1WM5A

Crystal structure of the n-terminal tpr domain (1-203) of p67phox
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
207
structure length
205
Chain Sequence
AMGSMSLVEAISLWNEGVLAADKKDWKGALDAFSAVQDPHSRICFNIGCMYTILKNMTEAEKAFTRSINRDKHLAVAYFQRGMLYYQTEKYDLAIKDLKEALIQLRGNQLIDYKILGLQFKLFACEVLYNIAFMYAKKEEWKKAEEQLALATSMKSEPRHSKIDKAMECVWKQKLYEPVVIPVGKLFRPNERQVAQLKDYLGKAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the N-terminal TPR domain (1-203) of p67phox
rcsb
source organism Homo sapiens
molecule tags Hormone/growth factor
molecule keywords Neutrophil cytosol factor 2
total genus 75
structure length 205
sequence length 207
ec nomenclature
pdb deposition date 2004-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13181 TPR_8 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 1wm5A00
1KT1A 2XCCA 4N2QA 1NA0A 4GZ5A 3AS4A 2P58C 5D0QD 2IF4A 3VTYA 5JJ6A 2L6JA 1ELRA 4J8DA 3Q15A 2KATA 3OXFA 4UI9C 5KJLA 2FF4A 2HO1A 4I2ZA 2I6HA 4Y6WA 2FEZA 4N39A 4BTBA 3AS5A 2UWJG 3KAEA 5CCLA 4RG6A 2JLBA 2VGXA 4JA7A 4B94A 3EDTB 2WQHA 3ASGA 2UY1A 5FZQA 4JL0A 5LCWJ 5G04J 3LYAA 5EX0A 4J0UA 4N3BA 3PDNA 1A17A 2WPVA 2XEVA 4I17A 2Y4TA 4U07A 3OXLA 3RKVA 1FCHA 3CK7A 3FFLA 3PE4A 4GCOA 3RIBA 5A6CA 2GW1A 5KJNA 1IYGA 1TJCA 4NQ0A 3IEGA 1KLXA 4WUYA 3QWPA 4G24A 2LSUA 4GZ6A 3QKYA 5C1DA 2XGSA 4BWRA 5JJ7A 5HI7A 2C0MA 3LY9A 3CKCA 3S7JA 3GW4A 3FP3A 3Q47B 4AY5A 4HOUA 4HOSA 4GYOA 1HH8A 2FO7A 2OOEA 4G1TA 5FZRA 4CDRA 2LSVA 1WM5A 1P5QA 3CV0A 3ASDA 4O6FA 4WNFA 3ZHEA 4H7XA 2V5FA 1QZ2A 4G2VA 2C0LA 3OXGA 1QQEA 3UPVA 3KS2A 3MV2B 4KYOB 5KJKA 1Y8MA 4N3CA 4N3AA 2VQ2A 2XPIA 3Q4AB 3E4BA 2PZIA 3SZ7A 3R9AB 2KCLA 5LCWC 2XGOA 4GPKA 2YQ8A 3ZPJA 3GZ2A 1ZBPA 5AYWD 2VGYA 2FBNA 2PL2A 4AIFA 2YHCA 2Q7FA 4HOQA 3KD7A 3UQ3A 4AM9A 3URZA 3N71A 4U0ZA 1OUVA 2QFCA 3HYMB 3Q5MA 5FT9A 3S7FA 3ZFWA 4A1SA 5DIZA 4APOA 3K9IA 4I9CA 5BNWA 4N2SA 3MEKA 2J9QA 3CKBA 3MA5A 4GYWA 4I9EA 2DBAA 4I2WA 4N5CA 3ULQA 3CK9A 3CVQA 3LKUA 2VSNA 3CVNA 4UI9K 1NA3A 3CVLA 3PE3A 2VGXB 4WNEA 5JJTA 2C2LA 4KXKB 3RJVA 4IN3B 4BT9A 4CGVA 3U4TA 3CVPA 5BW8C 5KJMA 4UQZA 5EKQD 5ARGA 3S7DA 3MV3B 2R5SA 3RO2A 2E2EA 1KT0A 3BEEA 2PQNA 5FZSA 3ASFA 3TAXA 5M72A 3TG4A 3LCAA 3RU0A 5G05J 1PC2A 3FWVA 3CK8A 3ESKA 4G25A 4LEUA 4GZ3A 4J8FA 3TGOA 4GA1A 5A7DB 4ME2A 1IHGA 4YVOA 4EQFA 3RO3A 3UUXA 4U04A 3QDNA 2BUGA 4WNDA 4H7YA 4F3VA 4XI9A 5BT1A 3CEQA 4CGWA 3U3WA 2PQRA 1B89A 1W3BA 2UY1B 4I1AA 5G04C 4ABNA 1XNFA 4RG9A 2MHKA 2KCKA 2KCVA 4HORA 4NRHB 2NC9A 2HYZA 3GZ1A 1NZNA 2KC7A 5G05C 3ZGQA 2IFUA 3TG5A 4BT8A 4AY6A 4UQXA 2AVPA 1ELWA 4XIFA 5DBKA 4UI9J 5CCMA 3GYZA 5CHEE 1HZ4A 3WXXA 2FI7A 4UQYA 4KBQA 4BTAA 4YVQC 2XCBA 5HQ8A 4U0UA 4HOTA 3JYSA 5EX3A 5FJYA 1HXIA 4JA9A 1ZU2A 2HR2A 1E96B 3MKRA 3NF1A 3LY8A 1WAO1 4J8EA 4U0SA 4WNGA 5ARFA 3Q49B 4Y6CA 3ZHEB 2LNIA 3VTXA 2VSYA 3S7BA 3SF4A 3LPZA 2ONDA 4YNDA 3O48A 4GYYA 4W9RA 4XI0A 3QWVA 3QWWA 3ASHA 2Y4UA 1YA0A 2VYIA 3AS8A 3QOUA 4G23A 3ZN3A 4GCNA 4G26A 5D0OD 3LY7A 4GA0A 4JHRA 4GA2A 5FTPA 2XGMA
chains in the Genus database with same CATH superfamily
1UJKA 3LJNA 3E33A 1JWGA 5JJ6A 4I2ZA 1JCRA 1AP7A 4ILGA 2WQHA 5FZQA 1A17A 1VDYA 3NAWA 4P29A 3FUKA 3TWUA 2QY7A 4TXQA 1K1BA 3IEGA 1KLXA 3DSTA 4L9PA 2GROB 3KSQA 1JUQA 3FDHA 4WNFA 3CHOA 5B3SE 3NOCD 1U3DA 4MRUA 2CHXA 5BV1A 5KNGA 3UKUG 1AWCB 3EIQC 4TXRA 1A5EA 3KD7A 3D9IA 2R17C 1OUVA 2CFUA 4CT4A 2P9SG 4N2SA 2DCPA 3G2SA 4JZYA 4J8YA 4U8VD 3CLJA 3D9KA 1NA3A 3FUDA 4IN3B 3S7DA 3E30A 5IY5E 3W9GA 5M72A 1HG5A 1MX4A 3CK8A 3TGOA 2H6FA 4ME2A 1TNUA 5FQ8A 3CVYA 5T3RA 2H6GA 4ABNA 3TXNA 3DPDA 1NI1A 4HORA 1K3ZD 2KC7A 3D9PA 3HDXA 3PZ4A 4KZCA 3B7RL 3PZ3A 5AJLA 2LXMA 4RQIA 1WAO1 4K03A 3LPZA 3LVQE 1YCSB 4C0EA 3LY7A 4I2WA 4UWGA 2XCCA 2XRZA 3FEXA 3S2AA 5CCLA 2EIJE 4LNGA 2WPVA 3OXLA 3APCA 3BQOA 1IYGA 2GW1A 4WWOA 4FU3A 4GTTA 3PEVB 3DBSA 2XGSA 3D9JA 3FU3A 4HNAD 4K0RA 3FP3A 4DRXE 1Z5SC 1P5QA 2X6FA 4F1PA 3PVLA 1QZ2A 4G2VA 3L22A 4PDXA 3VLDA 3MX3A 2DZOA 4BETA 1LTXA 2VGYA 4FHJA 2A5UA 3TWRA 4FADA 3ZFWA 3K9IA 3BG1B 3CKBA 3MA5A 4K5AB 3LKUA 4HB5A 2XZTG 3U4TA 3AAAC 2ZGDA 1NFIE 2E2EA 5BXOA 1KT0A 3TAXA 3CQCB 3TG4A 4U95D 4OVVA 4GA1A 4U04A 5BT1A 1OT8A 1B89A 3Q7AA 4HQDA 4RG9A 2LUHA 2KCVA 2WXLA 1MQSA 5DBKA 5CHEE 1H2TC 2JEKA 4FJYA 3ASOE 4U8YD 3UI2A 5ARFA 2LXLA 3EHMA 3UM0A 4C0MA 1S70B 2AXUA 3ULEG 3ASHA 4FULA 3ZN3A 1OWOA 4GZ5A 4GMLA 2LAIA 1H19A 3FHEA 1FVHA 2IU1A 4N39A 1LD7A 5HRYA 5AIJA 1HS6A 4J0UA 3RKVA 2BKGA 2DZNA 4G8KA 3S7JA 4CZ2D 2AW6A 5CEAA 2CG3A 1TN7A 2E0IA 2C0LA 1SZ9A 3KS2A 4IYPA 2PZIA 3B95A 2A5EA 1KZPA 5BPPA 2XENA 3QAQA 4BESA 2WXHA 5BXUA 1EYHA 3ONLA 2IO2C 2R5SA 5ITZF 3ASFA 3UT4A 4OAUC 5T4YA 4DLOA 5G05J 1E7VA 4F7AA 3ABLE 4M7CA 4MLPA 2Y3AA 3U9WA 4NACA 3ZXPA 3JUEA 4G11A 1XNFA 5G04C 4RVBA 3TG5A 4C48B 2P9IG 1OY3D 1X5BA 3MCXA 3KEZA 1HZ4A 4YVQC 4ACLA 3FUMA 2XS1A 4ATZD 4JHJA 4GTRA 2VSXE 4DK5A 1KPSB 1N4QA 5AENA 1YA0A 4DX1A 4UQZA 3EHRA 1O1RA 3RAUA 4XEIG 3CVXA 5AAOA 2R02A 3AG2E 3ASGA 5G04J 3GZSA 3PREA 2XQ0A 1TN6A 4I43A 3FFLA 3PE4A 2BF0X 3AJIA 2ZGGA 5LX8A 3ZXSA 5JJ7A 3GW4A 4A55A 2A4ZA 4HOSA 2YHEA 3JCKC 3Q9UC 5KJKA 2NYJA 2AXVA 2YINA 5FQ6A 3UQ3A 3URZA 3MKQA 1HO8A 3DSVA 3TL5A 2QYJA 3LS8A 5FQ4A 4HFGA 5D66A 3FU6A 1K8KG 2FULA 4IULA 2KBXA 3EHNA 1SA4A 4L1BA 2DYRE 3R9MA 1IHGA 2J07A 3PEUB 4F3VA 4I1AA 3T8MA 4EBAA 4NIKA 1UJJA 3T5VA 2EINE 3TJPA 4UQYA 1BI7B 1FPPA 3LXUX 3FTSA 3UX4A 3MKRA 4KZ0A 2NSZA 1H6OA 4B8AA 3MJWA 2ONDA 2GRPB 3QWWA 4GCNA 4J7WA 4JHRA 5FTPA 4HVBA 2KATA 