1WM4A

Solution structure of mouse coactosin, an actin filament binding protein
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
142
structure length
142
Chain Sequence
MATKIDKEACRAAYNLVRDDGSAVIWVTFRYDGATIVPGDQGADYQHFIQQCTDDVRLFAFVRFTTGDAMSKRSKFALITWIGEDVSGLQRAKTGTDKTLVKEVVQNFAKEFVISDRKELEEDFIRSELKKAGGANYDAQSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of coactosin reveals structural homology to ADF/cofilin family proteins
pubmed doi rcsb
source organism Mus musculus
molecule tags Protein binding
molecule keywords Coactosin-like protein
total genus 26
structure length 142
sequence length 142
ec nomenclature
pdb deposition date 2004-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00241 Cofilin_ADF Cofilin/tropomyosin-type actin-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.20.10 Alpha Beta 3-Layer(aba) Sandwich Severin Severin 1wm4A00
1KCQA 2MP4A 1NMDG 1M2VA 4JD2H 5FAEA 5KYXB 1V6FA 4KEFA 2I2QA 5DD2A 1VFQA 2XFAA 1CNUA 2LXXA 1X67A 1AHQA 1T44G 4Z94G 1D4XG 3EH1A 1D0NA 2D8BA 1P8ZG 3CJBG 2MOTA 2VIKA 3A5LS 3EGXB 3L50A 1M2VB 1TMWA 2LLFA 2FH3A 1T3YA 1Q8XA 2VACA 4PKHB 1JHWA 1WFSA 1NLVG 1F7SA 5KYWB 3FG7A 3CJCG 4CBUG 2L72A 3FG6A 3CI5G 2NUTB 1H1VG 3EGDB 5KYXA 1J72A 1PD1A 1YAGG 2NUPB 1WNJA 1T2LA 2KVKA 3A5NS 2FH1A 1VKKA 3FFKA 3A5OS 5KYWA 3EGDA 4KEDA 1C0FS 3Q2BA 5KYNA 1ESVS 3EG9B 2NUTA 2FF3A 1NM1G 1SVQA 4PKGG 1QPVA 2XF1A 1UDMA 4BEX1 5HVKD 5IVUA 1T3XA 4S10C 1NPHA 4PKIG 1PCXA 3A5MS 3EFOB 5KYUB 2QTVA 2NUPA 2FGHA 5KYYA 2FH2A 5A1MA 5HVKB 3EG9A 1Q8GA 4CBXG 5KYUA 2FF6G 2FH4A 2LJ8A 5L6WC 2HD7A 1HQZ1 3DAWB 1M4JA 3EGXA 1PD0A 1YVNG 1M2OA 5FAFA 1SVYA 1EQYS 2W0IA 1MDUA 1P8XA 4LIZA 1RGIG 1TVJA 2MV2A 1COFA 3CIPG 1DEJS 4CBWG 3EH2A 1WM4A 3FFNA 4KEEA 1CFYA 5KYYB 1AK6A 1C0GS 1SVRA 1AK7A 3TU5B 3EFOA 2VILA
chains in the Genus database with same CATH superfamily
1KCQA 2MP4A 1NMDG 1M2VA 4JD2H 5FAEA 5KYXB 1V6FA 4KEFA 2I2QA 5DD2A 1VFQA 2XFAA 1CNUA 2LXXA 1X67A 1AHQA 1T44G 4Z94G 1D4XG 3EH1A 1D0NA 2D8BA 1P8ZG 3CJBG 2MOTA 2VIKA 3A5LS 3EGXB 3L50A 1M2VB 1TMWA 2LLFA 2FH3A 1T3YA 1Q8XA 2VACA 4PKHB 1JHWA 1WFSA 1NLVG 1F7SA 5KYWB 3FG7A 3CJCG 4CBUG 2L72A 3FG6A 3CI5G 2NUTB 1H1VG 3EGDB 5KYXA 1J72A 1PD1A 1YAGG 2NUPB 1WNJA 3DA7A 1T2LA 2KVKA 3A5NS 2FH1A 1VKKA 3FFKA 3A5OS 5KYWA 3EGDA 4KEDA 1C0FS 3Q2BA 5KYNA 1ESVS 3EG9B 2NUTA 2FF3A 1NM1G 1SVQA 4PKGG 1QPVA 2XF1A 1UDMA 4BEX1 5HVKD 5IVUA 1T3XA 4S10C 1NPHA 4PKIG 1PCXA 3A5MS 3EFOB 5KYUB 2QTVA 2NUPA 2FGHA 5KYYA 2FH2A 5A1MA 5HVKB 3EG9A 1Q8GA 4CBXG 5KYUA 2FF6G 2FH4A 2LJ8A 5L6WC 2HD7A 1HQZ1 3DAWB 1M4JA 3EGXA 1PD0A 1YVNG 1M2OA 5FAFA 1SVYA 1EQYS 2W0IA 1MDUA 1P8XA 4LIZA 1RGIG 1TVJA 2MV2A 1COFA 3CIPG 1DEJS 4CBWG 3EH2A 1WM4A 3FFNA 4KEEA 1CFYA 5KYYB 1AK6A 1C0GS 1SVRA 1AK7A 3TU5B 3EFOA 2VILA
