1WM3A

Crystal structure of human sumo-2 protein
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
72
structure length
72
Chain Sequence
HINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquitin-like protein SMT3B
publication title Crystal structures of the human SUMO-2 protein at 1.6 A and 1.2 A resolution: implication on the functional differences of SUMO proteins
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 15
structure length 72
sequence length 72
ec nomenclature
pdb deposition date 2004-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11976 Rad60-SLD Ubiquitin-2 like Rad60 SUMO-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1wm3A00
4E3CA 2MRPA 1J8CA 4OVUA 3ONSA 2LGYA 3HM6X 1GC6A 4TV3A 2K8CA 4X57B 5D94A 4AJWA 4AWJA 4IM3A 2M4NA 1GG3A 4M0WB 2WYQA 3PT2B 1Q5WB 3S2AA 1WE7A 3U8ZA 5CHWA 2GOWA 5HKHA 4WQOB 1ZGUB 3DPDA 4BKGA 2RPQA 2KVRA 2C7MB 3PRPB 2L00B 2JRIB 3PZDA 3UF8A 4TUUA 2MBQA 2BYFA 4LJOB 2DYBA 4DHZE 2L05A 3WAPA 1OGWA 2CKHB 4MELA 4DDID 2M0XA 2BYVE 2LRUA 4IWPA 4HCNB 1Q0WB 4G50A 3UQAA 2DYOA 4URKA 1WI0A 5DCNA 1UH6A 4AJYB 1OTRB 3I3TB 3PPAA 2LWPA 4DK5A 1V5TA 2MP2A 3NZUA 3ZUNA 4II2B 2D07B 2KFJA 1RFAA 2L76A 2IY1B 2DAJA 4B95A 3BINA 2KTFA 1YJ1A 2Z0DB 2BWFA 4K81A 1LXDA 2K6DB 2KFKA 2KX3A 2LASA 3TJPA 1I35A 3APCA 3CF6E 2ZPYA 4M8MA 5AZGA 4E71A 2FCMA 3EFUA 2N1WA 2REXA 3RD2A 2ZVOA 1WJNA 1TTNA 3VQIA 1V86A 1U4AA 1WM3A 3CSFA 4PS7A 2PJHA 3PRMB 4KVGB 1YX5B 4NQLB 1Z5SB 3AI5A 2KTRA 2HE7A 3RCZA 3VH4B 2WDTB 1YQBA 4KZCA 2LZ6A 1SIFA 1V6EA 3VTWA 2WX0A 5DPWA 4MGKE 3HHMA 3R66C 2HTHA 2D3GA 2MCNB 1XD3B 2KOXA 2PEAA 4GIVA 1VCBA 1KJTA 2GBNA 3QC8B 2KDBA 5CHFA 5JHAA 3JSVA 1WGYA 3R7RA 4F7ZA 1OQYA 3DDCB 3ZNHB 3L54A 2NBVB 3ML9A 3N3KB 4WJQA 3DQVA 2PE6B 3LDZE 2DENB 2PPHA 1VD2A 4MSQB 4AP4C 2N4FA 2RR9A 2FAZA 2MBHA 3PV1A 5JH5C 1V81A 1E7VA 4DXAB 4F1SA 1X1MA 3TBLD 4GU2A 2AL3A 2L3ZA 4WWNA 2KWUB 3P2BA 2LVPA 2JXXA 5L83A 1E8WA 2CHWA 3NZSA 2K39A 1P0RA 2LD9A 2Z59B 4ANWA 4RMAA 4DBGA 2MQJA 2KQSA 5DPSA 4IG7B 4WAAA 2KN5A 3DBSA 3SDLC 2O6VD 3VUYA 1V80A 4XX5A 1WR6E 2ZNVB 2J0MA 1WY8A 2CU1A 3CMMB 2BF8B 4FJZA 4IWQA 3PHXB 1Q1OA 1E8YA 1V2YA 2KJRA 3M3JA 3RZFA 2KWVB 4HLEA 1J0GA 2L0TA 4WJPA 5IAAC 4NAWA 2JZZA 1RRBA 5D2MB 4ANXA 2MSED 2EMTA 4W9FA 1WX9A 3ZDMC 3SD5A 2EMSA 2JVCA 4BBNC 2RGFA 2J0JA 3B08A 3JYUA 4F8CB 5E6PA 2BWES 3OLMD 4KV2A 3ZRCA 4TKNA 4GMVA 1NI2A 3WA0A 3APFA 1T0YA 4LCDE 3V61A 1P3QU 3T9LA 3PHWB 1E8ZA 1WZ3A 4BVUC 3O65B 3L16A 4LDTB 1NBFC 1K8RB 1S3SG 3AULA 2EKEC 2WX1A 3ZKJC 3DOWA 2FCNA 3R7QA 4HJKA 3UIOB 1L2NA 2LGDA 3APDA 5E6NA 2LI5A 3K9PB 2ZNVC 3VVWB 3UGBB 1TZ1A 4K7SA 2NPTA 3RYTA 3PREA 4ASWC 2GMIC 2CR5A 2KXJA 2LRWA 1WGDA 2BYEA 1L7YA 3KUZA 2JRHA 4BKSA 2DX5B 3A4SC 2AL6A 4FHKA 3KW5B 1V5OA 3ALBA 2KDEB 3SU8X 3NS8A 2L7RA 2KTRB 1WXMA 2IO3B 3MJWA 4GB9A 4XZ4A 2B3AA 4KDLB 1UBQA 4K1RB 2C9WB 4GDKA 3ECIA 1S1QB 1P1AA 2IZVB 2R2OA 4N9F4 1UGMA 4IW0A 3ZNGC 2I1JA 3A33B 3ZRFA 2V3SA 3WANA 2JZ3B 1WH3A 4TQ0A 1F9JA 4NNJB 3JSVB 2LXCA 4ZDVA 3VAWA 2L8JA 1D3ZA 2KC2A 3N32A 2HJ8A 3M63B 4KSKC 2ZCCA 3QWZB 4MH0E 1WRDB 4MGYE 4KIKB 2OOBB 3X0WA 1YX6B 4GOCA 2RSUA 4RM8A 2JWZA 1ISNA 4FN2A 3RUIB 4AOFA 4GN1A 1P9DU 2MWSB 3DVGX 3A9KB 2ZZPB 3VXWA 1LQBA 3NOBA 2L0FA 2DZKA 2JUOA 5AZHA 2LUEA 2Z0EB 4W9EA 1C1YB 4EZLA 3HIZA 1WYWB 3NHEB 1WIAA 5CX3A 1WXSA 1WXVA 2C60A 3M95A 1LFDA 1WGGA 2FNJB 3QX1A 4NAWB 2MW5A 3UINB 4PS3A 3RZWC 1OEYA 4MSMB 5J17A 3W1YA 3DCGA 3PSEB 4FLHA 3ZW3A 4MGIE 2NVUI 2LVQA 3A1QA 2IYDB 1FXTB 1RAXA 2MX2A 1JRUA 3DBHI 4HPMB 4MJSB 4I6NB 1CMXB 1UD7A 4NQKE 1IYFA 1WJ4A 1YIWA 2MBOA 4BBNF 4I6LB 3KYCD 4ZRJA 1H4RA 3KYDD 3SHQA 4EZJA 2GBJA 5JZEB 2K1FA 4NJ6A 1WX7A 1J19A 2NR2A 3KH0A 1KLVA 3VH3B 2KLCA 2D10A 2M17A 1UELA 1ZKHA 3C0RB 3QCAA 4AUQC 3VDZA 4WWOA 3H6NA 4KIKA 5LXHA 3D32A 2NPTB 2FCQA 1R4MI 2G4SA 3A4RA 3GZNI 2YLMA 4ANUA 1IP9A 2IO2B 5GMVA 3A9KA 4HK2A 4BOSC 2KD0A 3JVZX 1UZXB 4A3OA 2C7HA 1R4NI 4HDOA 4FA6A 5AEKB 2KWCA 1SE9A 2ZPNA 4GDLA 3VHTC 2DYMA 1QZEA 2NBUA 3VUWA 4EOYA 2PE9A 2O6VA 4EKUA 5G2NA 1E5WA 3KUCB 4GDKB 2ZVNA 3QIJA 3TL5A 3U7DA 1HE8A 2KJ6A 1V49A 1WMHA 2XBBC 3DVNV 4RM9A 1WJUA 2JY6A 2FIFA 3IVFA 1RLFA 1V9JA 3PVLA 4ZRKA 2LGXA 4W9IA 1WGRA 4MJSA 3ZTDA 4ICUA 1WGHA 4I6PA 2FCSA 2N9XA 4FJYA 5DPRA 2GBKA 3AXCA 1KM7A 5FR6A 4W9JA 2BKRB 5CHVC 2MBEA 5LLIA 4EEWA 2N9PC 1MG8A 3QAQA 3H9DA 2IO0B 2IY0B 2WWZA 1UBIA 4DHJB 4FBJB 1TGZB 2M1MA 1H8CA 3RT3B 4HCPB 2AYOB 2HD5B 2KANA 2O2VA 3ZO5B 3UIPB 2DZMA 4NPNA 4PS8A 3VFKA 2KX0A 1EF1A 5J18A 1YD8U 4IWOA 3LJ3A 2BPSA 3PLUA 3U30A 4BOZB 1GUAB 2OJRA 2I1KA 4DWFA 3H7PB 4IC7B 4ICVA 2D2QA 4YL8A 4HVBA 1P98A 5TR5A 2XK5A 3QARA 2J0KA 2BGFA 3A1QB 3IBEA 4TQ1A 3WIMA 2G3QB 4PYZA 5LXIB 2CHZA 2KMCA 5D7GA 3MHSD 4JQWC 1GNUA 3ENEA 3QQ8B 3WAOA 2DHZA 3PGEA 1WZ0A 2KDFB 3Q3JA 4MGZE 3QK0A 2KDIA 3IG3A 1EF5A 1EUVB 2ASQA 2MLBA 3V6EB 4DHZB 3V6CB 5D6JB 4CYEA 2LVOA 2V4LA 2K8BA 3X23A 4BKTA 2JF5A 4ZYNA 4P7IA 4W9KA 4W9LA 4FULA 1PQSA 3OAWA 4HDQA 2Y5BB 1E8XA 4B9KA 4II3B 1WM2A 4E74A 1WE6A 2M8SA 4JGHB 2NBWB 4DDGD 3IHPC 4EFOA 1BT0A 4GDLB 5C23A 3ML8A 2KKCA 2ZEQA 1WF9A 1WX8A 4HPLB 4EZKA 2G4DB 2N7DA 2O6VB 4FHJA 4FADA 3VUXA 3TMPB 4PYUA 3W1SC 3JW0X 1KOTA 3DBLI 4LDTD 3H7PA 1IPGA 1WMHB 4CO7A 4DHJD 1I42A 2AEHA 2N7EA 2LJ5A 4MEMA 3TIXA 5KHOA 2JPHA 2KZRA 4WJOA 4EUTA 1LM8B 3OJ3A 4IUMB 3AU5A 4XC2A 1E90A 2FUHB 3A9JB 3L13A 3W1SA 3WAMA 3N30A 1E7UA 5EDSA 2G45B 2KO3A 1Y8RC 2IO1B 4A3PA 2DZIA 3L08A 4OVVA 4ZRIA 4A20A 2RD0A 4B6WA 3V60A 2N1VA 4GSWA 3PRZA 3ZNZB 2AWTA 4ANVA 1GJZA 2LXAA 4G0NB 1NDDA 4W9GA 3QHTA 2W9NA 5AZFA 3B1LX 4K7WA 2O2VB 4FJVB 3T8MA 3ZDTA 3GOEA 2KQ7A 1TBEA 5IA7A 2KMAA 3WALA 4JIOU 2DAFA 4NY0A 5C1ZA 2A5UA 2J7QB 3KUDB 5E6OA 1GC7A 4K7UA 2GBRA 3EECA 3UQBA 4NJ7A 3DVGY 3VTVA 1C3TA 1Z2MA 2JT4B 4JLCA 3DVNU 3V62A 1AARA 2QHOA 3QJZA 3ZVVA 2A4ZA 2XK5B 1G6JA 2UYZB 5G55A 5CTRC 3HK0A 4MM3A 1ZW7A 3EC8A 3PTFC 4IM2A 2UWQA 4W9CA 4WWPA 3M62B 3DBRI 3K9OB 3Q3FA 2IBIB 2GBMA 5BO4B 1XQQA 4HXDA 3NY5A 4GGQA 4J6IA 5JHBA 3L17A 4LJPB 5DPTA 2CS4A 2KLGA 3A9JA 3H7SA 3VTUA 2K8HA 2ZJDA 4BFRA 2N9EB 3AU4A 4W9HA 3HM3A 2NS5A 2KNBA 2V1YA 2KJHB 3ZLZA 2CHXA 3RULA 3R3MA 1SGHA 2VRRB 2KK8A 2YVCA 4G11A 3H1UA 1M94A 3L0WB 4KSLC 3OJ4B 2MA9B 3KVFB 1OEYJ 2BKFA 3TCAA 2K6QA 3ZNID 2C5LC 2MBBB 2KHWB 1WXAA 1WR1A 4G3XB 4KZ0A 3EHVA 3MTNB 2KC1A 3BY4B 2R2QA 2XEWA 4W9DA 3ZTCA 1EO6A 4MDKE 3L10B 4JL9A 2ZCBA 3PS6A 3ZIMA 4M8NA 3CSTA 4WJNA 2FIDA 1A5RA 2MP2B 2NCNA 1WFYA 3QA8A 4CHKA 1WJ6A 2D11A 5L95C 2C7NB 4HWIB 4IM0A 5J2RA 5KHQA 2DZJA 1XT9B 3IFWB 3PLVA 3B0AA 4BKSD 4KDIC 4GXBA 2KFKB 2K25A
chains in the Genus database with same CATH superfamily
