1WM3A

Crystal structure of human sumo-2 protein
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
72
structure length
72
Chain Sequence
HINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquitin-like protein SMT3B
publication title Crystal structures of the human SUMO-2 protein at 1.6 A and 1.2 A resolution: implication on the functional differences of SUMO proteins
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 15
structure length 72
sequence length 72
ec nomenclature
pdb deposition date 2004-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11976 Rad60-SLD Ubiquitin-2 like Rad60 SUMO-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1wm3A00
2K8CA 2RGFA 2KFKA 2FCNA 4EFOA 4G3XB 2BKFA 5CX3A 2PJHA 2AL6A 3M63B 4ZRJA 4BKGA 5BO4B 4MJSB 4BOZB 3ONSA 2AL3A 2CHWA 2IO0B 4IM2A 2ZEQA 1L7YA 4IWQA 3N3KB 3P2BA 3UIOB 4A3OA 2FNJB 4XX5A 1BT0A 3ZRFA 3DQVA 4K7SA 4W9HA 2K8BA 3LDZE 4K81A 5IAAC 2C9WB 3V62A 4WJNA 4HPMB 1ZGUB 4MGKE 3U30A 1RAXA 2KZRA 2LGYA 1I42A 2KJRA 2ZPYA 2DZKA 4DXAB 3W1YA 1LM8B 3DOWA 1NBFC 2LD9A 2LUEA 3DPDA 1WZ3A 4NQKE 4F8CB 3DBRI 3ZIMA 4DHZE 1XQQA 3SD5A 4MDKE 5EDSA 2KJHB 2BPSA 2NPTA 4PS3A 4OVUA 4GXBA 3A4RA 2CHXA 4ANUA 2KNBA 4W9CA 4BKSA 2N4FA 3A9KB 2KX0A 1P9DU 3S2AA 4P7IA 1OEYJ 3SU8X 4OVVA 2K25A 4PYUA 2OOBB 1RLFA 3TBLD 4JGHB 5JH5C 3M95A 4GGQA 3ZDMC 3SDLC 3NY5A 2R2OA 3DVNV 4GU2A 2Y5BB 3V6EB 4X57B 4JLCA 3TJPA 4EEWA 4EOYA 3JSVB 2K8HA 1UBIA 2GBNA 4XZ4A 3RCZA 3IFWB 5TR5A 5HKHA 1IPGA 4TQ1A 5FR6A 3TL5A 2CS4A 2XBBC 1MG8A 1KOTA 1WH3A 3HHMA 3SHQA 4BBNF 1J19A 3MJWA 1WF9A 4B6WA 4IC7B 4RM8A 2J0JA 4KSKC 1G6JA 3PLVA 2L0TA 4EZJA 3DVNU 2KLCA 3L08A 5IA7A 4WQOB 4PYZA 3WANA 3PRMB 4BKTA 3JVZX 3ZVVA 1PQSA 4XC2A 3RT3B 3GZNI 4HCNB 2K39A 3PHWB 2WX1A 4E74A 1Z2MA 3PVLA 4CYEA 3PHXB 1UGMA 4FN2A 3BINA 5DCNA 3IVFA 1SGHA 3RUIB 2FUHB 4B9KA 2KO3A 1WX8A 4WJOA 3MHSD 2NBUA 4DHZB 3ZNID 2C60A 2N7DA 2M1MA 3R7QA 2MP2B 2DENB 4MGIE 2O6VA 4ICVA 2BWFA 3T9LA 1V81A 1C1YB 1UELA 3PT2B 3O65B 5KHOA 4ZRKA 2MQJA 2IYDB 4GDKA 1WYWB 2LXCA 4IUMB 3WAOA 2CR5A 1I35A 1QZEA 1WI0A 1V5TA 4EKUA 3OLMD 2D11A 1WJUA 2JZZA 2O2VA 4ZYNA 3W1SA 4NAWA 1S3SG 3K9PB 4AUQC 3PV1A 4M8MA 1TBEA 1WR6E 2LZ6A 3H7PB 4BOSC 1H4RA 2FIFA 2HE7A 2KC2A 3OAWA 1WJ6A 2UWQA 3QJZA 2W9NA 3ZTCA 4NJ7A 4G0NB 2Z0DB 3M62B 3QCAA 4RMAA 1WX7A 1WZ0A 3ZTDA 2PEAA 4GDLB 3WIMA 2YVCA 3ALBA 3U8ZA 2M4NA 2ZVOA 1WRDB 2KC1A 2IZVB 1WR1A 4KDIC 2M17A 2VRRB 4YL8A 2FCMA 3ZO5B 2KMAA 2MBHA 3R7RA 1Q0WB 2WWZA 3PSEB 3TIXA 2N9PC 2LVOA 4GSWA 1Z5SB 3PS6A 4ANVA 4I6LB 3NS8A 4FLHA 1WGYA 1WGRA 1TTNA 2AYOB 4N9F4 5C23A 2DYOA 3ZDTA 3WAMA 1E7VA 2GOWA 3APCA 4NPNA 4IM3A 3UQBA 1V80A 4FHKA 2LGDA 3NHEB 4PS8A 5JZEB 1KJTA 2IBIB 4MSMB 1FXTB 3H7SA 4GMVA 2LVPA 4TUUA 1WMHA 3DBSA 2WDTB 4G50A 3QWZB 2RR9A 3GOEA 2KDFB 3APFA 5J17A 2A4ZA 2ZNVC 5CHVC 3UIPB 5AZHA 2N1WA 2G4SA 2NPTB 2R2QA 1GG3A 2C7NB 4FULA 1YQBA 3A33B 2DAJA 2GBMA 2KANA 2N9EB 2K1FA 2NVUI 3BY4B 3NZSA 3A1QA 2BGFA 2ZPNA 2JZ3B 4G11A 4HXDA 4WWNA 2MCNB 4EUTA 3PREA 1J0GA 2ZNVB 2J0MA 2PE6B 1E8YA 1ZKHA 2KWUB 5D6JB 3I3TB 2FAZA 3Q3FA 3A9JB 3ML8A 4A20A 1UH6A 4TQ0A 5DPWA 2YLMA 1E7UA 4M0WB 3H9DA 2IO1B 2DAFA 4MJSA 5DPTA 4DHJD 4TV3A 4HDQA 2LGXA 4TKNA 3ZNZB 3RD2A 4EZLA 4KSLC 5CHWA 1Q5WB 4AJWA 2JPHA 2DZMA 4IW0A 2N7EA 3UF8A 1CMXB 1WXAA 4K1RB 4DHJB 1WGGA 4DWFA 2MBBB 5DPRA 4NJ6A 3AU4A 3KYDD 1H8CA 2KQSA 4MM3A 3R3MA 1E8ZA 2DX5B 3HIZA 4I6NB 2B3AA 3ENEA 4EZKA 2I1JA 3ZLZA 1V86A 3X23A 2KVRA 1GUAB 2KLGA 3RYTA 4LJPB 3DBLI 4KZCA 1UBQA 4FJVB 3B1LX 1P3QU 2K6DB 2BWES 1HE8A 4IWOA 2L05A 3QK0A 4B95A 3VQIA 2NBWB 5JHBA 4KIKB 4JL9A 3WA0A 2WX0A 4ASWC 2JF5A 3A9KA 3CSFA 4I6PA 4CO7A 5L83A 3R66C 1AARA 2N1VA 4W9GA 3PRPB 3VUXA 4LCDE 2G4DB 3T8MA 4RM9A 3L54A 4CHKA 4F7ZA 2Z0EB 3V60A 3KW5B 2JT4B 2KHWB 3MTNB 2O2VB 3L0WB 5C1ZA 1KM7A 1Q1OA 1RFAA 2HD5B 2XEWA 2KTRA 2IO3B 5DPSA 2DYBA 1WX9A 2IY1B 3V6CB 2XK5B 5JHAA 2JWZA 2K6QA 2KDIA 3DCGA 5D7GA 4FADA 3L10B 1X1MA 2JRHA 2V4LA 4HWIB 4IM0A 3ZUNA 2L0FA 2MBQA 2JRIB 1GC7A 2I1KA 3VTUA 3ZRCA 1E90A 1OQYA 1GJZA 3VAWA 1R4MI 4NQLB 3VUWA 4BFRA 1E8WA 2KDBA 3QQ8B 2EKEC 2V1YA 1EF1A 3RZWC 3VTWA 1LQBA 3TCAA 1UD7A 2L3ZA 2KFKB 2RD0A 3NZUA 4GOCA 4W9FA 5CHFA 4WWOA 2RSUA 3PPAA 3RULA 2LWPA 2ZCBA 1OGWA 2MW5A 4E71A 4HDOA 2AWTA 2REXA 2LJ5A 3KUCB 2KFJA 2MBEA 4W9KA 2KQ7A 3V61A 1ISNA 4FBJB 1V49A 4II2B 5AZFA 1GC6A 2MP2A 5KHQA 3D32A 1IP9A 4BBNC 4WAAA 3VH4B 3RZFA 2KN5A 2ZZPB 2QHOA 2MBOA 2A5UA 1E5WA 1WGDA 2FCQA 2DHZA 1YJ1A 3HM6X 3L13A 3PTFC 2J0KA 3QHTA 2KXJA 2J7QB 4ANXA 5E6OA 3H6NA 1M94A 1A5RA 1YD8U 4KZ0A 4URKA 2GBJA 4AJYB 2C7MB 3M3JA 3VDZA 5E6PA 3U7DA 4DBGA 2M8SA 1V6EA 2LRUA 3VTVA 3ZNHB 4BKSD 4FA6A 3UQAA 3AU5A 3H7PA 4WJQA 3UINB 2MRPA 1WE7A 2KWCA 1KLVA 3Q3JA 2JVCA 1YX5B 3AXCA 1WE6A 2NCNA 4ICUA 4K7UA 4GDLA 4ZRIA 2GBKA 1SIFA 4LJOB 2OJRA 4F1SA 4ANWA 4DDID 4GB9A 2ZVNA 2M0XA 5L95C 4WWPA 2ZCCA 1D3ZA 3AULA 2JY6A 1TZ1A 2IO2B 3ZNGC 1C3TA 4E3CA 1F9JA 4FJZA 1EO6A 5G2NA 4BVUC 2IY0B 1OEYA 3QAQA 4AWJA 1UZXB 3TMPB 2BYFA 1TGZB 1OTRB 1P0RA 2HTHA 3B08A 2V3SA 4W9LA 5LLIA 1WGHA 1WJNA 2NS5A 1L2NA 1R4NI 1XT9B 3VH3B 3VFKA 4JIOU 4HLEA 2KX3A 5G55A 2BYVE 3CF6E 1T0YA 4K7WA 2FCSA 2MX2A 2CU1A 4M8NA 4MH0E 3QA8A 1V5OA 1GNUA 1EUVB 2DZIA 2LRWA 2KOXA 1WIAA 4MELA 1S1QB 3IG3A 4IG7B 5D94A 2KD0A 2L7RA 4ZDVA 3QIJA 1IYFA 3UGBB 2EMSA 1NI2A 2LVQA 2PE9A 2MA9B 3L16A 2O6VD 4JQWC 4MSQB 2D10A 3KYCD 5AEKB 2L76A 3EFUA 3PZDA 2GBRA 3LJ3A 3A9JA 1V9JA 3WALA 1K8RB 4MGYE 3ZW3A 3EC8A 1WY8A 3L17A 4KVGB 4W9IA 2KTRB 2O6VB 2MWSB 2NR2A 3W1SC 1U4AA 1LFDA 3EHVA 1RRBA 4HVBA 2HJ8A 2JXXA 2UYZB 1LXDA 2DZJA 2JUOA 1VCBA 2G3QB 1YX6B 5J18A 4GDKB 1XD3B 4PS7A 1YIWA 2BF8B 3APDA 3KH0A 1WFYA 4MEMA 5E6NA 4AOFA 3N32A 2ZJDA 4HCPB 2KJ6A 3JSVA 4HPLB 1JRUA 2MSED 2ASQA 4AP4C 3N30A 3OJ3A 4NAWB 3CMMB 2KK8A 3DBHI 5LXHA 4FHJA 4HJKA 1WM3A 2D3GA 2CHZA 3HM3A 3EECA 3ML9A 2KTFA 5D2MB 2C7HA 4KDLB 2KKCA 2WYQA 3X0WA 3HK0A 2LASA 2D2QA 2L00B 4NY0A 3KUZA 1WXMA 2MLBA 1WXSA 2LI5A 3WAPA 4WJPA 2N9XA 5CTRC 1NDDA 3VHTC 4FJYA 3AI5A 3VUYA 2KWVB 2FIDA 4KIKA 3KVFB 4NNJB 5GMVA 5AZGA 3ZKJC 1EF5A 4GIVA 3VXWA 2BYEA 1WM2A 4MGZE 4J6IA 1SE9A 2C5LC 3H1UA 2EMTA 1E8XA 4II3B 2RPQA 3ECIA 3QARA 2L8JA 2LXAA 4W9DA 1VD2A 2G45B 3JYUA 3IHPC 5J2RA 1P98A 4W9EA 2KMCA 1WMHB 2DYMA 4W9JA 3K9OB 4DDGD 3QC8B 3JW0X 3DVGX 4HK2A 4LDTD 3QX1A 3DVGY 2PPHA 3IBEA 5LXIB 2XK5A 1WXVA 3KUDB 4IWPA 1P1AA 2AEHA 2GMIC 2KDEB 2Z59B 3VVWB 2BKRB 1WJ4A 2CKHB 3A4SC 4GN1A 3C0RB 3CSTA 1J8CA 1Y8RC 1ZW7A 1V2YA 4LDTB 3NOBA 3A1QB 3PGEA 3PLUA 4A3PA 3PRZA 4DK5A 2D07B 4KV2A 3DDCB 2NBVB 3B0AA 3OJ4B
chains in the Genus database with same CATH superfamily