3OXFA 3B7SA 1KZOA 3R7QA 3PZ2A 4DUIA 3ZIMA 4RG6A 3PUJA 5JHAA 4GZCA 4B93B 3ZYLA 5EN5D 5A6CA 4LNBA 3HG0D 1OCZE 3RK6A 4U7EB 1O1SA 3DSWA 5HI7A 3Q47B 3L17A 4IRUA 4U8HA 4GTOA 3L08A 4AJWA 3FEYA 2ILRA 4N3AA 2P9KG 4ANVA 4GTQA 1YYHA 4N5QA 3N71A 2IQCA 3HYMB 3Q5MA 3AU5A 4V3IA 2VSNA 4WNEA 4BSXA 2R05A 5KJMA 4FP7A 3FTYA 3G2VA 2NXPA 3TWSA 3NB2A 3L9TA 1ZB1A 2UY1B 3TWWA 4DI4A 2HYZA 4GB9A 5A23A 3JQ1A 3QJZA 2X6KA 3CVUA 1V55E 3L82A 3GYZA 5CMYA 3EUVA 4UWKA 3Q49B 4Y6CA 3SGHA 3DWLG 1JCQA 4GA2A 3CR3A 1MX2A 1N4PA 2IF4A 3MZLB 4FC8A 2WQ7A 2HO1A 4Y6WA 3TWXA 2VGXA 3FUJA 3EDTB 3LJ3A 3SBSA 3OTNA 5H7PA 1N11A 2BKKB 1WM5A 4H7XA 4AVXA 3SQVA 3OXGA 3EHQA 2KZTB 2VQ2A 2WB2A 4YDWA 3FUIA 4APOA 5FT9A 1SZAA 5T8IA 1IQUA 3IXEA 1IHBA 5ARGA 1TJFA 2PQNA 2XZDG 5FZSA 2I2OA 3LCAA 2HE0A 3ZKJA 4HI8A 4JEUA 4YVOA 1QYMA 5G2NA 2GRQB 3DXKG 4WAFA 3TWTA 2H6HA 4BX8A 4UQXA 2AVPA 5EYPF 3NZUA 1HF8A 5CERB 2XCBA 2F0YA 5AQBA 1E7UA 2AWIA 2BTDA 3LY8A 4J8EA 4PS8A 3T5XA 4HLEA 2VSYA 4TUMA 1HFAA 5D0QD 2CHWA 3D9LA 3DSXA 3ML8A 5ENTD 3DPYA 3X2QE 4B94A 1SVXA 3J5PA 3ZVVA 3QK0A 1E8YA 1OWLA 5C1DA 4BWRA 4HOUA 5AQ9A 2FO7A 3B7BA 4EHMA 3MV2B 1QNFA 5LCWC 3R9AB 3NOGD 3MGBA 3ZPJA 3GZ2A 1Q2ZA 4AXHA 4LUNU 5CRVA 4URKA 3C72A 2XS8A 2IOLA 4M3OA 1D8DA 5EKQD 1U3CA 2IO3C 3ENEA 5EYLA 5J90A 2F8YA 3PH0C 3LVRE 4I1MA 4C9BB 4H7YA 1HU3A 5AN8A 2PQRA 1X81A 3Q78A 3FH8A 2Y0BG 1HX8A 2RFAA 3Q75A 3NBNB 5JHBA 2GRMA 5AJDA 4FA6A 5HQ8A 4AP2A 1UG3A 5EX3A 4JA9A 2X6JA 4L2YA 1RW2A 4HRMB 5LOZA 1O5MA 2CHZA 4JHKA 1G3NB 2UWJG 4R7LA 3KAEA 3APDA 3TXMA 3D9MA 4X8QA 5LCWJ 3PDNA 3TWQA 2GGFA 4CRWA 2I9CA 2RKKA 1NP7A 1TEZA 3VLEA 4UWFA 2OOEA 3RRNB 2LSVA 3CV0A 2VJ8A 3R7RA 1IXVA 3UPVA 3IBEA 4A3VA 2IY0C 2YQ8A 3CIAA 5CEDB 1EPUA 3KSLA 4XZ4A 5G55A 5C2YA 5DIZA 3AG3E 4I9EA 5BV0A 1OWMA 4ZFHA 3C5RA 2C2LA 2WMNA 4KXKB 4CGVA 1GW6A 3DXMG 2IONA 5EIBE 4WWPA 1N94A 2WXQA 4E6HA 3UUXA 4HI9A 5KCMA 4GMRA 5JA4D 2WXMA 2P9PG 2J4BA 4HS2A 1DC2A 5ANRA 3IHVA 4UI9J 3I4RB 5ENPD 4HOTA 4APFA 1OXJA 2ZIRA 4DX2A 3S7BA 1HE8A 2WXPA 5E76A 2XHEA 1IQRA 4N2QA 1N95A 4J8DA 5KJLA 2FF4A 4LG6A 4EZJA 3APFA 4Z68A 3BUAA 5EX0A 3C3QA 4XX5A 3E34A 4WUYA 1WG0A 3CHRA 3SBTB 3ZEFA 3CKCA 2XRYA 4JB8P 4JPSA 5FZRA 2IEJA 4HRLA 2V5FA 2J08A 2ZISA 4A1GA 2XPYA 1NL4A 2XPIA 3PNLB 4LERA 1MX6A 1BI8B 3ZNGA 3IHYA 2V5QC 5FINA 3UMVA 2WMOA 4N5CA 4D10C 2P2CP 4UI9K 3CVLA 3RJVA 3CVPA 5BW8C 3QARA 2M63A 3U66A 3B13A 3C98A 3V2OA 3RU0A 1H2UA 5JMND 3CQGB 1V54E 2J8SD 3RO3A 2PM7A 3PZ1A 4WNDA 1YMPA 3FH7A 3W9FA 2RG8A 4AY6A 1QBQA 5AQAA 2KM4A 2LAHA 4ACKA 3LEWA 2P9NG 3WG7E 1TN8A 2HR2A 4LSZE 3UINC 3F6QA 1N0QA 4CDMA 4G23A 2IOSA 5ENNA 1NA0A 1WDYA 2MYOA 3SHFA 3Q15A 4E85A 3AS5A 3VLFA 2UY1A 4OYSA 2R2LA 4U07A 3RIBA 4EPZA 4FJZA 3MYVA 3EU9A 5KWDA 1JCSA 1JPLA 3HXBA 2OCCE 2X6IA 2R03A 4DLQA 4KVOA 3Q4AB 3SZ7A 3ZYKA 2WXJA 2FBNA 1D8EA 1N54A 5CMWA 4K5CA 4BT9A 1SW6A 3ZYQA 1U2VG 4PS7A 1DNPA 1E90A 4GMJA 3P2BA 3RO2A 4ILIA 4JW1A 3BEEA 5KBAA 4DX7D 3CSTA 3FWVA 3ESKA 1UOHA 5A7DB 1JWFA 5J08A 4J8SA 4CGWA 1TNOA 5FWQA 3AG4E 3CSFA 1N52A 3UIOC 4BEPA 2RD0A 5CCMA 3I3NA 2XEEA 4JC8A 4KBQA 2ZU6B 4DI3A 4NURA 3FU5A 2CG2A 2LNIA 5ENRD 1N4RA 3ZU7B 2I1JA 4XI0A 3QWVA 2X38A 4G26A 1KT1A 2L6JA 1ELRA 4UI9C 4U96D 3CHPA 1OWPA 1UN8A 2GRNB 3UM1A 2L0TB 1BU9A 2OEWA 3C3RA 4JL0A 4XKCA 3RRMB 2OEVA 4J6IA 3G2TA 5KJNA 1S63A 2LO6A 2WXGA 4GZ6A 3QKYA 3LY9A 4GYOA 2I1KA 3FY4A 4L2LA 5B1BE 3I4GA 2B6CA 2CFZA 3P1UA 1ZBPA 4ILHB 1RZ4A 4UUCA 4A1SA 1L5JA 4GTMA 2XPZA 4F1SA 3D9HA 3CGHA 5CRUA 3L16A 4HBDA 3MV3B 4ZHBA 3RRUA 4O1OA 2ETCA 1N4SA 1ELKA 3JUIA 4BX9A 4NRHB 1NZNA 4AOFA 3PUKA 4MKTA 1LF8A 3MKQB 3JQ0A 4TXPA 3T8KA 4TV3A 3V30A 3SI5A 4YNDA 4EQFA 3ASNE 4GA0A 3ISMC 4DPRA 2J09A 4MS6A 3E32A 4AEZC 4G8LA 2I6HA 2V8SE 1BPOA 4BTBA 4MBGA 2HM8A 2JLBA 5EILA 4EBAG 3UIPC 1EDUA 4GCOA 1DCQA 1TJCA 4YDYA 5ENOD 2WXIA 3HIZA 4G1TA 4RSYA 2VTBA 1MHQA 4N3CA 2KCLA 5AARA 4AM9A 4FLBA 4HRNA 3PZDA 3MEKA 2J9QA 4HLLA 3UTMA 4I6EA 3PE3A 4ANXA 3SFXA 1E8ZA 3Q73A 3FTWA 2GRLA 2VGEA 4TRQA 1XGWA 1PY1A 2EIKE 3NZSA 3CEQA 3U3WA 1TYQG 3T9KA 2MHKA 4B0ZA 2ETBA 2NC9A 1H2VC 3FUNA 2DIWA 2ZXWE 1H6PA 3ABME 1MYOA 1S0PA 3DRAA 4XKBA 4ANWA 2MRIA 4YDOA 4PS3A 2VTBB 2R59A 1BD8A 2WVIA 4BY6A 3VTXA 4O1PA 3UM3A 2J49A 1BLXB 4U63A 3ESLA 3AS4A 3FULA 3VTYA 3ONKA 3IV0A 3HVEB 2FEZA 3ML9A 4A63B 4A3TA 3SFZA 4N3BA 1OCCE 2XEVA 2FO1E 3QC1A 4G24A 2JABA 3SFYA 1HH8A 3O4ZA 3CHSA 3UXGA 2F37A 3ASDA 5HS0A 3ZHEA 3I5PA 2X3MA 3HXEA 1Z6TA 3E4BA 2Y69E 5AYWD 4I6JA 2Q7FA 3TWVA 2WXNA 3S7FA 3HVEA 3G2WA 4PH4B 4I9CA 4Q94A 3ULQA 2DBAA 3ZRHA 1Y6IA 3CVQA 3CVNA 3CHMA 3PS6A 3EIJA 3E37A 1FT1A 3FTUA 1HG2A 3SY2A 3OAWA 3DSUA 2KXPC 2DYSE 4EECA 4G25A 3U64A 4YDEA 4OVUA 2WXRA 5EDSA 3SO8A 1N0RA 2PNNA 3SD5A 3D9OA 4OAVB 2XEHA 1OCOE 1DVPA 4BTAA 2VSOE 4U0UA 4GTVA 3JXJA 3HXFA 1HXIA 2WXKA 1ZU2A 3ZHEB 3HXDA 4PUCA 4EZLA 1OWNA 1E8WA 2EIME 2VYIA 3QB2A 2XGMA 2L0IA 5FQ7A 3AG1E 3BU8A 4CCAA 3UT8A 4CDNA 2QZAA 2L6BA 3L13A 3LDZA 4I17A 1MJ0A 1FCHA 3AU4A 1Z3XA 2LSUA 3V31A 5LFAA 4F6RD 3ZUVB 2H6IA 4KT6B 1D9SA 2AJAA 3HRAA 2PM6A 4Q96A 2EILE 3PRZA 2XGOA 5KNHD 5B1AE 4XE0A 2PL2A 3L54A 2QC9A 4U0ZA 3L6AA 2QFCA 5JJTA 4GZDA 1TR4A 3Q9NC 1H6KA 5ENSD 3EJNA 1UW4B 1FVFA 3QDNA 3PNTB 1H0AA 5EIDA 4XI9A 1W3BA 3DEOA 4GAAA 2KZTA 3GZ1A 4BT8A 2IFUA 3UKRG 1UN9A 4EZKA 2FI7A 3FUHA 5FJYA 3ZW3A 3ZYMA 1OCRE 3O48A 4W9RA 3QOUA 4GTSA 3J5QB 2MOWA 2F8XK 2YNQA 5CECB 3FUEA 4JA7A 3HHMA 1S64A 1FT2A 3LYAA 4CT0A 4L7TA 3CK7A 3KEAA 4NQ0A 1TNYA 2GRRB 3QWPA 2AXZA 2C0MA 4AY5A 3QNKA 3HXCA 1K1AA 4FLHA 