1MVKA 1J8CA 1GC6A 4PT5A 1I4RA 2OJWA 4M0WB 2BQQA 3S2AA 1WE7A 3DPDA 2KVRA 3PRPB 3PZDA 4LJOB 4DHZE 2E3TA 2Y5PA 4MELA 1WRIA 1J7CA 5FR3A 1JW9D 4LNIA 4HCNB 3P4RB 2L1AA 4G50A 2DYOA 4AJYB 3Q3MC 4DK5A 1FEHA 1V5TA 3NZUA 4P1CC 2N9KA 3HUIA 2D07B 2KFJA 1RFAA 2IY1B 1YJ1A 2WHIA 1BXTA 2KMMA 2QIEB 4E71A 2REXA 4OHJA 4RCOA 1TTNA 3VQIA 1U4AA 3CSFA 4PS7A 3PRMB 4NQLB 3RCZA 1B9RA 2QJLA 1SIFA 3Q2AC 4MGKE 2HTHA 4GIVA 3QC8B 5JHAA 4RGNA 3R7RA 3MFGA 4F7ZA 3N3KB 2WXOA 1SE4A 1QOFA 2DENB 2PPHA 1VD2A 4AP4C 5JH5C 2WXKA 2ACZB 4JWSC 4GU2A 2AL3A 4WWNA 2JXXA 5L83A 1E8WA 2IJ0A 3NZSA 2LD9A 4RMAA 2MQJA 1TT5B 4WAAA 1Q10A 3VUYA 1MJDA 2V3PA 4IDIA 2CU1A 3TSSA 2BF8B 4FJZA 3M3JA 4WJPA 5IAAC 3V3XA 2MSED 3ZDMC 3SD5A 2EMSA 2QMTA 1I4XA 4BBNC 1V1OA 2N9LA 3JYUA 5E6PA 5FK9C 4N58A 4TKNA 4GMVA 1C78A 2LUMA 2G1EA 1E8ZA 1K8RB 4HJGE 4M01A 3DOWA 4ZOHC 2FCNA 4HJKA 3UIOB 1L2NA 2QEJC 2JXTA 3O13A 2GMIC 4FXCA 2CR5A 3IAS1 3N9YC 2BYEA 1L7YA 2INCC 1V5OA 1E9MA 2KDEB 4C80A 4A90A 4KKJA 1VLBA 2B3AA 3ECIA 2INPE 1S1QB 3TEYA 4N9F4 1UGMA 4IW0A 3ZNGC 3A33B 2V3SA 3WANA 2JZ3B 1F9JA 1DOIA 2LXCA 4ZDVA 3VAWA 1PDXA 2KC2A 1QKZA 2NTSA 4OZAA 2HJ8A 1PGXA 3AE2B 2ZCCA 4MH0E 3X0WA 1SB3C 4YXDB 2ON8A 1HTQA 2RSUA 4OZCA 2WU2B 4GN1A 1CQVA 3DVGX 3T3NA 3VXWA 2L0FA 2JUOA 2LUEA 1WYWB 2BS3B 3M95A 1LFDA 1STEA 3QX1A 4WURA 4PS3A 1OEYA 1SXTA 2OEDA 3AE7B 1MG4A 1XLOA 4FLHA 1I7HA 3ZW3A 4MGIE 2NVUI 3A1QA 4HPMB 4I6NB 1IYFA 1WJ4A 2BYTA 3SHQA 4EZJA 2K1FA 4NJ6A 3ZYYX 4L2YA 2KLCA 5FKAC 2M17A 4P1BC 4AUQC 3E9SA 3H6NA 4KIKA 3ZGZA 3D32A 2RDBC 3A4RA 3GZNB 4J3OD 5GMVA 3A9KA 1HXYD 3AE5B 4HK2A 2FUG1 2M0AA 4GDLA 4M02A 2DYMA 2PE9A 1GOZA 2O6VA 2BB5A 1E5WA 2KJ6A 1WMHA 3DVNV 1WJUA 1GAQB 2JY6A 3BK1A 3IVFA 4W9IA 4MJSA 1WGHA 3ZJVA 3RFZB 4ARIA 2FCSA 3R2IA 4A9AA 1V8CA 2BKRB 1YN3A 2WQYB 5LLIA 2IO0B 2M1MA 1QF6A 2ONQA 3ZO5B 3UIPB 2DZMA 4XWTA 3VFKA 1HQRD 2BPSA 3PLUA 3U30A 3TEXA 2I1KA 4YL8A 4IC7B 2D2QA 4HVBA 3I5JC 1UNSA 4HEA1 5BYSA 3A1QB 3IBEA 1FXIA 3IXSA 3RNFC 5LXIB 4WH4A 3Q8AA 4P6VF 4OVZA 1VZ8A 1ZPSA 1J7AA 2KDFB 1YQ3B 2TSSA 3TUOA 3AH7A 3IG3A 1EF5A 2MLBA 2XNAC 1Y56A 4CYEA 3Q8CA 1ENFA 1JQ4A 4P7IA 4W9KA 4HDQA 4UDUC 1E8XA 1SE2A 1WM2A 1WE6A 2NBWB 1IUEA 1BT0A 4GDLB 5T8IA 4C4VB 5BMIA 4EZKA 2G4DB 2O6VB 2KYWA 1WWTA 3TMPB 2L83A 3DBLI 1MHXA 1IPGA 1WMHB 4DHJD 2AEHA 4MEMA 3TIXA 2JPHA 2KZRA 4EUTA 3IT4B 4XC2A 3W1SA 4XGAB 2IO1B 2Y3AA 2WDQB 2WXIA 4GSWA 3W2DA 1A70A 4S17A 1IBXB 5H92C 4RFBA 3B1LX 3T8MA 1PGBA 2RPVA 3BVZA 1C4AA 4K7UA 4XE0A 2GBRA 1C3TA 1AWDA 1Z2MA 3DVNU 3QJZA 5G55A 5CTRC 3HK0A 1C76A 2KAJA 1SBBB 2UWQA 3K9OB 1K53A 4RNAA 2N0SB 2BBCA 1XQQA 2KACA 4AQ7A 3NY5A 4US9A 4LJPB 1B1ZA 1XCTL 3VTUA 2K8HA 2BTEA 5HG2A 5LNK1 3HM3A 2KNBA 2V3NA 2CHXA 2LMCA 2WXHA 3KVFB 1V1PA 4G3XB 4KZ0A 3MTNB 2KC1A 4W9DA 2AX5A 2QCZA 2VZKB 4WJNA 2MP2B 2D11A 5EE9A 4HWIB 1E10A 4LNOA 2K25A 1DYQA 4OVUA 2LGYA 1ET9A 3P63A 4AJWA 1F2RI 1GG3A 4OZBA 4CQNA 3U8ZA 4C7YA 5CHWA 5HKHA 4WQOB 4BKGA 2L00B 3BK2A 3UF8A 1TS2A 1N5XA 2DYBA 2L05A 3WAPA 1OGWA 1SJHD 2CKHB 1QT9A 4DDID 4IWPA 1D6EC 4URKA 1WI0A 2JQRB 1FRDA 3PPAA 1FM0D 2PW9A 3CWIA 3W5UB 1ZOYB 4HKZE 3BVMA 3BINA 2ZW0A 2KFKA 3TJPA 1I35A 2LASA 4GLSC 2ZPYA 4L23A 2FCMA 3EFUA 4KGRA 2BS2B 4KVGB 1V1PB 2EKIA 1Z5SB 2V4IB 3AI5A 2LEKA 4NJCA 4YSXB 4KZCA 2WX0A 5AUIA 3HHMA 3MHZA 3MC9A 1VCBA 2GBNA 5CHFA 3ZNHB 4WJQA 2PE6B 3LDZE 1TZOA 2WDVB 2RR9A 1YJIA 2FAZA 1C9FA 4F1SA 1X1MA 3TBLD 2L3ZA 1MFWA 2KWUB 3P2BA 2LVPA 1NYRA 3N1YC 4K3BA 2CHWA 4YSZB 2K39A 2Z59B 4DBGA 2KQSA 2KN5A 1EWYC 2O6VD 3AEBB 2KT7A 1MI0A 3OWEB 4XX5A 2ZNVB 1WY8A 4YSYB 3RZFA 2KJRA 4HLEA 2KWVB 2JZZA 5D2MB 1N5WA 3PZ8A 2EMTA 4A8XC 1T0QC 3PO0A 2J52A 2RDGA 4F8CB 2WXNA 1JMLA 3B08A 2BWES 4BAXA 4KV2A 4RH6A 3WA0A 1QOAA 1P3QU 3T9LA 2LGSA 1S3SG 2HJ1A 4KGTA 2WX1A 3SFDB 3T3OA 1C77A 3AN1A 3APDA 3K9PB 1TZ1A 5D3DA 1MHHE 3KUZA 2DX5B 2AL6A 2K5PA 4FHKA 3KW5B 3ALBA 2JYEA 4WAFA 2IO3B 1WXQA 1ET6A 4GB9A 5BYRA 1RFKA 2R2OA 1C4PA 4P16A 4IKGA 1WH3A 1VDVA 4RGOS 4LTUA 4TQ0A 1FIQA 2QSDA 1FPYA 1T6BX 1L6UA 1WSPA 4KSKC 1RYJA 3ZJUA 4MGYE 4JX1C 1QOGA 3SR6A 1EM7A 1YX6B 2B76B 1ISNA 4NZLB 4FN2A 2L32A 4AOFA 2ZZPB 4KKIA 3KQ4A 2Z0EB 3EUB2 1C1YB 5CX3A 3NHEB 2MJEA 1WXSA 1WXVA 1BUIC 2VZKD 4LNNA 3VR8B 2IPKD 2MW5A 5J17A 3W1YA 3MP9A 3ZXRA 2IYDB 2MX2A 4KGSA 1UD7A 1KLGD 1WX7A 3AE6B 3VH3B 1TKYA 2INDC 1UELA 3C0RB 5E6JA 2M56B 1R4MB 2G4SA 3N20C 3GZNI 3B9JA 4ANUA 1IP9A 2IO2B 1JWAD 2KD0A 4HDOA 2IGGA 4EOYA 1QZEA 4RGMA 3KUCB 2ZVNA 3QIJA 1V49A 5IOIA 3W5VB 2FIFA 1V9JA 4ZRKA 1WGRA 5IKCM 2GBKA 1NENB 5FR6A 3PZ7A 2JU6X 2D3CA 4EEWA 3QAQA 5I4DA 4DHJB 1AW7A 3RT3B 1QQRA 1C79A 1L0YB 5EE3A 3LJ3A 1GUAB 1K50A 3URYA 4NAMA 3Q8BA 2J0KA 2MJDA 3AMZA 4S0RA 3R8BA 5D7GA 1JWUD 1GNUA 1CZPA 5H8YE 1ZXHA 4K3CA 1JALA 3NS1A 1TJEA 1P7EA 3V6CB 5D6JB 2WXFA 2WXJA 1KH0A 4W9LA 4FULA 1PQSA 3OAWA 2Y5BB 4DDGD 3ML8A 2KKCA 1XEEA 1YMHE 3W1SC 1KOTA 4JWUC 1D5XC 1ZDXA 4WWMA 2N7EA 3LB8C 5KHOA 1YJJA 1RM6C 1UGJA 3OJ3A 2SEBD 4IUMB 3AU5A 2FUHB 4YTNB 3WAMA 1KF6B 5EDSA 2G45B 3GB1A 4A3PA 2DZIA 3L08A 4OVVA 4R3DA 2N1VA 5GXGB 4DXGA 2AWTA 2LXAA 3NG0A 1ZE3D 1TBEA 2KMAA 1L4DB 4JIOU 4LLGM 2A5UA 5E6OA 3UQBA 3VTVA 3DWMA 2QHOA 2AQ3B 3Q8EA 4IM2A 4C4VA 3DBRB 2GB1A 2MHJA 1M4VA 4HXDA 2VH2A 4DQOC 3FC4A 3L17A 5DPTA 1YQ4B 3H7SA 2KDMA 1D4BA 2ZJDA 4W9HA 2KJHB 3NZ3A 2LHEA 2VRRB 2KK8A 2W3RA 4G11A 1IBXA 1JCKB 1J7BA 1JRPA 1OEYJ 2GI9A 2MBBB 1WR1A 2XEWA 2OHFA 4IOIE 2AQ2B 2N7JA 4MACA 1EO6A 3NUHB 3ZTCA 5C3JB 3PS6A 3WCQA 3ZIMA 4M8NA 3CSTA 4CHKA 1WFYA 1WJ6A 2C7NB 4LNKA 1NYQA 5J2RA 1XT9B 3IFWB 2NMQA 3B0AA 5G5HA 2QILA 4GXBA 4E3CA 4C00A 3HM6X 2JYTA 1I4QA 4AS1A 2WYQA 2I38A 3PT2B 2LHDA 2JX5A 2GOWA 4RF1A 3FILA 1T0RC 3GE3C 2M0XA 1Q0WB 3UQAA 2H88B 5DCNA 4ITKA 1GB1A 3I3TB 2MP2A 3ZUNA 4II2B 1F2RC 4B95A 4OW0A 1LXDA 3CF6E 1T5XD 1VZ6A 2YEPF 4M8MA 5AZGA 2N1WA 4ZYSA 2ZVOA 1WJNA 1QLBB 1V86A 2PJHA 1YX5B 1JWSD 3I9V1 3VH4B 2D5GA 2WDTB 5DPWA 5G5GA 3J9CA 3R66C 1XLPA 2PKOA 2D3GA 1XD3B 4HKQA 2PEAA 1KJTA 4B0MA 2KDBA 3B2GA 3HVZA 1K52A 1I4GA 4MSQB 3PV1A 3Q6BA 3SFEB 1V81A 4TSSA 1E7VA 1CJEA 3V05A 2W54A 5JXVA 3Q69A 4ANWA 4IG7B 2MH7A 3SDLC 1V80A 1WR6E 1P7FA 3RN9C 4US8A 4REZA 4IWQA 1E8YA 2L0TA 4NAWA 4ANXA 1RRBA 1FNWA 1ZP0B 2MJ3A 3AE3B 1VR9A 4W9FA 2WNMA 1WX9A 3AB5A 3L4PA 3FILB 4ARCA 3C8YA 2RGFA 4USAA 3OLMD 3AEGB 4LCDE 1T0YA 1XLQA 1WZ3A 3L16A 4LDTB 3AULA 1XLNA 2EKEC 3R7QA 5BMHA 2LGDA 5TSSA 1NVID 2LI5A 4K7SA 3PREA 1WGDA 2JRHA 4BKSA 3A4SC 2J42A 3SU8X 3AEFB 3MJWA 4XZ4A 3VRBB 2C9WB 4GDKA 4LNFA 2WXGA 2R61A 3N1XC 4NNJB 3NVYA 2PLPA 2H89B 4YTPB 4L1BA 2IGDA 2RMMA 3M63B 4C7ZA 1WRDB 2OOBB 1N6ZA 2K9XA 3AE4B 4GOCA 4RM8A 2JWZA 3RUIB 1P9DU 2MWSB 3NOBA 4XWWA 2BS4B 2DZKA 5AZHA 4W9EA 3HIZA 2Y5CA 3AM9A 2PIAA 1V97A 4NAWB 3RZWC 3RI7C 3HVDA 1PUTA 3PSEB 1JWMD 3RNCC 2LVQA 3DBHB 1CMXB 3Q8FA 4BBNF 3KYCD 4DXFA 1H4RA 3KYDD 3TEWA 3EGRA 1EU4A 1J19A 2NR2A 1KLVA 2BT6A 2D10A 1FFVA 4WWOA 1L4ZB 1F52A 5LXHA 1ESFA 1R4MI 3P42A 2QDFA 4BOSC 3GE8C 1UZXB 4A3OA 2KVZA 3R2TA 1R4NB 2C7HA 5AEKB 2IGHA 2KWCA 1SE9A 2ZPNA 1ZXIA 2BVCA 2NBUA 3VUWA 4EKUA 5AUKA 4GDKB 3U7DA 1ROEA 3TL5A 3W9CB 1HE8A 5EE0A 4KX6B 1FNUA 2XBBC 3PVLA 2LGXA 3ETRA 2RDHA 3ZTDA 4I6PA 2N9XA 1WYGA 3HRDD 4FJYA 3AXCA 1KM7A 5DPRA 4W9JA 4ZHOA 2WP9B 5CHVC 2MBEA 1YNTE 2N9PC 1MG8A 1KRHA 2SAKA 4D2KA 4N59A 3GP7A 3ZQ4A 3C19A 3H9DA 1KLUD 2IY0B 4A55A 2WWZA 1UBIA 2WU5B 1TGZB 1H8CA 1FXAA 2HTME 4HCPB 2AYOB 2O2VA 1FMAD 3AE8B 4NPNA 4PS8A 5EE1A 2KX0A 1EF1A 4IWOA 4BOZB 1FCLA 3H7PB 1ZDVA 1ZUD2 1P98A 2XK5A 1R7SA 3AEAB 2BGFA 5BYQA 4TQ1A 1IGDA 3MJ5A 2CHZA 3MHSD 4JQWC 1NEKB 3EFCA 3PGEA 5HI1A 4MGZE 3TEZA 1SEBD 2INNE 2WLBA 1EUVB 2ASQA 2DLBA 4DHZB 2GLSA 2JWUA 4BKTA 2DWQA 4II3B 1UWXA 2M8SA 2AQ1B 1D5ZC 1YOVB 5C23A 4MM3B 2JSVX 2N7DA 4FHJA 4FADA 1FNVA 4PYUA 4LDTD 4CO7A 2ZW1A 1E90A 1E0ZA 3A9JB 4XDCA 3BWUD 1SIJA 2KO3A 1Y8RC 4A20A 2RD0A 4B6WA 2WXQA 3V60A 3EA6A 3PRZA 5IO9A 3ZNZB 4ANVA 1GJZA 2EELA 4W9GA 1NDDA 3QHTA 2W9NA 5AZFA 4K7WA 2O2VB 4FJVB 3ZDTA 3GOEA 2KQ7A 5IA7A 3WALA 2DAFA 5BMGA 1N61A 2J7QB 3KUDB 4ZRPA 