1WM5A

Crystal structure of the n-terminal tpr domain (1-203) of p67phox
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
207
structure length
205
Chain Sequence
AMGSMSLVEAISLWNEGVLAADKKDWKGALDAFSAVQDPHSRICFNIGCMYTILKNMTEAEKAFTRSINRDKHLAVAYFQRGMLYYQTEKYDLAIKDLKEALIQLRGNQLIDYKILGLQFKLFACEVLYNIAFMYAKKEEWKKAEEQLALATSMKSEPRHSKIDKAMECVWKQKLYEPVVIPVGKLFRPNERQVAQLKDYLGKAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the N-terminal TPR domain (1-203) of p67phox
rcsb
source organism Homo sapiens
molecule tags Hormone/growth factor
molecule keywords Neutrophil cytosol factor 2
total genus 75
structure length 205
sequence length 207
ec nomenclature
pdb deposition date 2004-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13181 TPR_8 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 1wm5A00
1NA0A 2UWJG 3Q5MA 5EX0A 2IF4A 4AY5A 4NQ0A 2FBNA 2YHCA 3TG4A 5KJKA 2GW1A 2C0LA 3CVPA 3CKBA 3FFLA 2KCVA 4HOQA 4UI9J 3MV2B 1E96B 4J8EA 4JL0A 1HXIA 2VGYA 2LSUA 4G26A 4BTAA 2HO1A 2PQNA 3CK7A 3NF1A 3S7BA 3K9IA 4HOTA 3RIBA 2L6JA 2WQHA 3KS2A 3ULQA 4GYWA 3Q4AB 1B89A 3N71A 4N3CA 4W9RA 4GCOA 4AY6A 5FT9A 3HYMB 4BT9A 4KBQA 5ARFA 3ZHEB 3LY8A 2XPIA 4UI9K 1Y8MA 4HORA 5JJ6A 1W3BA 4GA0A 4EQFA 2FEZA 3GW4A 4JA9A 4N3BA 4UQXA 4NRHB 4G1TA 4XI9A 5ARGA 2C2LA 2DBAA 2BUGA 3PE3A 3ZGQA 2E2EA 4F3VA 2HR2A 2NC9A 2PQRA 4GZ6A 4KXKB 1ELRA 3IEGA 4RG9A 3WXXA 3CKCA 4CDRA 1P5QA 4U07A 4N2SA 3ZFWA 4APOA 5CCLA 4Y6CA 4I17A 2VGXA 4JHRA 4ABNA 2XEVA 1KLXA 3AS4A 3AS5A 2Y4TA 3CVNA 4H7XA 4ME2A 4GYOA 3QWPA 4WNFA 4UI9C 2JLBA 5DBKA 4U0UA 4N3AA 3ZHEA 3GZ2A 3UPVA 4I9EA 4I9CA 5LCWC 4YVOA 2PL2A 4GA1A 5M72A 1WAO1 3ASDA 3SF4A 2FI7A 4KYOB 4WNDA 5G04C 5JJTA 2HYZA 3ZPJA 5D0QD 3RO3A 3Q15A 3MKRA 2Y4UA 4G25A 3S7DA 1A17A 1HZ4A 3OXGA 5DIZA 4U04A 5BT1A 3CVQA 2KATA 3GYZA 1IYGA 3MV3B 3VTYA 4GA2A 3FWVA 4J0UA 2R5SA 5C1DA 2P58C 2KCLA 2UY1A 2ONDA 2J9QA 3GZ1A 4I1AA 5D0OD 5AYWD 4AM9A 5G04J 2XCCA 3QWWA 2KCKA 4UQYA 2PZIA 4GZ5A 4XI0A 4XIFA 3RU0A 5LCWJ 3JYSA 2C0MA 3MEKA 1QQEA 1TJCA 3CV0A 1FCHA 3Q47B 2KC7A 2QFCA 3BEEA 2I6HA 3R9AB 3S7JA 3ESKA 3TG5A 3EDTB 5HQ8A 2VYIA 4U0SA 4WNGA 4Y6WA 3S7FA 1IHGA 2XGSA 4RG6A 3AS8A 1OUVA 5FTPA 4IN3B 2XCBA 4G24A 5A7DB 3U4TA 4GYYA 5EKQD 4BTBA 2FO7A 4CGWA 3ASFA 4HOUA 3LPZA 3RKVA 4O6FA 3TAXA 4B94A 2VSYA 4LEUA 5G05J 3U3WA 1NZNA 2FF4A 2IFUA 3ZN3A 4N2QA 4N39A 1KT1A 5CCMA 4GPKA 3MA5A 3PDNA 1WM5A 3ASHA 4JA7A 3UQ3A 2AVPA 3CK8A 4WNEA 2V5FA 3LY9A 2VQ2A 1XNFA 4H7YA 3RO2A 3QOUA 4J8FA 2OOEA 5BW8C 2XGMA 2LSVA 5G05C 5HI7A 4WUYA 4YVQC 2UY1B 1ELWA 5FZQA 3KD7A 3O48A 3OXFA 4G23A 1NA3A 2Q7FA 2VSNA 1HH8A 4I2ZA 4HOSA 3QKYA 3CK9A 3TGOA 1KT0A 1ZBPA 2MHKA 4GCNA 1QZ2A 5A6CA 2XGOA 5CHEE 1ZU2A 4GZ3A 3UUXA 4CGVA 4G2VA 1YA0A 4I2WA 3Q49B 3RJVA 3LCAA 2WPVA 5KJNA 4A1SA 3LYAA 4N5CA 5JJ7A 3FP3A 1PC2A 5EX3A 5BNWA 3LKUA 3KAEA 3CEQA 5FJYA 4J8DA 4BT8A 4BWRA 5KJLA 3LY7A 3SZ7A 4UQZA 3ASGA 2VGXB 4YNDA 5FZSA 3VTXA 3OXLA 3E4BA 3PE4A 4U0ZA 4AIFA 2LNIA 5FZRA 3QWVA 2YQ8A 3QDNA 3CVLA 3URZA 5KJMA
chains in the Genus database with same CATH superfamily
4M7CA 2I2OA 3TXMA 5ENPD 4JL0A 1HXIA 4G26A 2HO1A 3K9IA 2RKKA 1RW2A 1UJJA 4N3CA 4GTMA 4L2LA 4BT9A 5CERB 2WXOA 2NYJA 4FADA 4F3VA 1ELRA 5CCLA 1DNPA 2XEVA 1Z5SC 3UI2A 1FVHA 3IHYA 2BEDA 1WAO1 4WNDA 3D9NA 2LAHA 3PNLB 3ZPJA 4B8AA 3FEXA 2R59A 2WMNA 4I1AA 3BG1B 3IHVA 3OAWA 4BX9A 2EIJE 1VDYA 3TWUA 4MRUA 2ETCA 2A5UA 4OVVA 3TWTA 1NZNA 5HRYA 3QJZA 1H0AA 4WNEA 3CGHA 3EUVA 1TN7A 3OXFA 4PS8A 3CSTA 4ATGA 4HS2A 5CMWA 4ANVA 1JCRA 3RJVA 2WB2A 2WPVA 4F1SA 4BT8A 4XKBA 2JEKA 3L13A 2V0PA 3FUMA 1NA0A 4BY6A 2EQXA 2YHCA 1N0QA 1UOHA 1H2UA 3OTNA 4BTAA 3IV0A 2P9SG 3SQVA 1IXVA 3NOGD 5BPPA 2WQHA 4K5CA 3T5XA 2GRQB 2XPIA 4UI9K 2R02A 4GA0A 