4O60A 3RSEG 4GPMA 1WY6A 4KYOB 3IKOB 4Q69A 4GPKA 4RLYA 4HXIA 4DJAA 4DX5D 4LNUD 4AIFA 4HOQA 3FU0A 2WXFA 4GYWA 4JXTA 4B8CB 4WWNA 3CK9A 3JXIA 2DWZA 2VGXB 1E8XA 2Y1LE 2QYUA 5ENQD 4KVMA 1EF1C 1Z3YA 1PC2A 4LEUA 4J8FA 4GTPA 2OV8A 3B7UX 2BUGA 1INZA 4KMOA 3UM2A 1TNZA 2WM9A 3EU5A 4JEHA 3SNXA 2DVWA 2KCKA 1SA5A 3BG0B 3DEPA 1ELWA 4CYMD 3FH5A 3V79K 3JYSA 3CVWA 1E96B 3NF1A 4U0SA 3FUFA 2WQ6A 4CEMA 4F53A 3UT7A 4GU5A 2ETAA 4AV7A 3SF4A 4LRZA 4DX6D 1O1TA 4GYYA 4CDRA 4QQIA 5CBNA 1MZCA 2BEDA 2P58C 2OVFA 5AQ7A 2V0PA 2L9BA 1DCEA 2J4DA 1LD8A 5CBOA 4LCTA 2WXOA 3ABKE 2P9LG 2X6HA 2Y4TA 4UWHA 4ATGA 4BSZB 2RFMA 4FHKA 3FTVA 4JVSA 1TNBA 5BUZA 1IKND 4O6FA 3NQPA 3C3OA 1QQEA 3B7TA 4I6GA 3CHQA 1Y8MA 4B89A 2V4LA 2YHCA 5BNWA 3D9NA 4ANUA 1N9AA 5ANLA 3CVVA 5E75A 5D2MC 5FIOA 4QFVA 4TUUA 4UWLA 3FTZA 2EQXA 4GZ3A 3G2UA 4I1OB 3FTXA 3V2XA 4K5BA 3ZGQA 5HKPA 5G05C 4BERA 2OVBA 3D3MA 2IJGX 4XIFA 4BFRA 1PAQA 3WXXA 3Q7FA 3DSSA 2B0OE 4JD2G 5LP0A 4L23A 3ULYA 4WNGA 1SQMA 2P9UG 2Y4UA 3AS8A 3Q79A 2V4HC 5D0OD
chains in the Genus database with same CATH topology
4U63A 1IQRA 4N2QA 1UJKA 3ESLA 3AS4A 3FULA 4HVBA 1JWGA 3VTYA 3ONKA 3IV0A 3HVEB 4J8DA 5JJ6A 2KATA 3OXFA 5KJLA 2FF4A 4I2ZA 2FEZA 3B7SA 3ML9A 3R7QA 3SFZA 4A3TA 3ZIMA 4RG6A 3PUJA 4ILGA 2WQHA 3APFA 4EZJA 5FZQA 5JHAA 4GZCA 5EX0A 4N3BA 1A17A 2XEVA 1VDYA 4P29A 4XX5A 3FUKA 3ZYLA 2QY7A 5A6CA 3IEGA 1KLXA 4WUYA 3RK6A 3CHRA 3QC1A 4G24A 3SBTB 3ZEFA 5HI7A 3CKCA 1JUQA 2XRYA 3Q47B 3FDHA 3L17A 4IRUA 4JPSA 4U8HA 1HH8A 3O4ZA 5FZRA 3CHSA 3ASDA 4WNFA 3CHOA 3ZHEA 3I5PA 1U3DA 2V5FA 1Z6TA 2X3MA 3L08A 4AJWA 2J08A 4MRUA 3FEYA 4A1GA 2CHXA 2ILRA 2XPYA 4N3AA 3PNLB 2XPIA 5BV1A 3E4BA 4LERA 3EIQC 5AYWD 4I6JA 4ANVA 2Q7FA 3KD7A 3D9IA 2WXNA 3N71A 2R17C 2IQCA 1OUVA 3HYMB 3Q5MA 3S7FA 3HVEA 2CFUA 3AU5A 3G2WA 4PH4B 4I9CA 3IHYA 4Q94A 4V3IA 4CT4A 4N2SA 3UMVA 2WMOA 3ULQA 2DBAA 2DCPA 3G2SA 4N5CA 3ZRHA 1Y6IA 4D10C 3CVQA 4JZYA 2VSNA 3CLJA 3CVNA 1NA3A 3CVLA 3D9KA 3FUDA 4UI9K 4WNEA 4BSXA 3RJVA 4IN3B 3CHMA 3CVPA 5BW8C 4FP7A 5KJMA 3QARA 2M63A 3U66A 3B13A 3PS6A 3S7DA 3EIJA 3FTYA 3FTUA 3C98A 1HG2A 3G2VA 3OAWA 5M72A 3RU0A 1H2UA 1HG5A 2NXPA 3CK8A 4EECA 4G25A 3CQGB 3TGOA 4ME2A 5FQ8A 3U64A 3CVYA 5T3RA 3RO3A 2PM7A 4WNDA 4OVUA 2WXRA 3FH7A 2UY1B 5EDSA 4ABNA 3TXNA 3DPDA 4DI4A 2RG8A 4HORA 2HYZA 3D9PA 2KC7A 4GB9A 3JQ1A 3QJZA 3SD5A 5A23A 2X6KA 4AY6A 3HDXA 3D9OA 3CVUA 4KZCA 3B7RL 3GYZA 5AJLA 2KM4A 1DVPA 4BTAA 2VSOE 2LAHA 4U0UA 4ACKA 3LEWA 5CMYA 1HXIA 2WXKA 4UWKA 1ZU2A 2HR2A 3ZHEB 1WAO1 3Q49B 4Y6CA 4K03A 3SGHA 4PUCA 4EZLA 1OWNA 3LPZA 1E8WA 4CDMA 3LVQE 4G23A 2VYIA 4C0EA 3QB2A 3LY7A 4I2WA 4UWGA 4GA2A 2XGMA 3CR3A 2XCCA 2IOSA 2L0IA 5ENNA 1NA0A 3SHFA 2IF4A 3MZLB 5FQ7A 4FC8A 2XRZA 3Q15A 2WQ7A 2HO1A 3FEXA 4Y6WA 4E85A 3AS5A 4CCAA 3UT8A 3S2AA 3VLFA 4CDNA 5CCLA 2VGXA 3FUJA 3EDTB 3LJ3A 2UY1A 3SBSA 4OYSA 2WPVA 3L13A 3LDZA 4I17A 4U07A 3OXLA 3APCA 1FCHA 3AU4A 3RIBA 4EPZA 1IYGA 2GW1A 3MYVA 3OTNA 4FJZA 1Z3XA 4WWOA 4FU3A 3PEVB 2LSUA 3DBSA 2XGSA 3D9JA 3FU3A 5LFAA 4K0RA 3FP3A 4KT6B 1WM5A 1P5QA 2X6FA 2PM6A 4H7XA 4AVXA 3PVLA 1QZ2A 4G2VA 3OXGA 1JPLA 3L22A 4Q96A 2X6IA 4PDXA 3VLDA 2KZTB 2VQ2A 4KVOA 3Q4AB 3MX3A 3SZ7A 3PRZA 4DLQA 2WB2A 3ZYKA 2XGOA 2WXJA 4XE0A 3FUIA 2VGYA 2FBNA 4FHJA 2PL2A 2A5UA 3L54A 1N54A 4U0ZA 3L6AA 2QFCA 5FT9A 3ZFWA 4APOA 4BT9A 4FADA 5CMWA 3K9IA 3BG1B 3ZYQA 1SZAA 3CKBA 3MA5A 4PS7A 5T8IA 3LKUA 1IQUA 5JJTA 4GZDA 1DNPA 1E90A 4GMJA 3P2BA 3U4TA 5ARGA 1H6KA 3RO2A 4ILIA 2E2EA 4JHRA 1KT0A 1TJFA 4JW1A 3BEEA 2PQNA 5FZSA 3TAXA 3CQCB 3TG4A 2I2OA 3CSTA 3LCAA 3FWVA 3ESKA 4OVVA 3EJNA 4JEUA 4GA1A 1UW4B 1FVFA 4YVOA 5A7DB 1JWFA 4U04A 5J08A 3QDNA 3PNTB 1H0AA 5BT1A 4XI9A 4J8SA 4CGWA 1B89A 1W3BA 5FWQA 5G2NA 4RG9A 4GAAA 2KCVA 3CSFA 2KZTA 3GZ1A 4WAFA 4BT8A 1N52A 2IFUA 4BX8A 1UN9A 4UQXA 2WXLA 2AVPA 1MQSA 5DBKA 2RD0A 5CCMA 3I3NA 4JC8A 5CHEE 1H2TC 4EZKA 3NZUA 2FI7A 1HF8A 2JEKA 4KBQA 3FUHA 4FJYA 2XCBA 2ZU6B 5FJYA 4DI3A 4NURA 1E7UA 3ZW3A 2AWIA 2BTDA 3FU5A 3LY8A 4J8EA 4PS8A 2CG2A 5ARFA 3EHMA 2LNIA 3T5XA 3ZYMA 4C0MA 4HLEA 2VSYA 2AXUA 2I1JA 3O48A 4W9RA 4XI0A 3QWVA 3ASHA 3QOUA 4FULA 3ZN3A 2X38A 1OWOA 4G26A 1HFAA 4GZ5A 2MOWA 1KT1A 4GMLA 2YNQA 2LAIA 5D0QD 2CHWA 1H19A 3D9LA 3ML8A 2L6JA 1ELRA 3FHEA 1FVHA 4UI9C 2IU1A 3CHPA 4N39A 1OWPA 1UN8A 2L0TB 3FUEA 4JA7A 4B94A 3HHMA 5AIJA 1HS6A 4JL0A 4XKCA 3RRMB 3LYAA 4J0UA 4CT0A 3ZVVA 4L7TA 3QK0A 1E8YA 3CK7A 3G2TA 4J6IA 3RKVA 5KJNA 1OWLA 4NQ0A 2LO6A 2AXZA 2WXGA 3QWPA 4GZ6A 3QKYA 5C1DA 4BWRA 2C0MA 3LY9A 3QNKA 3S7JA 4AY5A 2AW6A 4HOUA 4GYOA 2FO7A 2I1KA 2CG3A 3FY4A 4FLHA 2E0IA 2C0LA 4L2LA 1SZ9A 3KS2A 3MV2B 1WY6A 1QNFA 4KYOB 4IYPA 5LCWC 2PZIA 3I4GA 3IKOB 3R9AB 4Q69A 3P1UA 2CFZA 4GPKA 3MGBA 4HXIA 3GZ2A 3ZPJA 4AXHA 4DJAA 1ZBPA 4ILHB 4AIFA 4HOQA 5BPPA 4A1SA 3FU0A 4LUNU 1L5JA 2WXFA 3QAQA 2XPZA 4F1SA 4GYWA 4JXTA 4B8CB 4URKA 4WWNA 3CK9A 2WXHA 2VGXB 3CGHA 1EYHA 1E8XA 2IOLA 3ONLA 4M3OA 5EKQD 3L16A 1U3CA 3MV3B 2R5SA 4KVMA 3ENEA 1EF1C 5J90A 3RRUA 3ASFA 1Z3YA 3UT4A 5T4YA 4DLOA 5G05J 1PC2A 3PH0C 3LVRE 4LEUA 1E7VA 4I1MA 4J8FA 2OV8A 4F7AA 3B7UX 1ELKA 4MLPA 2Y3AA 3U9WA 2BUGA 1INZA 4KMOA 4C9BB 3JUIA 4H7YA 1HU3A 4BX9A 2PQRA 2WM9A 4NACA 4G11A 5G04C 1XNFA 4JEHA 3SNXA 2KCKA 3BG0B 4NRHB 3FH8A 4RVBA 1NZNA 1HX8A 3TG5A 4AOFA 1ELWA 3PUKA 4MKTA 1X5BA 3MCXA 3KEZA 1HZ4A 1LF8A 5JHBA 2GRMA 3MKQB 4YVQC 5AJDA 4ACLA 4FA6A 3FH5A 4AP2A 1UG3A 3JYSA 5EX3A 5HQ8A 3FUMA 4JA9A 3CVWA 1E96B 2X6JA 3NF1A 3FUFA 4JHJA 4U0SA 2WQ6A 4L2YA 3JQ0A 4CEMA 4F53A 2VSXE 