3H8HA 1I4HA 2K3UA 3V62A 3RNGC 1FFUA 3FKYA 2A4ZA 2XK5B 3ZVVA 1G6JA 3MC0B 1ACCA 1ZW7A 3EC8A 3PTFC 3M62B 3DBRI 2IBIB 1SF0A 2DNFA 2GBMA 2KWDA 3NRZA 4HRSA 3NVZA 5C2TB 4GGQA 4J6IA 2JZPA 5JHBA 2CS4A 2KLGA 2J53A 2N9EB 3AU4A 2NS5A 2V1YA 3DHIC 1DOYA 3R3MA 1SGHA 3E56A 2YVCA 1M94A 1IGCA 3L0WB 2MA9B 1XXGA 2BKFA 3ZNID 2C5LC 1WXAA 2DBYA 3BY4B 2R2QA 2D3BA 1OFFA 1FRRA 3L10B 4JL9A 2ZCBA 1A5RA 2FIDA 1L5PA 2NCNA 5KHQA 2DZJA 3PLVA 1I4PA 2PVGC 2X38A 4BKSD 3U4EG 3RNAC 3DHHC 2MRPA 3ONSA 1KTKA 4TV3A 5D94A 1RWSA 2K8CA 3BYYB 4X57B 1SSNA 4AWJA 4IM3A 2M4NA 1Q5WB 4HROA 1ZGUB 2CJOA 2V9HA 2RPQA 4RF0A 2C7MB 2I2YA 3U2SC 2JRIB 4TUUA 2MBQA 4WIPA 2BYFA 3AE1B 2L52A 3KLSX 2E6XA 2BYVE 3RPFC 2LRUA 2G9HD 4YT0B 1TYGB 1UH6A 3P1MA 1TS3A 3U7ZA 1OTRB 2LWPA 3RMKC 2L76A 1PYWD 2DAJA 2KTFA 2Z0DB 2BWFA 4K81A 2K6DB 2LJIA 2KX3A 1C4CA 3APCA 2VH1A 1SE3A 3UI3A 3RD2A 1YN5A 1WM3A 2YEPB 3P4SB 1UF0A 2KTRA 2HE7A 2IDYA 1YQBA 2LZ6A 1V6EA 3VTWA 2MCNB 2KOXA 4MH8A 3JSVA 1WGYA 1OQYA 1UUPA 1AYFA 1KFYB 2NBVB 3DDCB 2CJNA 3L54A 3ML9A 3U52E 3DQVA 2N4FA 2MBHA 1YN4A 4DXAB 1DGJA 1P0RA 2QC8A 3N1ZC 5DPSA 3AEEB 3DBSA 2K22A 2KN4A 2J0MA 3CMMB 1XCQL 3PHXB 1Q1OA 1V2YA 1TKEA 1J0GA 2D3AA 3RNBC 2JVCA 1FO4A 2KQ4X 1VJKA 1JROA 1PGAA 2J0JA 4TMAB 3ZRCA 1NI2A 3APFA 1N63A 3V61A 4XYCA 3PHWB 4BVUC 3O65B 1NBFC 4MT5A 1NI3A 3ZKJC 5E6NA 2ZNVC 3IAM1 3UGBB 3VVWB 2NPTA 3RYTA 4ASWC 2V0GA 2J4XA 2KXJA 2LRWA 3DHGC 2FE8A 1TKGA 1L0VB 3NS8A 2L7RA 2KTRB 1WXMA 4KDLB 1UBQA 2M19A 4K1RB 3LXFA 2UU7A 1P1AA 2IZVB 1F1HA 3AECB 2I1JA 1MPEA 3ZRFA 3JSVB 1D3ZA 2L8JA 2ICIA 3N32A 3QWZB 1QOBA 4KIKB 4HPPA 3IT6B 1OQQA 4BZAA 4PK1A 4RGTA 4M00A 1LO5D 3A9KB 1LQBA 3VR9B 3ABVB 4EZLA 3RNEC 1WIAA 1FCCC 1EU3A 2C60A 2X8XX 3BVGA 1WGGA 1N62A 2FNJB 3UINB 1GPXA 4MSMB 3DCGA 1FXTB 1RAXA 1TS4A 1JRUA 3DBHI 4MJSB 3KWVA 3Q3OC 1F77A 4NQKE 1YIWA 1XO3A 2MBOA 3AE9B 3VRAB 4I6LB 4ZRJA 2K0PA 5JZEB 2GBJA 1HZ5A 1GB4A 3KH0A 1HTOA 1QILA 1ZKHA 1OQRA 3QCAA 5HHDG 3VDZA 1BMLC 4LK0M 4JPSA 1TY0A 1JWBD 2NPTB 2FCQA 4YWGG 4EE2A 2YLMA 3NVVA 3JVZX 1R4NI 4FA6A 3VHTC 3OG5A 1TY2A 5G2NA 1L0XB 2PMVA 1WGKA 4RM9A 2HDEA 2W82A 1RLFA 4XDDA 3ZJTA 2PTLA 4JE3B 3I63C 4ICUA 4ACFA 2BB6A 2WGSA 3GS2A 3I57A 4FBJB 2Z8LA 1XF5L 2HD5B 2KANA 1UWMA 5J18A 1YD8U 3KWLA 2OJRA 4DWFA 4ICVA 5TR5A 3QARA 4C56C 4O1NA 3WIMA 1E7PB 3MC8A 2G3QB 4PYZA 2KMCA 5D3IB 3Q14C 3ENEA 3QQ8B 3WAOA 2CU3A 2DHZA 2LGIA 1WZ0A 1L6VA 3Q3JA 1T3QA 2PVOD 1VRAB 1CK1A 3QK0A 2KDIA 3BYTB 3V6EB 2LVOA 2V4LA 2K8BA 4ZRQA 3X23A 1HZ6A 1PFDA 2JF5A 4ZYNA 2W3SA 1AN8A 1N60A 2GRIA 1DOXA 4B9KA 1TIFA 4E74A 4JGHB 3IHPC 4EFOA 2WDRB 2ZEQA 1WF9A 1FD6A 1WX8A 2WXMA 4HPLB 3VUXA 2WS3B 3JW0X 3DBLB 4ZHPA 5MPOA 3H7PA 1I42A 2FBWB 3SEBA 2LJ5A 2Q5WD 4WJOA 1LM8B 1D5MC 3L13A 3N30A 1E7UA 4Q2JA 4ZRIA 3ZXVA 3NJTA 4WQMA 2LFIA 4B0EA 4N6EB 4G0NB 1T0SC 1VZ7A 1SJED 4M0WA 3CIRB 3B2FA 4NY0A 5C1ZA 2W55A 1GC7A 3EECA 4NJ7A 3DVGY 2JT4B 4JLCA 1AARA 2UYZB 4MM3A 1E6EB 4WWPA 1LGRA 4W9CA 3P4PB 3NVWA 3Q3FA 5BO4B 2MEKA 3P4QB 4H2AA 2WXRA 5IN7A 3A9JA 4YTMB 4BFRA 2WXLA 4QAYA 2WXPA 3FAHA 3ZLZA 3BIID 3RULA 5IP4D 2NTTA 3AEDB 3H1UA 4KSLC 3OJ4B 1EWCA 3LYYA 3TCAA 1HA5A 2K6QA 2KHWB 3AV8A 3EHVA 2XN9C 5HFYA 4MDKE 3Q3NC 3QA8A 5L95C 1K51A 4A6QA 4IM0A 3BZDB 1F0ZA 2BW2A 1TS5A 3DWGC 1HEZE 4KDIC 2KFKB
chains in the Genus database with same CATH topology
4E3CA 2MRPA 1J8CA 4OVUA 3ONSA 2LGYA 3HM6X 1GC6A 4TV3A 2K8CA 4X57B 5D94A 4AJWA 4AWJA 4IM3A 2M4NA 1GG3A 4M0WB 2WYQA 3PT2B 1Q5WB 3S2AA 1WE7A 3U8ZA 5CHWA 2GOWA 5HKHA 4WQOB 1ZGUB 3DPDA 4BKGA 2RPQA 2KVRA 2C7MB 3PRPB 2L00B 2JRIB 3PZDA 3UF8A 4TUUA 2MBQA 2BYFA 4LJOB 2DYBA 4DHZE 2L05A 3WAPA 1OGWA 2CKHB 4MELA 4DDID 2M0XA 2BYVE 2LRUA 4IWPA 4HCNB 1Q0WB 4G50A 3UQAA 2DYOA 4URKA 1WI0A 5DCNA 1UH6A 4AJYB 1OTRB 3I3TB 3PPAA 2LWPA 4DK5A 1V5TA 2MP2A 3NZUA 3ZUNA 4II2B 2D07B 2KFJA 1RFAA 2L76A 2IY1B 2DAJA 4B95A 3BINA 2KTFA 1YJ1A 2Z0DB 2BWFA 4K81A 1LXDA 2K6DB 2KFKA 2KX3A 2LASA 3TJPA 1I35A 3APCA 3CF6E 2ZPYA 4M8MA 5AZGA 4E71A 2FCMA 3EFUA 2N1WA 2REXA 3RD2A 2ZVOA 1WJNA 1TTNA 3VQIA 1V86A 1U4AA 1WM3A 3CSFA 4PS7A 2PJHA 3PRMB 4KVGB 1YX5B 4NQLB 1Z5SB 3AI5A 2KTRA 2HE7A 3RCZA 3VH4B 2WDTB 1YQBA 4KZCA 2LZ6A 1SIFA 1V6EA 3VTWA 2WX0A 5DPWA 4MGKE 3HHMA 3R66C 2HTHA 2D3GA 2MCNB 1XD3B 2KOXA 2PEAA 4GIVA 1VCBA 1KJTA 2GBNA 3QC8B 2KDBA 5CHFA 5JHAA 3JSVA 1WGYA 3R7RA 4F7ZA 1OQYA 3DDCB 3ZNHB 3L54A 2NBVB 3ML9A 3N3KB 4WJQA 3DQVA 2PE6B 3LDZE 2DENB 2PPHA 1VD2A 4MSQB 4AP4C 2N4FA 2RR9A 2FAZA 2MBHA 3PV1A 5JH5C 1V81A 1E7VA 4DXAB 4F1SA 1X1MA 3TBLD 4GU2A 2AL3A 2L3ZA 4WWNA 2KWUB 3P2BA 2LVPA 2JXXA 5L83A 1E8WA 2CHWA 3NZSA 2K39A 1P0RA 2LD9A 2Z59B 4ANWA 4RMAA 4DBGA 2MQJA 2KQSA 5DPSA 4IG7B 4WAAA 2KN5A 3DBSA 3SDLC 2O6VD 3VUYA 1V80A 4XX5A 1WR6E 2ZNVB 2J0MA 1WY8A 2CU1A 3CMMB 2BF8B 4FJZA 4IWQA 3PHXB 1Q1OA 1E8YA 1V2YA 2KJRA 3M3JA 3RZFA 2KWVB 4HLEA 1J0GA 2L0TA 4WJPA 5IAAC 4NAWA 2JZZA 1RRBA 5D2MB 4ANXA 2MSED 2EMTA 4W9FA 1WX9A 3ZDMC 3SD5A 2EMSA 2JVCA 4BBNC 2RGFA 2J0JA 3B08A 3JYUA 4F8CB 5E6PA 2BWES 3OLMD 4KV2A 3ZRCA 4TKNA 4GMVA 1NI2A 3WA0A 3APFA 1T0YA 4LCDE 3V61A 1P3QU 3T9LA 3PHWB 1E8ZA 1WZ3A 4BVUC 3O65B 3L16A 4LDTB 1NBFC 1K8RB 1S3SG 3AULA 2EKEC 2WX1A 3ZKJC 3DOWA 2FCNA 3R7QA 4HJKA 3UIOB 1L2NA 2LGDA 3APDA 5E6NA 2LI5A 3K9PB 2ZNVC 3VVWB 3UGBB 1TZ1A 4K7SA 2NPTA 3RYTA 3PREA 4ASWC 2GMIC 2CR5A 2KXJA 2LRWA 1WGDA 2BYEA 1L7YA 3KUZA 2JRHA 4BKSA 2DX5B 3A4SC 2AL6A 4FHKA 3KW5B 1V5OA 3ALBA 2KDEB 3SU8X 3NS8A 2L7RA 2KTRB 1WXMA 2IO3B 3MJWA 4GB9A 4XZ4A 2B3AA 4KDLB 1UBQA 4K1RB 2C9WB 4GDKA 3ECIA 1S1QB 1P1AA 2IZVB 2R2OA 4N9F4 1UGMA 4IW0A 3ZNGC 2I1JA 3A33B 3ZRFA 2V3SA 3WANA 2JZ3B 1WH3A 4TQ0A 1F9JA 4NNJB 3JSVB 2LXCA 4ZDVA 3VAWA 2L8JA 1D3ZA 2KC2A 3N32A 2HJ8A 3M63B 4KSKC 2ZCCA 3QWZB 4MH0E 1WRDB 4MGYE 4KIKB 2OOBB 3X0WA 1YX6B 4GOCA 2RSUA 4RM8A 2JWZA 1ISNA 4FN2A 3RUIB 4AOFA 4GN1A 1P9DU 2MWSB 3DVGX 3A9KB 2ZZPB 3VXWA 1LQBA 3NOBA 2L0FA 2DZKA 2JUOA 5AZHA 2LUEA 2Z0EB 4W9EA 1C1YB 4EZLA 3HIZA 1WYWB 3NHEB 1WIAA 5CX3A 1WXSA 1WXVA 2C60A 3M95A 1LFDA 1WGGA 2FNJB 3QX1A 4NAWB 2MW5A 3UINB 4PS3A 3RZWC 1OEYA 4MSMB 5J17A 3W1YA 3DCGA 3PSEB 4FLHA 3ZW3A 4MGIE 2NVUI 2LVQA 3A1QA 2IYDB 1FXTB 1RAXA 2MX2A 1JRUA 3DBHI 4HPMB 4MJSB 4I6NB 1CMXB 1UD7A 4NQKE 1IYFA 1WJ4A 1YIWA 2MBOA 4BBNF 4I6LB 3KYCD 4ZRJA 1H4RA 3KYDD 3SHQA 4EZJA 2GBJA 5JZEB 2K1FA 4NJ6A 1WX7A 1J19A 2NR2A 3KH0A 1KLVA 3VH3B 2KLCA 2D10A 2M17A 1UELA 1ZKHA 3C0RB 3QCAA 4AUQC 3VDZA 4WWOA 3H6NA 4KIKA 5LXHA 3D32A 2NPTB 2FCQA 1R4MI 2G4SA 3A4RA 3GZNI 2YLMA 4ANUA 1IP9A 2IO2B 5GMVA 3A9KA 4HK2A 4BOSC 2KD0A 3JVZX 1UZXB 4A3OA 2C7HA 1R4NI 4HDOA 4FA6A 5AEKB 2KWCA 1SE9A 2ZPNA 4GDLA 3VHTC 2DYMA 1QZEA 2NBUA 3VUWA 4EOYA 2PE9A 2O6VA 4EKUA 5G2NA 1E5WA 3KUCB 4GDKB 2ZVNA 3QIJA 3TL5A 3U7DA 1HE8A 2KJ6A 1V49A 1WMHA 2XBBC 3DVNV 4RM9A 1WJUA 2JY6A 2FIFA 3IVFA 1RLFA 1V9JA 3PVLA 4ZRKA 2LGXA 4W9IA 1WGRA 4MJSA 3ZTDA 4ICUA 1WGHA 4I6PA 2FCSA 2N9XA 4FJYA 5DPRA 2GBKA 3AXCA 1KM7A 5FR6A 4W9JA 2BKRB 5CHVC 2MBEA 5LLIA 4EEWA 2N9PC 1MG8A 3QAQA 3H9DA 2IO0B 2IY0B 2WWZA 1UBIA 4DHJB 4FBJB 1TGZB 2M1MA 1H8CA 3RT3B 4HCPB 2AYOB 2HD5B 2KANA 2O2VA 3ZO5B 3UIPB 2DZMA 4NPNA 4PS8A 3VFKA 2KX0A 1EF1A 5J18A 1YD8U 4IWOA 3LJ3A 2BPSA 3PLUA 3U30A 4BOZB 1GUAB 2OJRA 2I1KA 4DWFA 3H7PB 4IC7B 4ICVA 2D2QA 4YL8A 4HVBA 1P98A 5TR5A 2XK5A 3QARA 2J0KA 2BGFA 3A1QB 3IBEA 4TQ1A 3WIMA 2G3QB 4PYZA 