4N3BA 3VLDA 3ZGQA 2BUGA 4ILIA 1FVFA 2EILE 2QYUA 4APOA 4ABNA 2LXLA 3Q75A 4ME2A 2EIKE 2P9UG 2WQ6A 3JUIA 2KZTA 5CBNA 4ANXA 3S7DA 4I6JA 5D2MC 2KCKA 3B7RL 3ASNE 3PUKA 3JYSA 4G11A 5KBAA 1BPOA 4RVBA 5HQ8A 3PEUB 1OWLA 3S7FA 4O6FA 3JCKC 3LS8A 4O1OA 1TJFA 2LUHA 1WM5A 4JA7A 3CK8A 1FT1A 4L7TA 3QC1A 2EIME 3KEZA 1WY6A 1OWMA 3IKOB 1ELWA 2CG2A 3AG2E 4GTOA 4RQIA 3FUEA 2ZISA 2VGEA 1IKND 5IY5E 3VLEA 3FY4A 3T8MA 3UM3A 4G8KA 1TEZA 2YQ8A 3B95A 1WG0A 3HDXA 2IF4A 4NQ0A 3CVPA 1O1RA 4RSYA 4ILGA 1E8WA 1OCZE 4GYWA 3SNXA 5G55A 3D3MA 3IBEA 3R7QA 4U7EB 4BETA 2IO2C 2VGXA 1MZCA 3MKQB 4J6IA 1OWNA 4L23A 4HRLA 2DWZA 3B13A 2PL2A 5FQ8A 1IQRA 4FJYA 4MS6A 4O60A 2KBXA 3CVQA 1IHBA 2IEJA 4EBAG 3LDZA 2LXMA 3QWWA 2PZIA 2XEEA 3G2VA 2AXZA 3AG1E 3ESKA 2PM6A 2DCPA 2XQ0A 3SY2A 5A7DB 4B93B 3PS6A 2RG8A 1ZB1A 4E85A 5BXUA 2R2LA 2UY1B 4KT6B 4LNGA 3NBNB 3G2SA 4F53A 3NQPA 3EJNA 3UKRG 5ITZF 2DZNA 1E8ZA 4YDEA 4CZ2D 4N5CA 3RSEG 1PC2A 2A5EA 3DEPA 1H6PA 1YMPA 4C0MA 4OAUC 5BUZA 5KWDA 3PE4A 5BXOA 2UWJG 4DRXE 3T8KA 4CDMA 3PNTB 2WXFA 3ZIMA 4HOQA 4UI9J 2LSUA 1EDUA 4DX2A 3CK7A 1TN6A 3N71A 4HFGA 1TNUA 3TXNA 5ARFA 1JCQA 2NXPA 5JJ6A 5BW8C 2C2LA 3PE3A 4CT0A 1UG3A 4RG9A 3UKUG 4U8VD 4H7XA 4F6RD 4I9EA 5H7PA 4A63B 3FUHA 2J8SD 4D10C 5G04C 4GTTA 3I4GA 1ELKA 3MV3B 2HE0A 2KCLA 1E7UA 5G04J 2WXPA 4BSZB 3L54A 2C0MA 3Q78A 2QFCA 2RFAA 3ABLE 4WNGA 4DLQA 2AXUA 1Q2ZA 3F6QA 4YDWA 3TAXA 4B94A 3U3WA 3ZN3A 4N2QA 2XZDG 2CG3A 1N94A 3PDNA 3V79K 3UMVA 4HI8A 3V2OA 1U3CA 2J49A 5HI7A 2ILRA 1BLXB 5ENOD 4HI9A 4LCTA 3D9JA 2WM9A 3FP3A 3TWWA 5CECB 3DRAA 1UN9A 1Y6IA 4WAFA 3URZA 5AENA 4AY5A 4IYPA 2XS1A 2VGYA 5D66A 3S7BA 5KNGA 2WXHA 3DXKG 1U3DA 3CQCB 3DSVA 3SD5A 1O1TA 3ZHEB 5AQBA 1W3BA 2GRLA 4G8LA 4NIKA 4CCAA 5CRUA 3IEGA 4N2SA 4U8YD 3ZKJA 1S63A 4Q94A 3E37A 3QWPA 4TXQA 4HLEA 4K0RA 2GGFA 3UT8A 3ZRHA 5DIZA 4DX7D 3JQ1A 2CFZA 3NAWA 