3UT7A 4GU5A 4TV3A 4AV7A 3SI5A 4DK5A 3SF4A 4LRZA 4YNDA 4GYYA 5AENA 4CDRA 4EQFA 1YA0A 4GA0A 4UQZA 4DPRA 2P58C 2CHZA 5LOZA 4JHKA 2J09A 2OVFA 4MS6A 4AEZC 2I6HA 2V8SE 2V0PA 1BPOA 4BTBA 3CVXA 2L9BA 2J4DA 2UWJG 4R7LA 2HM8A 3KAEA 3APDA 2JLBA 4LCTA 3TXMA 3D9MA 3ASGA 2WXOA 5LCWJ 5G04J 3GZSA 3PREA 2XQ0A 4EBAG 2X6HA 3PDNA 2GGFA 1EDUA 2Y4TA 4I43A 4UWHA 4ATGA 4CRWA 3FFLA 2I9CA 3PE4A 4GCOA 2BF0X 1TJCA 4FHKA 1NP7A 2WXIA 5LX8A 1TEZA 3ZXSA 3FTVA 5JJ7A 3VLEA 4JVSA 3GW4A 4A55A 2A4ZA 3HIZA 4HOSA 2YHEA 2OOEA 4UWFA 4G1TA 3RRNB 2LSVA 3CV0A 2VJ8A 3JCKC 5BUZA 3R7RA 4O6FA 3NQPA 4RSYA 2VTBA 3UPVA 1QQEA 1MHQA 3B7TA 3IBEA 4I6GA 3CHQA 4A3VA 1Y8MA 4N3CA 5KJKA 4B89A 2KCLA 2YQ8A 2AXVA 2YINA 3CIAA 5FQ6A 2V4LA 2YHCA 4AM9A 3UQ3A 1EPUA 3URZA 3MKQA 4FLBA 1HO8A 4XZ4A 5G55A 5C2YA 3PZDA 5DIZA 3TL5A 3D9NA 5BNWA 4ANUA 3MEKA 2J9QA 4I9EA 5BV0A 1OWMA 4I6EA 5ANLA 3PE3A 3CVVA 4ANXA 3LS8A 2C2LA 2WMNA 4KXKB 5E75A 5FQ4A 4CGVA 4HFGA 1E8ZA 3FU6A 4QFVA 4TUUA 4UWLA 2FULA 4IULA 3FTWA 3FTZA 2GRLA 1GW6A 2EQXA 3EHNA 4TRQA 4L1BA 1XGWA 2IONA 4WWPA 4GZ3A 2WXQA 1IHGA 3G2UA 4E6HA 1PY1A 3UUXA 2J07A 3NZSA 3PEUB 4F3VA 4I1OB 3CEQA 3U3WA 4I1AA 3T8MA 3FTXA 4EBAA 5KCMA 2MHKA 2WXMA 4B0ZA 2J4BA 2NC9A 1H2VC 3ZGQA 3FUNA 5G05C 4HS2A 2OVBA 3D3MA 2DIWA 1UJJA 2IJGX 5ANRA 3T5VA 4XIFA 3TJPA 3IHVA 4UI9J 4BFRA 1PAQA 3I4RB 3WXXA 4UQYA 4HOTA 3LXUX 3FTSA 1S0PA 4APFA 4XKBA 4ANWA 2MRIA 3UX4A 4PS3A 3MKRA 5LP0A 4L23A 4WNGA 1SQMA 2R59A 4KZ0A 2WVIA 2VTBB 4BY6A 2NSZA 3VTXA 3S7BA 4B8AA 3MJWA 2ONDA 1HE8A 2WXPA 3QWWA 2Y4UA 2J49A 3AS8A 5E76A 4GCNA 5D0OD 2XHEA 5FTPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KT1 A;  2XCC A;  4N2Q A;  1NA0 A;  4GZ5 A;  3AS4 A;  2P58 C;  5D0Q D;  2IF4 A;  3VTY A;  5JJ6 A;  2L6J A;  1ELR A;  4J8D A;  3Q15 A;  2KAT A;  3OXF A;  4UI9 C;  5KJL A;  2FF4 A;  2HO1 A;  4I2Z A;  2I6H A;  4Y6W A;  2FEZ A;  4N39 A;  4BTB A;  3AS5 A;  2UWJ G;  3KAE A;  5CCL A;  4RG6 A;  2JLB A;  2VGX A;  4JA7 A;  4B94 A;  3EDT B;  2WQH A;  3ASG A;  2UY1 A;  5FZQ A;  4JL0 A;  5LCW J;  5G04 J;  3LYA A;  5EX0 A;  4J0U A;  4N3B A;  3PDN A;  1A17 A;  2WPV A;  2XEV A;  4I17 A;  2Y4T A;  4U07 A;  3OXL A;  3RKV A;  1FCH A;  3CK7 A;  3FFL A;  3PE4 A;  4GCO A;  3RIB A;  5A6C A;  2GW1 A;  5KJN A;  1IYG A;  1TJC A;  4NQ0 A;  3IEG A;  1KLX A;  4WUY A;  3QWP A;  4G24 A;  2LSU A;  4GZ6 A;  3QKY A;  5C1D A;  2XGS A;  4BWR A;  5JJ7 A;  5HI7 A;  2C0M A;  3LY9 A;  3CKC A;  3S7J A;  3GW4 A;  3FP3 A;  3Q47 B;  4AY5 A;  4HOU A;  4HOS A;  4GYO A;  1HH8 A;  2FO7 A;  2OOE A;  4G1T A;  5FZR A;  4CDR A;  2LSV A;  1WM5 A;  1P5Q A;  3CV0 A;  3ASD A;  4O6F A;  4WNF A;  3ZHE A;  4H7X A;  2V5F A;  1QZ2 A;  4G2V A;  2C0L A;  3OXG A;  1QQE A;  3UPV A;  3KS2 A;  3MV2 B;  4KYO B;  5KJK A;  1Y8M A;  4N3C A;  4N3A A;  2VQ2 A;  2XPI A;  3Q4A B;  3E4B A;  2PZI A;  3SZ7 A;  3R9A B;  2KCL A;  5LCW C;  2XGO A;  4GPK A;  2YQ8 A;  3ZPJ A;  3GZ2 A;  1ZBP A;  5AYW D;  2VGY A;  2FBN A;  2PL2 A;  4AIF A;  2YHC A;  2Q7F A;  4HOQ A;  3KD7 A;  3UQ3 A;  4AM9 A;  3URZ A;  3N71 A;  4U0Z A;  1OUV A;  2QFC A;  3HYM B;  3Q5M A;  5FT9 A;  3S7F A;  3ZFW A;  4A1S A;  5DIZ A;  4APO A;  3K9I A;  4I9C A;  5BNW A;  4N2S A;  3MEK A;  2J9Q A;  3CKB A;  3MA5 A;  4GYW A;  4I9E A;  2DBA A;  4I2W A;  4N5C A;  3ULQ A;  3CK9 A;  3CVQ A;  3LKU A;  2VSN A;  3CVN A;  4UI9 K;  1NA3 A;  3CVL A;  3PE3 A;  2VGX B;  4WNE A;  5JJT A;  2C2L A;  4KXK B;  3RJV A;  4IN3 B;  4BT9 A;  4CGV A;  3U4T A;  3CVP A;  5BW8 C;  5KJM A;  4UQZ A;  5EKQ D;  5ARG A;  3S7D A;  3MV3 B;  2R5S A;  3RO2 A;  2E2E A;  1KT0 A;  3BEE A;  2PQN A;  5FZS A;  3ASF A;  3TAX A;  5M72 A;  3TG4 A;  3LCA A;  3RU0 A;  5G05 J;  1PC2 A;  3FWV A;  3CK8 A;  3ESK A;  4G25 A;  4LEU A;  4GZ3 A;  4J8F A;  3TGO A;  4GA1 A;  5A7D B;  4ME2 A;  1IHG A;  4YVO A;  4EQF A;  3RO3 A;  3UUX A;  4U04 A;  3QDN A;  2BUG A;  4WND A;  4H7Y A;  4F3V A;  4XI9 A;  5BT1 A;  3CEQ A;  4CGW A;  3U3W A;  2PQR A;  1B89 A;  1W3B A;  2UY1 B;  4I1A A;  5G04 C;  4ABN A;  1XNF A;  4RG9 A;  2MHK A;  2KCK A;  2KCV A;  4HOR A;  4NRH B;  2NC9 A;  2HYZ A;  3GZ1 A;  1NZN A;  2KC7 A;  5G05 C;  3ZGQ A;  2IFU A;  3TG5 A;  4BT8 A;  4AY6 A;  4UQX A;  2AVP A;  1ELW A;  4XIF A;  5DBK A;  4UI9 J;  5CCM A;  3GYZ A;  5CHE E;  1HZ4 A;  3WXX A;  2FI7 A;  4UQY A;  4KBQ A;  4BTA A;  4YVQ C;  2XCB A;  5HQ8 A;  4U0U A;  4HOT A;  3JYS A;  5EX3 A;  5FJY A;  1HXI A;  4JA9 A;  1ZU2 A;  2HR2 A;  1E96 B;  3MKR A;  3NF1 A;  3LY8 A;  1WAO 1;  4J8E A;  4U0S A;  4WNG A;  5ARF A;  3Q49 B;  4Y6C A;  3ZHE B;  2LNI A;  3VTX A;  2VSY A;  3S7B A;  3SF4 A;  3LPZ A;  2OND A;  4YND A;  3O48 A;  4GYY A;  4W9R A;  4XI0 A;  3QWV A;  3QWW A;  3ASH A;  2Y4U A;  1YA0 A;  2VYI A;  3AS8 A;  3QOU A;  4G23 A;  3ZN3 A;  4GCN A;  4G26 A;  5D0O D;  3LY7 A;  4GA0 A;  4JHR A;  4GA2 A;  5FTP A;  2XGM A; 
#chains in the Genus database with same CATH topology