5LXIB 2CHZA 2KMCA 5D7GA 3MHSD 4JQWC 1GNUA 3ENEA 3QQ8B 3WAOA 2DHZA 3PGEA 1WZ0A 2KDFB 3Q3JA 4MGZE 3QK0A 2KDIA 3IG3A 1EF5A 1EUVB 2ASQA 2MLBA 3V6EB 4DHZB 3V6CB 5D6JB 4CYEA 2LVOA 2V4LA 2K8BA 3X23A 4BKTA 2JF5A 4ZYNA 4P7IA 4W9KA 4W9LA 4FULA 1PQSA 3OAWA 4HDQA 2Y5BB 1E8XA 4B9KA 4II3B 1WM2A 4E74A 1WE6A 2M8SA 4JGHB 2NBWB 4DDGD 3IHPC 4EFOA 1BT0A 4GDLB 5C23A 3ML8A 2KKCA 2ZEQA 1WF9A 1WX8A 4HPLB 4EZKA 2G4DB 2N7DA 2O6VB 4FHJA 4FADA 3VUXA 3TMPB 4PYUA 3W1SC 3JW0X 1KOTA 3DBLI 4LDTD 3H7PA 1IPGA 1WMHB 4CO7A 4DHJD 1I42A 2AEHA 2N7EA 2LJ5A 4MEMA 3TIXA 5KHOA 2JPHA 2KZRA 4WJOA 4EUTA 1LM8B 3OJ3A 4IUMB 3AU5A 4XC2A 1E90A 2FUHB 3A9JB 3L13A 3W1SA 3WAMA 3N30A 1E7UA 5EDSA 2G45B 2KO3A 1Y8RC 2IO1B 4A3PA 2DZIA 3L08A 4OVVA 4ZRIA 4A20A 2RD0A 4B6WA 3V60A 2N1VA 4GSWA 3PRZA 3ZNZB 2AWTA 4ANVA 1GJZA 2LXAA 4G0NB 1NDDA 4W9GA 3QHTA 2W9NA 5AZFA 3B1LX 4K7WA 2O2VB 4FJVB 3T8MA 3ZDTA 3GOEA 2KQ7A 1TBEA 5IA7A 2KMAA 3WALA 4JIOU 2DAFA 4NY0A 5C1ZA 2A5UA 2J7QB 3KUDB 5E6OA 1GC7A 4K7UA 2GBRA 3EECA 3UQBA 4NJ7A 3DVGY 3VTVA 1C3TA 1Z2MA 2JT4B 4JLCA 3DVNU 3V62A 1AARA 2QHOA 3QJZA 3ZVVA 2A4ZA 2XK5B 1G6JA 2UYZB 5G55A 5CTRC 3HK0A 4MM3A 1ZW7A 3EC8A 3PTFC 4IM2A 2UWQA 4W9CA 4WWPA 3M62B 3DBRI 3K9OB 3Q3FA 2IBIB 2GBMA 5BO4B 1XQQA 4HXDA 3NY5A 4GGQA 4J6IA 5JHBA 3L17A 4LJPB 5DPTA 2CS4A 2KLGA 3A9JA 3H7SA 3VTUA 2K8HA 2ZJDA 4BFRA 2N9EB 3AU4A 4W9HA 3HM3A 2NS5A 2KNBA 2V1YA 2KJHB 3ZLZA 2CHXA 3RULA 3R3MA 1SGHA 2VRRB 2KK8A 2YVCA 4G11A 3H1UA 1M94A 3L0WB 4KSLC 3OJ4B 2MA9B 3KVFB 1OEYJ 2BKFA 3TCAA 2K6QA 3ZNID 2C5LC 2MBBB 2KHWB 1WXAA 1WR1A 4G3XB 4KZ0A 3EHVA 3MTNB 2KC1A 3BY4B 2R2QA 2XEWA 4W9DA 3ZTCA 1EO6A 4MDKE 3L10B 4JL9A 2ZCBA 3PS6A 3ZIMA 4M8NA 3CSTA 4WJNA 2FIDA 1A5RA 2MP2B 2NCNA 1WFYA 3QA8A 4CHKA 1WJ6A 2D11A 5L95C 2C7NB 4HWIB 4IM0A 5J2RA 5KHQA 2DZJA 1XT9B 3IFWB 3PLVA 3B0AA 4BKSD 4KDIC 4GXBA 2KFKB 2K25A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4E3C A;  2MRP A;  1J8C A;  4OVU A;  3ONS A;  2LGY A;  3HM6 X;  1GC6 A;  4TV3 A;  2K8C A;  4X57 B;  5D94 A;  4AJW A;  4AWJ A;  4IM3 A;  2M4N A;  1GG3 A;  4M0W B;  2WYQ A;  3PT2 B;  1Q5W B;  3S2A A;  1WE7 A;  3U8Z A;  5CHW A;  2GOW A;  5HKH A;  4WQO B;  1ZGU B;  3DPD A;  4BKG A;  2RPQ A;  2KVR A;  2C7M B;  3PRP B;  2L00 B;  2JRI B;  3PZD A;  3UF8 A;  4TUU A;  2MBQ A;  2BYF A;  4LJO B;  2DYB A;  4DHZ E;  2L05 A;  3WAP A;  1OGW A;  2CKH B;  4MEL A;  4DDI D;  2M0X A;  2BYV E;  2LRU A;  4IWP A;  4HCN B;  1Q0W B;  4G50 A;  3UQA A;  2DYO A;  4URK A;  1WI0 A;  5DCN A;  1UH6 A;  4AJY B;  1OTR B;  3I3T B;  3PPA A;  2LWP A;  4DK5 A;  1V5T A;  2MP2 A;  3NZU A;  3ZUN A;  4II2 B;  2D07 B;  2KFJ A;  1RFA A;  2L76 A;  2IY1 B;  2DAJ A;  4B95 A;  3BIN A;  2KTF A;  1YJ1 A;  2Z0D B;  2BWF A;  4K81 A;  1LXD A;  2K6D B;  2KFK A;  2KX3 A;  2LAS A;  3TJP A;  1I35 A;  3APC A;  3CF6 E;  2ZPY A;  4M8M A;  5AZG A;  4E71 A;  2FCM A;  3EFU A;  2N1W A;  2REX A;  3RD2 A;  2ZVO A;  1WJN A;  1TTN A;  3VQI A;  1V86 A;  1U4A A;  1WM3 A;  3CSF A;  4PS7 A;  2PJH A;  3PRM B;  4KVG B;  1YX5 B;  4NQL B;  1Z5S B;  3AI5 A;  2KTR A;  2HE7 A;  3RCZ A;  3VH4 B;  2WDT B;  1YQB A;  4KZC A;  2LZ6 A;  1SIF A;  1V6E A;  3VTW A;  2WX0 A;  5DPW A;  4MGK E;  3HHM A;  3R66 C;  2HTH A;  2D3G A;  2MCN B;  1XD3 B;  2KOX A;  2PEA A;  4GIV A;  1VCB A;  1KJT A;  2GBN A;  3QC8 B;  2KDB A;  5CHF A;  5JHA A;  3JSV A;  1WGY A;  3R7R A;  4F7Z A;  1OQY A;  3DDC B;  3ZNH B;  3L54 A;  2NBV B;  3ML9 A;  3N3K B;  4WJQ A;  3DQV A;  2PE6 B;  3LDZ E;  2DEN B;  2PPH A;  1VD2 A;  4MSQ B;  4AP4 C;  2N4F A;  2RR9 A;  2FAZ A;  2MBH A;  3PV1 A;  5JH5 C;  1V81 A;  1E7V A;  4DXA B;  4F1S A;  1X1M A;  3TBL D;  4GU2 A;  2AL3 A;  2L3Z A;  4WWN A;  2KWU B;  3P2B A;  2LVP A;  2JXX A;  5L83 A;  1E8W A;  2CHW A;  3NZS A;  2K39 A;  1P0R A;  2LD9 A;  2Z59 B;  4ANW A;  4RMA A;  4DBG A;  2MQJ A;  2KQS A;  5DPS A;  4IG7 B;  4WAA A;  2KN5 A;  3DBS A;  3SDL C;  2O6V D;  3VUY A;  1V80 A;  4XX5 A;  1WR6 E;  2ZNV B;  2J0M A;  1WY8 A;  2CU1 A;  3CMM B;  2BF8 B;  4FJZ A;  4IWQ A;  3PHX B;  1Q1O A;  1E8Y A;  1V2Y A;  2KJR A;  3M3J A;  3RZF A;  2KWV B;  4HLE A;  1J0G A;  2L0T A;  4WJP A;  5IAA C;  4NAW A;  2JZZ A;  1RRB A;  5D2M B;  4ANX A;  2MSE D;  2EMT A;  4W9F A;  1WX9 A;  3ZDM C;  3SD5 A;  2EMS A;  2JVC A;  4BBN C;  2RGF A;  2J0J A;  3B08 A;  3JYU A;  4F8C B;  5E6P A;  2BWE S;  3OLM D;  4KV2 A;  3ZRC A;  4TKN A;  4GMV A;  1NI2 A;  3WA0 A;  3APF A;  1T0Y A;  4LCD E;  3V61 A;  1P3Q U;  3T9L A;  3PHW B;  1E8Z A;  1WZ3 A;  4BVU C;  3O65 B;  3L16 A;  4LDT B;  1NBF C;  1K8R B;  1S3S G;  3AUL A;  2EKE C;  2WX1 A;  3ZKJ C;  3DOW A;  2FCN A;  3R7Q A;  4HJK A;  3UIO B;  1L2N A;  2LGD A;  3APD A;  5E6N A;  2LI5 A;  3K9P B;  2ZNV C;  3VVW B;  3UGB B;  1TZ1 A;  4K7S A;  2NPT A;  3RYT A;  3PRE A;  4ASW C;  2GMI C;  2CR5 A;  2KXJ A;  2LRW A;  1WGD A;  2BYE A;  1L7Y A;  3KUZ A;  2JRH A;  4BKS A;  2DX5 B;  3A4S C;  2AL6 A;  4FHK A;  3KW5 B;  1V5O A;  3ALB A;  2KDE B;  3SU8 X;  3NS8 A;  2L7R A;  2KTR B;  1WXM A;  2IO3 B;  3MJW A;  4GB9 A;  4XZ4 A;  2B3A A;  4KDL B;  1UBQ A;  4K1R B;  2C9W B;  4GDK A;  3ECI A;  1S1Q B;  1P1A A;  2IZV B;  2R2O A;  4N9F 4;  1UGM A;  4IW0 A;  3ZNG C;  2I1J A;  3A33 B;  3ZRF A;  2V3S A;  3WAN A;  2JZ3 B;  1WH3 A;  4TQ0 A;  1F9J A;  4NNJ B;  3JSV B;  2LXC A;  4ZDV A;  3VAW A;  2L8J A;  1D3Z A;  2KC2 A;  3N32 A;  2HJ8 A;  3M63 B;  4KSK C;  2ZCC A;  3QWZ B;  4MH0 E;  1WRD B;  4MGY E;  4KIK B;  2OOB B;  3X0W A;  1YX6 B;  4GOC A;  2RSU A;  4RM8 A;  2JWZ A;  1ISN A;  4FN2 A;  3RUI B;  4AOF A;  4GN1 A;  1P9D U;  2MWS B;  3DVG X;  3A9K B;  2ZZP B;  3VXW A;  1LQB A;  3NOB A;  2L0F A;  2DZK A;  2JUO A;  5AZH A;  2LUE A;  2Z0E B;  4W9E A;  1C1Y B;  4EZL A;  3HIZ A;  1WYW B;  3NHE B;  1WIA A;  5CX3 A;  1WXS A;  1WXV A;  2C60 A;  3M95 A;  1LFD A;  1WGG A;  2FNJ B;  3QX1 A;  4NAW B;  2MW5 A;  3UIN B;  4PS3 A;  3RZW C;  1OEY A;  4MSM B;  5J17 A;  3W1Y A;  3DCG A;  3PSE B;  4FLH A;  3ZW3 A;  4MGI E;  2NVU I;  2LVQ A;  3A1Q A;  2IYD B;  1FXT B;  1RAX A;  2MX2 A;  1JRU A;  3DBH I;  4HPM B;  4MJS B;  4I6N B;  1CMX B;  1UD7 A;  4NQK E;  1IYF A;  1WJ4 A;  1YIW A;  2MBO A;  4BBN F;  4I6L B;  3KYC D;  4ZRJ A;  1H4R A;  3KYD D;  3SHQ A;  4EZJ A;  2GBJ A;  5JZE B;  2K1F A;  4NJ6 A;  1WX7 A;  1J19 A;  2NR2 A;  3KH0 A;  1KLV A;  3VH3 B;  2KLC A;  2D10 A;  2M17 A;  1UEL A;  1ZKH A;  3C0R B;  3QCA A;  4AUQ C;  3VDZ A;  4WWO A;  3H6N A;  4KIK A;  5LXH A;  3D32 A;  2NPT B;  2FCQ A;  1R4M I;  2G4S A;  3A4R A;  3GZN I;  2YLM A;  4ANU A;  1IP9 A;  2IO2 B;  5GMV A;  3A9K A;  4HK2 A;  4BOS C;  2KD0 A;  3JVZ X;  1UZX B;  4A3O A;  2C7H A;  1R4N I;  4HDO A;  4FA6 A;  5AEK B;  2KWC A;  1SE9 A;  2ZPN A;  4GDL A;  3VHT C;  2DYM A;  1QZE A;  2NBU A;  3VUW A;  4EOY A;  2PE9 A;  2O6V A;  4EKU A;  5G2N A;  1E5W A;  3KUC B;  4GDK B;  2ZVN A;  3QIJ A;  3TL5 A;  3U7D A;  1HE8 A;  2KJ6 A;  1V49 A;  1WMH A;  2XBB C;  3DVN V;  4RM9 A;  1WJU A;  2JY6 A;  2FIF A;  3IVF A;  1RLF A;  1V9J A;  3PVL A;  4ZRK A;  2LGX A;  4W9I A;  1WGR A;  4MJS A;  3ZTD A;  4ICU A;  1WGH A;  4I6P A;  2FCS A;  2N9X A;  4FJY A;  5DPR A;  2GBK A;  3AXC A;  1KM7 A;  5FR6 A;  4W9J A;  2BKR B;  5CHV