2RGFA 2KFKA 2BKFA 2PTLA 4BKGA 1FFVA 1VDVA 2AL3A 2CHWA 4IM2A 4N6EB 2AQ3B 3CWIA 4K7SA 3HVDA 4YXDB 3NVVA 4TSSA 2KZRA 4MM3B 4C56C 1I42A 2KJRA 1ZXHA 4JWUC 3GB1A 1WZ3A 3P4RB 4DHZE 1XQQA 2BS3B 4B0EA 3SD5A 2KJHB 2BPSA 3R2IA 4MH8A 4OVUA 3A4RA 2WDRB 2KX0A 4P7IA 4OVVA 2K25A 2OOBB 3TBLD 4L1BA 2EELA 4LLGM 4A8XC 3V6EB 1IGDA 4EEWA 1UBIA 2GBNA 4XZ4A 5EE1A 1TT5B 4TQ1A 3TL5A 2CS4A 3MJWA 2V9HA 1KFYB 4IC7B 2J0JA 4KSKC 2L32A 3DVNU 3I5JC 3WANA 2L52A 2LHEA 4XC2A 2BVCA 3GZNI 3WCQA 1TZOA 3PVLA 3MJ5A 4FN2A 1R4MB 4IKGA 1A70A 4OZCA 2XN9C 2PVGC 2OEDA 2NBUA 3MHSD 4KKIA 3ZNID 1D4BA 2C60A 2BWFA 3PT2B 1IUEA 3O65B 1ENFA 4R3DA 2LXCA 1WI0A 4EKUA 3P63A 1WJUA 2JZZA 4ZYNA 2JX5A 5LNK1 5H8YE 5HG2A 1H4RA 2HE7A 3ZTCA 1AW7A 5AUIA 1TJEA 3TEYA 2Z0DB 3QCAA 1WZ0A 4GDLB 4OVZA 3WIMA 2YVCA 3U8ZA 2ZVOA 4L23A 4Q2JA 1WR1A 2VRRB 3ZO5B 1Q0WB 3PSEB 3Q14C 2K5PA 4H2AA 4ANVA 3NS8A 2J53A 1WGYA 2N0SB 1TTNA 2D3CA 2AYOB 2RDGA 1FCLA 5C23A 2DYOA 3ZDTA 1OQQA 3WAMA 3APCA 1STEA 4FHKA 5JZEB 4PS8A 4TUUA 3DBSA 4G50A 3AH7A 2YEPB 2RR9A 3GOEA 5J17A 3DWGC 3UIPB 3ZJUA 5AZHA 2BQQA 1ZP0B 2KANA 2NVUI 5FKAC 3A1QA 2GLSA 4EUTA 4G11A 1MI0A 2M19A 2ZNVB 4PT5A 1DOXA 2PE6B 4JX1C 2FAZA 4A20A 1J7CA 2QILA 3BZDB 3P4SB 4C80A 1E7PB 4AJWA 2DZMA 1CMXB 4USAA 4NJ6A 3KYDD 1H8CA 3HIZA 2DBYA 3AE5B 2KMMA 2INNE 1BMLC 2D3AA 3B1LX 2X8XX 4IWOA 2L05A 4KIKB 3EUB2 2WX0A 1KH0A 4OHJA 4I6PA 3R66C 3VR9B 3ZJTA 1GOZA 1NEKB 1N5XA 3T8MA 3KW5B 2KHWB 3MTNB 1MG4A 5GXGB 2IDYA 1Q1OA 4D2KA 3AE2B 5DPSA 2Y5CA 1TKEA 2JSVX 2XK5B 3SR6A 2JWZA 2K6QA 5D7GA 3DCGA 4FADA 2JRHA 2V4LA 3LB8C 3ZUNA 2L0FA 2HDEA 2JRIB 2MBQA 2I1KA 3VTUA 3ZRCA 5EE3A 2Q5WD 1E8WA 2KDBA 2V1YA 1EF1A 2I2YA 5CHFA 1AYFA 2RSUA 3PPAA 2MW5A 4MACA 2EKIA 4HDOA 2MBEA 1UNSA 1V49A 4II2B 4LNOA 2TSSA 3D32A 4LNIA 2PLPA 4BZAA 4RF0A 2A5UA 3MC8A 2FCQA 2J7QB 1VJKA 1A5RA 3R8BA 1ESFA 1EWYC 4DBGA 4IDIA 2LRUA 3ZNHB 1FNWA 4C00A 3H7PA 1ZDXA 3VRAB 1SJED 3UINB 2MRPA 2KWCA 3Q3JA 2D3BA 2RPVA 2QMTA 2CJNA 4ICUA 2QIEB 4YTMB 3GP7A 4F1SA 4GB9A 2ZVNA 1L0YB 1UWMA 1HA5A 1TZ1A 2IO2B 1C3TA 4E3CA 5G2NA 4BVUC 3NZ3A 1OTRB 1QOGA 2V3SA 1I4QA 1WJNA 1L2NA 1I4XA 1XT9B 2AQ1B 4JIOU 3CF6E 1T0YA 1YJIA 2FCSA 1GPXA 2DZIA 2LRWA 2JQRB 5IOIA 1I7HA 4MELA 1PGBA 3IG3A 1EWCA 4IG7B 3AE7B 5C3JB 1IYFA 3UGBB 2MHJA 4FXCA 3KWVA 1FD6A 4JQWC 4MSQB 2MA9B 2K0PA 3KYCD 1WY8A 1YN5A 2MWSB 4M0WA 2MEKA 4HVBA 3AE8B 2G1EA 1VCBA 4AQ7A 4EE2A 1HZ5A 2K3UA 1WFYA 2WXRA 3N32A 2J42A 3ZXRA 3JSVA 3OJ3A 4HJKA 1B9RA 3O13A 3TUOA 2WYQA 2D2QA 2L00B 4NY0A 2MLBA 3WAPA 3VHTC 2WXGA 3AI5A 4FJYA 1P7EA 2WXLA 5AZGA 3NRZA 4J6IA 1VZ8A 1E9MA 2BBCA 4II3B 2EMTA 4KGRA 1E0ZA 2ZW1A 4W9DA 1GAQB 4ZOHC 1C77A 2KN4A 3Q8CA 5EE0A 5J2RA 1TS4A 2DYMA 1F0ZA 3JW0X 3DVGX 2IPKD 3QX1A 2PPHA 2BT6A 3KUDB 1P1AA 4C4VA 3VVWB 3RNEC 1WJ4A 2CKHB 1J8CA 1Y8RC 1V2YA 4LDTB 3PLUA 2BW2A 4A3PA 1FO4A 2D07B 4A9AA 4US9A 4BBNC 5HKHA 4A90A 2I38A 1QOAA 4ARCA 2GB1A 4ZRJA 4MJSB 3ONSA 5I4DA 2BS4B 4XX5A 2K8BA 1BUIC 1B1ZA 1YQ4B 1ZGUB 4HPMB 4WJNA 1RAXA 1BXTA 1XLOA 2LGYA 2ICIA 2ZPYA 1N60A 2DZKA 1XF5L 4DXAB 4LNFA 1LM8B 3DOWA 1NBFC 2LUEA 3DPDA 4NQKE 1LO5D 3DBRI 3ZIMA 2IGDA 2V4IB 3SEBA 1C79A 2B76B 4ANUA 3DBLB 1JWSD 2QSDA 4GGQA 3DVNV 2WXQA 1J7AA 3JSVB 2K8HA 4ZRQA 2WXOA 3IFWB 1IBXB 1IPGA 1YJJA 4CQNA 2XBBC 4REZA 1MG8A 3I9V1 3BVZA 3SHQA 1J19A 2R61A 2V3PA 4HEA1 3VRBB 4RM8A 2E6XA 3PLVA 1KLUD 4EZJA 3L08A 5IA7A 2H88B 3PRMB 1T0QC 3ZQ4A 1J7BA 3RT3B 4HCNB 3PHWB 1Z2MA 1V1OA 5HI1A 3PHXB 1UGMA 2MH7A 5DCNA 3IVFA 3L4PA 1SGHA 2WNMA 4B9KA 1RWSA 1I4GA 4WJOA 4DHZB 2N7DA 2MP2B 5G5HA 1C1YB 1KTKA 1YN4A 1ZPSA 2MQJA 3J9CA 2Y5PA 1WYWB 3Q8EA 1I35A 2CR5A 2KWDA 1V5TA 2PW9A 3V05A 2JYEA 1HXYD 4AUQC 1TBEA 3OAWA 1WJ6A 2UWQA 2W9NA 4RMAA 1WRDB 4YL8A 2M17A 2FCMA 3LYYA 3R7RA 2WWZA 3TIXA 2N9PC 2LVOA 4GSWA 3PS6A 2JWUA 3TEWA 4I6LB 3GS2A 1ZUD2 1E7VA 2GOWA 2INCC 3FILB 2LGDA 1ZDVA 4MSMB 4GMVA 3H7SA 1VLBA 1WMHA 2WDTB 3U7ZA 3HVZA 1LGRA 1DOYA 3APFA 2WLBA 5CHVC 4YWGG 2JZPA 3B9JA 1L6UA 1R4NB 1JCKB 1WSPA 2R2QA 2LGIA 2DAJA 2GBMA 2K1FA 3NZSA 4K3CA 2BGFA 2KAJA 3NG0A 2ZPNA 2JZ3B 2MCNB 4RF1A 5D6JB 3N1YC 3A9JB 3RNFC 3ML8A 2BTEA 5DPWA 1F77A 2IO1B 5DPTA 2K9XA 1D5XC 4TV3A 4EZLA 5CHWA 4YSZB 2JPHA 2ACZB 1WXAA 4K1RB 4DHJB 1WGGA 5DPRA 4OZBA 4M02A 2KQSA 1E8ZA 2DX5B 1ACCA 1C4CA 3ENEA 2I1JA 3BIID 2KLGA 2YEPF 4LJPB 1UBQA 3AEFB 2NBWB 2FUG1 3WA0A 2JF5A 3A9KA 3CSFA 3IAM1 5L83A 1AARA 4PK1A 2CJOA 2QJLA 3AE9B 5IO9A 4F7ZA 4M00A 2JT4B 2BB5A 4S0RA 3L0WB 5C1ZA 2WQYB 1V1PA 1GB1A 3L10B 1X1MA 1RFKA 4IM0A 1GC7A 3AE4B 2KT7A 3VAWA 1R4MI 4NQLB 3VUWA 3HUIA 1XXGA 1LQBA 1UD7A 2RD0A 2KFKB 3NZUA 4GOCA 2LMCA 3RULA 1HZ6A 3Q8FA 1OGWA 2MJDA 4E71A 2AWTA 5IP4D 3V61A 2IGHA 1GC6A 4RCOA 1ZXIA 1IP9A 3VH4B 2ZZPB 5HHDG 1E5WA 1WGDA 1EU3A 1VR9A 4ANXA 5E6OA 3Q2AC 5TSSA 2PVOD 4URKA 2GBJA 2V0GA 3M3JA 4BKSD 3UQAA 3C8YA 3AU5A 1HTQA 1WE7A 3FAHA 1VRAB 4K7UA 4KGSA 1AWDA 4ZRIA 2GBKA 1SIFA 4RH6A 2OJRA 1JMLA 2WXPA 3W5VB 3ABVB 2M0XA 1YMHE 1D3ZA 2JY6A 1F9JA 2BS2B 1L4ZB 2KDMA 4FJZA 2M0AA 3TMPB 2BYFA 1TGZB 2GRIA 2HTHA 3B08A 2QCZA 4P6VF 1ZE3D 3VH3B 2KX3A 2BYVE 1FIQA 3OWEB 2MX2A 4JPSA 2CU1A 3QA8A 4DXGA 1EUVB 1D6EC 3EA6A 1S1QB 5D94A 2KD0A 4UDUC 2EMSA 3DBHB 2LVQA 2O6VD 3Q3MC 2D10A 4A55A 5AEKB 2L76A 3PZDA 3LJ3A 3WALA 4MGYE 3L17A 1T0RC 1T0SC 4RGNA 4NZLB 5D3DA 1RRBA 2HJ8A 2UYZB 1QQRA 2DZJA 3MHZA 1FXIA 2BYTA 1UWXA 4AOFA 2VZKD 2ZJDA 4HROA 2KJ6A 4HPLB 1JRUA 3CMMB 3DBHI 5LXHA 2N9LA 2D3GA 3AB5A 3ML9A 3AV8A 2C7HA 1D5ZC 3KUZA 3PO0A 4ZHOA 1KLGD 5IN7A 2KWVB 4NNJB 3RI7C 3VXWA 4S17A 3W2DA 2K22A 2C5LC 2RPQA 4YTPB 2LXAA 2WU5B 2L1AA 3OG5A 3JYUA 1ET6A 2KMCA 1L0VB 4DDGD 4HK2A 1FFUA 2W55A 5LXIB 4IWPA 1SEBD 1JQ4A 2PIAA 2Z59B 3EGRA 3C0RB 4XWTA 3A1QB 1SBBB 4KV2A 3TEXA 3SFDB 2NBVB 3OJ4B 1SXTA 2K8CA 2FCNA 5EE9A 5CX3A 2PJHA 4WAFA 2AL6A 3N9YC 4JE3B 4BOZB 2IO0B 3SFEB 3URYA 2Z8LA 4A3OA 5BMHA 3DQVA 3Q3NC 4K81A 3BYYB 3V62A 4L2YA 4XDCA 4MGKE 1FNUA 1QT9A 2LD9A 4F8CB 5EDSA 4MDKE 3KLSX 1T5XD 3Q8BA 4BKSA 5C2TB 4WH4A 3RNCC 1P9DU 1OEYJ 1RLFA 4JGHB 3M95A 3ZDMC 3HRDD 3NY5A 3SDLC 2ONQA 3KWLA 2Y5BB 4X57B 3TJPA 1WXQA 4P16A 3T3OA 5TR5A 1DYQA 5FR6A 1C4AA 1AN8A 1WH3A 1KOTA 1WF9A 4B6WA 3BYTB 1FNVA 1G6JA 2KLCA 4PYZA 4BKTA 3JVZX 3N20C 3ZVVA 3B2FA 1HQRD 4NAMA 4E74A 4CYEA 2FE8A 2FUHB 1FEHA 2NTSA 2KO3A 1EM7A 3R7QA 2DENB 4MGIE 2O6VA 4ICVA 4C7YA 1V81A 1UELA 2QEJC 2LEKA 4GDKA 2IYDB 4IUMB 3WAOA 1QZEA 3OLMD 2O2VA 1ROEA 3BK1A 2RDBC 3W1SA 4NAWA 1L4DB 3K9PB 4M8MA 3H7PB 4BOSC 1MJDA 3AMZA 4NJ7A 4G0NB 3M62B 3ZTDA 3VR8B 3ALBA 2LFIA 3PZ7A 2KMAA 1Z5SB 1PFDA 4FLHA 1WGRA 1XLNA 4NPNA 4IM3A 1CK1A 3UQBA 2WXKA 1FXTB 2LVPA 4WURA 1OFFA 3QWZB 1QF6A 3LXFA 2A4ZA 3U4EG 3ZJVA 1JWAD 3MFGA 3DHHC 2N1WA 2G4SA 3FKYA 2C7NB 1FMAD 4FULA 3A33B 2JU6X 2N9EB 3I57A 1DOIA 1J0GA 4P1CC 4HKQA 1E8YA 1ZKHA 2KWUB 1K52A 2NMQA 3Q3FA 2PKOA 2W54A 4KGTA 1V8CA 1E6EB 1M4VA 2WDQB 2YLMA 4M0WB 3H9DA 4RGOS 4HDQA 2LGXA 4KSLC 1L5PA 4IW0A 2N7EA 4OZAA 4DWFA 1JRPA 2WXMA 4MM3A 3R3MA 1C78A 4I6NB 4EZKA 1V86A 1HEZE 2KVRA 1GUAB 3DBLI 1P3QU 2K6DB 2BWES 3MP9A 4B95A 5JHBA 3FC4A 5T8IA 1Y56A 3Q69A 4ASWC 1RYJA 1FRRA 2N1VA 4RM9A 4CHKA 3V60A 3W9CB 4MT5A 2O2VB 1KM7A 1RFAA 2HD5B 2XEWA 3E9SA 4C7ZA 2KTRA 4XYCA 2DWQA 3DWMA 1GB4A 1WX9A 2IY1B 2VZKB 5JHAA 2KDIA 4C4VB 1K51A 3ZYYX 4HWIB 2X38A 2RDHA 3U2SC 1CZPA 1OQYA 3C19A 5BYQA 1SE3A 5HFYA 3TCAA 2PMVA 2L3ZA 3Q8AA 3RNBC 4W9FA 3IT6B 3AECB 4LK0M 3DHGC 2REXA 2IJ0A 2KQ7A 4FBJB 4DXFA 1NENB 3AM9A 2QHOA 2MJ3A 3HM6X 3L13A 4OW0A 3PTFC 2J0KA 3H6NA 1F2RC 1XLPA 4N59A 2C7MB 3VDZA 2DNFA 2M8SA 4FA6A 3AE1B 1N61A 4WJQA 3AE3B 1KLVA 4KKJA 3ZGZA 2JVCA 3AXCA 4DQOC 2NCNA 4GDLA 1N62A 1I4PA 4DDID 3TEZA 5L95C 2CU3A 4WWPA 4ZHPA 3R2TA 2ZCCA 2VH1A 3AULA 1UUPA 1EO6A 2IY0B 1OEYA 3QAQA 1SF0A 4AWJA 3I63C 2RMMA 1P0RA 2LJIA 1R4NI 2JYTA 1VZ6A 1MFWA 5G55A 4US8A 4M8NA 1V5OA 1CQVA 1WIAA 3MC9A 4ZDVA 1JWMD 1QOBA 3L16A 2QC8A 3AEAB 3EFUA 3RNAC 3GZNB 1PYWD 1MHHE 1OQRA 1N6ZA 1R7SA 2KTRB 2NR2A 3W1SC 1U4AA 4LTUA 1LFDA 1LXDA 1YX6B 5E6NA 4PS7A 2BF8B 3APDA 1HTOA 2J52A 1JROA 2ASQA 4AP4C 