2NSZA 3HXFA 4XIFA 3R9MA 3AU5A 1NL4A 3BEEA 3S7JA 3DSUA 1BU9A 1EYHA 4URKA 4Y6WA 3UT4A 1OUVA 4EBAA 4U8HA 4LNBA 4PS7A 4UUCA 2VSYA 3EHMA 4BFRA 4B89A 3D9MA 3L08A 1LF8A 1OCOE 1BI7B 3CHSA 3CVWA 4B0ZA 4FHJA 3ABKE 1Z6TA 3TWRA 3TL5A 1QZ2A 4N5QA 4LERA 2WXGA 3AG3E 3RAUA 3KSLA 2X38A 5AIJA 4YNDA 2LNIA 1KZOA 4FJZA 2WXIA 5KJKA 2J09A 4YDOA 1N4RA 1OCCE 3ZVVA 3KS2A 3Q4AB 4W9RA 1RZ4A 3V31A 1Y8MA 4QQIA 2XENA 4ZFHA 3FUNA 3X2QE 2A4ZA 4X8QA 2MRIA 4EZKA 1G3NB 5LX8A 1LTXA 4FULA 2E0IA 3CQGB 3CHPA 4QFVA 3NZSA 5AN8A 3PZ3A 3FTVA 4OVUA 3GYZA 2EINE 4GU5A 2IU1A 3V30A 4ANWA 4L1BA 3J5PA 3L22A 1U2VG 1S64A 4KVOA 4DX1A 3MEKA 2KC7A 2I6HA 4DI3A 3W9GA 4DLOA 2L0IA 3U4TA 3JXIA 4WWNA 1KPSB 4ATZD 2BF0X 3UTMA 3HHMA 1UW4B 2AVPA 1JCSA 1XNFA 5FQ7A 2GROB 1E7VA 3EIQC 3E30A 3LJNA 3QKYA 1KT0A 5EYLA 1IYGA 3Q7FA 5KJNA 1HFAA 4A1SA 4L9PA 4C0EA 3KSQA 3SHFA 3TWQA 4UQZA 2F8XK 4EZLA 1N4QA 3AJIA 1K1AA 4U63A 3Q5MA 5EILA 5A23A 3B7UX 2QC9A 1BD8A 3MV2B 5FIOA 3RRMB 4EECA 5JHAA 2AJAA 1SZ9A 3NF1A 3U64A 3RIBA 1N11A 4GCOA 3T9KA 4Z68A 4NURA 2J4BA 2R03A 5A6CA 3FH5A 1H6OA 5J90A 2I9CA 4FLBA 3EHNA 4I17A 3CVNA 1D9SA 1OWPA 4U0UA 3HVEA 2PNNA 4GA1A 4KYOB 3Q15A 4G25A 3LXUX 4XZ4A 4XE0A 5AARA 2J9QA 5D0OD 1TNZA 3FTZA 2GRMA 4UQYA 4BSXA 3ZU7B 4UWHA 3FTUA 4JEUA 4EZJA 1KZPA 2BKGA 2XGSA 2H6HA 4Q96A 3MZLB 4JD2G 3CVXA 4AEZC 3RKVA 4AJWA 1GW6A 5G2NA 1TN8A 4GPKA 3ASHA 3R7RA 3HXCA 3QOUA 1E8XA 4XX5A 4YVQC 5AAOA 2P9PG 3APDA 4RLYA 4AOFA 4ILHB 2IY0C 2Q7FA 1HH8A 4GZ3A 3EHRA 3G2UA 3SBTB 3WG7E 1D8DA 4DK5A 5LP0A 4JZYA 3DSTA 1N4SA 3ASOE 2WXKA 3TG4A 3JXJA 3UM2A 2KCVA 4I6EA 2BKKB 4CDNA 3MX3A 3TWSA 4KVMA 4JHKA 2XEHA 1BI8B 5JHBA 3DXMG 4TUMA 3UPVA 3GW4A 2P9NG 2Y3AA 1JPLA 3WXXA 2X6KA 3IXEA 4KZCA 1P5QA 4GPMA 4JHRA 3D9LA 2JLBA 3ZHEA 4HOTA 2FI7A 3RK6A 2UY1A 4AM9A 2QY7A 4JW1A 4BEPA 5T3RA 2GRRB 4UWFA 5AQAA 3EU5A 4CGWA 2DYSE 3FH7A 3L6AA 4LEUA 