chains in the Genus database with same CATH topology
1KCQA 2MP4A 1NMDG 1M2VA 4JD2H 5FAEA 5KYXB 1V6FA 4KEFA 2I2QA 5DD2A 1VFQA 2XFAA 1CNUA 2LXXA 1X67A 1AHQA 1T44G 4Z94G 1D4XG 3EH1A 1D0NA 2D8BA 1P8ZG 3CJBG 2MOTA 2VIKA 3A5LS 3EGXB 3L50A 1M2VB 1TMWA 2LLFA 2FH3A 1T3YA 1Q8XA 2VACA 4PKHB 1JHWA 1WFSA 1NLVG 1F7SA 5KYWB 3FG7A 3CJCG 4CBUG 2L72A 3FG6A 3CI5G 2NUTB 1H1VG 3EGDB 5KYXA 1J72A 1PD1A 1YAGG 2NUPB 1WNJA 3DA7A 1T2LA 2KVKA 3A5NS 2FH1A 1VKKA 3FFKA 3A5OS 5KYWA 3EGDA 4KEDA 1C0FS 3Q2BA 5KYNA 1ESVS 3EG9B 2NUTA 2FF3A 1NM1G 1SVQA 4PKGG 1QPVA 2XF1A 1UDMA 4BEX1 5HVKD 5IVUA 1T3XA 4S10C 1NPHA 4PKIG 1PCXA 3A5MS 3EFOB 5KYUB 2QTVA 2NUPA 2FGHA 5KYYA 2FH2A 5A1MA 5HVKB 3EG9A 1Q8GA 4CBXG 5KYUA 2FF6G 2FH4A 2LJ8A 5L6WC 2HD7A 1HQZ1 3DAWB 1M4JA 3EGXA 1PD0A 1YVNG 1M2OA 5FAFA 1SVYA 1EQYS 2W0IA 1MDUA 1P8XA 4LIZA 1RGIG 1TVJA 2MV2A 1COFA 3CIPG 1DEJS 4CBWG 3EH2A 1WM4A 3FFNA 4KEEA 1CFYA 5KYYB 1AK6A 1C0GS 1SVRA 1AK7A 3TU5B 3EFOA 2VILA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KCQ A;  2MP4 A;  1NMD G;  1M2V A;  4JD2 H;  5FAE A;  5KYX B;  1V6F A;  4KEF A;  2I2Q A;  5DD2 A;  1VFQ A;  2XFA A;  1CNU A;  2LXX A;  1X67 A;  1AHQ A;  1T44 G;  4Z94 G;  1D4X G;  3EH1 A;  1D0N A;  2D8B A;  1P8Z G;  3CJB G;  2MOT A;  2VIK A;  3A5L S;  3EGX B;  3L50 A;  1M2V B;  1TMW A;  2LLF A;  2FH3 A;  1T3Y A;  1Q8X A;  2VAC A;  4PKH B;  1JHW A;  1WFS A;  1NLV G;  1F7S A;  5KYW B;  3FG7 A;  3CJC G;  4CBU G;  2L72 A;  3FG6 A;  3CI5 G;  2NUT B;  1H1V G;  3EGD B;  5KYX A;  1J72 A;  1PD1 A;  1YAG G;  2NUP B;  1WNJ A;  1T2L A;  2KVK A;  3A5N S;  2FH1 A;  1VKK A;  3FFK A;  3A5O S;  5KYW A;  3EGD A;  4KED A;  1C0F S;  3Q2B A;  5KYN A;  1ESV S;  3EG9 B;  2NUT A;  2FF3 A;  1NM1 G;  1SVQ A;  4PKG G;  1QPV A;  2XF1 A;  1UDM A;  4BEX 1;  5HVK D;  5IVU A;  1T3X A;  4S10 C;  1NPH A;  4PKI G;  1PCX A;  3A5M S;  3EFO B;  5KYU B;  2QTV A;  2NUP A;  2FGH A;  5KYY A;  2FH2 A;  5A1M A;  5HVK B;  3EG9 A;  1Q8G A;  4CBX G;  5KYU A;  2FF6 G;  2FH4 A;  2LJ8 A;  5L6W C;  2HD7 A;  1HQZ 1;  3DAW B;  1M4J A;  3EGX A;  1PD0 A;  1YVN G;  1M2O A;  5FAF A;  1SVY A;  1EQY S;  2W0I A;  1MDU A;  1P8X A;  4LIZ A;  1RGI G;  1TVJ A;  2MV2 A;  1COF A;  3CIP G;  1DEJ S;  4CBW G;  3EH2 A;  1WM4 A;  3FFN A;  4KEE A;  1CFY A;  5KYY B;  1AK6 A;  1C0G S;  1SVR A;  1AK7 A;  3TU5 B;  3EFO A;  2VIL A; 
#chains in the Genus database with same CATH topology