3N30A 2J4XA 4KX6B 2CHZA 2KTFA 5D2MB 4KDLB 2LASA 3NUHB 1WXMA 1WXSA 2LI5A 2N9XA 5CTRC 1NDDA 2V3NA 3VUYA 2FIDA 4KIKA 5GMVA 2BYEA 1WM2A 1SE9A 1E8XA 3N1XC 5JXVA 2Y3AA 3P1MA 2WHIA 2WS3B 2G45B 1I4RA 3IHPC 4YT0B 4YTNB 1WMHB 2HJ1A 3P4PB 4W9JA 3K9OB 3QC8B 4N58A 3UI3A 1ZOYB 1QOFA 4LDTD 1JWBD 3AE6B 3DVGY 3IBEA 1SB3C 2XK5A 1WXVA 2GMIC 5IKCM 4GN1A 5G5GA 1SIJA 4ACFA 4XWWA 3BVGA 2DLBA 4XE0A 3AEBB 3DDCB 2INDC 4EFOA 1NYQA 1SE2A 1XLQA 4G3XB 1WRIA 3M63B 3AEGB 5BO4B 2N9KA 2ZEQA 4JWSC 4YSYB 1L7YA 4IWQA 3N3KB 3P2BA 3UIOB 2FNJB 4RGMA 1BT0A 4NJCA 2D5GA 3IT4B 3ZRFA 4W9HA 5IAAC 3LDZE 2WXHA 2C9WB 3U30A 1TY2A 2M56B 3IXSA 1V97A 3W1YA 1KF6B 2LGSA 5BYSA 1I4HA 3AEDB 4HPPA 1L6VA 4P1BC 1TYGB 1YNTE 1QKZA 2WXJA 2NPTA 4PS3A 4GXBA 2CHXA 1TIFA 2KNBA 4W9CA 1XEEA 2FBWB 2N4FA 2OJWA 3A9KB 3S2AA 3SU8X 4PYUA 2OHFA 3E56A 1P7FA 1QILA 2WP9B 5JH5C 2R2OA 2W3RA 4YSXB 4GU2A 1MVKA 4JLCA 2AQ2B 1IGCA 2QDFA 4EOYA 4GLSC 3RCZA 4XDDA 1V1PB 3B2GA 3U52E 3TSSA 4LNNA 3GE3C 3HHMA 4BBNF 2KQ4X 2VH2A 3NVZA 1E10A 2L0TA 1FXAA 4WQOB 1YN3A 1PDXA 1PQSA 1SE4A 3NVYA 2K39A 2WX1A 3IAS1 1JW9D 2WU2B 3BINA 5AUKA 3RUIB 5D3IB 1WWTA 1WX8A 1WYGA 3ETRA 2M1MA 5H92C 3T9LA 3CIRB 5KHOA 2SEBD 4ZRKA 1XCQL 1PGXA 4WQMA 2D11A 4B0MA 1ET9A 1S3SG 3PV1A 1WR6E 2LZ6A 2KC2A 2FIFA 2G9HD 2XNAC 3QJZA 1C76A 1WX7A 2PEAA 2M4NA 1FCCC 1QLBB 2KC1A 2IZVB 4KDIC 2MBHA 1PGAA 2E3TA 3BVMA 4N9F4 4ZRPA 1V80A 3Q6BA 3NHEB 1KJTA 2IBIB 1XCTL 2KDFB 2ZNVC 2NTTA 2NPTB 1GG3A 4RFBA 1YQBA 3BY4B 3NS1A 2W3SA 1YOVB 4ITKA 4HXDA 4WWNA 3PREA 2J0MA 1MHXA 1N5WA 3I3TB 1TKYA 2GI9A 1UH6A 4TQ0A 1E7UA 4QAYA 2DAFA 4MJSA 4DHJD 4M01A 3RMKC 4TKNA 3ZNZB 3RD2A 1L0XB 1Q5WB 3Q3OC 1UF0A 3UF8A 2MBBB 3AU4A 4RGTA 1RM6C 1JALA 1EU4A 4WWMA 1DGJA 2AX5A 3GE8C 2B3AA 1TKGA 3ZLZA 2KYWA 3X23A 1CJEA 3RYTA 4KZCA 4FJVB 1KRHA 5FR3A 1JWUD 1HE8A 3QK0A 3VQIA 1N63A 2MJEA 4JL9A 3PZ8A 4CO7A 1F1HA 2KACA 4W9GA 3PRPB 3VUXA 4LCDE 2G4DB 4BAXA 4AS1A 3L54A 2Z0EB 4XGAB 1NYRA 2L83A 1IBXA 2IO3B 4LNKA 3T3NA 2INPE 2DYBA 3V6CB 2SAKA 1TS5A 1E90A 1GJZA 4BFRA 3QQ8B 1C9FA 1VZ7A 2EKEC 3VTWA 3RZWC 1K50A 4WWOA 2UU7A 2LWPA 2ZCBA 1F52A 1Q10A 5BMGA 2LJ5A 3KUCB 2KFJA 4W9KA 5BMIA 1TS2A 1ISNA 4ARIA 5AZFA 2W82A 2MP2A 5KHQA 1SJHD 4WAAA 3RZFA 2KN5A 1YQ3B 2MBOA 3QHTA 2DHZA 1YJ1A 2ON8A 4K3BA 2KXJA 3N1ZC 1M94A 1YD8U 4KZ0A 3RN9C 2BB6A 4AJYB 3AEEB 5E6PA 3U7DA 3AN1A 1V6EA 3VTVA 3W5UB 1NI3A 2WDVB 1PUTA 1FRDA 2LUMA 1YX5B 4J3OD 1WE6A 3DBRB 3P4QB 1XO3A 3DHIC 3P42A 4LJOB 4ANWA 2H89B 4RNAA 4HKZE 5MPOA 1NVID 2HTME 3ZNGC 2KVZA 1UZXB 3FILA 2WGSA 4W9LA 5LLIA 1WGHA 1F2RI 2NS5A 1MPEA 1SSNA 3VFKA 4HLEA 3BWUD 3RPFC 4K7WA 2IGGA 4MH0E 1GNUA 2KOXA 3RFZB 3NVWA 1C4PA 4WIPA 4TMAB 2L7RA 3QIJA 1NI2A 2LHDA 2PE9A 3RNGC 3EFCA 2GBRA 3A9JA 1V9JA 1K8RB 3ZW3A 3EC8A 4HRSA 4KVGB 4W9IA 2O6VB 3V3XA 3EHVA 2JXXA 4A6QA 2JUOA 3NJTA 2G3QB 1TS3A 4ZYSA 5J18A 4GDKB 1XD3B 2WXNA 1YIWA 4MEMA 3KH0A 4HJGE 4HCPB 2MSED 1FM0D 5E6JA 4NAWB 1T6BX 2KK8A 2N7JA 4FHJA 2ZW0A 1WM3A 5BYRA 3HM3A 3EECA 2WXFA 3ZXVA 2KKCA 3X0WA 3HK0A 4WJPA 3KVFB 4IOIE 1K53A 3KQ4A 1EF5A 4GIVA 3ZKJC 3H8HA 4MGZE 3MC0B 3H1UA 3BK2A 3ECIA 3QARA 2L8JA 4O1NA 1VD2A 1TY0A 1P98A 4W9EA 5FK9C 1WGKA 2AEHA 1FPYA 2KDEB 1T3QA 2BKRB 3A4SC 3CSTA 2JXTA 1UGJA 1ZW7A 1D5MC 3NOBA 3PGEA 4DK5A 3PRZA 2WXIA 3B0AA
chains in the Genus database with same CATH topology
2K8CA 2RGFA 2KFKA 2FCNA 4EFOA 4G3XB 2BKFA 5CX3A 2PJHA 2AL6A 3M63B 4ZRJA 4BKGA 5BO4B 4MJSB 4BOZB 3ONSA 2AL3A 2CHWA 2IO0B 4IM2A 2ZEQA 1L7YA 4IWQA 3N3KB 3P2BA 3UIOB 4A3OA 2FNJB 4XX5A 1BT0A 3ZRFA 3DQVA 4K7SA 4W9HA 2K8BA 3LDZE 4K81A 5IAAC 2C9WB 3V62A 4WJNA 4HPMB 1ZGUB 4MGKE 3U30A 1RAXA 2KZRA 2LGYA 1I42A 2KJRA 2ZPYA 2DZKA 4DXAB 3W1YA 1LM8B 3DOWA 1NBFC 2LD9A 2LUEA 3DPDA 1WZ3A 4NQKE 4F8CB 3DBRI 3ZIMA 4DHZE 1XQQA 3SD5A 4MDKE 5EDSA 2KJHB 2BPSA 2NPTA 4PS3A 4OVUA 4GXBA 3A4RA 2CHXA 4ANUA 2KNBA 4W9CA 4BKSA 2N4FA 3A9KB 2KX0A 1P9DU 3S2AA 4P7IA 1OEYJ 3SU8X 4OVVA 2K25A 4PYUA 2OOBB 1RLFA 3TBLD 4JGHB 5JH5C 3M95A 4GGQA 3ZDMC 3SDLC 3NY5A 2R2OA 3DVNV 4GU2A 2Y5BB 3V6EB 4X57B 4JLCA 3TJPA 4EEWA 4EOYA 3JSVB 2K8HA 1UBIA 2GBNA 4XZ4A 3RCZA 3IFWB 5TR5A 5HKHA 1IPGA 4TQ1A 5FR6A 3TL5A 2CS4A 2XBBC 1MG8A 1KOTA 1WH3A 3HHMA 3SHQA 4BBNF 1J19A 3MJWA 1WF9A 4B6WA 4IC7B 4RM8A 2J0JA 4KSKC 1G6JA 3PLVA 2L0TA 4EZJA 3DVNU 2KLCA 3L08A 5IA7A 4WQOB 4PYZA 3WANA 3PRMB 4BKTA 3JVZX 3ZVVA 1PQSA 4XC2A 3RT3B 3GZNI 4HCNB 2K39A 3PHWB 2WX1A 4E74A 1Z2MA 3PVLA 4CYEA 3PHXB 1UGMA 4FN2A 3BINA 5DCNA 3IVFA 1SGHA 3RUIB 2FUHB 4B9KA 2KO3A 1WX8A 4WJOA 3MHSD 2NBUA 4DHZB 3ZNID 2C60A 2N7DA 2M1MA 3R7QA 2MP2B 2DENB 4MGIE 2O6VA 4ICVA 2BWFA 3T9LA 1V81A 1C1YB 1UELA 3PT2B 3O65B 5KHOA 4ZRKA 2MQJA 2IYDB 4GDKA 1WYWB 2LXCA 4IUMB 3WAOA 2CR5A 1I35A 1QZEA 1WI0A 1V5TA 4EKUA 3OLMD 2D11A 1WJUA 2JZZA 2O2VA 4ZYNA 3W1SA 4NAWA 1S3SG 3K9PB 4AUQC 3PV1A 4M8MA 1TBEA 1WR6E 2LZ6A 3H7PB 4BOSC 1H4RA 2FIFA 2HE7A 2KC2A 3OAWA 1WJ6A 2UWQA 3QJZA 2W9NA 3ZTCA 4NJ7A 4G0NB 2Z0DB 3M62B 3QCAA 4RMAA 1WX7A 1WZ0A 3ZTDA 2PEAA 4GDLB 3WIMA 2YVCA 3ALBA 3U8ZA 2M4NA 2ZVOA 1WRDB 2KC1A 2IZVB 1WR1A 4KDIC 2M17A 2VRRB 4YL8A 2FCMA 3ZO5B 2KMAA 2MBHA 3R7RA 1Q0WB 2WWZA 3PSEB 3TIXA 2N9PC 2LVOA 4GSWA 1Z5SB 3PS6A 4ANVA 4I6LB 3NS8A 4FLHA 1WGYA 1WGRA 1TTNA 2AYOB 4N9F4 5C23A 2DYOA 3ZDTA 3WAMA 1E7VA 2GOWA 3APCA 4NPNA 4IM3A 3UQBA 1V80A 4FHKA 2LGDA 3NHEB 4PS8A 5JZEB 1KJTA 2IBIB 4MSMB 1FXTB 3H7SA 4GMVA 2LVPA 4TUUA 1WMHA 3DBSA 2WDTB 4G50A 3QWZB 2RR9A 3GOEA 2KDFB 3APFA 5J17A 2A4ZA 2ZNVC 5CHVC 3UIPB 5AZHA 2N1WA 2G4SA 2NPTB 2R2QA 1GG3A 2C7NB 4FULA 1YQBA 3A33B 2DAJA 2GBMA 2KANA 2N9EB 2K1FA 2NVUI 3BY4B 3NZSA 3A1QA 2BGFA 2ZPNA 2JZ3B 4G11A 4HXDA 4WWNA 2MCNB 4EUTA 3PREA 1J0GA 2ZNVB 2J0MA 2PE6B 1E8YA 1ZKHA 2KWUB 5D6JB 3I3TB 2FAZA 3Q3FA 3A9JB 3ML8A 4A20A 1UH6A 4TQ0A 5DPWA 2YLMA 1E7UA 4M0WB 3H9DA 2IO1B 2DAFA 4MJSA 5DPTA 4DHJD 4TV3A 4HDQA 2LGXA 4TKNA 3ZNZB 3RD2A 4EZLA 4KSLC 5CHWA 1Q5WB 4AJWA 2JPHA 2DZMA 4IW0A 2N7EA 3UF8A 1CMXB 1WXAA 4K1RB 4DHJB 1WGGA 4DWFA 2MBBB 5DPRA 4NJ6A 3AU4A 3KYDD 1H8CA 2KQSA 4MM3A 3R3MA 1E8ZA 2DX5B 3HIZA 4I6NB 2B3AA 3ENEA 4EZKA 2I1JA 3ZLZA 1V86A 3X23A 2KVRA 1GUAB 2KLGA 3RYTA 4LJPB 3DBLI 4KZCA 1UBQA 4FJVB 3B1LX 1P3QU 2K6DB 2BWES 1HE8A 4IWOA 2L05A 3QK0A 4B95A 3VQIA 2NBWB 5JHBA 4KIKB 4JL9A 3WA0A 2WX0A 4ASWC 2JF5A 3A9KA 3CSFA 4I6PA 4CO7A 5L83A 3R66C 1AARA 2N1VA 4W9GA 3PRPB 3VUXA 4LCDE 2G4DB 3T8MA 4RM9A 3L54A 4CHKA 4F7ZA 2Z0EB 3V60A 3KW5B 2JT4B 2KHWB 3MTNB 2O2VB 3L0WB 5C1ZA 1KM7A 1Q1OA 1RFAA 2HD5B 2XEWA 2KTRA 2IO3B 5DPSA 2DYBA 1WX9A 2IY1B 3V6CB 2XK5B 5JHAA 2JWZA 2K6QA 2KDIA 3DCGA 5D7GA 4FADA 3L10B 1X1MA 2JRHA 2V4LA 4HWIB 4IM0A 3ZUNA 2L0FA 2MBQA 2JRIB 1GC7A 2I1KA 3VTUA 3ZRCA 1E90A 1OQYA 1GJZA 3VAWA 1R4MI 4NQLB 3VUWA 4BFRA 1E8WA 2KDBA 3QQ8B 2EKEC 2V1YA 1EF1A 3RZWC 3VTWA 1LQBA 3TCAA 1UD7A 2L3ZA 2KFKB 2RD0A 3NZUA 4GOCA 4W9FA 5CHFA 4WWOA 2RSUA 3PPAA 3RULA 2LWPA 2ZCBA 1OGWA 2MW5A 4E71A 4HDOA 2AWTA 2REXA 2LJ5A 3KUCB 2KFJA 2MBEA 4W9KA 2KQ7A 3V61A 1ISNA 4FBJB 1V49A 4II2B 5AZFA 1GC6A 2MP2A 5KHQA 3D32A 1IP9A 4BBNC 4WAAA 3VH4B 3RZFA 2KN5A 2ZZPB 2QHOA 2MBOA 2A5UA 1E5WA 1WGDA 2FCQA 2DHZA 1YJ1A 3HM6X 3L13A 3PTFC 2J0KA 3QHTA 2KXJA 2J7QB 4ANXA 5E6OA 3H6NA 1M94A 1A5RA 1YD8U 4KZ0A 4URKA 2GBJA 4AJYB 2C7MB 3M3JA 3VDZA 5E6PA 3U7DA 4DBGA 2M8SA 1V6EA 2LRUA 3VTVA 3ZNHB 4BKSD 4FA6A 3UQAA 3AU5A 3H7PA 