 1UJK A;  3LJN A;  3E33 A;  1JWG A;  5JJ6 A;  4I2Z A;  1JCR A;  1AP7 A;  4ILG A;  2WQH A;  5FZQ A;  1A17 A;  1VDY A;  3NAW A;  4P29 A;  3FUK A;  3TWU A;  2QY7 A;  4TXQ A;  1K1B A;  3IEG A;  1KLX A;  3DST A;  4L9P A;  2GRO B;  3KSQ A;  1JUQ A;  3FDH A;  4WNF A;  3CHO A;  5B3S E;  3NOC D;  1U3D A;  4MRU A;  2CHX A;  5BV1 A;  5KNG A;  3UKU G;  1AWC B;  3EIQ C;  4TXR A;  1A5E A;  3KD7 A;  3D9I A;  2R17 C;  1OUV A;  2CFU A;  4CT4 A;  2P9S G;  4N2S A;  2DCP A;  3G2S A;  4JZY A;  4J8Y A;  4U8V D;  3CLJ A;  3D9K A;  1NA3 A;  3FUD A;  4IN3 B;  3S7D A;  3E30 A;  5IY5 E;  3W9G A;  5M72 A;  1HG5 A;  1MX4 A;  3CK8 A;  3TGO A;  2H6F A;  4ME2 A;  1TNU A;  5FQ8 A;  3CVY A;  5T3R A;  2H6G A;  4ABN A;  3TXN A;  3DPD A;  1NI1 A;  4HOR A;  1K3Z D;  2KC7 A;  3D9P A;  3HDX A;  3PZ4 A;  4KZC A;  3B7R L;  3PZ3 A;  5AJL A;  2LXM A;  4RQI A;  1WAO 1;  4K03 A;  3LPZ A;  3LVQ E;  1YCS B;  4C0E A;  3LY7 A;  4I2W A;  4UWG A;  2XCC A;  2XRZ A;  3FEX A;  3S2A A;  5CCL A;  2EIJ E;  4LNG A;  2WPV A;  3OXL A;  3APC A;  3BQO A;  1IYG A;  2GW1 A;  4WWO A;  4FU3 A;  4GTT A;  3PEV B;  3DBS A;  2XGS A;  3D9J A;  3FU3 A;  4HNA D;  4K0R A;  3FP3 A;  4DRX E;  1Z5S C;  1P5Q A;  2X6F A;  4F1P A;  3PVL A;  1QZ2 A;  4G2V A;  3L22 A;  4PDX A;  3VLD A;  3MX3 A;  2DZO A;  4BET A;  1LTX A;  2VGY A;  4FHJ A;  2A5U A;  3TWR A;  4FAD A;  3ZFW A;  3K9I A;  3BG1 B;  3CKB A;  3MA5 A;  4K5A B;  3LKU A;  4HB5 A;  2XZT G;  3U4T A;  3AAA C;  2ZGD A;  1NFI E;  2E2E A;  5BXO A;  1KT0 A;  3TAX A;  3CQC B;  3TG4 A;  4U95 D;  4OVV A;  4GA1 A;  4U04 A;  5BT1 A;  1OT8 A;  1B89 A;  3Q7A A;  4HQD A;  4RG9 A;  2LUH A;  2KCV A;  2WXL A;  1MQS A;  5DBK A;  5CHE E;  1H2T C;  2JEK A;  4FJY A;  3ASO E;  4U8Y D;  3UI2 A;  5ARF A;  2LXL A;  3EHM A;  3UM0 A;  4C0M A;  1S70 B;  2AXU A;  3ULE G;  3ASH A;  4FUL A;  3ZN3 A;  1OWO A;  4GZ5 A;  4GML A;  2LAI A;  1H19 A;  3FHE A;  1FVH A;  2IU1 A;  4N39 A;  1LD7 A;  5HRY A;  5AIJ A;  1HS6 A;  4J0U A;  3RKV A;  2BKG A;  2DZN A;  4G8K A;  3S7J A;  4CZ2 D;  2AW6 A;  5CEA A;  2CG3 A;  1TN7 A;  2E0I A;  2C0L A;  1SZ9 A;  3KS2 A;  4IYP A;  2PZI A;  3B95 A;  2A5E A;  1KZP A;  5BPP A;  2XEN A;  3QAQ A;  4BES A;  2WXH A;  5BXU A;  1EYH A;  3ONL A;  2IO2 C;  2R5S A;  5ITZ F;  3ASF A;  3UT4 A;  4OAU C;  5T4Y A;  4DLO A;  5G05 J;  1E7V A;  4F7A A;  3ABL E;  4M7C A;  4MLP A;  2Y3A A;  3U9W A;  4NAC A;  3ZXP A;  3JUE A;  4G11 A;  1XNF A;  5G04 C;  4RVB A;  3TG5 A;  4C48 B;  2P9I G;  1OY3 D;  1X5B A;  3MCX A;  3KEZ A;  1HZ4 A;  4YVQ C;  4ACL A;  3FUM A;  2XS1 A;  4ATZ D;  4JHJ A;  4GTR A;  2VSX E;  4DK5 A;  1KPS B;  1N4Q A;  5AEN A;  1YA0 A;  4DX1 A;  4UQZ A;  3EHR A;  1O1R A;  3RAU A;  4XEI G;  3CVX A;  5AAO A;  2R02 A;  3AG2 E;  3ASG A;  5G04 J;  3GZS A;  3PRE A;  2XQ0 A;  1TN6 A;  4I43 A;  3FFL A;  3PE4 A;  2BF0 X;  3AJI A;  2ZGG A;  5LX8 A;  3ZXS A;  5JJ7 A;  3GW4 A;  4A55 A;  2A4Z A;  4HOS A;  2YHE A;  3JCK C;  3Q9U C;  5KJK A;  2NYJ A;  2AXV A;  2YIN A;  5FQ6 A;  3UQ3 A;  3URZ A;  3MKQ A;  1HO8 A;  3DSV A;  3TL5 A;  2QYJ A;  3LS8 A;  5FQ4 A;  4HFG A;  5D66 A;  3FU6 A;  1K8K G;  2FUL A;  4IUL A;  2KBX A;  3EHN A;  1SA4 A;  4L1B A;  2DYR E;  3R9M A;  1IHG A;  2J07 A;  3PEU B;  4F3V A;  4I1A A;  3T8M A;  4EBA A;  4NIK A;  1UJJ A;  3T5V A;  2EIN E;  3TJP A;  4UQY A;  1BI7 B;  1FPP A;  3LXU X;  3FTS A;  3UX4 A;  3MKR A;  4KZ0 A;  2NSZ A;  1H6O A;  4B8A A;  3MJW A;  2OND A;  2GRP B;  3QWW A;  4GCN A;  4J7W A;  4JHR A;  5FTP A;  4HVB A;  2KAT A;  3OXF A;  3B7S A;  1KZO A;  3R7Q A;  3PZ2 A;  4DUI A;  3ZIM A;  4RG6 A;  3PUJ A;  5JHA A;  4GZC A;  4B93 B;  3ZYL A;  5EN5 D;  5A6C A;  4LNB A;  3HG0 D;  1OCZ E;  3RK6 A;  4U7E B;  1O1S A;  3DSW A;  5HI7 A;  3Q47 B;  3L17 A;  4IRU A;  4U8H A;  4GTO A;  3L08 A;  4AJW A;  3FEY A;  2ILR A;  4N3A A;  2P9K G;  4ANV A;  4GTQ A;  1YYH A;  4N5Q A;  3N71 A;  2IQC A;  3HYM B;  3Q5M A;  3AU5 A;  4V3I A;  2VSN A;  4WNE A;  4BSX A;  2R05 A;  5KJM A;  4FP7 A;  3FTY A;  3G2V A;  2NXP A;  3TWS A;  3NB2 A;  3L9T A;  1ZB1 A;  2UY1 B;  3TWW A;  4DI4 A;  2HYZ A;  4GB9 A;  5A23 A;  3JQ1 A;  3QJZ A;  2X6K A;  3CVU A;  1V55 E;  3L82 A;  3GYZ A;  5CMY A;  3EUV A;  4UWK A;  3Q49 B;  4Y6C A;  3SGH A;  3DWL G;  1JCQ A;  4GA2 A;  3CR3 A;  1MX2 A;  1N4P A;  2IF4 A;  3MZL B;  4FC8 A;  2WQ7 A;  2HO1 A;  4Y6W A;  3TWX A;  2VGX A;  3FUJ A;  3EDT B;  3LJ3 A;  3SBS A;  3OTN A;  5H7P A;  1N11 A;  2BKK B;  1WM5 A;  4H7X A;  4AVX A;  3SQV A;  3OXG A;  3EHQ A;  2KZT B;  2VQ2 A;  2WB2 A;  4YDW A;  3FUI A;  4APO A;  5FT9 A;  1SZA A;  5T8I A;  1IQU A;  3IXE A;  1IHB A;  5ARG A;  1TJF A;  2PQN A;  2XZD G;  5FZS A;  2I2O A;  3LCA A;  2HE0 A;  3ZKJ A;  4HI8 A;  4JEU A;  4YVO A;  1QYM A;  5G2N A;  2GRQ B;  3DXK G;  4WAF A;  3TWT A;  2H6H A;  4BX8 A;  4UQX A;  2AVP A;  5EYP F;  3NZU A;  1HF8 A;  5CER B;  2XCB A;  2F0Y A;  5AQB A;  1E7U A;  2AWI A;  2BTD A;  3LY8 A;  4J8E A;  4PS8 A;  3T5X A;  4HLE A;  2VSY A;  4TUM A;  1HFA A;  5D0Q D;  2CHW A;  3D9L A;  3DSX A;  3ML8 A;  5ENT D;  3DPY A;  3X2Q E;  4B94 A;  1SVX A;  3J5P A;  3ZVV A;  3QK0 A;  1E8Y A;  1OWL A;  5C1D A;  4BWR A;  4HOU A;  5AQ9 A;  2FO7 A;  3B7B A;  4EHM A;  3MV2 B;  1QNF A;  5LCW C;  3R9A B;  3NOG D;  3MGB A;  3ZPJ A;  3GZ2 A;  1Q2Z A;  4AXH A;  4LUN U;  5CRV A;  4URK A;  3C72 A;  2XS8 A;  2IOL A;  4M3O A;  1D8D A;  5EKQ D;  1U3C A;  2IO3 C;  3ENE A;  5EYL A;  5J90 A;  2F8Y A;  3PH0 C;  3LVR E;  4I1M A;  4C9B B;  4H7Y A;  1HU3 A;  5AN8 A;  2PQR A;  1X81 A;  3Q78 A;  3FH8 A;  2Y0B G;  1HX8 A;  2RFA A;  3Q75 A;  3NBN B;  5JHB A;  2GRM A;  5AJD A;  4FA6 A;  5HQ8 A;  4AP2 A;  1UG3 A;  5EX3 A;  4JA9 A;  2X6J A;  4L2Y A;  1RW2 A;  4HRM B;  5LOZ A;  1O5M A;  2CHZ A;  4JHK A;  1G3N B;  2UWJ G;  4R7L A;  3KAE A;  3APD A;  3TXM A;  3D9M A;  4X8Q A;  5LCW J;  3PDN A;  3TWQ A;  2GGF A;  4CRW A;  2I9C A;  2RKK A;  1NP7 