5T5MD 3FPUA 5ERGB 5CD1A 1YNND 1TWGA 1WCMA 1Y1VA 3SUKA 2A6ED 2V3VA 1SIWA 4AZDA 4KDIA 3GTLA 4KLNA 1I50A 2R92A 2A68D 4FERA 5FTNA 5D6WA 2JA7A 2B63A 2WAQA 2JIMA 3X2PA 2BE5D 1PQEA 3X2MA 1DMRA 3ML1A 3QQ8A 1OA7A 2QQRA 1FDOA 3GTPA 3CQZA 1E5VA 4JCWA 1G8KA 1H5NA 1TMOA 2G5DA 2PJJA 3IR6A 1E32A 1DMSA 1TWAA 2VPYA 1R9TA 2MM2A 2GF7A 3LHDA 2B25A 1R27A 1H0HA 3H0GA 2KY9A 2VPZA 3GTMA 4QIWA 3MB5A 4DMRA 1SFOA 3X2NA 4ZM7A 1HD5A 2LW6A 1TWFA 1IW7D 3ENGA 5EQJB 2JIQA 5FTKA 4FIBA 2YU9A 4ENGA 1YNJD 2CW0D 2PICA 2Y0SA 3LGAA 4CRZA 3D30A 5GLXA 4KO8A 2A6HD 2DMRA 1S3SA 1KQGA 1AA6A 1BW4A 1OGYA 2R93A 1PQHA 1PYUB 5T5ID 2YUJA 4JP6A 4GA5A 5DYIA 3PLXB 3TM7B 3GTGA 3BQBA 3FPTA 3QQ7A 2HCZX 3SULA 1KQFA 3GTQA 2WB1A 2ENGA 5H4UA 5D6YA 2JV2A 3X2GA 1I9GA 3X2LA 2YVLA 2PMZA 1QCSA 2GFAA 4GA6A 1YLEA 2NVYA 4D7ZB 1TWHA 1CR5A 3OUGA 4AVRA 2JA6A 3TIWA 4AQ7A 4FG2A 1UHDA 2NYAA 3O5AA 1E61A 4JJOA 5B6CA 4CQNA 5CCXA 1PYQA 3IR5A 3CZBA 1PT0A 1R7RA 2AE0X 4ARIA 4CRYG 4NOHA 5EPPA 3FPRA 1L8FA 5C1BA 2E2HA 1ZC1A 1VC3B 3QWZA 1K83A 3ZJTA 5D6XA 3SUMA 1UHEA 5DYGA 2E2IA 3ZJVA 3X2JA 3X2IA 1CZ4A 4FFTA 4AAYA 1Q16A 1G8JA 2EEOB 2JIPA 2VUMA 4AYBA 2A69D 1BW3A 2O5JD 1SMYD 2G6GA 3FKIA 1O54A 1TWCA 4RV0A 3HU2A 3IR7A 1OA9A 2VPWA 4JP7A 2PNWA 1Y5IA 2PI8A 1PT1A 2KI8A 2R7ZA 5CCBA 5C18A 3QC8A 1Y4ZA 3DMRA 2XDPA 1ZYRD 2NAPA 4KDLA 2Q1CX 4AOKB 3SUJA 1QDNA 1PPYA 2E7ZA 4ARCA
chains in the Genus database with same CATH topology
4AS1A 1E60A 3ZJUA 4C2MA 2JIOA 5FTMA 3GTKA 1WLFA 3GTOA 3HKZA 2C45A 2QQSA 5GLFA 2Q19X 2JIRA 3ZGZA 4CS0A 2IV2X 4KODA 1AW8B 5FTLA 2NVXA 3HU3A 1PQFA 2VPXA 2Q1DX 1CZ5A 1Y1WA 2GAEA 2JA5A 2MM0A 2Q1AX 1EU1A 2V45A 4UC4A 2PJHB 3GTJA 4AONB 1I3QA 3CF2A 3HU1A 2PWYA 2Q18X 5FTJA 1E18A 1FDIA 5T5MD 5ERGB 3FPUA 5CD1A 1YNND 1TWGA 1WCMA 1Y1VA 2A6ED 2V3VA 1SIWA 4AZDA 4KDIA 3GTLA 4KLNA 1I50A 2R92A 2A68D 5FTNA 5D6WA 2JA7A 2B63A 2WAQA 2JIMA 2BE5D 1PQEA 1DMRA 3ML1A 3QQ8A 2QQRA 1FDOA 3GTPA 3CQZA 1E5VA 1G8KA 1H5NA 1TMOA 2G5DA 2PJJA 3IR6A 1E32A 1DMSA 1TWAA 2VPYA 1R9TA 2MM2A 2GF7A 3LHDA 2B25A 1R27A 1H0HA 3H0GA 2KY9A 2VPZA 3GTMA 4QIWA 3MB5A 4DMRA 1SFOA 2LW6A 1TWFA 1IW7D 5EQJB 2JIQA 5FTKA 4FIBA 2YU9A 1YNJD 2CW0D 2PICA 2Y0SA 3LGAA 4CRZA 4KO8A 2A6HD 2DMRA 1S3SA 1KQGA 1AA6A 1OGYA 2R93A 1PQHA 1PYUB 5T5ID 2YUJA 5DYIA 4GA5A 3GTGA 3PLXB 3TM7B 3BQBA 3FPTA 5D6XA 3QQ7A 1KQFA 3GTQA 2WB1A 5D6YA 2JV2A 1I9GA 2YVLA 2PMZA 