4WJQA 3UINB 2MRPA 1WE7A 2KWCA 1KLVA 3Q3JA 2JVCA 1YX5B 3AXCA 1WE6A 2NCNA 4ICUA 4K7UA 4GDLA 4ZRIA 2GBKA 1SIFA 4LJOB 2OJRA 4F1SA 4ANWA 4DDID 4GB9A 2ZVNA 2M0XA 5L95C 4WWPA 2ZCCA 1D3ZA 3AULA 2JY6A 1TZ1A 2IO2B 3ZNGC 1C3TA 4E3CA 1F9JA 4FJZA 1EO6A 5G2NA 4BVUC 2IY0B 1OEYA 3QAQA 4AWJA 1UZXB 3TMPB 2BYFA 1TGZB 1OTRB 1P0RA 2HTHA 3B08A 2V3SA 4W9LA 5LLIA 1WGHA 1WJNA 2NS5A 1L2NA 1R4NI 1XT9B 3VH3B 3VFKA 4JIOU 4HLEA 2KX3A 5G55A 2BYVE 3CF6E 1T0YA 4K7WA 2FCSA 2MX2A 2CU1A 4M8NA 4MH0E 3QA8A 1V5OA 1GNUA 1EUVB 2DZIA 2LRWA 2KOXA 1WIAA 4MELA 1S1QB 3IG3A 4IG7B 5D94A 2KD0A 2L7RA 4ZDVA 3QIJA 1IYFA 3UGBB 2EMSA 1NI2A 2LVQA 2PE9A 2MA9B 3L16A 2O6VD 4JQWC 4MSQB 2D10A 3KYCD 5AEKB 2L76A 3EFUA 3PZDA 2GBRA 3LJ3A 3A9JA 1V9JA 3WALA 1K8RB 4MGYE 3ZW3A 3EC8A 1WY8A 3L17A 4KVGB 4W9IA 2KTRB 2O6VB 2MWSB 2NR2A 3W1SC 1U4AA 1LFDA 3EHVA 1RRBA 4HVBA 2HJ8A 2JXXA 2UYZB 1LXDA 2DZJA 2JUOA 1VCBA 2G3QB 1YX6B 5J18A 4GDKB 1XD3B 4PS7A 1YIWA 2BF8B 3APDA 3KH0A 1WFYA 4MEMA 5E6NA 4AOFA 3N32A 2ZJDA 4HCPB 2KJ6A 3JSVA 4HPLB 1JRUA 2MSED 2ASQA 4AP4C 3N30A 3OJ3A 4NAWB 3CMMB 2KK8A 3DBHI 5LXHA 4FHJA 4HJKA 1WM3A 2D3GA 2CHZA 3HM3A 3EECA 3ML9A 2KTFA 5D2MB 2C7HA 4KDLB 2KKCA 2WYQA 3X0WA 3HK0A 2LASA 2D2QA 2L00B 4NY0A 3KUZA 1WXMA 2MLBA 1WXSA 2LI5A 3WAPA 4WJPA 2N9XA 5CTRC 1NDDA 3VHTC 4FJYA 3AI5A 3VUYA 2KWVB 2FIDA 4KIKA 3KVFB 4NNJB 5GMVA 5AZGA 3ZKJC 1EF5A 4GIVA 3VXWA 2BYEA 1WM2A 4MGZE 4J6IA 1SE9A 2C5LC 3H1UA 2EMTA 1E8XA 4II3B 2RPQA 3ECIA 3QARA 2L8JA 2LXAA 4W9DA 1VD2A 2G45B 3JYUA 3IHPC 5J2RA 1P98A 4W9EA 2KMCA 1WMHB 2DYMA 4W9JA 3K9OB 4DDGD 3QC8B 3JW0X 3DVGX 4HK2A 4LDTD 3QX1A 3DVGY 2PPHA 3IBEA 5LXIB 2XK5A 1WXVA 3KUDB 4IWPA 1P1AA 2AEHA 2GMIC 2KDEB 2Z59B 3VVWB 2BKRB 1WJ4A 2CKHB 3A4SC 4GN1A 3C0RB 3CSTA 1J8CA 1Y8RC 1ZW7A 1V2YA 4LDTB 3NOBA 3A1QB 3PGEA 3PLUA 4A3PA 3PRZA 4DK5A 2D07B 4KV2A 3DDCB 2NBVB 3B0AA 3OJ4B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K8C A;  2RGF A;  2KFK A;  2FCN A;  4EFO A;  4G3X B;  2BKF A;  5CX3 A;  2PJH A;  2AL6 A;  3M63 B;  4ZRJ A;  4BKG A;  5BO4 B;  4MJS B;  4BOZ B;  3ONS A;  2AL3 A;  2CHW A;  2IO0 B;  4IM2 A;  2ZEQ A;  1L7Y A;  4IWQ A;  3N3K B;  3P2B A;  3UIO B;  4A3O A;  2FNJ B;  4XX5 A;  1BT0 A;  3ZRF A;  3DQV A;  4K7S A;  4W9H A;  2K8B A;  3LDZ E;  4K81 A;  5IAA C;  2C9W B;  3V62 A;  4WJN A;  4HPM B;  1ZGU B;  4MGK E;  3U30 A;  1RAX A;  2KZR A;  2LGY A;  1I42 A;  2KJR A;  2ZPY A;  2DZK A;  4DXA B;  3W1Y A;  1LM8 B;  3DOW A;  1NBF C;  2LD9 A;  2LUE A;  3DPD A;  1WZ3 A;  4NQK E;  4F8C B;  3DBR I;  3ZIM A;  4DHZ E;  1XQQ A;  3SD5 A;  4MDK E;  5EDS A;  2KJH B;  2BPS A;  2NPT A;  4PS3 A;  4OVU A;  4GXB A;  3A4R A;  2CHX A;  4ANU A;  2KNB A;  4W9C A;  4BKS A;  2N4F A;  3A9K B;  2KX0 A;  1P9D U;  3S2A A;  4P7I A;  1OEY J;  3SU8 X;  4OVV A;  2K25 A;  4PYU A;  2OOB B;  1RLF A;  3TBL D;  4JGH B;  5JH5 C;  3M95 A;  4GGQ A;  3ZDM C;  3SDL C;  3NY5 A;  2R2O A;  3DVN V;  4GU2 A;  2Y5B B;  3V6E B;  4X57 B;  4JLC A;  3TJP A;  4EEW A;  4EOY A;  3JSV B;  2K8H A;  1UBI A;  2GBN A;  4XZ4 A;  3RCZ A;  3IFW B;  5TR5 A;  5HKH A;  1IPG A;  4TQ1 A;  5FR6 A;  3TL5 A;  2CS4 A;  2XBB C;  1MG8 A;  1KOT A;  1WH3 A;  3HHM A;  3SHQ A;  4BBN F;  1J19 A;  3MJW A;  1WF9 A;  4B6W A;  4IC7 B;  4RM8 A;  2J0J A;  4KSK C;  1G6J A;  3PLV A;  2L0T A;  4EZJ A;  3DVN U;  2KLC A;  3L08 A;  5IA7 A;  4WQO B;  4PYZ A;  3WAN A;  3PRM B;  4BKT A;  3JVZ X;  3ZVV A;  1PQS A;  4XC2 A;  3RT3 B;  3GZN I;  4HCN B;  2K39 A;  3PHW B;  2WX1 A;  4E74 A;  1Z2M A;  3PVL A;  4CYE A;  3PHX B;  1UGM A;  4FN2 A;  3BIN A;  5DCN A;  3IVF A;  1SGH A;  3RUI B;  2FUH B;  4B9K A;  2KO3 A;  1WX8 A;  4WJO A;  3MHS D;  2NBU A;  4DHZ B;  3ZNI D;  2C60 A;  2N7D A;  2M1M A;  3R7Q A;  2MP2 B;  2DEN B;  4MGI E;  2O6V A;  4ICV A;  2BWF A;  3T9L A;  1V81 A;  1C1Y B;  1UEL A;  3PT2 B;  3O65 B;  5KHO A;  4ZRK A;  2MQJ A;  2IYD B;  4GDK A;  1WYW B;  2LXC A;  4IUM B;  3WAO A;  2CR5 A;  1I35 A;  1QZE A;  1WI0 A;  1V5T A;  4EKU A;  3OLM D;  2D11 A;  1WJU A;  2JZZ A;  2O2V A;  4ZYN A;  3W1S A;  4NAW A;  1S3S G;  3K9P B;  4AUQ C;  3PV1 A;  4M8M A;  1TBE A;  1WR6 E;  2LZ6 A;  3H7P B;  4BOS C;  1H4R A;  2FIF A;  2HE7 A;  2KC2 A;  3OAW A;  1WJ6 A;  2UWQ A;  3QJZ A;  2W9N A;  3ZTC A;  4NJ7 A;  4G0N B;  2Z0D B;  3M62 B;  3QCA A;  4RMA A;  1WX7 A;  1WZ0 A;  3ZTD A;  2PEA A;  4GDL B;  3WIM A;  2YVC A;  3ALB A;  3U8Z A;  2M4N A;  2ZVO A;  1WRD B;  2KC1 A;  2IZV B;  1WR1 A;  4KDI C;  2M17 A;  2VRR B;  4YL8 A;  2FCM A;  3ZO5 B;  2KMA A;  2MBH A;  3R7R A;  1Q0W B;  2WWZ A;  3PSE B;  3TIX A;  2N9P C;  2LVO A;  4GSW A;  1Z5S B;  3PS6 A;  4ANV A;  4I6L B;  3NS8 A;  4FLH A;  1WGY A;  1WGR A;  1TTN A;  2AYO B;  4N9F 4;  5C23 A;  2DYO A;  3ZDT A;  3WAM A;  1E7V A;  2GOW A;  3APC A;  4NPN A;  4IM3 A;  3UQB A;  1V80 A;  4FHK A;  2LGD A;  3NHE B;  4PS8 A;  5JZE B;  1KJT A;  2IBI B;  4MSM B;  1FXT B;  3H7S A;  4GMV A;  2LVP A;  4TUU A;  1WMH A;  3DBS A;  2WDT B;  4G50 A;  3QWZ B;  2RR9 A;  3GOE A;  2KDF B;  3APF A;  5J17 A;  2A4Z A;  2ZNV C;  5CHV C;  3UIP B;  5AZH A;  2N1W A;  2G4S A;  2NPT B;  2R2Q A;  1GG3 A;  2C7N B;  4FUL A;  1YQB A;  3A33 B;  2DAJ A;  2GBM A;  2KAN A;  2N9E B;  2K1F A;  2NVU I;  3BY4 B;  3NZS A;  3A1Q A;  2BGF A;  2ZPN A;  2JZ3 B;  4G11 A;  4HXD A;  4WWN A;  2MCN B;  4EUT A;  3PRE A;  1J0G A;  2ZNV B;  2J0M A;  2PE6 B;  1E8Y A;  1ZKH A;  2KWU B;  5D6J B;  3I3T B;  2FAZ A;  3Q3F A;  3A9J B;  3ML8 A;  4A20 A;  1UH6 A;  4TQ0 A;  5DPW A;  2YLM A;  1E7U A;  4M0W B;  3H9D A;  2IO1 B;  2DAF A;  4MJS A;  5DPT A;  4DHJ D;  4TV3 A;  4HDQ A;  2LGX A;  4TKN A;  3ZNZ B;  3RD2 A;  4EZL A;  4KSL C;  5CHW A;  1Q5W B;  4AJW A;  2JPH A;  2DZM A;  4IW0 A;  2N7E A;  3UF8 A;  1CMX B;  1WXA A;  4K1R B;  4DHJ B;  1WGG A;  4DWF A;  2MBB B;  5DPR A;  4NJ6 A;  3AU4 A;  3KYD D;  1H8C A;  2KQS A;  4MM3 A;  3R3M A;  1E8Z A;  2DX5 B;  3HIZ A;  4I6N B;  2B3A A;  3ENE A;  4EZK A;  2I1J A;  3ZLZ A;  1V86 A;  3X23 A;  2KVR A;  1GUA B;  2KLG A;  3RYT A;  4LJP B;  3DBL I;  4KZC A;  1UBQ A;  4FJV B;  3B1L X;  1P3Q U;  2K6D B;  2BWE S;  1HE8 A;  4IWO A;  2L05 A;  3QK0 A;  4B95 A;  3VQI A;  2NBW B;  5JHB A;  4KIK B;  4JL9 A;  3WA0 A;  2WX0 A;  4ASW C;  2JF5 A;  3A9K A;  3CSF A;  4I6P A;  4CO7 A;  5L83 A;  3R66 C;  1AAR A;  2N1V A;  4W9G A;  3PRP B;  3VUX A;  4LCD E;  2G4D B;  3T8M A;  4RM9 A;  3L54 A;  4CHK A;  4F7Z A;  2Z0E B;  3V60 A;  3KW5 B;  2JT4 B;  2KHW B;  3MTN B;  2O2V B;  3L0W B;  5C1Z A;  1KM7 A;  1Q1O A;  1RFA A;  2HD5 B;  2XEW A;  2KTR A;  2IO3 B;  5DPS A;  2DYB A;  1WX9 A;  2IY1 B;  3V6C B;  2XK5 B;  5JHA A;  2JWZ A;  2K6Q A;  2KDI A;  3DCG A;  5D7G A;  4FAD A;  3L10 B;  1X1M A;  2JRH A;  2V4L A;  4HWI B;  4IM0 A;  3ZUN A;  2L0F A;  2MBQ A;  2JRI B;  1GC7 A;  2I1K A;  3VTU A;  3ZRC A;  1E90 A;  1OQY A;  1GJZ A;  3VAW A;  1R4M I;  4NQL B;  3VUW A;  4BFR A;  1E8W A;  2KDB A;  3QQ8 B;  2EKE C;  2V1Y A;  1EF1 A;  3RZW C;  3VTW A;  1LQB A;  3TCA A;  1UD7 A;  2L3Z A;  2KFK B;  2RD0 A;  3NZU A;  4GOC A;  4W9F A;  5CHF A;  4WWO A;  2RSU A;  3PPA A;  3RUL A;  2LWP A;  2ZCB A;  1OGW A;  2MW5 A;  4E71 A;  4HDO A;  2AWT A;  2REX A;  2LJ5 A;  3KUC B;  2KFJ A;  2MBE A;  4W9K