A;  1TEZ A;  3VLE A;  4UWF A;  2OOE A;  3RRN B;  2LSV A;  3CV0 A;  2VJ8 A;  3R7R A;  1IXV A;  3UPV A;  3IBE A;  4A3V A;  2IY0 C;  2YQ8 A;  3CIA A;  5CED B;  1EPU A;  3KSL A;  4XZ4 A;  5G55 A;  5C2Y A;  5DIZ A;  3AG3 E;  4I9E A;  5BV0 A;  1OWM A;  4ZFH A;  3C5R A;  2C2L A;  2WMN A;  4KXK B;  4CGV A;  1GW6 A;  3DXM G;  2ION A;  5EIB E;  4WWP A;  1N94 A;  2WXQ A;  4E6H A;  3UUX A;  4HI9 A;  5KCM A;  4GMR A;  5JA4 D;  2WXM A;  2P9P G;  2J4B A;  4HS2 A;  1DC2 A;  5ANR A;  3IHV A;  4UI9 J;  3I4R B;  5ENP D;  4HOT A;  4APF A;  1OXJ A;  2ZIR A;  4DX2 A;  3S7B A;  1HE8 A;  2WXP A;  5E76 A;  2XHE A;  1IQR A;  4N2Q A;  1N95 A;  4J8D A;  5KJL A;  2FF4 A;  4LG6 A;  4EZJ A;  3APF A;  4Z68 A;  3BUA A;  5EX0 A;  3C3Q A;  4XX5 A;  3E34 A;  4WUY A;  1WG0 A;  3CHR A;  3SBT B;  3ZEF A;  3CKC A;  2XRY A;  4JB8 P;  4JPS A;  5FZR A;  2IEJ A;  4HRL A;  2V5F A;  2J08 A;  2ZIS A;  4A1G A;  2XPY A;  1NL4 A;  2XPI A;  3PNL B;  4LER A;  1MX6 A;  1BI8 B;  3ZNG A;  3IHY A;  2V5Q C;  5FIN A;  3UMV A;  2WMO A;  4N5C A;  4D10 C;  2P2C P;  4UI9 K;  3CVL A;  3RJV A;  3CVP A;  5BW8 C;  3QAR A;  2M63 A;  3U66 A;  3B13 A;  3C98 A;  3V2O A;  3RU0 A;  1H2U A;  5JMN D;  3CQG B;  1V54 E;  2J8S D;  3RO3 A;  2PM7 A;  3PZ1 A;  4WND A;  1YMP A;  3FH7 A;  3W9F A;  2RG8 A;  4AY6 A;  1QBQ A;  5AQA A;  2KM4 A;  2LAH A;  4ACK A;  3LEW A;  2P9N G;  3WG7 E;  1TN8 A;  2HR2 A;  4LSZ E;  3UIN C;  3F6Q A;  1N0Q A;  4CDM A;  4G23 A;  2IOS A;  5ENN A;  1NA0 A;  1WDY A;  2MYO A;  3SHF A;  3Q15 A;  4E85 A;  3AS5 A;  3VLF A;  2UY1 A;  4OYS A;  2R2L A;  4U07 A;  3RIB A;  4EPZ A;  4FJZ A;  3MYV A;  3EU9 A;  5KWD A;  1JCS A;  1JPL A;  3HXB A;  2OCC E;  2X6I A;  2R03 A;  4DLQ A;  4KVO A;  3Q4A B;  3SZ7 A;  3ZYK A;  2WXJ A;  2FBN A;  1D8E A;  1N54 A;  5CMW A;  4K5C A;  4BT9 A;  1SW6 A;  3ZYQ A;  1U2V G;  4PS7 A;  1DNP A;  1E90 A;  4GMJ A;  3P2B A;  3RO2 A;  4ILI A;  4JW1 A;  3BEE A;  5KBA A;  4DX7 D;  3CST A;  3FWV A;  3ESK A;  1UOH A;  5A7D B;  1JWF A;  5J08 A;  4J8S A;  4CGW A;  1TNO A;  5FWQ A;  3AG4 E;  3CSF A;  1N52 A;  3UIO C;  4BEP A;  2RD0 A;  5CCM A;  3I3N A;  2XEE A;  4JC8 A;  4KBQ A;  2ZU6 B;  4DI3 A;  4NUR A;  3FU5 A;  2CG2 A;  2LNI A;  5ENR D;  1N4R A;  3ZU7 B;  2I1J A;  4XI0 A;  3QWV A;  2X38 A;  4G26 A;  1KT1 A;  2L6J A;  1ELR A;  4UI9 C;  4U96 D;  3CHP A;  1OWP A;  1UN8 A;  2GRN B;  3UM1 A;  2L0T B;  1BU9 A;  2OEW A;  3C3R A;  4JL0 A;  4XKC A;  3RRM B;  2OEV A;  4J6I A;  3G2T A;  5KJN A;  1S63 A;  2LO6 A;  2WXG A;  4GZ6 A;  3QKY A;  3LY9 A;  4GYO A;  2I1K A;  3FY4 A;  4L2L A;  5B1B E;  3I4G A;  2B6C A;  2CFZ A;  3P1U A;  1ZBP A;  4ILH B;  1RZ4 A;  4UUC A;  4A1S A;  1L5J A;  4GTM A;  2XPZ A;  4F1S A;  3D9H A;  3CGH A;  5CRU A;  3L16 A;  4HBD A;  3MV3 B;  4ZHB A;  3RRU A;  4O1O A;  2ETC A;  1N4S A;  1ELK A;  3JUI A;  4BX9 A;  4NRH B;  1NZN A;  4AOF A;  3PUK A;  4MKT A;  1LF8 A;  3MKQ B;  3JQ0 A;  4TXP A;  3T8K A;  4TV3 A;  3V30 A;  3SI5 A;  4YND A;  4EQF A;  3ASN E;  4GA0 A;  3ISM C;  4DPR A;  2J09 A;  4MS6 A;  3E32 A;  4AEZ C;  4G8L A;  2I6H A;  2V8S E;  1BPO A;  4BTB A;  4MBG A;  2HM8 A;  2JLB A;  5EIL A;  4EBA G;  3UIP C;  1EDU A;  4GCO A;  1DCQ A;  1TJC A;  4YDY A;  5ENO D;  2WXI A;  3HIZ A;  4G1T A;  4RSY A;  2VTB A;  1MHQ A;  4N3C A;  2KCL A;  5AAR A;  4AM9 A;  4FLB A;  4HRN A;  3PZD A;  3MEK A;  2J9Q A;  4HLL A;  3UTM A;  4I6E A;  3PE3 A;  4ANX A;  3SFX A;  1E8Z A;  3Q73 A;  3FTW A;  2GRL A;  2VGE A;  4TRQ A;  1XGW A;  1PY1 A;  2EIK E;  3NZS A;  3CEQ A;  3U3W A;  1TYQ G;  3T9K A;  2MHK A;  4B0Z A;  2ETB A;  2NC9 A;  1H2V C;  3FUN A;  2DIW A;  2ZXW E;  1H6P A;  3ABM E;  1MYO A;  1S0P A;  3DRA A;  4XKB A;  4ANW A;  2MRI A;  4YDO A;  4PS3 A;  2VTB B;  2R59 A;  1BD8 A;  2WVI A;  4BY6 A;  3VTX A;  4O1P A;  3UM3 A;  2J49 A;  1BLX B;  4U63 A;  3ESL A;  3AS4 A;  3FUL A;  3VTY A;  3ONK A;  3IV0 A;  3HVE B;  2FEZ A;  3ML9 A;  4A63 B;  4A3T A;  3SFZ A;  4N3B A;  1OCC E;  2XEV A;  2FO1 E;  3QC1 A;  4G24 A;  2JAB A;  3SFY A;  1HH8 A;  3O4Z A;  3CHS A;  3UXG A;  2F37 A;  3ASD A;  5HS0 A;  3ZHE A;  3I5P A;  2X3M A;  3HXE A;  1Z6T A;  3E4B A;  2Y69 E;  5AYW D;  4I6J A;  2Q7F A;  3TWV A;  2WXN A;  3S7F A;  3HVE A;  3G2W A;  4PH4 B;  4I9C A;  4Q94 A;  3ULQ A;  2DBA A;  3ZRH A;  1Y6I A;  3CVQ A;  3CVN A;  3CHM A;  3PS6 A;  3EIJ A;  3E37 A;  1FT1 A;  3FTU A;  1HG2 A;  3SY2 A;  3OAW A;  3DSU A;  2KXP C;  2DYS E;  4EEC A;  4G25 A;  3U64 A;  4YDE A;  4OVU A;  2WXR A;  5EDS A;  3SO8 A;  1N0R A;  2PNN A;  3SD5 A;  3D9O A;  4OAV B;  2XEH A;  1OCO E;  1DVP A;  4BTA A;  2VSO E;  4U0U A;  4GTV A;  3JXJ A;  3HXF A;  1HXI A;  2WXK A;  1ZU2 A;  3ZHE B;  3HXD A;  4PUC A;  4EZL A;  1OWN A;  1E8W A;  2EIM E;  2VYI A;  3QB2 A;  2XGM A;  2L0I A;  5FQ7 A;  3AG1 E;  3BU8 A;  4CCA A;  3UT8 A;  4CDN A;  2QZA A;  2L6B A;  3L13 A;  3LDZ A;  4I17 A;  1MJ0 A;  1FCH A;  3AU4 A;  1Z3X A;  2LSU A;  3V31 A;  5LFA A;  4F6R D;  3ZUV B;  2H6I A;  4KT6 B;  1D9S A;  2AJA A;  3HRA A;  2PM6 A;  4Q96 A;  2EIL E;  3PRZ A;  2XGO A;  5KNH D;  5B1A E;  4XE0 A;  2PL2 A;  3L54 A;  2QC9 A;  4U0Z A;  3L6A A;  2QFC A;  5JJT A;  4GZD A;  1TR4 A;  3Q9N C;  1H6K A;  5ENS D;  3EJN A;  1UW4 B;  1FVF A;  3QDN A;  3PNT B;  1H0A A;  5EID A;  4XI9 A;  1W3B A;  3DEO A;  4GAA A;  2KZT A;  3GZ1 A;  4BT8 A;  2IFU A;  3UKR G;  1UN9 A;  4EZK A;  2FI7 A;  3FUH A;  5FJY