1QCSA 2GFAA 4GA6A 1YLEA 2NVYA 4D7ZB 1TWHA 1CR5A 3OUGA 2JA6A 3TIWA 4AQ7A 1UHDA 2NYAA 3O5AA 1E61A 4CQNA 5B6CA 5CCXA 1PYQA 3IR5A 3CZBA 1PT0A 1R7RA 2AE0X 4ARIA 4CRYG 4NOHA 5EPPA 3FPRA 5C1BA 2E2HA 1ZC1A 1VC3B 3QWZA 1K83A 3ZJTA 3ZJVA 1UHEA 5DYGA 2E2IA 1CZ4A 4AAYA 1Q16A 1G8JA 2EEOB 2JIPA 2VUMA 4AYBA 2A69D 2O5JD 1SMYD 2G6GA 3FKIA 1O54A 1TWCA 4RV0A 3HU2A 3IR7A 2VPWA 2PNWA 1Y5IA 2PI8A 1PT1A 2KI8A 2R7ZA 5CCBA 5C18A 3QC8A 1Y4ZA 3DMRA 2XDPA 1ZYRD 2NAPA 4KDLA 2Q1CX 4AOKB 1QDNA 1PPYA 2E7ZA 4ARCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1E60 A;  4C2M A;  2JIO A;  5FTM A;  3GTK A;  1WLF A;  3GTO A;  3HKZ A;  2C45 A;  5GLF A;  2JIR A;  4CS0 A;  2IV2 X;  4KOD A;  1AW8 B;  5FTL A;  2NVX A;  3HU3 A;  1PQF A;  2VPX A;  1CZ5 A;  1Y1W A;  2JA5 A;  1EU1 A;  2V45 A;  2PJH B;  3GTJ A;  4AON B;  1I3Q A;  3CF2 A;  3HU1 A;  5FTJ A;  1E18 A;  1FDI A;  5T5M D;  1TWG A;  1WCM A;  1Y1V A;  2V3V A;  1SIW A;  4AZD A;  4KDI A;  3GTL A;  4KLN A;  1I50 A;  2R92 A;  5FTN A;  2JA7 A;  2B63 A;  2WAQ A;  2JIM A;  1PQE A;  1DMR A;  3ML1 A;  3QQ8 A;  1FDO A;  3GTP A;  3CQZ A;  1E5V A;  1G8K A;  1H5N A;  1TMO A;  3IR6 A;  1E32 A;  1DMS A;  1TWA A;  2VPY A;  1R9T A;  1R27 A;  1H0H A;  3H0G A;  2VPZ A;  3GTM A;  4QIW A;  4DMR A;  1SFO A;  1TWF A;  1IW7 D;  2JIQ A;  5FTK A;  2YU9 A;  2Y0S A;  4CRZ A;  4KO8 A;  2DMR A;  1S3S A;  1KQG A;  1AA6 A;  1OGY A;  2R93 A;  1PQH A;  1PYU B;  5T5I D;  2YUJ A;  5DYI A;  4GA5 A;  3GTG A;  3PLX B;  3TM7 B;  3QQ7 A;  1KQF A;  3GTQ A;  2WB1 A;  2JV2 A;  2PMZ A;  1QCS A;  4GA6 A;  1YLE A;  2NVY A;  4D7Z B;  1TWH A;  1CR5 A;  3OUG A;  2JA6 A;  3TIW A;  1UHD A;  2NYA A;  3O5A A;  1E61 A;  5B6C A;  1PYQ A;  3IR5 A;  1PT0 A;  1R7R A;  4CRY G;  5EPP A;  5C1B A;  2E2H A;  1ZC1 A;  1VC3 B;  3QWZ A;  1K83 A;  1UHE A;  5DYG A;  2E2I A;  1CZ4 A;  4AAY A;  1Q16 A;  1G8J A;  2EEO B;  2JIP A;  2VUM A;  4AYB A;  3FKI A;  1TWC A;  4RV0 A;  3HU2 A;  3IR7 A;  2VPW A;  1Y5I A;  1PT1 A;  2KI8 A;  2R7Z A;  5C18 A;  3QC8 A;  1Y4Z A;  3DMR A;  2NAP A;  4KDL A;  4AOK B;  1QDN A;  1PPY A;  2E7Z A; 
#chains in the Genus database with same CATH topology