C;  2MBE A;  5LLI A;  4EEW A;  2N9P C;  1MG8 A;  3QAQ A;  3H9D A;  2IO0 B;  2IY0 B;  2WWZ A;  1UBI A;  4DHJ B;  4FBJ B;  1TGZ B;  2M1M A;  1H8C A;  3RT3 B;  4HCP B;  2AYO B;  2HD5 B;  2KAN A;  2O2V A;  3ZO5 B;  3UIP B;  2DZM A;  4NPN A;  4PS8 A;  3VFK A;  2KX0 A;  1EF1 A;  5J18 A;  1YD8 U;  4IWO A;  3LJ3 A;  2BPS A;  3PLU A;  3U30 A;  4BOZ B;  1GUA B;  2OJR A;  2I1K A;  4DWF A;  3H7P B;  4IC7 B;  4ICV A;  2D2Q A;  4YL8 A;  4HVB A;  1P98 A;  5TR5 A;  2XK5 A;  3QAR A;  2J0K A;  2BGF A;  3A1Q B;  3IBE A;  4TQ1 A;  3WIM A;  2G3Q B;  4PYZ A;  5LXI B;  2CHZ A;  2KMC A;  5D7G A;  3MHS D;  4JQW C;  1GNU A;  3ENE A;  3QQ8 B;  3WAO A;  2DHZ A;  3PGE A;  1WZ0 A;  2KDF B;  3Q3J A;  4MGZ E;  3QK0 A;  2KDI A;  3IG3 A;  1EF5 A;  1EUV B;  2ASQ A;  2MLB A;  3V6E B;  4DHZ B;  3V6C B;  5D6J B;  4CYE A;  2LVO A;  2V4L A;  2K8B A;  3X23 A;  4BKT A;  2JF5 A;  4ZYN A;  4P7I A;  4W9K A;  4W9L A;  4FUL A;  1PQS A;  3OAW A;  4HDQ A;  2Y5B B;  1E8X A;  4B9K A;  4II3 B;  1WM2 A;  4E74 A;  1WE6 A;  2M8S A;  4JGH B;  2NBW B;  4DDG D;  3IHP C;  4EFO A;  1BT0 A;  4GDL B;  5C23 A;  3ML8 A;  2KKC A;  2ZEQ A;  1WF9 A;  1WX8 A;  4HPL B;  4EZK A;  2G4D B;  2N7D A;  2O6V B;  4FHJ A;  4FAD A;  3VUX A;  3TMP B;  4PYU A;  3W1S C;  3JW0 X;  1KOT A;  3DBL I;  4LDT D;  3H7P A;  1IPG A;  1WMH B;  4CO7 A;  4DHJ D;  1I42 A;  2AEH A;  2N7E A;  2LJ5 A;  4MEM A;  3TIX A;  5KHO A;  2JPH A;  2KZR A;  4WJO A;  4EUT A;  1LM8 B;  3OJ3 A;  4IUM B;  3AU5 A;  4XC2 A;  1E90 A;  2FUH B;  3A9J B;  3L13 A;  3W1S A;  3WAM A;  3N30 A;  1E7U A;  5EDS A;  2G45 B;  2KO3 A;  1Y8R C;  2IO1 B;  4A3P A;  2DZI A;  3L08 A;  4OVV A;  4ZRI A;  4A20 A;  2RD0 A;  4B6W A;  3V60 A;  2N1V A;  4GSW A;  3PRZ A;  3ZNZ B;  2AWT A;  4ANV A;  1GJZ A;  2LXA A;  4G0N B;  1NDD A;  4W9G A;  3QHT A;  2W9N A;  5AZF A;  3B1L X;  4K7W A;  2O2V B;  4FJV B;  3T8M A;  3ZDT A;  3GOE A;  2KQ7 A;  1TBE A;  5IA7 A;  2KMA A;  3WAL A;  4JIO U;  2DAF A;  4NY0 A;  5C1Z A;  2A5U A;  2J7Q B;  3KUD B;  5E6O A;  1GC7 A;  4K7U A;  2GBR A;  3EEC A;  3UQB A;  4NJ7 A;  3DVG Y;  3VTV A;  1C3T A;  1Z2M A;  2JT4 B;  4JLC A;  3DVN U;  3V62 A;  1AAR A;  2QHO A;  3QJZ A;  3ZVV A;  2A4Z A;  2XK5 B;  1G6J A;  2UYZ B;  5G55 A;  5CTR C;  3HK0 A;  4MM3 A;  1ZW7 A;  3EC8 A;  3PTF C;  4IM2 A;  2UWQ A;  4W9C A;  4WWP A;  3M62 B;  3DBR I;  3K9O B;  3Q3F A;  2IBI B;  2GBM A;  5BO4 B;  1XQQ A;  4HXD A;  3NY5 A;  4GGQ A;  4J6I A;  5JHB A;  3L17 A;  4LJP B;  5DPT A;  2CS4 A;  2KLG A;  3A9J A;  3H7S A;  3VTU A;  2K8H A;  2ZJD A;  4BFR A;  2N9E B;  3AU4 A;  4W9H A;  3HM3 A;  2NS5 A;  2KNB A;  2V1Y A;  2KJH B;  3ZLZ A;  2CHX A;  3RUL A;  3R3M A;  1SGH A;  2VRR B;  2KK8 A;  2YVC A;  4G11 A;  3H1U A;  1M94 A;  3L0W B;  4KSL C;  3OJ4 B;  2MA9 B;  3KVF B;  1OEY J;  2BKF A;  3TCA A;  2K6Q A;  3ZNI D;  2C5L C;  2MBB B;  2KHW B;  1WXA A;  1WR1 A;  4G3X B;  4KZ0 A;  3EHV A;  3MTN B;  2KC1 A;  3BY4 B;  2R2Q A;  2XEW A;  4W9D A;  3ZTC A;  1EO6 A;  4MDK E;  3L10 B;  4JL9 A;  2ZCB A;  3PS6 A;  3ZIM A;  4M8N A;  3CST A;  4WJN A;  2FID A;  1A5R A;  2MP2 B;  2NCN A;  1WFY A;  3QA8 A;  4CHK A;  1WJ6 A;  2D11 A;  5L95 C;  2C7N B;  4HWI B;  4IM0 A;  5J2R A;  5KHQ A;  2DZJ A;  1XT9 B;  3IFW B;  3PLV A;  3B0A A;  4BKS D;  4KDI C;  4GXB A;  2KFK B;  2K25 A; 
#chains in the Genus database with same CATH topology
 1MVK A;  1J8C A;  1GC6 A;  4PT5 A;  1I4R A;  2OJW A;  4M0W B;  2BQQ A;  3S2A A;  1WE7 A;  3DPD A;  2KVR A;  3PRP B;  3PZD A;  4LJO B;  4DHZ E;  2E3T A;  2Y5P A;  4MEL A;  1WRI A;  1J7C A;  5FR3 A;  1JW9 D;  4LNI A;  4HCN B;  3P4R B;  2L1A A;  4G50 A;  2DYO A;  4AJY B;  3Q3M C;  4DK5 A;  1FEH A;  1V5T A;  3NZU A;  4P1C C;  2N9K A;  3HUI A;  2D07 B;  2KFJ A;  1RFA A;  2IY1 B;  1YJ1 A;  2WHI A;  1BXT A;  2KMM A;  2QIE B;  4E71 A;  2REX A;  4OHJ A;  4RCO A;  1TTN A;  3VQI A;  1U4A A;  3CSF A;  4PS7 A;  3PRM B;  4NQL B;  3RCZ A;  1B9R A;  2QJL A;  1SIF A;  3Q2A C;  4MGK E;  2HTH A;  4GIV A;  3QC8 B;  5JHA A;  4RGN A;  3R7R A;  3MFG A;  4F7Z A;  3N3K B;  2WXO A;  1SE4 A;  1QOF A;  2DEN B;  2PPH A;  1VD2 A;  4AP4 C;  5JH5 C;  2WXK A;  2ACZ B;  4JWS C;  4GU2 A;  2AL3 A;  4WWN A;  2JXX A;  5L83 A;  1E8W A;  2IJ0 A;  3NZS A;  2LD9 A;  4RMA A;  2MQJ A;  1TT5 B;  4WAA A;  1Q10 A;  3VUY A;  1MJD A;  2V3P A;  4IDI A;  2CU1 A;  3TSS A;  2BF8 B;  4FJZ A;  3M3J A;  4WJP A;  5IAA C;  3V3X A;  2MSE D;  3ZDM C;  3SD5 A;  2EMS A;  2QMT A;  1I4X A;  4BBN C;  1V1O A;  2N9L A;  3JYU A;  5E6P A;  5FK9 C;  4N58 A;  4TKN A;  4GMV A;  1C78 A;  2LUM A;  2G1E A;  1E8Z A;  1K8R B;  4HJG E;  4M01 A;  3DOW A;  4ZOH C;  2FCN A;  4HJK A;  3UIO B;  1L2N A;  2QEJ C;  2JXT A;  3O13 A;  2GMI C;  4FXC A;  2CR5 A;  3IAS 1;  3N9Y C;  2BYE A;  1L7Y A;  2INC C;  1V5O A;  1E9M A;  2KDE B;  4C80 A;  4A90 A;  4KKJ A;  1VLB A;  2B3A A;  3ECI A;  2INP E;  1S1Q B;  3TEY A;  4N9F 4;  1UGM A;  4IW0 A;  3ZNG C;  3A33 B;  2V3S A;  3WAN A;  2JZ3 B;  1F9J A;  1DOI A;  2LXC A;  4ZDV A;  3VAW A;  1PDX A;  2KC2 A;  1QKZ A;  2NTS A;  4OZA A;  2HJ8 A;  1PGX A;  3AE2 B;  2ZCC A;  4MH0 E;  3X0W A;  1SB3 C;  4YXD B;  2ON8 A;  1HTQ A;  2RSU A;  4OZC A;  2WU2 B;  4GN1 A;  1CQV A;  3DVG X;  3T3N A;  3VXW A;  2L0F A;  2JUO A;  2LUE A;  1WYW B;  2BS3 B;  3M95 A;  1LFD A;  1STE A;  3QX1 A;  4WUR A;  4PS3 A;  1OEY A;  1SXT A;  2OED A;  3AE7 B;  1MG4 A;  1XLO A;  4FLH A;  1I7H A;  3ZW3 A;  4MGI E;  2NVU I;  3A1Q A;  4HPM B;  4I6N B;  1IYF A;  1WJ4 A;  2BYT A;  3SHQ A;  4EZJ A;  2K1F A;  4NJ6 A;  3ZYY X;  4L2Y A;  2KLC A;  5FKA C;  2M17 A;  4P1B C;  4AUQ C;  3E9S A;  3H6N A;  4KIK A;  3ZGZ A;  3D32 A;  2RDB C;  3A4R A;  3GZN B;  4J3O D;  5GMV A;  3A9K A;  1HXY D;  3AE5 B;  4HK2 A;  2FUG 1;  2M0A A;  4GDL A;  4M02 A;  2DYM A;  2PE9 A;  1GOZ A;  2O6V A;  2BB5 A;  1E5W A;  2KJ6 A;  1WMH A;  3DVN V;  1WJU A;  1GAQ B;  2JY6 A;  3BK1 A;  3IVF A;  4W9I A;  4MJS A;  1WGH A;  3ZJV A;  3RFZ B;  4ARI A;  2FCS A;  3R2I A;  4A9A A;  1V8C A;  2BKR B;  1YN3 A;  2WQY B;  5LLI A;  2IO0 B;  2M1M A;  1QF6 A;  2ONQ A;  3ZO5 B;  3UIP B;  2DZM A;  4XWT A;  3VFK A;  1HQR D;  2BPS A;  3PLU A;  3U30 A;  3TEX A;  2I1K A;  4YL8 A;  4IC7 B;  2D2Q A;  4HVB A;  3I5J C;  1UNS A;  4HEA 1;  5BYS A;  3A1Q B;  3IBE A;  1FXI A;  3IXS A;  3RNF C;  5LXI B;  4WH4 A;  3Q8A A;  4P6V F;  4OVZ A;  1VZ8 A;  1ZPS A;  1J7A A;  2KDF B;  1YQ3 B;  2TSS A;  3TUO A;  3AH7 A;  3IG3 A;  1EF5 A;  2MLB A;  2XNA C;  1Y56 A;  4CYE A;  3Q8C A;  1ENF A;  1JQ4 A;  4P7I A;  4W9K A;  4HDQ A;  4UDU C;  1E8X A;  1SE2 A;  1WM2 A;  1WE6 A;  2NBW B;  1IUE A;  1BT0 A;  4GDL B;  5T8I A;  4C4V B;  5BMI A;  4EZK A;  2G4D B;  2O6V B;  2KYW A;  1WWT A;  3TMP B;  2L83 A;  3DBL I;  1MHX A;  1IPG A;  1WMH B;  4DHJ D;  2AEH A;  4MEM A;  3TIX A;  2JPH A;  2KZR A;  4EUT A;  3IT4 B;  4XC2 A;  3W1S A;  4XGA B;  2IO1 B;  2Y3A A;  2WDQ B;  2WXI A;  4GSW A;  3W2D A;  1A70 A;  4S17 A;  1IBX B;  5H92 C;  4RFB A;  3B1L X;  3T8M A;  1PGB A;  2RPV A;  3BVZ A;  1C4A A;  4K7U A;  4XE0 A;  2GBR A;  1C3T A;  1AWD A;  1Z2M A;  3DVN U;  3QJZ A;  5G55 A;  5CTR C;  3HK0 A;  1C76 A;  2KAJ A;  1SBB B;  2UWQ A;  3K9O B;  1K53 A;  4RNA A;  2N0S B;  2BBC A;  1XQQ A;  2KAC A;  4AQ7 A;  3NY5 A;  4US9 A;  4LJP B;  1B1Z A;  1XCT L;  3VTU A;  2K8H A;  2BTE A;  5HG2 A;  5LNK 1;  3HM3 A;  2KNB A;  2V3N A;  2CHX A;  2LMC A;  2WXH A;  3KVF B;  1V1P A;  4G3X B;  4KZ0 A;  3MTN B;  2KC1 A;  4W9D A;  2AX5 A;  2QCZ A;  2VZK B;  4WJN A;  2MP2 B;  2D11 A;  5EE9 A;  4HWI B;  1E10 A;  4LNO A;  2K25 A;  1DYQ A;  4OVU A;  2LGY A;  1ET9 A;  3P63 A;  4AJW A;  1F2R I;  1GG3 A;  4OZB A;  4CQN A;  3U8Z A;  4C7Y A;  5CHW A;  5HKH A;  4WQO B;  4BKG A;  2L00 B;  3BK2 A;  3UF8 A;  1TS2 A;  1N5X A;  2DYB A;  2L05 A;  3WAP A;  1OGW A;  1SJH D;  2CKH B;  1QT9 A;  4DDI D;  4IWP A;  1D6E C;  4URK A;  1WI0 A;  2JQR B;  1FRD A;  3PPA A;  1FM0 D;  2PW9 A;  3CWI A;  3W5U B;  1ZOY B;  4HKZ E;  3BVM A;  3BIN A;  2ZW0 A;  2KFK A;  3TJP A;  1I35 A;  2LAS A;  4GLS C;  2ZPY A;  4L23 A;  2FCM A;  3EFU A;  4KGR A;  2BS2 B;  4KVG B;  1V1P B;  2EKI A;  1Z5S B;  2V4I B;  3AI5 A;  2LEK A;  4NJC A;  4YSX B;  4KZC A;  2WX0 A;  5AUI A;  3HHM A;  3MHZ A;  3MC9 A;  1VCB A;  2GBN A;  5CHF A;  3ZNH B;  4WJQ A;  2PE6 B;  3LDZ E;  1TZO A;  2WDV B;  2RR9 A;  1YJI A;  2FAZ A;  1C9F A;  4F1S A;  1X1M A;  3TBL D;  2L3Z A;  1MFW A;  2KWU B;  3P2B A;  2LVP A;  1NYR A;  3N1Y C;  4K3B A;  2CHW A;  4YSZ B;  2K39 A;  2Z59 B;  4DBG A;  2KQS A;  2KN5 A;  1EWY C;  2O6V D;  3AEB B;  2KT7 A;  1MI0 A;  3OWE B;  4XX5 A;  2ZNV B;  1WY8 A;  4YSY B;  3RZF A;  2KJR A;  4HLE A;  2KWV B;  2JZZ A;  5D2M B;  1N5W A;  3PZ8 A;  2EMT A;  4A8X C;  1T0Q C;  3PO0 A;  2J52 A;  2RDG A;  4F8C B;  2WXN A;  1JML A;  3B08 A;  2BWE S;  4BAX A;  4KV2 A;  4RH6 A;  3WA0 A;  1QOA A;  1P3Q U;  3T9L A;  2LGS A;  1S3S G;  2HJ1 A;  4KGT A;  2WX1 A;  3SFD B;  3T3O A;  1C77 A;  3AN1 A;  3APD A;  3K9P B;  1TZ1 A;  5D3D A;  1MHH E;  3KUZ A;  2DX5 B;  2AL6 A;  2K5P A;  4FHK A;  3KW5 B;  3ALB A;  2JYE A;  4WAF A;  2IO3 B;  1WXQ A;  1ET6 A;  4GB9 A;  5BYR A;  1RFK A;  2R2O A;  1C4P A;  4P16 A;  4IKG A;  1WH3 A;  1VDV A;  4RGO S;  4LTU A;  4TQ0 A;  1FIQ A;  2QSD A;  1FPY A;  1T6B X;  1L6U A;  1WSP A;  4KSK C;  1RYJ A;  3ZJU A;  4MGY E;  4JX1 C;  1QOG A;  3SR6 A;  1EM7 A;  1YX6 B;  2B76 B;  1ISN A;  4NZL B;  4FN2 A;  2L32 A;  4AOF A;  2ZZP B;  4KKI A;  3KQ4 A;  2Z0E B;  3EUB 2;  1C1Y B;  5CX3 A;  3NHE B;  2MJE A;  1WXS A;  1WXV A;  1BUI C;  2VZK D;  4LNN A;  3VR8 B;  2IPK D;  2MW5 A;  5J17 A;  3W1Y A;  3MP9 A;  3ZXR A;  2IYD B;  2MX2 A;  4KGS A;  1UD7 A;  1KLG D;  1WX7 A;  3AE6 B;  3VH3 B;  1TKY A;  2IND C;  1UEL A;  3C0R B;  5E6J A;  2M56 B;  1R4M B;  2G4S A;  3N20 C;  3GZN I;  3B9J A;  4ANU A;  1IP9 A;  2IO2 B;  1JWA D;  2KD0 A;  4HDO A;  2IGG A;  4EOY A;  1QZE A;  4RGM A;  3KUC B;  2ZVN A;  3QIJ A;  1V49 A;  5IOI A;  3W5V B;  2FIF A;  1V9J A;  4ZRK A;  1WGR A;  5IKC M;  2GBK A;  1NEN B;  5FR6 A;  3PZ7 A;  2JU6 X;  2D3C A;  4EEW A;  3QAQ A;  5I4D A;  4DHJ B;  1AW7 A;  3RT3 B;  1QQR A;  1C79 A;  1L0Y B;  5EE3 A;  3LJ3 A;  1GUA B;  1K50 A;  3URY A;  4NAM A;  3Q8B A;  2J0K A;  2MJD A;  3AMZ A;  4S0R A;  3R8B A;  5D7G A;  1JWU D;  1GNU A;  1CZP A;  5H8Y E;  1ZXH A;  4K3C A;  1JAL A;  3NS1 A;  1TJE A;  1P7E A;  3V6C B;  5D6J B;  2WXF A;  2WXJ A;  1KH0 A;  4W9L A;  4FUL A;  1PQS A;  3OAW A;  2Y5B B;  4DDG D;  3ML8 A;  2KKC A;  1XEE A;  1YMH E;  3W1S C;  1KOT A;  4JWU C;  1D5X C;  1ZDX A;  4WWM A;  2N7E A;  3LB8 C;  5KHO A;  1YJJ A;  1RM6 C;  1UGJ A;  3OJ3 A;  2SEB D;  4IUM B;  3AU5 A;  2FUH B;  4YTN B;  3WAM A;  1KF6 B;  5EDS A;  2G45 B;  3GB1 A;  4A3P A;  2DZI A;  3L08 A;  4OVV A;  4R3D A;  2N1V A;  5GXG B;  4DXG A;  2AWT A;  2LXA A;  3NG0 A;  1ZE3 D;  1TBE A;  2KMA A;  1L4D B;  4JIO U;  4LLG M;  2A5U A;  5E6O A;  3UQB A;  3VTV A;  3DWM A;  2QHO A;  2AQ3 B;  3Q8E A;  4IM2 A;  4C4V A;  3DBR B;  2GB1 A;  2MHJ A;  1M4V A;  4HXD A;  2VH2 A;  4DQO C;  3FC4 A;  3L17 A;  5DPT A;  1YQ4 B;  3H7S A;  2KDM A;  1D4B A;  2ZJD A;  4W9H A;  2KJH B;  3NZ3 A;  2LHE A;  2VRR B;  2KK8 A;  2W3R A;  4G11 A;  1IBX A;  1JCK B;  1J7B A;  1JRP A;  1OEY J;  2GI9 A;  2MBB B;  1WR1 A;  2XEW A;  2OHF A;  4IOI E;  2AQ2 B;  2N7J A;  4MAC A;  1EO6 A;  3NUH B;  3ZTC A;  5C3J B;  3PS6 A;  3WCQ A;  3ZIM A;  4M8N A;  3CST A;  4CHK A;  1WFY A;  1WJ6 A;  2C7N B;  4LNK A;  1NYQ A;  5J2R A;  1XT9 B;  3IFW B;  2NMQ A;  3B0A A;  5G5H A;  2QIL A;  4GXB A;  4E3C A;  4C00 A;  3HM6 X;  2JYT A;  1I4Q A;  4AS1 A;  2WYQ A;  2I38 A;  3PT2 B;  2LHD A;  2JX5 A;  2GOW A;  4RF1 A;  3FIL A;  1T0R C;  3GE3 C;  2M0X A;  1Q0W B;  3UQA A;  2H88 B;  5DCN A;  4ITK A;  1GB1 A;  3I3T B;  2MP2 A;  3ZUN A;  4II2 B;  1F2R C;  4B95 A;  4OW0 A;  1LXD A;  3CF6 E;  1T5X D;  1VZ6 A;  2YEP F;  4M8M A;  5AZG A;  2N1W A;  4ZYS A;  2ZVO A;  1WJN A;  1QLB B;  1V86 A;  2PJH A;  1YX5 B;  1JWS D;  3I9V 1;  3VH4 B;  2D5G A;  2WDT B;  5DPW A;  5G5G A;  3J9C A;  3R66 C;  1XLP A;  2PKO A;  2D3G A;  1XD3 B;  4HKQ A;  2PEA A;  1KJT A;  4B0M A;  2KDB A;  3B2G A;  3HVZ A;  1K52 A;  1I4G A;  4MSQ B;  3PV1 A;  3Q6B A;  3SFE B;  1V81 A;  4TSS A;  1E7V A;  1CJE A;  3V05 A;  2W54 A;  5JXV A;  3Q69 A;  4ANW A;  4IG7 B;  2MH7 A;  3SDL C;  1V80 A;  1WR6 E;  1P7F A;  3RN9 C;  4US8 A;  4REZ A;  4IWQ A;  1E8Y A;  2L0T A;  4NAW A;  4ANX A;  1RRB A;  1FNW A;  1ZP0 B;  2MJ3 A;  3AE3 B;  1VR9 A;  4W9F A;  2WNM A;  1WX9 A;  3AB5 A;  3L4P A;  3FIL B;  4ARC A;  3C8Y A;  2RGF A;  4USA A;  3OLM D;  3AEG B;  4LCD E;  1T0Y A;  1XLQ A;  1WZ3 A;  3L16 A;  4LDT B;  3AUL A;  1XLN A;  2EKE C;  3R7Q A;  5BMH A;  2LGD A;  5TSS A;  1NVI D;  2LI5 A;  4K7S A;  3PRE A;  1WGD A;  2JRH A;  4BKS A;  3A4S C;  2J42 A;  3SU8 X;  3AEF B;  3MJW A;  4XZ4 A;  3VRB B;  2C9W B;  4GDK A;  4LNF A;  2WXG A;  2R61 A;  3N1X C;  4NNJ B;  3NVY A;  2PLP A;  2H89 B;  4YTP B;  4L1B A;  2IGD A;  2RMM A;  3M63 B;  4C7Z A;  1WRD B;  2OOB B;  1N6Z A;  2K9X A;  3AE4 B;  4GOC A;  4RM8 A;  2JWZ A;  3RUI B;  1P9D U;  2MWS B;  3NOB A;  4XWW A;  2BS4 B;  2DZK A;  5AZH A;  4W9E A;  3HIZ A;  2Y5C A;  3AM9 A;  2PIA A;  1V97 A;  4NAW B;  3RZW C;  3RI7 C;  3HVD A;  1PUT A;  3PSE B;  1JWM D;  3RNC C;  2LVQ A;  3DBH B;  1CMX B;  3Q8F A;  4BBN F;  3KYC D;  4DXF A;  1H4R A;  3KYD D;  3TEW A;  3EGR A;  1EU4 A;  1J19 A;  2NR2 A;  1KLV A;  2BT6 A;  2D10 A;  1FFV A;  4WWO A;  1L4Z B;  1F52 A;  5LXH A;  1ESF A;  1R4M I;  3P42 A;  2QDF A;  4BOS C;  3GE8 C;  1UZX B;  4A3O A;  2KVZ A;  3R2T A;  1R4N B;  2C7H A;  5AEK B;  2IGH A;  2KWC A;  1SE9 A;  2ZPN A;  1ZXI A;  2BVC A;  2NBU A;  3VUW A;  4EKU A;  5AUK A;  4GDK B;  3U7D A;  1ROE A;  3TL5 A;  3W9C B;  1HE8 A;  5EE0 A;  4KX6 B;  1FNU A;  2XBB C;  3PVL A;  2LGX A;  3ETR A;  2RDH A;  3ZTD A;  4I6P A;  2N9X A;  1WYG A;  3HRD D;  4FJY A;  3AXC A;  1KM7 A;  5DPR A;  4W9J A;  4ZHO A;  2WP9 B;  5CHV C;  2MBE A;  1YNT E;  2N9P C;  1MG8 A;  1KRH A;  2SAK A;  4D2K A;  4N59 A;  3GP7 A;  3ZQ4 A;  3C19 A;  3H9D A;  1KLU D;  2IY0 B;  4A55 A;  2WWZ A;  1UBI A;  2WU5 B;  1TGZ B;  1H8C A;  1FXA A;  2HTM E;  4HCP B;  2AYO B;  2O2V A;  1FMA D;  3AE8 B;  4NPN A;  4PS8 A;  5EE1 A;  2KX0 A;  1EF1 A;  4IWO A;  4BOZ B;  1FCL A;  3H7P B;  1ZDV A;  1ZUD 2;  