 1KCQ A;  2MP4 A;  1NMD G;  1M2V A;  4JD2 H;  5FAE A;  5KYX B;  1V6F A;  4KEF A;  2I2Q A;  5DD2 A;  1VFQ A;  2XFA A;  1CNU A;  2LXX A;  1X67 A;  1AHQ A;  1T44 G;  4Z94 G;  1D4X G;  3EH1 A;  1D0N A;  2D8B A;  1P8Z G;  3CJB G;  2MOT A;  2VIK A;  3A5L S;  3EGX B;  3L50 A;  1M2V B;  1TMW A;  2LLF A;  2FH3 A;  1T3Y A;  1Q8X A;  2VAC A;  4PKH B;  1JHW A;  1WFS A;  1NLV G;  1F7S A;  5KYW B;  3FG7 A;  3CJC G;  4CBU G;  2L72 A;  3FG6 A;  3CI5 G;  2NUT B;  1H1V G;  3EGD B;  5KYX A;  1J72 A;  1PD1 A;  1YAG G;  2NUP B;  1WNJ A;  3DA7 A;  1T2L A;  2KVK A;  3A5N S;  2FH1 A;  1VKK A;  3FFK A;  3A5O S;  5KYW A;  3EGD A;  4KED A;  1C0F S;  3Q2B A;  5KYN A;  1ESV S;  3EG9 B;  2NUT A;  2FF3 A;  1NM1 G;  1SVQ A;  4PKG G;  1QPV A;  2XF1 A;  1UDM A;  4BEX 1;  5HVK D;  5IVU A;  1T3X A;  4S10 C;  1NPH A;  4PKI G;  1PCX A;  3A5M S;  3EFO B;  5KYU B;  2QTV A;  2NUP A;  2FGH A;  5KYY A;  2FH2 A;  5A1M A;  5HVK B;  3EG9 A;  1Q8G A;  4CBX G;  5KYU A;  2FF6 G;  2FH4 A;  2LJ8 A;  5L6W C;  2HD7 A;  1HQZ 1;  3DAW B;  1M4J A;  3EGX A;  1PD0 A;  1YVN G;  1M2O A;  5FAF A;  1SVY A;  1EQY S;  2W0I A;  1MDU A;  1P8X A;  4LIZ A;  1RGI G;  1TVJ A;  2MV2 A;  1COF A;  3CIP G;  1DEJ S;  4CBW G;  3EH2 A;  1WM4 A;  3FFN A;  4KEE A;  1CFY A;  5KYY B;  1AK6 A;  1C0G S;  1SVR A;  1AK7 A;  3TU5 B;  3EFO A;  2VIL A; 
#chains in the Genus database with same CATH homology
 1KCQ A;  2MP4 A;  1NMD G;  1M2V A;  4JD2 H;  5FAE A;  5KYX B;  1V6F A;  4KEF A;  2I2Q A;  5DD2 A;  1VFQ A;  2XFA A;  1CNU A;  2LXX A;  1X67 A;  1AHQ A;  1T44 G;  4Z94 G;  1D4X G;  3EH1 A;  1D0N A;  2D8B A;  1P8Z G;  3CJB G;  2MOT A;  2VIK A;  3A5L S;  3EGX B;  3L50 A;  1M2V B;  1TMW A;  2LLF A;  2FH3 A;  1T3Y A;  1Q8X A;  2VAC A;  4PKH B;  1JHW A;  1WFS A;  1NLV G;  1F7S A;  5KYW B;  3FG7 A;  3CJC G;  4CBU G;  2L72 A;  3FG6 A;  3CI5 G;  2NUT B;  1H1V G;  3EGD B;  5KYX A;  1J72 A;  1PD1 A;  1YAG G;  2NUP B;  1WNJ A;  3DA7 A;  1T2L A;  2KVK A;  3A5N S;  2FH1 A;  1VKK A;  3FFK A;  3A5O S;  5KYW A;  3EGD A;  4KED A;  1C0F S;  3Q2B A;  5KYN A;  1ESV S;  3EG9 B;  2NUT A;  2FF3 A;  1NM1 G;  1SVQ A;  4PKG G;  1QPV A;  2XF1 A;  1UDM A;  4BEX 1;  5HVK D;  5IVU A;  1T3X A;  4S10 C;  1NPH A;  4PKI G;  1PCX A;  3A5M S;  3EFO B;  5KYU B;  2QTV A;  2NUP A;  2FGH A;  5KYY A;  2FH2 A;  5A1M A;  5HVK B;  3EG9 A;  1Q8G A;  4CBX G;  5KYU A;  2FF6 G;  2FH4 A;  2LJ8 A;  5L6W C;  2HD7 A;  1HQZ 1;  3DAW B;  1M4J A;  3EGX A;  1PD0 A;  1YVN G;  1M2O A;  5FAF A;  1SVY A;  1EQY S;  2W0I A;  1MDU A;  1P8X A;  4LIZ A;  1RGI G;  1TVJ A;  2MV2 A;  1COF A;  3CIP G;  1DEJ S;  4CBW G;  3EH2 A;  1WM4 A;  3FFN A;  4KEE A;  1CFY A;  5KYY B;  1AK6 A;  1C0G S;  1SVR A;  1AK7 A;  3TU5 B;  3EFO A;  2VIL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...