 3X2O A;  4AS1 A;  1E60 A;  3X2H A;  3ZJU A;  4C2M A;  2JIO A;  5FTM A;  3GTK A;  1WLF A;  3GTO A;  3HKZ A;  4JS7 A;  2C45 A;  2QQS A;  5GLF A;  2Q19 X;  2JIR A;  3ZGZ A;  3M3G A;  4CS0 A;  2IV2 X;  4KOD A;  1AW8 B;  1WC2 A;  5FTL A;  2NVX A;  3HU3 A;  4L48 A;  1PQF A;  2VPX A;  2Q1D X;  1CZ5 A;  1Y1W A;  2GAE A;  2JA5 A;  2MM0 A;  2Q1A X;  5GM9 A;  4FG4 A;  1EU1 A;  2V45 A;  4UC4 A;  2PJH B;  3GTJ A;  1N10 A;  4AON B;  1I3Q A;  2KQA A;  2BH0 A;  3CF2 A;  3HU1 A;  3X2K A;  2PWY A;  2Q18 X;  5FTJ A;  1E18 A;  1FDI A;  5GLY A;  5T5M D;  3FPU A;  5ERG B;  5CD1 A;  1YNN D;  1TWG A;  1WCM A;  1Y1V A;  3SUK A;  2A6E D;  2V3V A;  1SIW A;  4AZD A;  4KDI A;  3GTL A;  4KLN A;  1I50 A;  2R92 A;  2A68 D;  4FER A;  5FTN A;  5D6W A;  2JA7 A;  2B63 A;  2WAQ A;  2JIM A;  3X2P A;  2BE5 D;  1PQE A;  3X2M A;  1DMR A;  3ML1 A;  3QQ8 A;  1OA7 A;  2QQR A;  1FDO A;  3GTP A;  3CQZ A;  1E5V A;  4JCW A;  1G8K A;  1H5N A;  1TMO A;  2G5D A;  2PJJ A;  3IR6 A;  1E32 A;  1DMS A;  1TWA A;  2VPY A;  1R9T A;  2MM2 A;  2GF7 A;  3LHD A;  2B25 A;  1R27 A;  1H0H A;  3H0G A;  2KY9 A;  2VPZ A;  3GTM A;  4QIW A;  3MB5 A;  4DMR A;  1SFO A;  3X2N A;  4ZM7 A;  1HD5 A;  2LW6 A;  1TWF A;  1IW7 D;  3ENG A;  5EQJ B;  2JIQ A;  5FTK A;  4FIB A;  2YU9 A;  4ENG A;  1YNJ D;  2CW0 D;  2PIC A;  2Y0S A;  3LGA A;  4CRZ A;  3D30 A;  5GLX A;  4KO8 A;  2A6H D;  2DMR A;  1S3S A;  1KQG A;  1AA6 A;  1BW4 A;  1OGY A;  2R93 A;  1PQH A;  1PYU B;  5T5I D;  2YUJ A;  4JP6 A;  4GA5 A;  5DYI A;  3PLX B;  3TM7 B;  3GTG A;  3BQB A;  3FPT A;  3QQ7 A;  2HCZ X;  3SUL A;  1KQF A;  3GTQ A;  2WB1 A;  2ENG A;  5H4U A;  5D6Y A;  2JV2 A;  3X2G A;  1I9G A;  3X2L A;  2YVL A;  2PMZ A;  1QCS A;  2GFA A;  4GA6 A;  1YLE A;  2NVY A;  4D7Z B;  1TWH A;  1CR5 A;  3OUG A;  4AVR A;  2JA6 A;  3TIW A;  4AQ7 A;  4FG2 A;  1UHD A;  2NYA A;  3O5A A;  1E61 A;  4JJO A;  5B6C A;  4CQN A;  5CCX A;  1PYQ A;  3IR5 A;  3CZB A;  1PT0 A;  1R7R A;  2AE0 X;  4ARI A;  4CRY G;  4NOH A;  5EPP A;  3FPR A;  1L8F A;  5C1B A;  2E2H A;  1ZC1 A;  1VC3 B;  3QWZ A;  1K83 A;  3ZJT A;  5D6X A;  3SUM A;  1UHE A;  5DYG A;  2E2I A;  3ZJV A;  3X2J A;  3X2I A;  1CZ4 A;  4FFT A;  4AAY A;  1Q16 A;  1G8J A;  2EEO B;  2JIP A;  2VUM A;  4AYB A;  2A69 D;  1BW3 A;  2O5J D;  1SMY D;  2G6G A;  3FKI A;  1O54 A;  1TWC A;  4RV0 A;  3HU2 A;  3IR7 A;  1OA9 A;  2VPW A;  4JP7 A;  2PNW A;  1Y5I A;  2PI8 A;  1PT1 A;  2KI8 A;  2R7Z A;  5CCB A;  5C18 A;  3QC8 A;  1Y4Z A;  3DMR A;  2XDP A;  1ZYR D;  2NAP A;  4KDL A;  2Q1C X;  4AOK B;  3SUJ A;  1QDN A;  1PPY A;  2E7Z A;  4ARC A; 
#chains in the Genus database with same CATH homology
 4AS1 A;  1E60 A;  3ZJU A;  4C2M A;  2JIO A;  5FTM A;  3GTK A;  1WLF A;  3GTO A;  3HKZ A;  2C45 A;  2QQS A;  5GLF A;  2Q19 X;  2JIR A;  3ZGZ A;  4CS0 A;  2IV2 X;  4KOD A;  1AW8 B;  5FTL A;  2NVX A;  3HU3 A;  1PQF A;  2VPX A;  2Q1D X;  1CZ5 A;  1Y1W A;  2GAE A;  2JA5 A;  2MM0 A;  2Q1A X;  1EU1 A;  2V45 A;  4UC4 A;  2PJH B;  3GTJ A;  4AON B;  1I3Q A;  3CF2 A;  3HU1 A;  2PWY A;  2Q18 X;  5FTJ A;  1E18 A;  1FDI A;  5T5M D;  5ERG B;  3FPU A;  5CD1 A;  1YNN D;  1TWG A;  1WCM A;  1Y1V A;  2A6E D;  2V3V A;  1SIW A;  4AZD A;  4KDI A;  3GTL A;  4KLN A;  1I50 A;  2R92 A;  2A68 D;  5FTN A;  5D6W A;  2JA7 A;  2B63 A;  2WAQ A;  2JIM A;  2BE5 D;  1PQE A;  1DMR A;  3ML1 A;  3QQ8 A;  2QQR A;  1FDO A;  3GTP A;  3CQZ A;  1E5V A;  1G8K A;  1H5N A;  1TMO A;  2G5D A;  2PJJ A;  3IR6 A;  1E32 A;  1DMS A;  1TWA A;  2VPY A;  1R9T A;  2MM2 A;  2GF7 A;  3LHD A;  2B25 A;  1R27 A;  1H0H A;  3H0G A;  2KY9 A;  2VPZ A;  3GTM A;  4QIW A;  3MB5 A;  4DMR A;  1SFO A;  2LW6 A;  1TWF A;  1IW7 D;  5EQJ B;  2JIQ A;  5FTK A;  4FIB A;  2YU9 A;  1YNJ D;  2CW0 D;  2PIC A;  2Y0S A;  3LGA A;  4CRZ A;  4KO8 A;  2A6H D;  2DMR A;  1S3S A;  1KQG A;  1AA6 A;  1OGY A;  2R93 A;  1PQH A;  1PYU B;  5T5I D;  2YUJ A;  5DYI A;  4GA5 A;  3GTG A;  3PLX B;  3TM7 B;  3BQB A;  3FPT A;  5D6X A;  3QQ7 A;  1KQF A;  3GTQ A;  2WB1 A;  5D6Y A;  2JV2 A;  1I9G A;  2YVL A;  2PMZ A;  1QCS A;  2GFA A;  4GA6 A;  1YLE A;  2NVY A;  4D7Z B;  1TWH A;  1CR5 A;  3OUG A;  2JA6 A;  3TIW A;  4AQ7 A;  1UHD A;  2NYA A;  3O5A A;  1E61 A;  4CQN A;  5B6C A;  5CCX A;  1PYQ A;  3IR5 A;  3CZB A;  1PT0 A;  1R7R A;  2AE0 X;  4ARI A;  4CRY G;  4NOH A;  5EPP A;  3FPR A;  5C1B A;  2E2H A;  1ZC1 A;  1VC3 B;  3QWZ A;  1K83 A;  3ZJT A;  3ZJV A;  1UHE A;  5DYG A;  2E2I A;  1CZ4 A;  4AAY A;  1Q16 A;  1G8J A;  2EEO B;  2JIP A;  2VUM A;  4AYB A;  2A69 D;  2O5J D;  1SMY D;  2G6G A;  3FKI A;  1O54 A;  1TWC A;  4RV0 A;  3HU2 A;  3IR7 A;  2VPW A;  2PNW A;  1Y5I A;  2PI8 A;  1PT1 A;  2KI8 A;  2R7Z A;  5CCB A;  5C18 A;  3QC8 A;  1Y4Z A;  3DMR A;  2XDP A;  1ZYR D;  2NAP A;  4KDL A;  2Q1C X;  4AOK B;  1QDN A;  1PPY A;  2E7Z A;  4ARC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...