1P98 A;  2XK5 A;  1R7S A;  3AEA B;  2BGF A;  5BYQ A;  4TQ1 A;  1IGD A;  3MJ5 A;  2CHZ A;  3MHS D;  4JQW C;  1NEK B;  3EFC A;  3PGE A;  5HI1 A;  4MGZ E;  3TEZ A;  1SEB D;  2INN E;  2WLB A;  1EUV B;  2ASQ A;  2DLB A;  4DHZ B;  2GLS A;  2JWU A;  4BKT A;  2DWQ A;  4II3 B;  1UWX A;  2M8S A;  2AQ1 B;  1D5Z C;  1YOV B;  5C23 A;  4MM3 B;  2JSV X;  2N7D A;  4FHJ A;  4FAD A;  1FNV A;  4PYU A;  4LDT D;  4CO7 A;  2ZW1 A;  1E90 A;  1E0Z A;  3A9J B;  4XDC A;  3BWU D;  1SIJ A;  2KO3 A;  1Y8R C;  4A20 A;  2RD0 A;  4B6W A;  2WXQ A;  3V60 A;  3EA6 A;  3PRZ A;  5IO9 A;  3ZNZ B;  4ANV A;  1GJZ A;  2EEL A;  4W9G A;  1NDD A;  3QHT A;  2W9N A;  5AZF A;  4K7W A;  2O2V B;  4FJV B;  3ZDT A;  3GOE A;  2KQ7 A;  5IA7 A;  3WAL A;  2DAF A;  5BMG A;  1N61 A;  2J7Q B;  3KUD B;  4ZRP A;  3H8H A;  1I4H A;  2K3U A;  3V62 A;  3RNG C;  1FFU A;  3FKY A;  2A4Z A;  2XK5 B;  3ZVV A;  1G6J A;  3MC0 B;  1ACC A;  1ZW7 A;  3EC8 A;  3PTF C;  3M62 B;  3DBR I;  2IBI B;  1SF0 A;  2DNF A;  2GBM A;  2KWD A;  3NRZ A;  4HRS A;  3NVZ A;  5C2T B;  4GGQ A;  4J6I A;  2JZP A;  5JHB A;  2CS4 A;  2KLG A;  2J53 A;  2N9E B;  3AU4 A;  2NS5 A;  2V1Y A;  3DHI C;  1DOY A;  3R3M A;  1SGH A;  3E56 A;  2YVC A;  1M94 A;  1IGC A;  3L0W B;  2MA9 B;  1XXG A;  2BKF A;  3ZNI D;  2C5L C;  1WXA A;  2DBY A;  3BY4 B;  2R2Q A;  2D3B A;  1OFF A;  1FRR A;  3L10 B;  4JL9 A;  2ZCB A;  1A5R A;  2FID A;  1L5P A;  2NCN A;  5KHQ A;  2DZJ A;  3PLV A;  1I4P A;  2PVG C;  2X38 A;  4BKS D;  3U4E G;  3RNA C;  3DHH C;  2MRP A;  3ONS A;  1KTK A;  4TV3 A;  5D94 A;  1RWS A;  2K8C A;  3BYY B;  4X57 B;  1SSN A;  4AWJ A;  4IM3 A;  2M4N A;  1Q5W B;  4HRO A;  1ZGU B;  2CJO A;  2V9H A;  2RPQ A;  4RF0 A;  2C7M B;  2I2Y A;  3U2S C;  2JRI B;  4TUU A;  2MBQ A;  4WIP A;  2BYF A;  3AE1 B;  2L52 A;  3KLS X;  2E6X A;  2BYV E;  3RPF C;  2LRU A;  2G9H D;  4YT0 B;  1TYG B;  1UH6 A;  3P1M A;  1TS3 A;  3U7Z A;  1OTR B;  2LWP A;  3RMK C;  2L76 A;  1PYW D;  2DAJ A;  2KTF A;  2Z0D B;  2BWF A;  4K81 A;  2K6D B;  2LJI A;  2KX3 A;  1C4C A;  3APC A;  2VH1 A;  1SE3 A;  3UI3 A;  3RD2 A;  1YN5 A;  1WM3 A;  2YEP B;  3P4S B;  1UF0 A;  2KTR A;  2HE7 A;  2IDY A;  1YQB A;  2LZ6 A;  1V6E A;  3VTW A;  2MCN B;  2KOX A;  4MH8 A;  3JSV A;  1WGY A;  1OQY A;  1UUP A;  1AYF A;  1KFY B;  2NBV B;  3DDC B;  2CJN A;  3L54 A;  3ML9 A;  3U52 E;  3DQV A;  2N4F A;  2MBH A;  1YN4 A;  4DXA B;  1DGJ A;  1P0R A;  2QC8 A;  3N1Z C;  5DPS A;  3AEE B;  3DBS A;  2K22 A;  2KN4 A;  2J0M A;  3CMM B;  1XCQ L;  3PHX B;  1Q1O A;  1V2Y A;  1TKE A;  1J0G A;  2D3A A;  3RNB C;  2JVC A;  1FO4 A;  2KQ4 X;  1VJK A;  1JRO A;  1PGA A;  2J0J A;  4TMA B;  3ZRC A;  1NI2 A;  3APF A;  1N63 A;  3V61 A;  4XYC A;  3PHW B;  4BVU C;  3O65 B;  1NBF C;  4MT5 A;  1NI3 A;  3ZKJ C;  5E6N A;  2ZNV C;  3IAM 1;  3UGB B;  3VVW B;  2NPT A;  3RYT A;  4ASW C;  2V0G A;  2J4X A;  2KXJ A;  2LRW A;  3DHG C;  2FE8 A;  1TKG A;  1L0V B;  3NS8 A;  2L7R A;  2KTR B;  1WXM A;  4KDL B;  1UBQ A;  2M19 A;  4K1R B;  3LXF A;  2UU7 A;  1P1A A;  2IZV B;  1F1H A;  3AEC B;  2I1J A;  1MPE A;  3ZRF A;  3JSV B;  1D3Z A;  2L8J A;  2ICI A;  3N32 A;  3QWZ B;  1QOB A;  4KIK B;  4HPP A;  3IT6 B;  1OQQ A;  4BZA A;  4PK1 A;  4RGT A;  4M00 A;  1LO5 D;  3A9K B;  1LQB A;  3VR9 B;  3ABV B;  4EZL A;  3RNE C;  1WIA A;  1FCC C;  1EU3 A;  2C60 A;  2X8X X;  3BVG A;  1WGG A;  1N62 A;  2FNJ B;  3UIN B;  1GPX A;  4MSM B;  3DCG A;  1FXT B;  1RAX A;  1TS4 A;  1JRU A;  3DBH I;  4MJS B;  3KWV A;  3Q3O C;  1F77 A;  4NQK E;  1YIW A;  1XO3 A;  2MBO A;  3AE9 B;  3VRA B;  4I6L B;  4ZRJ A;  2K0P A;  5JZE B;  2GBJ A;  1HZ5 A;  1GB4 A;  3KH0 A;  1HTO A;  1QIL A;  1ZKH A;  1OQR A;  3QCA A;  5HHD G;  3VDZ A;  1BML C;  4LK0 M;  4JPS A;  1TY0 A;  1JWB D;  2NPT B;  2FCQ A;  4YWG G;  4EE2 A;  2YLM A;  3NVV A;  3JVZ X;  1R4N I;  4FA6 A;  3VHT C;  3OG5 A;  1TY2 A;  5G2N A;  1L0X B;  2PMV A;  1WGK A;  4RM9 A;  2HDE A;  2W82 A;  1RLF A;  4XDD A;  3ZJT A;  2PTL A;  4JE3 B;  3I63 C;  4ICU A;  4ACF A;  2BB6 A;  2WGS A;  3GS2 A;  3I57 A;  4FBJ B;  2Z8L A;  1XF5 L;  2HD5 B;  2KAN A;  1UWM A;  5J18 A;  1YD8 U;  3KWL A;  2OJR A;  4DWF A;  4ICV A;  5TR5 A;  3QAR A;  4C56 C;  4O1N A;  3WIM A;  1E7P B;  3MC8 A;  2G3Q B;  4PYZ A;  2KMC A;  5D3I B;  3Q14 C;  3ENE A;  3QQ8 B;  3WAO A;  2CU3 A;  2DHZ A;  2LGI A;  1WZ0 A;  1L6V A;  3Q3J A;  1T3Q A;  2PVO D;  1VRA B;  1CK1 A;  3QK0 A;  2KDI A;  3BYT B;  3V6E B;  2LVO A;  2V4L A;  2K8B A;  4ZRQ A;  3X23 A;  1HZ6 A;  1PFD A;  2JF5 A;  4ZYN A;  2W3S A;  1AN8 A;  1N60 A;  2GRI A;  1DOX A;  4B9K A;  1TIF A;  4E74 A;  4JGH B;  3IHP C;  4EFO A;  2WDR B;  2ZEQ A;  1WF9 A;  1FD6 A;  1WX8 A;  2WXM A;  4HPL B;  3VUX A;  2WS3 B;  3JW0 X;  3DBL B;  4ZHP A;  5MPO A;  3H7P A;  1I42 A;  2FBW B;  3SEB A;  2LJ5 A;  2Q5W D;  4WJO A;  1LM8 B;  1D5M C;  3L13 A;  3N30 A;  1E7U A;  4Q2J A;  4ZRI A;  3ZXV A;  3NJT A;  4WQM A;  2LFI A;  4B0E A;  4N6E B;  4G0N B;  1T0S C;  1VZ7 A;  1SJE D;  4M0W A;  3CIR B;  3B2F A;  4NY0 A;  5C1Z A;  2W55 A;  1GC7 A;  3EEC A;  4NJ7 A;  3DVG Y;  2JT4 B;  4JLC A;  1AAR A;  2UYZ B;  4MM3 A;  1E6E B;  4WWP A;  1LGR A;  4W9C A;  3P4P B;  3NVW A;  3Q3F A;  5BO4 B;  2MEK A;  3P4Q B;  4H2A A;  2WXR A;  5IN7 A;  3A9J A;  4YTM B;  4BFR A;  2WXL A;  4QAY A;  2WXP A;  3FAH A;  3ZLZ A;  3BII D;  3RUL A;  5IP4 D;  2NTT A;  3AED B;  3H1U A;  4KSL C;  3OJ4 B;  1EWC A;  3LYY A;  3TCA A;  1HA5 A;  2K6Q A;  2KHW B;  3AV8 A;  3EHV A;  2XN9 C;  5HFY A;  4MDK E;  3Q3N C;  3QA8 A;  5L95 C;  1K51 A;  4A6Q A;  4IM0 A;  3BZD B;  1F0Z A;  2BW2 A;  1TS5 A;  3DWG C;  1HEZ E;  4KDI C;  2KFK B; 
#chains in the Genus database with same CATH homology
 4E3C A;  2MRP A;  1J8C A;  4OVU A;  3ONS A;  2LGY A;  3HM6 X;  1GC6 A;  4TV3 A;  2K8C A;  4X57 B;  5D94 A;  4AJW A;  4AWJ A;  4IM3 A;  2M4N A;  1GG3 A;  4M0W B;  2WYQ A;  3PT2 B;  1Q5W B;  3S2A A;  1WE7 A;  3U8Z A;  5CHW A;  2GOW A;  5HKH A;  4WQO B;  1ZGU B;  3DPD A;  4BKG A;  2RPQ A;  2KVR A;  2C7M B;  3PRP B;  2L00 B;  2JRI B;  3PZD A;  3UF8 A;  4TUU A;  2MBQ A;  2BYF A;  4LJO B;  2DYB A;  4DHZ E;  2L05 A;  3WAP A;  1OGW A;  2CKH B;  4MEL A;  4DDI D;  2M0X A;  2BYV E;  2LRU A;  4IWP A;  4HCN B;  1Q0W B;  4G50 A;  3UQA A;  2DYO A;  4URK A;  1WI0 A;  5DCN A;  1UH6 A;  4AJY B;  1OTR B;  3I3T B;  3PPA A;  2LWP A;  4DK5 A;  1V5T A;  2MP2 A;  3NZU A;  3ZUN A;  4II2 B;  2D07 B;  2KFJ A;  1RFA A;  2L76 A;  2IY1 B;  2DAJ A;  4B95 A;  3BIN A;  2KTF A;  1YJ1 A;  2Z0D B;  2BWF A;  4K81 A;  1LXD A;  2K6D B;  2KFK A;  2KX3 A;  2LAS A;  3TJP A;  1I35 A;  3APC A;  3CF6 E;  2ZPY A;  4M8M A;  5AZG A;  4E71 A;  2FCM A;  3EFU A;  2N1W A;  2REX A;  3RD2 A;  2ZVO A;  1WJN A;  1TTN A;  3VQI A;  1V86 A;  1U4A A;  1WM3 A;  3CSF A;  4PS7 A;  2PJH A;  3PRM B;  4KVG B;  1YX5 B;  4NQL B;  1Z5S B;  3AI5 A;  2KTR A;  2HE7 A;  3RCZ A;  3VH4 B;  2WDT B;  1YQB A;  4KZC A;  2LZ6 A;  1SIF A;  1V6E A;  3VTW A;  2WX0 A;  5DPW A;  4MGK E;  3HHM A;  3R66 C;  2HTH A;  2D3G A;  2MCN B;  1XD3 B;  2KOX A;  2PEA A;  4GIV A;  1VCB A;  1KJT A;  2GBN A;  3QC8 B;  2KDB A;  5CHF A;  5JHA A;  3JSV A;  1WGY A;  3R7R A;  4F7Z A;  1OQY A;  3DDC