A;  3ZW3 A;  3ZYM A;  1OCR E;  3O48 A;  4W9R A;  3QOU A;  4GTS A;  3J5Q B;  2MOW A;  2F8X K;  2YNQ A;  5CEC B;  3FUE A;  4JA7 A;  3HHM A;  1S64 A;  1FT2 A;  3LYA A;  4CT0 A;  4L7T A;  3CK7 A;  3KEA A;  4NQ0 A;  1TNY A;  2GRR B;  3QWP A;  2AXZ A;  2C0M A;  4AY5 A;  3QNK A;  3HXC A;  1K1A A;  4FLH A;  4O60 A;  3RSE G;  4GPM A;  1WY6 A;  4KYO B;  3IKO B;  4Q69 A;  4GPK A;  4RLY A;  4HXI A;  4DJA A;  4DX5 D;  4LNU D;  4AIF A;  4HOQ A;  3FU0 A;  2WXF A;  4GYW A;  4JXT A;  4B8C B;  4WWN A;  3CK9 A;  3JXI A;  2DWZ A;  2VGX B;  1E8X A;  2Y1L E;  2QYU A;  5ENQ D;  4KVM A;  1EF1 C;  1Z3Y A;  1PC2 A;  4LEU A;  4J8F A;  4GTP A;  2OV8 A;  3B7U X;  2BUG A;  1INZ A;  4KMO A;  3UM2 A;  1TNZ A;  2WM9 A;  3EU5 A;  4JEH A;  3SNX A;  2DVW A;  2KCK A;  1SA5 A;  3BG0 B;  3DEP A;  1ELW A;  4CYM D;  3FH5 A;  3V79 K;  3JYS A;  3CVW A;  1E96 B;  3NF1 A;  4U0S A;  3FUF A;  2WQ6 A;  4CEM A;  4F53 A;  3UT7 A;  4GU5 A;  2ETA A;  4AV7 A;  3SF4 A;  4LRZ A;  4DX6 D;  1O1T A;  4GYY A;  4CDR A;  4QQI A;  5CBN A;  1MZC A;  2BED A;  2P58 C;  2OVF A;  5AQ7 A;  2V0P A;  2L9B A;  1DCE A;  2J4D A;  1LD8 A;  5CBO A;  4LCT A;  2WXO A;  3ABK E;  2P9L G;  2X6H A;  2Y4T A;  4UWH A;  4ATG A;  4BSZ B;  2RFM A;  4FHK A;  3FTV A;  4JVS A;  1TNB A;  5BUZ A;  1IKN D;  4O6F A;  3NQP A;  3C3O A;  1QQE A;  3B7T A;  4I6G A;  3CHQ A;  1Y8M A;  4B89 A;  2V4L A;  2YHC A;  5BNW A;  3D9N A;  4ANU A;  1N9A A;  5ANL A;  3CVV A;  5E75 A;  5D2M C;  5FIO A;  4QFV A;  4TUU A;  4UWL A;  3FTZ A;  2EQX A;  4GZ3 A;  3G2U A;  4I1O B;  3FTX A;  3V2X A;  4K5B A;  3ZGQ A;  5HKP A;  5G05 C;  4BER A;  2OVB A;  3D3M A;  2IJG X;  4XIF A;  4BFR A;  1PAQ A;  3WXX A;  3Q7F A;  3DSS A;  2B0O E;  4JD2 G;  5LP0 A;  4L23 A;  3ULY A;  4WNG A;  1SQM A;  2P9U G;  2Y4U A;  3AS8 A;  3Q79 A;  2V4H C;  5D0O D; 
#chains in the Genus database with same CATH homology
 4U63 A;  1IQR A;  4N2Q A;  1UJK A;  3ESL A;  3AS4 A;  3FUL A;  4HVB A;  1JWG A;  3VTY A;  3ONK A;  3IV0 A;  3HVE B;  4J8D A;  5JJ6 A;  2KAT A;  3OXF A;  5KJL A;  2FF4 A;  4I2Z A;  2FEZ A;  3B7S A;  3ML9 A;  3R7Q A;  3SFZ A;  4A3T A;  3ZIM A;  4RG6 A;  3PUJ A;  4ILG A;  2WQH A;  3APF A;  4EZJ A;  5FZQ A;  5JHA A;  4GZC A;  5EX0 A;  4N3B A;  1A17 A;  2XEV A;  1VDY A;  4P29 A;  4XX5 A;  3FUK A;  3ZYL A;  2QY7 A;  5A6C A;  3IEG A;  1KLX A;  4WUY A;  3RK6 A;  3CHR A;  3QC1 A;  4G24 A;  3SBT B;  3ZEF A;  5HI7 A;  3CKC A;  1JUQ A;  2XRY A;  3Q47 B;  3FDH A;  3L17 A;  4IRU A;  4JPS A;  4U8H A;  1HH8 A;  3O4Z A;  5FZR A;  3CHS A;  3ASD A;  4WNF A;  3CHO A;  3ZHE A;  3I5P A;  1U3D A;  2V5F A;  1Z6T A;  2X3M A;  3L08 A;  4AJW A;  2J08 A;  4MRU A;  3FEY A;  4A1G A;  2CHX A;  2ILR A;  2XPY A;  4N3A A;  3PNL B;  2XPI A;  5BV1 A;  3E4B A;  4LER A;  3EIQ C;  5AYW D;  4I6J A;  4ANV A;  2Q7F A;  3KD7 A;  3D9I A;  2WXN A;  3N71 A;  2R17 C;  2IQC A;  1OUV A;  3HYM B;  3Q5M A;  3S7F A;  3HVE A;  2CFU A;  3AU5 A;  3G2W A;  4PH4 B;  4I9C A;  3IHY A;  4Q94 A;  4V3I A;  4CT4 A;  4N2S A;  3UMV A;  2WMO A;  3ULQ A;  2DBA A;  2DCP A;  3G2S A;  4N5C A;  3ZRH A;  1Y6I A;  4D10 C;  3CVQ A;  4JZY A;  2VSN A;  3CLJ A;  3CVN A;  1NA3 A;  3CVL A;  3D9K A;  3FUD A;  4UI9 K;  4WNE A;  4BSX A;  3RJV A;  4IN3 B;  3CHM A;  3CVP A;  5BW8 C;  4FP7 A;  5KJM A;  3QAR A;  2M63 A;  3U66 A;  3B13 A;  3PS6 A;  3S7D A;  3EIJ A;  3FTY A;  3FTU A;  3C98 A;  1HG2 A;  3G2V A;  3OAW A;  5M72 A;  3RU0 A;  1H2U A;  1HG5 A;  2NXP A;  3CK8 A;  4EEC A;  4G25 A;  3CQG B;  3TGO A;  4ME2 A;  5FQ8 A;  3U64 A;  3CVY A;  5T3R A;  3RO3 A;  2PM7 A;  4WND A;  4OVU A;  2WXR A;  3FH7 A;  2UY1 B;  5EDS A;  4ABN A;  3TXN A;  3DPD A;  4DI4 A;  2RG8 A;  4HOR A;  2HYZ A;  3D9P A;  2KC7 A;  4GB9 A;  3JQ1 A;  3QJZ A;  3SD5 A;  5A23 A;  2X6K A;  4AY6 A;  3HDX A;  3D9O A;  3CVU A;  4KZC A;  3B7R L;  3GYZ A;  5AJL A;  2KM4 A;  1DVP A;  4BTA A;  2VSO E;  2LAH A;  4U0U A;  4ACK A;  3LEW A;  5CMY A;  1HXI A;  2WXK A;  4UWK A;  1ZU2 A;  2HR2 A;  3ZHE B;  1WAO 1;  3Q49 B;  4Y6C A;  4K03 A;  3SGH A;  4PUC A;  4EZL A;  1OWN A;  3LPZ A;  1E8W A;  4CDM A;  3LVQ E;  4G23 A;  2VYI A;  4C0E A;  3QB2 A;  3LY7 A;  4I2W A;  4UWG A;  4GA2 A;  2XGM A;  3CR3 A;  2XCC A;  2IOS A;  2L0I A;  5ENN A;  1NA0 A;  3SHF A;  2IF4 A;  3MZL B;  5FQ7 A;  4FC8 A;  2XRZ A;  3Q15 A;  2WQ7 A;  2HO1 A;  3FEX A;  4Y6W A;  4E85 A;  3AS5 A;  4CCA A;  3UT8 A;  3S2A A;  3VLF A;  4CDN A;  5CCL A;  2VGX A;  3FUJ A;  3EDT B;  3LJ3 A;  2UY1 A;  3SBS A;  4OYS A;  2WPV A;  3L13 A;  3LDZ A;  4I17 A;  4U07 A;  3OXL A;  3APC A;  1FCH A;  3AU4 A;  3RIB A;  4EPZ A;  1IYG A;  2GW1 A;  3MYV A;  3OTN A;  4FJZ A;  1Z3X A;  4WWO A;  4FU3 A;  3PEV B;  2LSU A;  3DBS A;  2XGS A;  3D9J A;  3FU3 A;  5LFA A;  4K0R A;  3FP3 A;  4KT6 B;  1WM5 A;  1P5Q A;  2X6F A;  2PM6 A;  4H7X A;  4AVX A;  3PVL A;  1QZ2 A;  4G2V A;  3OXG A;  1JPL A;  3L22 A;  4Q96 A;  2X6I A;  4PDX A;  3VLD A;  2KZT B;  2VQ2 A;  4KVO A;  3Q4A B;  3MX3 A;  3SZ7 A;  3PRZ A;  4DLQ A;  2WB2 A;  3ZYK A;  2XGO A;  2WXJ A;  4XE0 A;  3FUI A;  2VGY A;  2FBN A;  4FHJ A;  2PL2 A;  2A5U A;  3L54 A;  1N54 A;  4U0Z A;  3L6A A;  2QFC A;  5FT9 A;  3ZFW A;  4APO A;  4BT9 A;  4FAD A;  5CMW A;  3K9I A;  3BG1 B;  3ZYQ A;  1SZA A;  3CKB A;  3MA5 A;  4PS7 A;  5T8I A;  3LKU A;  1IQU A;  5JJT A;  4GZD A;  1DNP A;  1E90 A;  4GMJ A;  3P2B A;  3U4T A;  5ARG A;  1H6K A;  