1Z3XA 4K5BA 5FQ4A 4KMOA 2RD0A 3CR3A 2V5FA 3LY9A 5EDSA 2LSVA 5G05C 3C3RA 2FO1E 1QNFA 3PUJA 2XRZA 3C72A 3U66A 4G2VA 1YYHA 1Z3YA 4I2WA 5E75A 3ZYKA 5T4YA 3OXLA 4F1PA 5CRVA 5EX0A 2IO3C 3CKBA 3FFLA 5ENTD 2J4DA 3ONLA 4MBGA 2ZXWE 4JB8P 3FUFA 2PQNA 5AQ7A 2WMOA 1LD7A 1OT8A 2ZGGA 4IULA 2PM7A 2DYRE 3LJ3A 3BG0B 2ETAA 2HR2A 1JWGA 4U07A 4LRZA 1N0RA 4TXRA 4P29A 4YVOA 3SF4A 2H6GA 5JJTA 2J08A 5D0QD 3FH8A 1OWOA 1HG5A 4AV7A 3OXGA 1DVPA 3FULA 3VTYA 4APFA 2P58C 3CIAA 5AYWD 3RU0A 2IOLA 3FU0A 3UIPC 1MYOA 1MHQA 2XHEA 1H6KA 4U0SA 4FP7A 1PY1A 3D9PA 3G2TA 5ENNA 1NFIE 4E6HA 3FTSA 2FO7A 3ZW3A 4ACKA 3EU9A 5JMND 2FF4A 2L6BA 1K3ZD 4N39A 3RRUA 5C2YA 3MA5A 2VQ2A 4J8FA 5T8IA 4I2ZA 4GMRA 3JUEA 3UUXA 1YA0A 2CFUA 4JPSA 3KAEA 5LFAA 4J8DA 3LY7A 5FZSA 1NI1A 3B7TA 3FEYA 2V5QC 4GTSA 4R7LA 1S70B 2IJGX 3EIJA 4XEIG 4J8EA 1H2TC 5E76A 3QB2A 1WDYA 4KBQA 4ANUA 4LUNU 3APFA 4UQXA 4G1TA 3UINC 2FULA 2OVFA 1H19A 2H6FA 5CEDB 4WWPA 4I9CA 4DI4A 1DC2A 4J8YA 4DX5D 3MKRA 1A17A 3UIOC 2HM8A 2V8SE 5KCMA 3JQ0A 2P9KG 4UWGA 2ONDA 3ZNGA 1HU3A 4GZ5A 4JVSA 2VJ8A 3TG5A 2YHEA 1UN8A 2LO6A 2Y69E 4LSZE 1UJKA 3L9TA 4K03A 5ENRD 3ML8A 1DCQA 5EN5D 2OOEA 3ONKA 2X6HA 3QARA 1JWFA 2AWIA 5FZQA 5AJLA 3FUJA 4HOSA 2MHKA 3ZXSA 2QZAA 2L0TB 2VGXB 3MKQA 4CEMA 1X81A 3MJWA 1DCEA 3FUDA 2GW1A 4EPZA 5HKPA 2CHWA 4I43A 4Q69A 1X5BA 2YINA 4CT4A 4PH4B 2WVIA 2KZTB 4AY6A 3B7SA 2B6CA 3LY8A 3VLFA 5CEAA 2XPZA 4EQFA 2FEZA 5ARGA 2E2EA 4J8SA 2PQRA 1SVXA 4GZ6A 3U9WA 4OAVB 3ESLA 2IOSA 4CYMD 4Y6CA 3AS4A 3CHOA 5CMYA 5DBKA 5B1BE 2WXJA 3GZ2A 4B8CB 3P2BA 4A55A 3G2WA 2Y4UA 5AJDA 5BT1A 4U04A 2KATA 2OVBA 2KM4A 3CVYA 3HXBA 3DPDA 1QQEA 1FCHA 3Q47B 2OV8A 4O1PA 4TUUA 2X6FA 2XZTG 3AS8A 4ZHBA 4GYYA 3UT7A 3HXDA 4DX6D 1HE8A 4MKTA 3SO8A 2WXRA 5LOZA 4I1MA 1HG2A 3FTWA 3DSSA 1N4PA 1YCSB 3KD7A 3HVEB 5FQ6A 2IQCA 2V4HC 4LNUD 5CHEE 1ZU2A 1MQSA 4HRNA 5EX3A 