A;  2KQ7 A;  3V61 A;  1ISN A;  4FBJ B;  1V49 A;  4II2 B;  5AZF A;  1GC6 A;  2MP2 A;  5KHQ A;  3D32 A;  1IP9 A;  4BBN C;  4WAA A;  3VH4 B;  3RZF A;  2KN5 A;  2ZZP B;  2QHO A;  2MBO A;  2A5U A;  1E5W A;  1WGD A;  2FCQ A;  2DHZ A;  1YJ1 A;  3HM6 X;  3L13 A;  3PTF C;  2J0K A;  3QHT A;  2KXJ A;  2J7Q B;  4ANX A;  5E6O A;  3H6N A;  1M94 A;  1A5R A;  1YD8 U;  4KZ0 A;  4URK A;  2GBJ A;  4AJY B;  2C7M B;  3M3J A;  3VDZ A;  5E6P A;  3U7D A;  4DBG A;  2M8S A;  1V6E A;  2LRU A;  3VTV A;  3ZNH B;  4BKS D;  4FA6 A;  3UQA A;  3AU5 A;  3H7P A;  4WJQ A;  3UIN B;  2MRP A;  1WE7 A;  2KWC A;  1KLV A;  3Q3J A;  2JVC A;  1YX5 B;  3AXC A;  1WE6 A;  2NCN A;  4ICU A;  4K7U A;  4GDL A;  4ZRI A;  2GBK A;  1SIF A;  4LJO B;  2OJR A;  4F1S A;  4ANW A;  4DDI D;  4GB9 A;  2ZVN A;  2M0X A;  5L95 C;  4WWP A;  2ZCC A;  1D3Z A;  3AUL A;  2JY6 A;  1TZ1 A;  2IO2 B;  3ZNG C;  1C3T A;  4E3C A;  1F9J A;  4FJZ A;  1EO6 A;  5G2N A;  4BVU C;  2IY0 B;  1OEY A;  3QAQ A;  4AWJ A;  1UZX B;  3TMP B;  2BYF A;  1TGZ B;  1OTR B;  1P0R A;  2HTH A;  3B08 A;  2V3S A;  4W9L A;  5LLI A;  1WGH A;  1WJN A;  2NS5 A;  1L2N A;  1R4N I;  1XT9 B;  3VH3 B;  3VFK A;  4JIO U;  4HLE A;  2KX3 A;  5G55 A;  2BYV E;  3CF6 E;  1T0Y A;  4K7W A;  2FCS A;  2MX2 A;  2CU1 A;  4M8N A;  4MH0 E;  3QA8 A;  1V5O A;  1GNU A;  1EUV B;  2DZI A;  2LRW A;  2KOX A;  1WIA A;  4MEL A;  1S1Q B;  3IG3 A;  4IG7 B;  5D94 A;  2KD0 A;  2L7R A;  4ZDV A;  3QIJ A;  1IYF A;  3UGB B;  2EMS A;  1NI2 A;  2LVQ A;  2PE9 A;  2MA9 B;  3L16 A;  2O6V D;  4JQW C;  4MSQ B;  2D10 A;  3KYC D;  5AEK B;  2L76 A;  3EFU A;  3PZD A;  2GBR A;  3LJ3 A;  3A9J A;  1V9J A;  3WAL A;  1K8R B;  4MGY E;  3ZW3 A;  3EC8 A;  1WY8 A;  3L17 A;  4KVG B;  4W9I A;  2KTR B;  2O6V B;  2MWS B;  2NR2 A;  3W1S C;  1U4A A;  1LFD A;  3EHV A;  1RRB A;  4HVB A;  2HJ8 A;  2JXX A;  2UYZ B;  1LXD A;  2DZJ A;  2JUO A;  1VCB A;  2G3Q B;  1YX6 B;  5J18 A;  4GDK B;  1XD3 B;  4PS7 A;  1YIW A;  2BF8 B;  3APD A;  3KH0 A;  1WFY A;  4MEM A;  5E6N A;  4AOF A;  3N32 A;  2ZJD A;  4HCP B;  2KJ6 A;  3JSV A;  4HPL B;  1JRU A;  2MSE D;  2ASQ A;  4AP4 C;  3N30 A;  3OJ3 A;  4NAW B;  3CMM B;  2KK8 A;  3DBH I;  5LXH A;  4FHJ A;  4HJK A;  1WM3 A;  2D3G A;  2CHZ A;  3HM3 A;  3EEC A;  3ML9 A;  2KTF A;  5D2M B;  2C7H A;  4KDL B;  2KKC A;  2WYQ A;  3X0W A;  3HK0 A;  2LAS A;  2D2Q A;  2L00 B;  4NY0 A;  3KUZ A;  1WXM A;  2MLB A;  1WXS A;  2LI5 A;  3WAP A;  4WJP A;  2N9X A;  5CTR C;  1NDD A;  3VHT C;  4FJY A;  3AI5 A;  3VUY A;  2KWV B;  2FID A;  4KIK A;  3KVF B;  4NNJ B;  5GMV A;  5AZG A;  3ZKJ C;  1EF5 A;  4GIV A;  3VXW A;  2BYE A;  1WM2 A;  4MGZ E;  4J6I A;  1SE9 A;  2C5L C;  3H1U A;  2EMT A;  1E8X A;  4II3 B;  2RPQ A;  3ECI A;  3QAR A;  2L8J A;  2LXA A;  4W9D A;  1VD2 A;  2G45 B;  3JYU A;  3IHP C;  5J2R A;  1P98 A;  4W9E A;  2KMC A;  1WMH B;  2DYM A;  4W9J A;  3K9O B;  4DDG D;  3QC8 B;  3JW0 X;  3DVG X;  4HK2 A;  4LDT D;  3QX1 A;  3DVG Y;  2PPH A;  3IBE A;  5LXI B;  2XK5 A;  1WXV A;  3KUD B;  4IWP A;  1P1A A;  2AEH A;  2GMI C;  2KDE B;  2Z59 B;  3VVW B;  2BKR B;  1WJ4 A;  2CKH B;  3A4S C;  4GN1 A;  3C0R B;  3CST A;  1J8C A;  1Y8R C;  1ZW7 A;  1V2Y A;  4LDT B;  3NOB A;  3A1Q B;  3PGE A;  3PLU A;  4A3P A;  3PRZ A;  4DK5 A;  2D07 B;  4KV2 A;  3DDC B;  2NBV B;  3B0A A;  3OJ4 B; 
#chains in the Genus database with same CATH topology
 2RGF A;  2KFK A;  2BKF A;  2PTL A;  4BKG A;  1FFV A;  1VDV A;  2AL3 A;  2CHW A;  4IM2 A;  4N6E B;  2AQ3 B;  3CWI A;  4K7S A;  3HVD A;  4YXD B;  3NVV A;  4TSS A;  2KZR A;  4MM3 B;  4C56 C;  1I42 A;  2KJR A;  1ZXH A;  4JWU C;  3GB1 A;  1WZ3 A;  3P4R B;  4DHZ E;  1XQQ A;  2BS3 B;  4B0E A;  3SD5 A;  2KJH B;  2BPS A;  3R2I A;  4MH8 A;  4OVU A;  3A4R A;  2WDR B;  2KX0 A;  4P7I A;  4OVV A;  2K25 A;  2OOB B;  3TBL D;  4L1B A;  2EEL A;  4LLG M;  4A8X C;  3V6E B;  1IGD A;  4EEW A;  1UBI A;  2GBN A;  4XZ4 A;  5EE1 A;  1TT5 B;  4TQ1 A;  3TL5 A;  2CS4 A;  3MJW A;  2V9H A;  1KFY B;  4IC7 B;  2J0J A;  4KSK C;  2L32 A;  3DVN U;  3I5J C;  3WAN A;  2L52 A;  2LHE A;  4XC2 A;  2BVC A;  3GZN I;  3WCQ A;  1TZO A;  3PVL A;  3MJ5 A;  4FN2 A;  1R4M B;  4IKG A;  1A70 A;  4OZC A;  2XN9 C;  2PVG C;  2OED A;  2NBU A;  3MHS D;  4KKI A;  3ZNI D;  1D4B A;  2C60 A;  2BWF A;  3PT2 B;  1IUE A;  3O65 B;  1ENF A;  4R3D A;  2LXC A;  1WI0 A;  4EKU A;  3P63 A;  1WJU A;  2JZZ A;  4ZYN A;  2JX5 A;  5LNK 1;  5H8Y E;  5HG2 A;  1H4R A;  2HE7 A;  3ZTC A;  1AW7 A;  5AUI A;  1TJE A;  3TEY A;  2Z0D B;  3QCA A;  1WZ0 A;  4GDL B;  4OVZ A;  3WIM A;  2YVC A;  3U8Z A;  2ZVO A;  4L23 A;  4Q2J A;  1WR1 A;  2VRR B;  3ZO5 B;  1Q0W B;  3PSE B;  3Q14 C;  2K5P A;  4H2A A;  4ANV A;  3NS8 A;  2J53 A;  1WGY A;  2N0S B;  1TTN A;  2D3C A;  2AYO B;  2RDG A;  1FCL A;  5C23 A;  2DYO A;  3ZDT A;  1OQQ A;  3WAM A;  3APC A;  1STE A;  4FHK A;  5JZE B;  4PS8 A;  4TUU A;  3DBS A;  4G50 A;  3AH7 A;  2YEP B;  2RR9 A;  3GOE A;  5J17 A;  3DWG C;  3UIP B;  3ZJU A;  5AZH A;  2BQQ A;  1ZP0 B;  2KAN A;  2NVU I;  5FKA C;  3A1Q A;  2GLS A;  4EUT A;  4G11 A;  1MI0 A;  2M19 A;  2ZNV B;  4PT5 A;  1DOX A;  2PE6 B;  4JX1 C;  2FAZ A;  4A20 A;  1J7C A;  2QIL A;  3BZD B;  3P4S B;  4C80 A;  1E7P B;  4AJW A;  2DZM A;  1CMX B;  4USA A;  4NJ6 A;  3KYD D;  1H8C A;  3HIZ A;  2DBY A;  3AE5 B;  2KMM A;  2INN E;  1BML C;  2D3A A;  3B1L X;  2X8X X;  4IWO A;  2L05 A;  4KIK B;  3EUB 2;  2WX0 A;  1KH0 A;  4OHJ A;  4I6P A;  3R66 C;  3VR9 B;  3ZJT A;  1GOZ A;  1NEK B;  1N5X A;  3T8M A;  3KW5 B;  2KHW B;  3MTN B;  1MG4 A;  5GXG B;  2IDY A;  1Q1O A;  4D2K A;  3AE2 B;  5DPS A;  2Y5C A;  1TKE A;  2JSV X;  2XK5 B;  3SR6 A;  2JWZ A;  2K6Q A;  5D7G A;  3DCG A;  4FAD A;  2JRH A;  2V4L A;  3LB8 C;  3ZUN A;  2L0F A;  2HDE A;  2JRI B;  2MBQ A;  2I1K A;  3VTU A;  3ZRC A;  5EE3 A;  2Q5W D;  1E8W A;  2KDB A;  2V1Y A;  1EF1 A;  2I2Y A;  5CHF A;  1AYF A;  2RSU A;  3PPA A;  2MW5 A;  4MAC A;  2EKI A;  4HDO A;  2MBE A;  1UNS A;  1V49 A;  4II2 B;  4LNO A;  2TSS A;  3D32 A;  4LNI A;  2PLP A;  4BZA A;  4RF0 A;  2A5U A;  3MC8 A;  2FCQ A;  2J7Q B;  1VJK A;  1A5R A;  3R8B A;  1ESF A;  1EWY C;  4DBG A;  4IDI A;  2LRU A;  3ZNH B;  1FNW A;  4C00 A;  3H7P A;  1ZDX A;  3VRA B;  1SJE D;  3UIN B;  2MRP A;  2KWC A;  3Q3J A;  2D3B A;  2RPV A;  2QMT A;  2CJN A;  4ICU A;  2QIE B;  4YTM B;  3GP7 A;  4F1S A;  4GB9 A;  2ZVN A;  1L0Y B;  1UWM A;  1HA5 A;  1TZ1 A;  2IO2 B;  1C3T A;  4E3C A;  5G2N A;  4BVU C;  3NZ3 A;  1OTR B;  1QOG A;  2V3S A;  1I4Q A;  1WJN A;  1L2N A;  1I4X A;  1XT9 B;  2AQ1 B;  4JIO U;  3CF6 E;  1T0Y A;  1YJI A;  2FCS A;  1GPX A;  2DZI A;  2LRW A;  2JQR B;  5IOI A;  1I7H A;  4MEL A;  1PGB A;  3IG3 A;  1EWC A;  4IG7 B;  3AE7 B;  5C3J B;  1IYF A;  3UGB B;  2MHJ A;  4FXC A;  3KWV A;  1FD6 A;  4JQW C;  4MSQ B;  2MA9 B;  2K0P A;  3KYC D;  1WY8 A;  1YN5 A;  2MWS B;  4M0W A;  2MEK A;  4HVB A;  3AE8 B;  2G1E A;  1VCB A;  4AQ7 A;  4EE2 A;  1HZ5 A;  2K3U A;  1WFY A;  2WXR A;  3N32 A;  2J42 A;  3ZXR A;  3JSV A;  3OJ3 A;  4HJK A;  1B9R A;  3O13 A;  3TUO A;  2WYQ A;  2D2Q A;  2L00 B;  4NY0 A;  2MLB A;  3WAP A;  3VHT C;  2WXG A;  3AI5 A;  4FJY A;  1P7E A;  2WXL A;  5AZG A;  3NRZ A;  4J6I A;  1VZ8 A;  1E9M A;  2BBC A;  4II3 B;  2EMT A;  4KGR A;  1E0Z A;  2ZW1 A;  4W9D A;  1GAQ B;  4ZOH C;  1C77 A;  2KN4 A;  3Q8C A;  5EE0 A;  5J2R A;  1TS4 A;  2DYM A;  1F0Z A;  3JW0 X;  3DVG X;  2IPK D;  3QX1 A;  2PPH A;  2BT6 A;  3KUD B;  1P1A A;  4C4V A;  3VVW B;  3RNE C;  1WJ4 A;  2CKH B;  1J8C A;  1Y8R C;  1V2Y A;  4LDT B;  3PLU A;  2BW2 A;  4A3P A;  1FO4 A;  2D07 B;  4A9A A;  4US9 A;  4BBN C;  5HKH A;  4A90 A;  2I38 A;  1QOA A;  4ARC A;  2GB1 A;  4ZRJ A;  4MJS B;  3ONS A;  5I4D A;  2BS4 B;  4XX5 A;  2K8B A;  1BUI C;  1B1Z A;  1YQ4 B;  1ZGU B;  4HPM B;  4WJN A;  1RAX A;  1BXT A;  1XLO A;  2LGY A;  2ICI A;  2ZPY A;  1N60 A;  2DZK A;  1XF5 L;  4DXA B;  4LNF A;  1LM8 B;  3DOW A;  1NBF C;  2LUE A;  3DPD A;  4NQK E;  1LO5 D;  3DBR I;  3ZIM A;  2IGD A;  2V4I B;  3SEB A;  1C79 A;  2B76 B;  4ANU A;  3DBL B;  1JWS D;  2QSD A;  4GGQ A;  3DVN V;  2WXQ A;  1J7A A;  3JSV B;  2K8H A;  4ZRQ A;  2WXO A;  3IFW B;  1IBX B;  1IPG A;  1YJJ A;  4CQN A;  2XBB C;  4REZ A;  1MG8 A;  3I9V 1;  3BVZ A;  3SHQ A;  1J19 A;  2R61 A;  2V3P A;  4HEA 1;  3VRB B;  4RM8 A;  2E6X A;  3PLV A;  1KLU D;  4EZJ A;  3L08 A;  5IA7 A;  2H88 B;  3PRM B;  1T0Q C;  3ZQ4 A;  1J7B A;  3RT3 B;  4HCN B;  3PHW B;  1Z2M A;  1V1O A;  5HI1 A;  3PHX B;  1UGM A;  2MH7 A;  5DCN A;  3IVF A;  3L4P A;  1SGH A;  2WNM A;  4B9K A;  1RWS A;  1I4G A;  4WJO A;  4DHZ B;  2N7D A;  2MP2 B;  5G5H A;  1C1Y B;  1KTK A;  1YN4 A;  1ZPS A;  2MQJ A;  3J9C A;  2Y5P A;  1WYW B;  3Q8E A;  1I35 A;  2CR5 A;  2KWD A;  1V5T A;  2PW9 A;  3V05 A;  2JYE A;  1HXY D;  4AUQ C;  1TBE A;  3OAW A;  1WJ6 A;  2UWQ A;  2W9N A;  4RMA A;  1WRD B;  4YL8 A;  2M17 A;  2FCM A;  3LYY A;  3R7R A;  2WWZ A;  3TIX A;  2N9P C;  2LVO A;  4GSW A;  3PS6 A;  2JWU A;  3TEW A;  4I6L B;  3GS2 A;  1ZUD 2;  1E7V A;  2GOW A;  2INC C;  3FIL B;  2LGD A;  1ZDV A;  4MSM B;  4GMV A;  3H7S A;  1VLB A;  1WMH A;  2WDT B;  3U7Z A;  3HVZ A;  1LGR A;  1DOY A;  3APF A;  2WLB A;  5CHV C;  4YWG G;  2JZP A;  3B9J A;  1L6U A;  1R4N B;  1JCK B;  1WSP A;  2R2Q A;  2LGI A;  2DAJ A;  2GBM A;  2K1F A;  3NZS A;  4K3C A;  2BGF A;  2KAJ A;  3NG0 A;  2ZPN A;  2JZ3 B;  2MCN B;  4RF1 A;  5D6J B;  3N1Y C;  3A9J B;  3RNF C;  3ML8 A;  2BTE A;  5DPW A;  1F77 A;  2IO1 B;  5DPT A;  2K9X A;  1D5X C;  4TV3 A;  4EZL A;  5CHW A;  4YSZ B;  2JPH A;  2ACZ B;  1WXA A;  4K1R B;  4DHJ B;  1WGG A;  5DPR A;  4OZB A;  4M02 A;  2KQS A;  1E8Z A;  2DX5 B;  1ACC A;  1C4C A;  3ENE A;  2I1J A;  3BII D;  2KLG A;  2YEP F;  4LJP B;  1UBQ A;  3AEF B;  2NBW B;  2FUG 1;  3WA0 A;  2JF5 A;  3A9K A;  3CSF A;  3IAM 1;  5L83 A;  1AAR A;  4PK1 A;  2CJO A;  2QJL A;  3AE9 B;  5IO9 A;  4F7Z A;  4M00 A;  2JT4 B;  2BB5 A;  4S0R A;  3L0W B;  5C1Z A;  2WQY B;  1V1P A;  1GB1 A;  3L10 B;  1X1M A;  1RFK A;  4IM0 A;  1GC7 A;  3AE4 B;  2KT7 A;  3VAW A;  1R4M I;  4NQL B;  3VUW A;  3HUI A;  1XXG A;  1LQB A;  1UD7 A;  2RD0 A;  2KFK B;  3NZU A;  4GOC A;  2LMC A;  3RUL A;  1HZ6 A;  3Q8F A;  1OGW A;  2MJD A;  4E71 A;  2AWT A;  5IP4 D;  3V61 A;  2IGH A;  1GC6 A;  4RCO A;  1ZXI A;  1IP9 A;  3VH4 B;  2ZZP B;  5HHD G;  1E5W A;  1WGD A;  1EU3 A;  1VR9 A;  4ANX A;  5E6O A;  3Q2A C;  5TSS A;  2PVO D;  4URK A;  2GBJ A;  2V0G A;  3M3J A;  4BKS D;  3UQA A;  3C8Y A;  3AU5 A;  1HTQ A;  1WE7 A;  3FAH A;  1VRA B;  4K7U A;  4KGS A;  1AWD A;  4ZRI A;  2GBK A;  1SIF A;  4RH6 A;  2OJR A;  1JML A;  2WXP A;  3W5V B;  3ABV B;  2M0X A;  1YMH E;  1D3Z A;  2JY6 A;  1F9J A;  2BS2 B;  1L4Z B;  2KDM A;  4FJZ A;  2M0A A;  3TMP B;  2BYF A;  1TGZ B;  2GRI A;  2HTH A;  3B08 A;  2QCZ A;  4P6V F;  1ZE3 D;  3VH3 B;  2KX3 A;  2BYV E;  1FIQ A;  3OWE B;  2MX2 A;  4JPS A;  2CU1 A;  3QA8 A;  4DXG A;  1EUV B;  1D6E C;  3EA6 A;  1S1Q B;  5D94 A;  2KD0 A;  4UDU C;  2EMS A;  3DBH B;  2LVQ A;  2O6V D;  3Q3M C;  2D10 A;  4A55 A;  5AEK B;  2L76 A;  3PZD A;  3LJ3 A;  3WAL A;  4MGY E;  3L17 A;  1T0R C;  1T0S C;  4RGN A;  4NZL B;  5D3D A;  1RRB A;  2HJ8 A;  2UYZ B;  1QQR A;  2DZJ A;  3MHZ A;  1FXI A;  2BYT A;  1UWX A;  4AOF A;  2VZK D;  2ZJD A;  4HRO A;  2KJ6 A;  4HPL B;  1JRU A;  3CMM B;  3DBH I;  5LXH A;  2N9L A;  2D3G A;  3AB5 A;  3ML9 A;  3AV8 A;  2C7H A;  1D5Z C;  3KUZ A;  3PO0 A;  4ZHO A;  1KLG D;  5IN7 A;  2KWV B;  4NNJ B;  3RI7 C;  3VXW A;  4S17 A;  3W2D A;  2K22 A;  2C5L C;  2RPQ A;  4YTP B;  2LXA A;  2WU5 B;  2L1A A;  3OG5 A;  3JYU A;  1ET6 A;  2KMC A;  1L0V B;  4DDG D;  4HK2 A;  1FFU A;  2W55 A;  5LXI B;  4IWP A;  1SEB D;  1JQ4 A;  2PIA A;  2Z59 B;  3EGR A;  3C0R B;  4XWT A;  3A1Q B;  1SBB B;  4KV2 A;  3TEX A;  3SFD B;  2NBV B;  3OJ4 B;  1SXT A;  2K8C A;  2FCN A;  5EE9 A;  5CX3 A;  2PJH A;  4WAF A;  2AL6 A;  3N9Y C;  4JE3 B;  4BOZ B;  2IO0 B;  3SFE B;  3URY A;  2Z8L A;  4A3O A;  5BMH A;  3DQV A;  3Q3N C;  4K81 A;  3BYY B;  3V62 A;  4L2Y A;  4XDC A;  4MGK E;  1FNU A;  1QT9 A;  2LD9 A;  4F8C B;  5EDS A;  4MDK E;  3KLS X;  1T5X D;  3Q8B A;  4BKS A;  5C2T B;  4WH4 A;  3RNC C;  1P9D U;  1OEY J;  1RLF A;  4JGH B;  3M95 A;  3ZDM C;  3HRD D;  3NY5 A;  3SDL C;  2ONQ A;  3KWL A;  2Y5B B;  4X57 B;  3TJP A;  1WXQ A;  4P16 A;  3T3O A;  5TR5 A;  1DYQ A;  5FR6 A;  1C4A A;  1AN8 A;  1WH3 A;  1KOT A;  1WF9 A;  4B6W A;  3BYT B;  1FNV A;  1G6J A;  2KLC A;  4PYZ A;  4BKT A;  3JVZ X;  3N20 C;  3ZVV A;  3B2F A;  1HQR D;  4NAM A;  4E74 A;  4CYE A;  2FE8 A;  2FUH B;  1FEH A;  2NTS A;  2KO3 A;  1EM7 A;  3R7Q A;  2DEN B;  4MGI E;  2O6V A;  4ICV A;  4C7Y A;  1V81 A;  1UEL A;  2QEJ C;  2LEK A;  4GDK A;  2IYD B;  4IUM B;  3WAO A;  1QZE A;  3OLM D;  2O2V A;  1ROE A;  3BK1 A;  2RDB C;  3W1S A;  4NAW A;  1L4D B;  3K9P B;  4M8M A;  3H7P B;  4BOS C;  1MJD A;  3AMZ A;  4NJ7 A;  4G0N B;  3M62 B;  3ZTD A;  3VR8 B;  3ALB A;  2LFI A;  3PZ7 A;  2KMA A;  1Z5S B;  1PFD A;  4FLH A;  1WGR A;  1XLN A;  4NPN A;  4IM3 A;  1CK1 A;  3UQB A;  2WXK A;  1FXT B;  2LVP A;  4WUR A;  1OFF A;  3QWZ B;  1QF6 A;  3LXF A;  2A4Z A;  3U4E G;  3ZJV A;  1JWA D;  3MFG A;  3DHH C;  2N1W A;  2G4S A;  3FKY A;  2C7N B;  1FMA D;  4FUL A;  3A33 B;  2JU6 X;  2N9E B;  3I57 A;  1DOI A;  1J0G A;  4P1C C;  4HKQ A;  1E8Y A;  1ZKH A;  2KWU B;  1K52 A;  2NMQ A;  3Q3F A;  2PKO A;  2W54 A;  4KGT A;  1V8C A;  1E6E B;  1M4V A;  2WDQ B;  2YLM A;  4M0W B;  3H9D A;  4RGO S;  4HDQ A;  2LGX A;  4KSL C;  1L5P A;  4IW0 A;  2N7E A;  4OZA A;  4DWF A;  1JRP A;  2WXM A;  4MM3 A;  3R3M A;  1C78 A;  4I6N B;  4EZK A;  1V86 A;  1HEZ E;  2KVR A;  1GUA B;  3DBL I;  1P3Q U;  2K6D B;  2BWE S;  3MP9 A;  4B95 A;  5JHB A;  3FC4 A;  5T8I A;  1Y56 A;  3Q69 A;  4ASW C;  1RYJ A;  1FRR A;  2N1V A;  4RM9 A;  4CHK A;  3V60 A;  3W9C B;  4MT5 A;  2O2V B;  1KM7 A;  1RFA A;  2HD5 B;  2XEW A;  3E9S A;  4C7Z A;  2KTR A;  4XYC A;  2DWQ A;  3DWM A;  1GB4 A;  1WX9 A;  2IY1 B;  2VZK B;  5JHA A;  2KDI A;  4C4V B;  1K51 A;  3ZYY X;  4HWI B;  2X38 A;  2RDH A;  3U2S C;  1CZP A;  1OQY A;  3C19 A;  5BYQ A;  1SE3 A;  5HFY A;  3TCA A;  2PMV A;  2L3Z A;  3Q8A A;  3RNB C;  4W9F A;  3IT6 B;  3AEC B;  4LK0 M;  3DHG C;  2REX A;  2IJ0 A;  2KQ7 A;  4FBJ B;  4DXF A;  1NEN B;  3AM9 A;  2QHO A;  2MJ3 A;  3HM6 X;  3L13 A;  4OW0 A;  3PTF C;  2J0K A;  3H6N A;  