3RO2 A;  4ILI A;  2E2E A;  4JHR A;  1KT0 A;  1TJF A;  4JW1 A;  3BEE A;  2PQN A;  5FZS A;  3TAX A;  3CQC B;  3TG4 A;  2I2O A;  3CST A;  3LCA A;  3FWV A;  3ESK A;  4OVV A;  3EJN A;  4JEU A;  4GA1 A;  1UW4 B;  1FVF A;  4YVO A;  5A7D B;  1JWF A;  4U04 A;  5J08 A;  3QDN A;  3PNT B;  1H0A A;  5BT1 A;  4XI9 A;  4J8S A;  4CGW A;  1B89 A;  1W3B A;  5FWQ A;  5G2N A;  4RG9 A;  4GAA A;  2KCV A;  3CSF A;  2KZT A;  3GZ1 A;  4WAF A;  4BT8 A;  1N52 A;  2IFU A;  4BX8 A;  1UN9 A;  4UQX A;  2WXL A;  2AVP A;  1MQS A;  5DBK A;  2RD0 A;  5CCM A;  3I3N A;  4JC8 A;  5CHE E;  1H2T C;  4EZK A;  3NZU A;  2FI7 A;  1HF8 A;  2JEK A;  4KBQ A;  3FUH A;  4FJY A;  2XCB A;  2ZU6 B;  5FJY A;  4DI3 A;  4NUR A;  1E7U A;  3ZW3 A;  2AWI A;  2BTD A;  3FU5 A;  3LY8 A;  4J8E A;  4PS8 A;  2CG2 A;  5ARF A;  3EHM A;  2LNI A;  3T5X A;  3ZYM A;  4C0M A;  4HLE A;  2VSY A;  2AXU A;  2I1J A;  3O48 A;  4W9R A;  4XI0 A;  3QWV A;  3ASH A;  3QOU A;  4FUL A;  3ZN3 A;  2X38 A;  1OWO A;  4G26 A;  1HFA A;  4GZ5 A;  2MOW A;  1KT1 A;  4GML A;  2YNQ A;  2LAI A;  5D0Q D;  2CHW A;  1H19 A;  3D9L A;  3ML8 A;  2L6J A;  1ELR A;  3FHE A;  1FVH A;  4UI9 C;  2IU1 A;  3CHP A;  4N39 A;  1OWP A;  1UN8 A;  2L0T B;  3FUE A;  4JA7 A;  4B94 A;  3HHM A;  5AIJ A;  1HS6 A;  4JL0 A;  4XKC A;  3RRM B;  3LYA A;  4J0U A;  4CT0 A;  3ZVV A;  4L7T A;  3QK0 A;  1E8Y A;  3CK7 A;  3G2T A;  4J6I A;  3RKV A;  5KJN A;  1OWL A;  4NQ0 A;  2LO6 A;  2AXZ A;  2WXG A;  3QWP A;  4GZ6 A;  3QKY A;  5C1D A;  4BWR A;  2C0M A;  3LY9 A;  3QNK A;  3S7J A;  4AY5 A;  2AW6 A;  4HOU A;  4GYO A;  2FO7 A;  2I1K A;  2CG3 A;  3FY4 A;  4FLH A;  2E0I A;  2C0L A;  4L2L A;  1SZ9 A;  3KS2 A;  3MV2 B;  1WY6 A;  1QNF A;  4KYO B;  4IYP A;  5LCW C;  2PZI A;  3I4G A;  3IKO B;  3R9A B;  4Q69 A;  3P1U A;  2CFZ A;  4GPK A;  3MGB A;  4HXI A;  3GZ2 A;  3ZPJ A;  4AXH A;  4DJA A;  1ZBP A;  4ILH B;  4AIF A;  4HOQ A;  5BPP A;  4A1S A;  3FU0 A;  4LUN U;  1L5J A;  2WXF A;  3QAQ A;  2XPZ A;  4F1S A;  4GYW A;  4JXT A;  4B8C B;  4URK A;  4WWN A;  3CK9 A;  2WXH A;  2VGX B;  3CGH A;  1EYH A;  1E8X A;  2IOL A;  3ONL A;  4M3O A;  5EKQ D;  3L16 A;  1U3C A;  3MV3 B;  2R5S A;  4KVM A;  3ENE A;  1EF1 C;  5J90 A;  3RRU A;  3ASF A;  1Z3Y A;  3UT4 A;  5T4Y A;  4DLO A;  5G05 J;  1PC2 A;  3PH0 C;  3LVR E;  4LEU A;  1E7V A;  4I1M A;  4J8F A;  2OV8 A;  4F7A A;  3B7U X;  1ELK A;  4MLP A;  2Y3A A;  3U9W A;  2BUG A;  1INZ A;  4KMO A;  4C9B B;  3JUI A;  4H7Y A;  1HU3 A;  4BX9 A;  2PQR A;  2WM9 A;  4NAC A;  4G11 A;  5G04 C;  1XNF A;  4JEH A;  3SNX A;  2KCK A;  3BG0 B;  4NRH B;  3FH8 A;  4RVB A;  1NZN A;  1HX8 A;  3TG5 A;  4AOF A;  1ELW A;  3PUK A;  4MKT A;  1X5B A;  3MCX A;  3KEZ A;  1HZ4 A;  1LF8 A;  5JHB A;  2GRM A;  3MKQ B;  4YVQ C;  5AJD A;  4ACL A;  4FA6 A;  3FH5 A;  4AP2 A;  1UG3 A;  3JYS A;  5EX3 A;  5HQ8 A;  3FUM A;  4JA9 A;  3CVW A;  1E96 B;  2X6J A;  3NF1 A;  3FUF A;  4JHJ A;  4U0S A;  2WQ6 A;  4L2Y A;  3JQ0 A;  4CEM A;  4F53 A;  2VSX E;  3UT7 A;  4GU5 A;  4TV3 A;  4AV7 A;  3SI5 A;  4DK5 A;  3SF4 A;  4LRZ A;  4YND A;  4GYY A;  5AEN A;  4CDR A;  4EQF A;  1YA0 A;  4GA0 A;  4UQZ A;  4DPR A;  2P58 C;  2CHZ A;  5LOZ A;  4JHK A;  2J09 A;  2OVF A;  4MS6 A;  4AEZ C;  2I6H A;  2V8S E;  2V0P A;  1BPO A;  4BTB A;  3CVX A;  2L9B A;  2J4D A;  2UWJ G;  4R7L A;  2HM8 A;  3KAE A;  3APD A;  2JLB A;  4LCT A;  3TXM A;  3D9M A;  3ASG A;  2WXO A;  5LCW J;  5G04 J;  3GZS A;  3PRE A;  2XQ0 A;  4EBA G;  2X6H A;  3PDN A;  2GGF A;  1EDU A;  2Y4T A;  4I43 A;  4UWH A;  4ATG A;  4CRW A;  3FFL A;  2I9C A;  3PE4 A;  4GCO A;  2BF0 X;  1TJC A;  4FHK A;  1NP7 A;  2WXI A;  5LX8 A;  1TEZ A;  3ZXS A;  3FTV A;  5JJ7 A;  3VLE A;  4JVS A;  3GW4 A;  4A55 A;  2A4Z A;  3HIZ A;  4HOS A;  2YHE A;  2OOE A;  4UWF A;  4G1T A;  3RRN B;  2LSV A;  3CV0 A;  2VJ8 A;  3JCK C;  5BUZ A;  3R7R A;  4O6F A;  3NQP A;  4RSY A;  2VTB A;  3UPV A;  1QQE A;  1MHQ A;  3B7T A;  3IBE A;  4I6G A;  3CHQ A;  4A3V A;  1Y8M A;  4N3C A;  5KJK A;  4B89 A;  2KCL A;  2YQ8 A;  2AXV A;  2YIN A;  3CIA A;  5FQ6 A;  2V4L A;  2YHC A;  4AM9 A;  3UQ3 A;  1EPU A;  3URZ A;  3MKQ A;  4FLB A;  1HO8 A;  4XZ4 A;  5G55 A;  5C2Y A;  3PZD A;  5DIZ A;  3TL5 A;  3D9N A;  5BNW A;  4ANU A;  3MEK A;  2J9Q A;  4I9E A;  5BV0 A;  1OWM A;  4I6E A;  5ANL A;  3PE3 A;  3CVV A;  4ANX A;  3LS8 A;  2C2L A;  2WMN A;  4KXK B;  5E75 A;  5FQ4 A;  4CGV A;  4HFG A;  1E8Z A;  3FU6 A;  4QFV A;  4TUU A;  4UWL A;  2FUL A;  4IUL A;  3FTW A;  3FTZ A;  2GRL A;  1GW6 A;  2EQX A;  3EHN A;  4TRQ A;  4L1B A;  1XGW A;  2ION A;  4WWP A;  4GZ3 A;  2WXQ A;  1IHG A;  3G2U A;  4E6H A;  1PY1 A;  3UUX A;  2J07 A;  3NZS A;  3PEU B;  4F3V A;  4I1O B;  3CEQ A;  3U3W A;  4I1A A;  3T8M A;  3FTX A;  4EBA A;  5KCM A;  2MHK A;  2WXM A;  4B0Z A;  2J4B A;  2NC9 A;  1H2V C;  3ZGQ A;  3FUN A;  5G05 C;  4HS2 A;  2OVB A;  3D3M A;  2DIW A;  1UJJ A;  2IJG X;  5ANR A;  3T5V A;  4XIF A;  3TJP A;  3IHV A;  4UI9 J;  4BFR A;  1PAQ A;  3I4R B;  3WXX A;  4UQY A;  4HOT A;  3LXU X;  3FTS A;  1S0P A;  4APF A;  4XKB A;  4ANW A;  2MRI A;  3UX4 A;  4PS3 A;  3MKR A;  5LP0 A;  4L23 A;  4WNG A;  1SQM A;  2R59 A;  4KZ0 A;  2WVI A;  2VTB B;  4BY6 A;  2NSZ A;  3VTX A;  3S7B A;  4B8A A;  3MJW A;  2OND A;  1HE8 A;  2WXP A;  3QWW A;  2Y4U A;  2J49 A;  3AS8 A;  5E76 A;  4GCN A;  5D0O D;  2XHE A;  5FTP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...