5FJYA 2WXNA 4GTRA 2CHXA 4HLLA 4M3OA 3QDNA 4XKCA 1HS6A 2DVWA 3SFYA 5B3SE 1N54A 3ULQA 1B89A 1H2VC 3CLJA 3B7BA 3C98A 4TXPA 4GAAA 1N95A 4JA9A 4XI9A 3SFXA 4FHKA 3HXEA 3QNKA 1K8KG 4DJAA 2NC9A 3ISMC 4A3VA 2P9IG 4GZCA 3ZFWA 1KLXA 4WNFA 4GYOA 1TR4A 3AU4A 1XGWA 5M72A 1SW6A 3RO3A 2ZIRA 5C1DA 3S2AA 2XCCA 5LCWJ 4K5AB 1INZA 4HVBA 3GZSA 2VSOE 1OCRE 1N52A 3L82A 3EDTB 3D9IA 1IHGA 3ZEFA 5FTPA 4IN3B 2XCBA 2WQ7A 3CHMA 4HOUA 4HQDA 4JEHA 3E34A 1MX4A 2VTBB 4C9BB 4TV3A 2XGMA 2Y0BG 2VSNA 4BESA 1V55E 4GCNA 3UXGA 1OY3D 1SQMA 2GRPB 3EHQA 3SBSA 5BNWA 3FU6A 5KJLA 1S0PA 4CRWA 4L2YA 2ZGDA 3ZYMA 1QBQA 2C0LA 4BX8A 3FUKA 2VTBA 2WXLA 2L6JA 5EIBE 3DSXA 5FT9A 3PVLA 4FA6A 3D9OA 2CHZA 4NRHB 5AQ9A 2DBAA 4KXKB 4AXHA 3QK0A 3CKCA 3PREA 5EYPF 1TNOA 4OYSA 3BUAA 3AS5A 4GTVA 2IONA 3PZ1A 3Q9NC 2L9BA 4UWLA 4J0UA 3GZ1A 2OEVA 1EF1C 1HO8A 3T5VA 4FU3A 4C48B 1TJCA 2H6IA 4LG6A 1FT2A 3CHQA 2RFMA 3Q7AA 1MJ0A 3FTYA 2F8YA 3ASFA 5JA4D 3TWVA 2AXVA 1JUQA 3ABME 3UM0A 3DPYA 3RO2A 3UM1A 1D8EA 3O48A 1NA3A 2M63A 3CK9A 3FUIA 1ZBPA 3D9HA 4TRQA 3PRZA 1TNYA 2DIWA 2P2CP 4GTQA 3AAAC 4BWRA 3SZ7A 3ULEG 3ASGA 3NB2A 4ACLA 3E4BA 4NACA 3I4RB 3PH0C 1FPPA 1SA4A 3ULYA 3TWXA 3LVQE 1QYMA 3PZ2A 2LAIA 4HORA 3HIZA 3W9FA 4CDRA 3L17A 1MX6A 4I1OB 2ETBA 3C3QA 2MYOA 3I3NA 4FC8A 2HYZA 3LEWA 3SI5A 5HS0A 2P9LG 1HX8A 4GB9A 2B0OE 3CV0A 3MGBA 1N9AA 3CSFA 3RRNB 4U96D 2R17C 5EIDA 3C3OA 3UQ3A 3HG0D 3L16A 1O5MA 3BQOA 2JABA 4WUYA 2I1JA 3TJPA 4F7AA 2R05A 3Q79A 4HNAD 4AVXA 2XPYA 2XGOA 4CGVA 3DBSA 3Q49B 4V3IA 3LCAA 3LYAA 5JJ7A 2AW6A 3LKUA 3VTXA 3QWVA 1OXJA 2X6IA 4JXTA 4YDYA 3AG4E 4PUCA 1E96B 3APCA 1SA5A 3Q9UC 3MYVA 1A5EA 3CVUA 4FLHA 4A1GA 3PEVB 3D9KA 4U95D 4GZDA 3CVVA 1O1SA 5ENQD 4GMJA 3ENEA 4N3AA 1EPUA 5LCWC 2Y1LE 4JC8A 3LVRE 4AP2A 3ZXPA 2V4LA 1AWCB 1HZ4A 4HRMB 4HBDA 3NOCD 3FU5A 2R5SA 3TGOA 3FDHA 3KEAA 3ML9A 3DEOA 3PZDA 2WXQA 1TYQG 