1F2R C;  1XLP A;  4N59 A;  2C7M B;  3VDZ A;  2DNF A;  2M8S A;  4FA6 A;  3AE1 B;  1N61 A;  4WJQ A;  3AE3 B;  1KLV A;  4KKJ A;  3ZGZ A;  2JVC A;  3AXC A;  4DQO C;  2NCN A;  4GDL A;  1N62 A;  1I4P A;  4DDI D;  3TEZ A;  5L95 C;  2CU3 A;  4WWP A;  4ZHP A;  3R2T A;  2ZCC A;  2VH1 A;  3AUL A;  1UUP A;  1EO6 A;  2IY0 B;  1OEY A;  3QAQ A;  1SF0 A;  4AWJ A;  3I63 C;  2RMM A;  1P0R A;  2LJI A;  1R4N I;  2JYT A;  1VZ6 A;  1MFW A;  5G55 A;  4US8 A;  4M8N A;  1V5O A;  1CQV A;  1WIA A;  3MC9 A;  4ZDV A;  1JWM D;  1QOB A;  3L16 A;  2QC8 A;  3AEA B;  3EFU A;  3RNA C;  3GZN B;  1PYW D;  1MHH E;  1OQR A;  1N6Z A;  1R7S A;  2KTR B;  2NR2 A;  3W1S C;  1U4A A;  4LTU A;  1LFD A;  1LXD A;  1YX6 B;  5E6N A;  4PS7 A;  2BF8 B;  3APD A;  1HTO A;  2J52 A;  1JRO A;  2ASQ A;  4AP4 C;  3N30 A;  2J4X A;  4KX6 B;  2CHZ A;  2KTF A;  5D2M B;  4KDL B;  2LAS A;  3NUH B;  1WXM A;  1WXS A;  2LI5 A;  2N9X A;  5CTR C;  1NDD A;  2V3N A;  3VUY A;  2FID A;  4KIK A;  5GMV A;  2BYE A;  1WM2 A;  1SE9 A;  1E8X A;  3N1X C;  5JXV A;  2Y3A A;  3P1M A;  2WHI A;  2WS3 B;  2G45 B;  1I4R A;  3IHP C;  4YT0 B;  4YTN B;  1WMH B;  2HJ1 A;  3P4P B;  4W9J A;  3K9O B;  3QC8 B;  4N58 A;  3UI3 A;  1ZOY B;  1QOF A;  4LDT D;  1JWB D;  3AE6 B;  3DVG Y;  3IBE A;  1SB3 C;  2XK5 A;  1WXV A;  2GMI C;  5IKC M;  4GN1 A;  5G5G A;  1SIJ A;  4ACF A;  4XWW A;  3BVG A;  2DLB A;  4XE0 A;  3AEB B;  3DDC B;  2IND C;  4EFO A;  1NYQ A;  1SE2 A;  1XLQ A;  4G3X B;  1WRI A;  3M63 B;  3AEG B;  5BO4 B;  2N9K A;  2ZEQ A;  4JWS C;  4YSY B;  1L7Y A;  4IWQ A;  3N3K B;  3P2B A;  3UIO B;  2FNJ B;  4RGM A;  1BT0 A;  4NJC A;  2D5G A;  3IT4 B;  3ZRF A;  4W9H A;  5IAA C;  3LDZ E;  2WXH A;  2C9W B;  3U30 A;  1TY2 A;  2M56 B;  3IXS A;  1V97 A;  3W1Y A;  1KF6 B;  2LGS A;  5BYS A;  1I4H A;  3AED B;  4HPP A;  1L6V A;  4P1B C;  1TYG B;  1YNT E;  1QKZ A;  2WXJ A;  2NPT A;  4PS3 A;  4GXB A;  2CHX A;  1TIF A;  2KNB A;  4W9C A;  1XEE A;  2FBW B;  2N4F A;  2OJW A;  3A9K B;  3S2A A;  3SU8 X;  4PYU A;  2OHF A;  3E56 A;  1P7F A;  1QIL A;  2WP9 B;  5JH5 C;  2R2O A;  2W3R A;  4YSX B;  4GU2 A;  1MVK A;  4JLC A;  2AQ2 B;  1IGC A;  2QDF A;  4EOY A;  4GLS C;  3RCZ A;  4XDD A;  1V1P B;  3B2G A;  3U52 E;  3TSS A;  4LNN A;  3GE3 C;  3HHM A;  4BBN F;  2KQ4 X;  2VH2 A;  3NVZ A;  1E10 A;  2L0T A;  1FXA A;  4WQO B;  1YN3 A;  1PDX A;  1PQS A;  1SE4 A;  3NVY A;  2K39 A;  2WX1 A;  3IAS 1;  1JW9 D;  2WU2 B;  3BIN A;  5AUK A;  3RUI B;  5D3I B;  1WWT A;  1WX8 A;  1WYG A;  3ETR A;  2M1M A;  5H92 C;  3T9L A;  3CIR B;  5KHO A;  2SEB D;  4ZRK A;  1XCQ L;  1PGX A;  4WQM A;  2D11 A;  4B0M A;  1ET9 A;  1S3S G;  3PV1 A;  1WR6 E;  2LZ6 A;  2KC2 A;  2FIF A;  2G9H D;  2XNA C;  3QJZ A;  1C76 A;  1WX7 A;  2PEA A;  2M4N A;  1FCC C;  1QLB B;  2KC1 A;  2IZV B;  4KDI C;  2MBH A;  1PGA A;  2E3T A;  3BVM A;  4N9F 4;  4ZRP A;  1V80 A;  3Q6B A;  3NHE B;  1KJT A;  2IBI B;  1XCT L;  2KDF B;  2ZNV C;  2NTT A;  2NPT B;  1GG3 A;  4RFB A;  1YQB A;  3BY4 B;  3NS1 A;  2W3S A;  1YOV B;  4ITK A;  4HXD A;  4WWN A;  3PRE A;  2J0M A;  1MHX A;  1N5W A;  3I3T B;  1TKY A;  2GI9 A;  1UH6 A;  4TQ0 A;  1E7U A;  4QAY A;  2DAF A;  4MJS A;  4DHJ D;  4M01 A;  3RMK C;  4TKN A;  3ZNZ B;  3RD2 A;  1L0X B;  1Q5W B;  3Q3O C;  1UF0 A;  3UF8 A;  2MBB B;  3AU4 A;  4RGT A;  1RM6 C;  1JAL A;  1EU4 A;  4WWM A;  1DGJ A;  2AX5 A;  3GE8 C;  2B3A A;  1TKG A;  3ZLZ A;  2KYW A;  3X23 A;  1CJE A;  3RYT A;  4KZC A;  4FJV B;  1KRH A;  5FR3 A;  1JWU D;  1HE8 A;  3QK0 A;  3VQI A;  1N63 A;  2MJE A;  4JL9 A;  3PZ8 A;  4CO7 A;  1F1H A;  2KAC A;  4W9G A;  3PRP B;  3VUX A;  4LCD E;  2G4D B;  4BAX A;  4AS1 A;  3L54 A;  2Z0E B;  4XGA B;  1NYR A;  2L83 A;  1IBX A;  2IO3 B;  4LNK A;  3T3N A;  2INP E;  2DYB A;  3V6C B;  2SAK A;  1TS5 A;  1E90 A;  1GJZ A;  4BFR A;  3QQ8 B;  1C9F A;  1VZ7 A;  2EKE C;  3VTW A;  3RZW C;  1K50 A;  4WWO A;  2UU7 A;  2LWP A;  2ZCB A;  1F52 A;  1Q10 A;  5BMG A;  2LJ5 A;  3KUC B;  2KFJ A;  4W9K A;  5BMI A;  1TS2 A;  1ISN A;  4ARI A;  5AZF A;  2W82 A;  2MP2 A;  5KHQ A;  1SJH D;  4WAA A;  3RZF A;  2KN5 A;  1YQ3 B;  2MBO A;  3QHT A;  2DHZ A;  1YJ1 A;  2ON8 A;  4K3B A;  2KXJ A;  3N1Z C;  1M94 A;  1YD8 U;  4KZ0 A;  3RN9 C;  2BB6 A;  4AJY B;  3AEE B;  5E6P A;  3U7D A;  3AN1 A;  1V6E A;  3VTV A;  3W5U B;  1NI3 A;  2WDV B;  1PUT A;  1FRD A;  2LUM A;  1YX5 B;  4J3O D;  1WE6 A;  3DBR B;  3P4Q B;  1XO3 A;  3DHI C;  3P42 A;  4LJO B;  4ANW A;  2H89 B;  4RNA A;  4HKZ E;  5MPO A;  1NVI D;  2HTM E;  3ZNG C;  2KVZ A;  1UZX B;  3FIL A;  2WGS A;  4W9L A;  5LLI A;  1WGH A;  1F2R I;  2NS5 A;  1MPE A;  1SSN A;  3VFK A;  4HLE A;  3BWU D;  3RPF C;  4K7W A;  2IGG A;  4MH0 E;  1GNU A;  2KOX A;  3RFZ B;  3NVW A;  1C4P A;  4WIP A;  4TMA B;  2L7R A;  3QIJ A;  1NI2 A;  2LHD A;  2PE9 A;  3RNG C;  3EFC A;  2GBR A;  3A9J A;  1V9J A;  1K8R B;  3ZW3 A;  3EC8 A;  4HRS A;  4KVG B;  4W9I A;  2O6V B;  3V3X A;  3EHV A;  2JXX A;  4A6Q A;  2JUO A;  3NJT A;  2G3Q B;  1TS3 A;  4ZYS A;  5J18 A;  4GDK B;  1XD3 B;  2WXN A;  1YIW A;  4MEM A;  3KH0 A;  4HJG E;  4HCP B;  2MSE D;  1FM0 D;  5E6J A;  4NAW B;  1T6B X;  2KK8 A;  2N7J A;  4FHJ A;  2ZW0 A;  1WM3 A;  5BYR A;  3HM3 A;  3EEC A;  2WXF A;  3ZXV A;  2KKC A;  3X0W A;  3HK0 A;  4WJP A;  3KVF B;  4IOI E;  1K53 A;  3KQ4 A;  1EF5 A;  4GIV A;  3ZKJ C;  3H8H A;  4MGZ E;  3MC0 B;  3H1U A;  3BK2 A;  3ECI A;  3QAR A;  2L8J A;  4O1N A;  1VD2 A;  1TY0 A;  1P98 A;  4W9E A;  5FK9 C;  1WGK A;  2AEH A;  1FPY A;  2KDE B;  1T3Q A;  2BKR B;  3A4S C;  3CST A;  2JXT A;  1UGJ A;  1ZW7 A;  1D5M C;  3NOB A;  3PGE A;  4DK5 A;  3PRZ A;  2WXI A;  3B0A A; 
#chains in the Genus database with same CATH homology
 2K8C A;  2RGF A;  2KFK A;  2FCN A;  4EFO A;  4G3X B;  2BKF A;  5CX3 A;  2PJH A;  2AL6 A;  3M63 B;  4ZRJ A;  4BKG A;  5BO4 B;  4MJS B;  4BOZ B;  3ONS A;  2AL3 A;  2CHW A;  2IO0 B;  4IM2 A;  2ZEQ A;  1L7Y A;  4IWQ A;  3N3K B;  3P2B A;  3UIO B;  4A3O A;  2FNJ B;  4XX5 A;  1BT0 A;  3ZRF A;  3DQV A;  4K7S A;  4W9H A;  2K8B A;  3LDZ E;  4K81 A;  5IAA C;  2C9W B;  3V62 A;  4WJN A;  4HPM B;  1ZGU B;  4MGK E;  3U30 A;  1RAX A;  2KZR A;  2LGY A;  1I42 A;  2KJR A;  2ZPY A;  2DZK A;  4DXA B;  3W1Y A;  1LM8 B;  3DOW A;  1NBF C;  2LD9 A;  2LUE A;  3DPD A;  1WZ3 A;  4NQK E;  4F8C B;  3DBR I;  3ZIM A;  4DHZ E;  1XQQ A;  3SD5 A;  4MDK E;  5EDS A;  2KJH B;  2BPS A;  2NPT A;  4PS3 A;  4OVU A;  4GXB A;  3A4R A;  2CHX A;  4ANU A;  2KNB A;  4W9C A;  4BKS A;  2N4F A;  3A9K B;  2KX0 A;  1P9D U;  3S2A A;  4P7I A;  1OEY J;  3SU8 X;  4OVV A;  2K25 A;  4PYU A;  2OOB B;  1RLF A;  3TBL D;  4JGH B;  5JH5 C;  3M95 A;  4GGQ A;  3ZDM C;  3SDL C;  3NY5 A;  2R2O A;  3DVN V;  4GU2 A;  2Y5B B;  3V6E B;  4X57 B;  4JLC A;  3TJP A;  4EEW A;  4EOY A;  3JSV B;  2K8H A;  1UBI A;  2GBN A;  4XZ4 A;  3RCZ A;  3IFW B;  5TR5 A;  5HKH A;  1IPG A;  4TQ1 A;  5FR6 A;  3TL5 A;  2CS4 A;  2XBB C;  1MG8 A;  1KOT A;  1WH3 A;  3HHM A;  3SHQ A;  4BBN F;  1J19 A;  3MJW A;  1WF9 A;  4B6W A;  4IC7 B;  4RM8 A;  2J0J A;  4KSK C;  1G6J A;  3PLV A;  2L0T A;  4EZJ A;  3DVN U;  2KLC A;  3L08 A;  5IA7 A;  4WQO B;  4PYZ A;  3WAN A;  3PRM B;  4BKT A;  3JVZ X;  3ZVV