B;  3ZNH B;  3L54 A;  2NBV B;  3ML9 A;  3N3K B;  4WJQ A;  3DQV A;  2PE6 B;  3LDZ E;  2DEN B;  2PPH A;  1VD2 A;  4MSQ B;  4AP4 C;  2N4F A;  2RR9 A;  2FAZ A;  2MBH A;  3PV1 A;  5JH5 C;  1V81 A;  1E7V A;  4DXA B;  4F1S A;  1X1M A;  3TBL D;  4GU2 A;  2AL3 A;  2L3Z A;  4WWN A;  2KWU B;  3P2B A;  2LVP A;  2JXX A;  5L83 A;  1E8W A;  2CHW A;  3NZS A;  2K39 A;  1P0R A;  2LD9 A;  2Z59 B;  4ANW A;  4RMA A;  4DBG A;  2MQJ A;  2KQS A;  5DPS A;  4IG7 B;  4WAA A;  2KN5 A;  3DBS A;  3SDL C;  2O6V D;  3VUY A;  1V80 A;  4XX5 A;  1WR6 E;  2ZNV B;  2J0M A;  1WY8 A;  2CU1 A;  3CMM B;  2BF8 B;  4FJZ A;  4IWQ A;  3PHX B;  1Q1O A;  1E8Y A;  1V2Y A;  2KJR A;  3M3J A;  3RZF A;  2KWV B;  4HLE A;  1J0G A;  2L0T A;  4WJP A;  5IAA C;  4NAW A;  2JZZ A;  1RRB A;  5D2M B;  4ANX A;  2MSE D;  2EMT A;  4W9F A;  1WX9 A;  3ZDM C;  3SD5 A;  2EMS A;  2JVC A;  4BBN C;  2RGF A;  2J0J A;  3B08 A;  3JYU A;  4F8C B;  5E6P A;  2BWE S;  3OLM D;  4KV2 A;  3ZRC A;  4TKN A;  4GMV A;  1NI2 A;  3WA0 A;  3APF A;  1T0Y A;  4LCD E;  3V61 A;  1P3Q U;  3T9L A;  3PHW B;  1E8Z A;  1WZ3 A;  4BVU C;  3O65 B;  3L16 A;  4LDT B;  1NBF C;  1K8R B;  1S3S G;  3AUL A;  2EKE C;  2WX1 A;  3ZKJ C;  3DOW A;  2FCN A;  3R7Q A;  4HJK A;  3UIO B;  1L2N A;  2LGD A;  3APD A;  5E6N A;  2LI5 A;  3K9P B;  2ZNV C;  3VVW B;  3UGB B;  1TZ1 A;  4K7S A;  2NPT A;  3RYT A;  3PRE A;  4ASW C;  2GMI C;  2CR5 A;  2KXJ A;  2LRW A;  1WGD A;  2BYE A;  1L7Y A;  3KUZ A;  2JRH A;  4BKS A;  2DX5 B;  3A4S C;  2AL6 A;  4FHK A;  3KW5 B;  1V5O A;  3ALB A;  2KDE B;  3SU8 X;  3NS8 A;  2L7R A;  2KTR B;  1WXM A;  2IO3 B;  3MJW A;  4GB9 A;  4XZ4 A;  2B3A A;  4KDL B;  1UBQ A;  4K1R B;  2C9W B;  4GDK A;  3ECI A;  1S1Q B;  1P1A A;  2IZV B;  2R2O A;  4N9F 4;  1UGM A;  4IW0 A;  3ZNG C;  2I1J A;  3A33 B;  3ZRF A;  2V3S A;  3WAN A;  2JZ3 B;  1WH3 A;  4TQ0 A;  1F9J A;  4NNJ B;  3JSV B;  2LXC A;  4ZDV A;  3VAW A;  2L8J A;  1D3Z A;  2KC2 A;  3N32 A;  2HJ8 A;  3M63 B;  4KSK C;  2ZCC A;  3QWZ B;  4MH0 E;  1WRD B;  4MGY E;  4KIK B;  2OOB B;  3X0W A;  1YX6 B;  4GOC A;  2RSU A;  4RM8 A;  2JWZ A;  1ISN A;  4FN2 A;  3RUI B;  4AOF A;  4GN1 A;  1P9D U;  2MWS B;  3DVG X;  3A9K B;  2ZZP B;  3VXW A;  1LQB A;  3NOB A;  2L0F A;  2DZK A;  2JUO A;  5AZH A;  2LUE A;  2Z0E B;  4W9E A;  1C1Y B;  4EZL A;  3HIZ A;  1WYW B;  3NHE B;  1WIA A;  5CX3 A;  1WXS A;  1WXV A;  2C60 A;  3M95 A;  1LFD A;  1WGG A;  2FNJ B;  3QX1 A;  4NAW B;  2MW5 A;  3UIN B;  4PS3 A;  3RZW C;  1OEY A;  4MSM B;  5J17 A;  3W1Y A;  3DCG A;  3PSE B;  4FLH A;  3ZW3 A;  4MGI E;  2NVU I;  2LVQ A;  3A1Q A;  2IYD B;  1FXT B;  1RAX A;  2MX2 A;  1JRU A;  3DBH I;  4HPM B;  4MJS B;  4I6N B;  1CMX B;  1UD7 A;  4NQK E;  1IYF A;  1WJ4 A;  1YIW A;  2MBO A;  4BBN F;  4I6L B;  3KYC D;  4ZRJ A;  1H4R A;  3KYD D;  3SHQ A;  4EZJ A;  2GBJ A;  5JZE B;  2K1F A;  4NJ6 A;  1WX7 A;  1J19 A;  2NR2 A;  3KH0 A;  1KLV A;  3VH3 B;  2KLC A;  2D10 A;  2M17 A;  1UEL A;  1ZKH A;  3C0R B;  3QCA A;  4AUQ C;  3VDZ A;  4WWO A;  3H6N A;  4KIK A;  5LXH A;  3D32 A;  2NPT B;  2FCQ A;  1R4M I;  2G4S A;  3A4R A;  3GZN I;  2YLM A;  4ANU A;  1IP9 A;  2IO2 B;  5GMV A;  3A9K A;  4HK2 A;  4BOS C;  2KD0 A;  3JVZ X;  1UZX B;  4A3O A;  2C7H A;  1R4N I;  4HDO A;  4FA6 A;  5AEK B;  2KWC A;  1SE9 A;  2ZPN A;  4GDL A;  3VHT C;  2DYM A;  1QZE A;  2NBU A;  3VUW A;  4EOY A;  2PE9 A;  2O6V A;  4EKU A;  5G2N A;  1E5W A;  3KUC B;  4GDK B;  2ZVN A;  3QIJ A;  3TL5 A;  3U7D A;  1HE8 A;  2KJ6 A;  1V49 A;  1WMH A;  2XBB C;  3DVN V;  4RM9 A;  1WJU A;  2JY6 A;  2FIF A;  3IVF A;  1RLF A;  1V9J A;  3PVL A;  4ZRK A;  2LGX A;  4W9I A;  1WGR A;  4MJS A;  3ZTD A;  4ICU A;  1WGH A;  4I6P A;  2FCS A;  2N9X A;  4FJY A;  5DPR A;  2GBK A;  3AXC A;  1KM7 A;  5FR6 A;  4W9J A;  2BKR B;  5CHV C;  2MBE A;  5LLI A;  4EEW A;  2N9P C;  1MG8 A;  3QAQ A;  3H9D A;  2IO0 B;  2IY0 B;  2WWZ A;  1UBI A;  4DHJ B;  4FBJ B;  1TGZ B;  2M1M A;  1H8C A;  3RT3 B;  4HCP B;  2AYO B;  2HD5 B;  2KAN A;  2O2V A;  3ZO5 B;  3UIP B;  2DZM A;  4NPN A;  4PS8 A;  3VFK A;  2KX0 A;  1EF1 A;  5J18 A;  1YD8 U;  4IWO A;  3LJ3 A;  2BPS A;  3PLU A;  3U30 A;  4BOZ B;  1GUA B;  2OJR A;  2I1K A;  4DWF A;  3H7P B;  4IC7 B;  4ICV A;  2D2Q A;  4YL8 A;  4HVB A;  1P98 A;  5TR5 A;  2XK5 A;  3QAR A;  2J0K A;  2BGF A;  3A1Q B;  3IBE A;  4TQ1 A;  3WIM A;  2G3Q B;  4PYZ A;  5LXI B;  2CHZ A;  2KMC A;  5D7G A;  3MHS D;  4JQW C;  1GNU A;  3ENE A;  3QQ8 B;  3WAO A;  2DHZ A;  3PGE A;  1WZ0 A;  2KDF B;  3Q3J A;  4MGZ E;  3QK0 A;  2KDI A;  3IG3 A;  1EF5 A;  1EUV B;  2ASQ A;  2MLB A;  3V6E B;  4DHZ B;  3V6C B;  5D6J B;  4CYE A;  2LVO A;  2V4L A;  2K8B A;  3X23 A;  4BKT A;  2JF5 A;  4ZYN A;  4P7I A;  4W9K A;  4W9L A;  4FUL A;  1PQS A;  3OAW A;  4HDQ A;  2Y5B B;  1E8X A;  4B9K A;  4II3 B;  1WM2 A;  4E74 A;  1WE6 A;  2M8S A;  4JGH B;  2NBW B;  4DDG D;  3IHP C;  4EFO A;  1BT0 A;  4GDL B;  5C23 A;  3ML8 A;  2KKC A;  2ZEQ A;  1WF9 A;  1WX8 A;  4HPL B;  4EZK A;  2G4D B;  2N7D A;  2O6V B;  4FHJ A;  4FAD A;  3VUX A;  3TMP B;  4PYU A;  3W1S C;  3JW0 X;  1KOT A;  3DBL I;  4LDT D;  3H7P A;  1IPG A;  1WMH B;  4CO7 A;  4DHJ D;  1I42 A;  2AEH A;  2N7E A;  2LJ5 A;  4MEM A;  3TIX A;  5KHO A;  2JPH A;  2KZR A;  4WJO A;  4EUT A;  1LM8 B;  3OJ3 A;  4IUM B;  3AU5 A;  4XC2 A;  1E90 A;  2FUH B;  3A9J B;  3L13 A;  3W1S A;  3WAM A;  3N30 A;  1E7U A;  5EDS A;  2G45 B;  2KO3 A;  1Y8R C;  2IO1 B;  4A3P A;  2DZI A;  3L08 A;  4OVV A;  4ZRI A;  4A20 A;  2RD0 A;  4B6W A;  3V60 A;  2N1V A;  4GSW A;  3PRZ A;  3ZNZ B;  2AWT A;  4ANV A;  1GJZ A;  2LXA A;  4G0N B;  1NDD A;  4W9G A;  3QHT A;  2W9N A;  5AZF A;  3B1L X;  4K7W A;  2O2V B;  4FJV B;  3T8M A;  3ZDT A;  3GOE A;  2KQ7 A;  1TBE A;  5IA7 A;  2KMA A;  3WAL A;  4JIO U;  2DAF A;  4NY0 A;  5C1Z A;  2A5U A;  2J7Q B;  3KUD B;  5E6O A;  1GC7 A;  4K7U A;  2GBR A;  3EEC A;  3UQB A;  4NJ7 A;  3DVG Y;  3VTV A;  1C3T A;  1Z2M A;  2JT4 B;  4JLC A;  3DVN U;  3V62 A;  1AAR A;  2QHO A;  3QJZ A;  3ZVV A;  2A4Z A;  2XK5 B;  1G6J A;  2UYZ B;  5G55 A;  5CTR C;  3HK0 A;  4MM3 A;  1ZW7 A;  3EC8 A;  3PTF C;  4IM2 A;  2UWQ A;  4W9C A;  4WWP A;  3M62 B;  3DBR I;  3K9O B;  3Q3F A;  2IBI B;  2GBM A;  5BO4 B;  1XQQ A;  4HXD A;  3NY5 A;  4GGQ A;  4J6I A;  5JHB A;  3L17 A;  4LJP B;  5DPT A;  2CS4 A;  2KLG A;  3A9J A;  3H7S A;  3VTU A;  2K8H A;  2ZJD A;  4BFR A;  2N9E B;  3AU4 A;  4W9H A;  3HM3 A;  2NS5 A;  2KNB A;  2V1Y A;  2KJH B;  3ZLZ A;  2CHX A;  3RUL A;  3R3M A;  1SGH A;  2VRR B;  2KK8 A;  2YVC A;  4G11 A;  3H1U A;  1M94 A;  3L0W B;  4KSL C;  3OJ4 B;  2MA9 B;  3KVF B;  1OEY J;  2BKF A;  3TCA A;  2K6Q A;  3ZNI D;  2C5L C;  2MBB B;  2KHW B;  1WXA A;  1WR1 A;  4G3X B;  4KZ0 A;  3EHV A;  3MTN B;  2KC1 A;  3BY4 B;  2R2Q A;  2XEW A;  4W9D A;  3ZTC A;  1EO6 A;  4MDK E;  3L10 B;  4JL9 A;  2ZCB A;  3PS6 A;  3ZIM A;  4M8N A;  3CST A;  4WJN A;  2FID A;  1A5R A;  2MP2 B;  2NCN A;  1WFY A;  3QA8 A;  4CHK A;  1WJ6 A;  2D11 A;  5L95 C;  2C7N B;  4HWI B;  4IM0 A;  5J2R A;  5KHQ A;  2DZJ A;  1XT9 B;  3IFW B;  3PLV A;  3B0A A;  4BKS D;  4KDI C;  4GXB A;  2KFK B;  2K25 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...