4G24A 5EKQD 4EHMA 3DSWA 1KT1A 5CCMA 3FHEA 5ENSD 4HB5A 4J7WA 4DPRA 4DUIA 4G23A 4KZ0A 4A3TA 3SGHA 1E8YA 1NP7A 2VSXE 1SZAA 4GTPA 5ANRA 3CEQA 2MOWA 4U0ZA 5FZRA 5KJMA 2FBNA 3ZYLA 2YNQA 1AP7A 2ZU6B 2XS8A 2I1KA 3NZUA 3O4ZA 3HYMB 2BTDA 3E32A 1HF8A 3P1UA 2WXMA 2DZOA 5BV0A 3HRAA 2OEWA 3DWLG 2OCCE 3E33A 2X6JA 3C5RA 2XRYA 4PS3A 4WWOA 2Y4TA 3PZ4A 5B1AE 4UWKA 4GMLA 4UI9C 2GRNB 4HXIA 4PDXA 3ASDA 1LD8A 1IQUA 3V2XA 3ZUVB 2J07A 3Q73A 4GA2A 1E90A 3FWVA 4BERA 4XI0A 5J08A 4MLPA 3R9AB 5FWQA 2VYIA 3SFZA 4I6GA 4RG6A 4JHJA 2F0YA 5FINA 4BTBA 3J5QB 3LPZA 3CHRA 5G05J 2IFUA 3MCXA 3I5PA 3ZYQA 1K1BA 1V54E 2QYJA 4H7YA 1MX2A 5KNHD 2KXPC 2X3MA 5BV1A 1L5JA 3UX4A 1TNBA 5CBOA 3FU3A 3FTXA 3BU8A 1PAQA 4IRUA 2F37A 3QAQA 5ANLA 4AIFA 3CVLA
chains in the Genus database with same CATH topology
5EX0A 4AY5A 3ZYMA 4IYPA 2C0LA 2I2OA 3CKBA 3FFLA 4BX8A 3TXMA 2J4DA 3ONLA 3FUKA 4JL0A 1HXIA 2VGYA 4G26A 2HO1A 3FUFA 2VTBA 2PQNA 3S7BA 3K9IA 2WMOA 2L6JA 2WXLA 2WXHA 1UJJA 4N3CA 1U3DA 3CQCB 5FT9A 3SD5A 4IULA 3PVLA 4L2LA 4BT9A 4FA6A 3ZHEB 2PM7A 2WXOA 1W3BA 2GRLA 3LJ3A 3D9OA 2CHZA 3BG0B 4NRHB 4FADA 4CCAA 2DBAA 4F3VA 2HR2A 4KXKB 1ELRA 1JWGA 3IEGA 3QK0A 3CKCA 3PREA 4U07A 4AXHA 4LRZA 4N2SA 5CCLA 4OYSA 1DNPA 2XEVA 3AS5A 4Q94A 3QWPA 4HLEA 4K0RA 4P29A 2GGFA 1FVHA 2IONA 3IHYA 3UT8A 4YVOA 3ZRHA 1WAO1 3SF4A 4WNDA 5JJTA 2J08A 3D9NA 2LAHA 3PNLB 5D0QD 3ZPJA 4B8AA 3FH8A 1OWOA 1HG5A 5DIZA 3OXGA 4AV7A 1DVPA 3FULA 2L9BA 3FEXA 3JQ1A 4UWLA 3VTYA 2CFZA 4J0UA 4APFA 2P58C 2R59A 2WMNA 3CIAA 3GZ1A 4I1AA 5AYWD 2NSZA 3RU0A 3BG1B 2IOLA 3IHVA 3FU0A 1EF1C 1HO8A 4XIFA 4FU3A 3AU5A 1TJCA 3T5VA 3OAWA 1MHQA 3BEEA 2XHEA 3S7JA 1VDYA 4BX9A 1H6KA 4U0SA 1EYHA 4URKA 4FP7A 4Y6WA 1PY1A 3D9PA 3G2TA 5ENNA 3UT4A 1OUVA 4EBAA 3CHQA 4U8HA 4MRUA 3FTSA 4E6HA 4PS7A 2A5UA 3FTYA 2FO7A 3ZW3A 3ASFA 4ACKA 4OVVA 2AXVA 2VSYA 1NZNA 2FF4A 