A;  1PQS A;  4XC2 A;  3RT3 B;  3GZN I;  4HCN B;  2K39 A;  3PHW B;  2WX1 A;  4E74 A;  1Z2M A;  3PVL A;  4CYE A;  3PHX B;  1UGM A;  4FN2 A;  3BIN A;  5DCN A;  3IVF A;  1SGH A;  3RUI B;  2FUH B;  4B9K A;  2KO3 A;  1WX8 A;  4WJO A;  3MHS D;  2NBU A;  4DHZ B;  3ZNI D;  2C60 A;  2N7D A;  2M1M A;  3R7Q A;  2MP2 B;  2DEN B;  4MGI E;  2O6V A;  4ICV A;  2BWF A;  3T9L A;  1V81 A;  1C1Y B;  1UEL A;  3PT2 B;  3O65 B;  5KHO A;  4ZRK A;  2MQJ A;  2IYD B;  4GDK A;  1WYW B;  2LXC A;  4IUM B;  3WAO A;  2CR5 A;  1I35 A;  1QZE A;  1WI0 A;  1V5T A;  4EKU A;  3OLM D;  2D11 A;  1WJU A;  2JZZ A;  2O2V A;  4ZYN A;  3W1S A;  4NAW A;  1S3S G;  3K9P B;  4AUQ C;  3PV1 A;  4M8M A;  1TBE A;  1WR6 E;  2LZ6 A;  3H7P B;  4BOS C;  1H4R A;  2FIF A;  2HE7 A;  2KC2 A;  3OAW A;  1WJ6 A;  2UWQ A;  3QJZ A;  2W9N A;  3ZTC A;  4NJ7 A;  4G0N B;  2Z0D B;  3M62 B;  3QCA A;  4RMA A;  1WX7 A;  1WZ0 A;  3ZTD A;  2PEA A;  4GDL B;  3WIM A;  2YVC A;  3ALB A;  3U8Z A;  2M4N A;  2ZVO A;  1WRD B;  2KC1 A;  2IZV B;  1WR1 A;  4KDI C;  2M17 A;  2VRR B;  4YL8 A;  2FCM A;  3ZO5 B;  2KMA A;  2MBH A;  3R7R A;  1Q0W B;  2WWZ A;  3PSE B;  3TIX A;  2N9P C;  2LVO A;  4GSW A;  1Z5S B;  3PS6 A;  4ANV A;  4I6L B;  3NS8 A;  4FLH A;  1WGY A;  1WGR A;  1TTN A;  2AYO B;  4N9F 4;  5C23 A;  2DYO A;  3ZDT A;  3WAM A;  1E7V A;  2GOW A;  3APC A;  4NPN A;  4IM3 A;  3UQB A;  1V80 A;  4FHK A;  2LGD A;  3NHE B;  4PS8 A;  5JZE B;  1KJT A;  2IBI B;  4MSM B;  1FXT B;  3H7S A;  4GMV A;  2LVP A;  4TUU A;  1WMH A;  3DBS A;  2WDT B;  4G50 A;  3QWZ B;  2RR9 A;  3GOE A;  2KDF B;  3APF A;  5J17 A;  2A4Z A;  2ZNV C;  5CHV C;  3UIP B;  5AZH A;  2N1W A;  2G4S A;  2NPT B;  2R2Q A;  1GG3 A;  2C7N B;  4FUL A;  1YQB A;  3A33 B;  2DAJ A;  2GBM A;  2KAN A;  2N9E B;  2K1F A;  2NVU I;  3BY4 B;  3NZS A;  3A1Q A;  2BGF A;  2ZPN A;  2JZ3 B;  4G11 A;  4HXD A;  4WWN A;  2MCN B;  4EUT A;  3PRE A;  1J0G A;  2ZNV B;  2J0M A;  2PE6 B;  1E8Y A;  1ZKH A;  2KWU B;  5D6J B;  3I3T B;  2FAZ A;  3Q3F A;  3A9J B;  3ML8 A;  4A20 A;  1UH6 A;  4TQ0 A;  5DPW A;  2YLM A;  1E7U A;  4M0W B;  3H9D A;  2IO1 B;  2DAF A;  4MJS A;  5DPT A;  4DHJ D;  4TV3 A;  4HDQ A;  2LGX A;  4TKN A;  3ZNZ B;  3RD2 A;  4EZL A;  4KSL C;  5CHW A;  1Q5W B;  4AJW A;  2JPH A;  2DZM A;  4IW0 A;  2N7E A;  3UF8 A;  1CMX B;  1WXA A;  4K1R B;  4DHJ B;  1WGG A;  4DWF A;  2MBB B;  5DPR A;  4NJ6 A;  3AU4 A;  3KYD D;  1H8C A;  2KQS A;  4MM3 A;  3R3M A;  1E8Z A;  2DX5 B;  3HIZ A;  4I6N B;  2B3A A;  3ENE A;  4EZK A;  2I1J A;  3ZLZ A;  1V86 A;  3X23 A;  2KVR A;  1GUA B;  2KLG A;  3RYT A;  4LJP B;  3DBL I;  4KZC A;  1UBQ A;  4FJV B;  3B1L X;  1P3Q U;  2K6D B;  2BWE S;  1HE8 A;  4IWO A;  2L05 A;  3QK0 A;  4B95 A;  3VQI A;  2NBW B;  5JHB A;  4KIK B;  4JL9 A;  3WA0 A;  2WX0 A;  4ASW C;  2JF5 A;  3A9K A;  3CSF A;  4I6P A;  4CO7 A;  5L83 A;  3R66 C;  1AAR A;  2N1V A;  4W9G A;  3PRP B;  3VUX A;  4LCD E;  2G4D B;  3T8M A;  4RM9 A;  3L54 A;  4CHK A;  4F7Z A;  2Z0E B;  3V60 A;  3KW5 B;  2JT4 B;  2KHW B;  3MTN B;  2O2V B;  3L0W B;  5C1Z A;  1KM7 A;  1Q1O A;  1RFA A;  2HD5 B;  2XEW A;  2KTR A;  2IO3 B;  5DPS A;  2DYB A;  1WX9 A;  2IY1 B;  3V6C B;  2XK5 B;  5JHA A;  2JWZ A;  2K6Q A;  2KDI A;  3DCG A;  5D7G A;  4FAD A;  3L10 B;  1X1M A;  2JRH A;  2V4L A;  4HWI B;  4IM0 A;  3ZUN A;  2L0F A;  2MBQ A;  2JRI B;  1GC7 A;  2I1K A;  3VTU A;  3ZRC A;  1E90 A;  1OQY A;  1GJZ A;  3VAW A;  1R4M I;  4NQL B;  3VUW A;  4BFR A;  1E8W A;  2KDB A;  3QQ8 B;  2EKE C;  2V1Y A;  1EF1 A;  3RZW C;  3VTW A;  1LQB A;  3TCA A;  1UD7 A;  2L3Z A;  2KFK B;  2RD0 A;  3NZU A;  4GOC A;  4W9F A;  5CHF A;  4WWO A;  2RSU A;  3PPA A;  3RUL A;  2LWP A;  2ZCB A;  1OGW A;  2MW5 A;  4E71 A;  4HDO A;  2AWT A;  2REX A;  2LJ5 A;  3KUC B;  2KFJ A;  2MBE A;  4W9K A;  2KQ7 A;  3V61 A;  1ISN A;  4FBJ B;  1V49 A;  4II2 B;  5AZF A;  1GC6 A;  2MP2 A;  5KHQ A;  3D32 A;  1IP9 A;  4BBN C;  4WAA A;  3VH4 B;  3RZF A;  2KN5 A;  2ZZP B;  2QHO A;  2MBO A;  2A5U A;  1E5W A;  1WGD A;  2FCQ A;  2DHZ A;  1YJ1 A;  3HM6 X;  3L13 A;  3PTF C;  2J0K A;  3QHT A;  2KXJ A;  2J7Q B;  4ANX A;  5E6O A;  3H6N A;  1M94 A;  1A5R A;  1YD8 U;  4KZ0 A;  4URK A;  2GBJ A;  4AJY B;  2C7M B;  3M3J A;  3VDZ A;  5E6P A;  3U7D A;  4DBG A;  2M8S A;  1V6E A;  2LRU A;  3VTV A;  3ZNH B;  4BKS D;  4FA6 A;  3UQA A;  3AU5 A;  3H7P A;  4WJQ A;  3UIN B;  2MRP A;  1WE7 A;  2KWC A;  1KLV A;  3Q3J A;  2JVC A;  1YX5 B;  3AXC A;  1WE6 A;  2NCN A;  4ICU A;  4K7U A;  4GDL A;  4ZRI A;  2GBK A;  1SIF A;  4LJO B;  2OJR A;  4F1S A;  4ANW A;  4DDI D;  4GB9 A;  2ZVN A;  2M0X A;  5L95 C;  4WWP A;  2ZCC A;  1D3Z A;  3AUL A;  2JY6 A;  1TZ1 A;  2IO2 B;  3ZNG C;  1C3T A;  4E3C A;  1F9J A;  4FJZ A;  1EO6 A;  5G2N A;  4BVU C;  2IY0 B;  1OEY A;  3QAQ A;  4AWJ A;  1UZX B;  3TMP B;  2BYF A;  1TGZ B;  1OTR B;  1P0R A;  2HTH A;  3B08 A;  2V3S A;  4W9L A;  5LLI A;  1WGH A;  1WJN A;  2NS5 A;  1L2N A;  1R4N I;  1XT9 B;  3VH3 B;  3VFK A;  4JIO U;  4HLE A;  2KX3 A;  5G55 A;  2BYV E;  3CF6 E;  1T0Y A;  4K7W A;  2FCS A;  2MX2 A;  2CU1 A;  4M8N A;  4MH0 E;  3QA8 A;  1V5O A;  1GNU A;  1EUV B;  2DZI A;  2LRW A;  2KOX A;  1WIA A;  4MEL A;  1S1Q B;  3IG3 A;  4IG7 B;  5D94 A;  2KD0 A;  2L7R A;  4ZDV A;  3QIJ A;  1IYF A;  3UGB B;  2EMS A;  1NI2 A;  2LVQ A;  2PE9 A;  2MA9 B;  3L16 A;  2O6V D;  4JQW C;  4MSQ B;  2D10 A;  3KYC D;  5AEK B;  2L76 A;  3EFU A;  3PZD A;  2GBR A;  3LJ3 A;  3A9J A;  1V9J A;  3WAL A;  1K8R B;  4MGY E;  3ZW3 A;  3EC8 A;  1WY8 A;  3L17 A;  4KVG B;  4W9I A;  2KTR B;  2O6V B;  2MWS B;  2NR2 A;  3W1S C;  1U4A A;  1LFD A;  3EHV A;  1RRB A;  4HVB A;  2HJ8 A;  2JXX A;  2UYZ B;  1LXD A;  2DZJ A;  2JUO A;  1VCB A;  2G3Q B;  1YX6 B;  5J18 A;  4GDK B;  1XD3 B;  4PS7 A;  1YIW A;  2BF8 B;  3APD A;  3KH0 A;  1WFY A;  4MEM A;  5E6N A;  4AOF A;  3N32 A;  2ZJD A;  4HCP B;  2KJ6 A;  3JSV A;  4HPL B;  1JRU A;  2MSE D;  2ASQ A;  4AP4 C;  3N30 A;  3OJ3 A;  4NAW B;  3CMM B;  2KK8 A;  3DBH I;  5LXH A;  4FHJ A;  4HJK A;  1WM3 A;  2D3G A;  2CHZ A;  3HM3 A;  3EEC A;  3ML9 A;  2KTF A;  5D2M B;  2C7H A;  4KDL B;  2KKC A;  2WYQ A;  3X0W A;  3HK0 A;  2LAS A;  2D2Q A;  2L00 B;  4NY0 A;  3KUZ A;  1WXM A;  2MLB A;  1WXS A;  2LI5 A;  3WAP A;  4WJP A;  2N9X A;  5CTR C;  1NDD A;  3VHT C;  4FJY A;  3AI5 A;  3VUY A;  2KWV B;  2FID A;  4KIK A;  3KVF B;  4NNJ B;  5GMV A;  5AZG A;  3ZKJ C;  1EF5 A;  4GIV A;  3VXW A;  2BYE A;  1WM2 A;  4MGZ E;  4J6I A;  1SE9 A;  2C5L C;  3H1U A;  2EMT A;  1E8X A;  4II3 B;  2RPQ A;  3ECI A;  3QAR A;  2L8J A;  2LXA A;  4W9D A;  1VD2 A;  2G45 B;  3JYU A;  3IHP C;  5J2R A;  1P98 A;  4W9E A;  2KMC A;  1WMH B;  2DYM A;  4W9J A;  3K9O B;  4DDG D;  3QC8 B;  3JW0 X;  3DVG X;  4HK2 A;  4LDT D;  3QX1 A;  3DVG Y;  2PPH A;  3IBE A;  5LXI B;  2XK5 A;  1WXV A;  3KUD B;  4IWP A;  1P1A A;  2AEH A;  2GMI C;  2KDE B;  2Z59 B;  3VVW B;  2BKR B;  1WJ4 A;  2CKH B;  3A4S C;  4GN1 A;  3C0R B;  3CST A;  1J8C A;  1Y8R C;  1ZW7 A;  1V2Y A;  4LDT B;  3NOB A;  3A1Q B;  3PGE A;  3PLU A;  4A3P A;  3PRZ A;  4DK5 A;  2D07 B;  4KV2 A;  3DDC B;  2NBV B;  3B0A A;  3OJ4 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...