3EHMA 1JUQA 3RRUA 4N39A 4BFRA 5C2YA 4B89A 3D9MA 3MA5A 3QJZA 1H0AA 4WNEA 3L08A 2VQ2A 1LF8A 3CGHA 3RO2A 4J8FA 3CHSA 5T8IA 3CVWA 4B0ZA 4FHJA 1Z6TA 3O48A 3OXFA 4PS8A 1NA3A 2M63A 3CSTA 4I2ZA 4HS2A 4ATGA 3CK9A 3FUIA 1ZBPA 5CMWA 3TL5A 4ANVA 1QZ2A 4TRQA 3UUXA 1YA0A 3RJVA 2WB2A 2WPVA 3PRZA 2DIWA 2CFUA 4LERA 4JPSA 3KAEA 5LFAA 2WXGA 4J8DA 4F1SA 4BT8A 2X38A 4XKBA 2JEKA 4BWRA 3LY7A 3SZ7A 5AIJA 3ASGA 4YNDA 5FZSA 3L13A 4ACLA 3E4BA 4NACA 2LNIA 3B7TA 2V0PA 3FEYA 3FUMA 1NA0A 4R7LA 4FJZA 4BY6A 2IJGX 2WXIA 2EQXA 3EIJA 2YHCA 5KJKA 1H2UA 3I4RB 2J09A 3PH0C 4J8EA 3OTNA 4BTAA 3IV0A 3ZVVA 1H2TC 5BPPA 2WQHA 3KS2A 3Q4AB 3LVQE 5E76A 3QB2A 4W9RA 3T5XA 4KBQA 2LAIA 4ANUA 2XPIA 4LUNU 4UI9K 1Y8MA 3APFA 4HORA 4GA0A 4UQXA 4N3BA 3VLDA 3HIZA 4G1TA 3ZGQA 2BUGA 2FULA 3FUNA 2OVFA 4ILIA 1FVFA 4CDRA 2A4ZA 2MRIA 1H19A 4APOA 4EZKA 4ABNA 3L17A 5LX8A 4FULA 4I1OB 4ME2A 2E0IA 3CQGB 4WWPA 4I9CA 3CHPA 2WQ6A 3JUIA 2KZTA 3I3NA 4DI4A 4FC8A 4QFVA 3NZSA 2HYZA 4ANXA 3FTVA 3MKRA 3S7DA 1A17A 3LEWA 4OVUA 3GYZA 3SI5A 4GU5A 2IU1A 2HM8A 2V8SE 5KCMA 4ANWA 4L1BA 3JQ0A 3L22A 4UWGA 2ONDA 4I6JA 1HU3A 2KCKA 3B7RL 4GZ5A 1HX8A 4KVOA 3PUKA 4JVSA 3JYSA 4GB9A 4G11A 3MEKA 3CV0A 2KC7A 2I6HA 4DI3A 2VJ8A 3TG5A 1BPOA 3MGBA 4RVBA 5HQ8A 3PEUB 1OWLA 2YHEA 3S7FA 4DLOA 2L0IA 1UN8A 2LO6A 3CSFA 3U4TA 4WWNA 3RRNB 4O6FA 1UJKA 2BF0X 3JCKC 3LS8A 3HHMA 1UW4B 2R17C 1TJFA 4JA7A 1WM5A 3UQ3A 2AVPA 3CK8A 4K03A 4L7TA 3QC1A 3ML8A 1XNFA 3L16A 3KEZA 1WY6A 5FQ7A 2OOEA 3ONKA 2X6HA 3QARA 1OWMA 1JWFA 3IKOB 4WUYA 1E7VA 2I1JA 2AWIA 3TJPA 1ELWA 5FZQA 5AJLA 4F7AA 3EIQC 2CG2A 3FUJA 3QKYA 4HOSA 1KT0A 2MHKA 4AVXA 2XPYA 2XGOA 1IYGA 4CGVA 3DBSA 3Q49B 4V3IA 3LCAA 1HFAA 5KJNA 4A1SA 3LYAA 5JJ7A 2AW6A 3FUEA 3ZXSA 4C0EA 3LKUA 2L0TB 3SHFA 4UQZA 2VGXB 3MKQA 3VLEA 3FY4A 3T8MA 3VTXA 4EZLA 4CEMA 3QWVA 1TEZA 2YQ8A 4U63A 3Q5MA 3MJWA 3HDXA 2X6IA 2IF4A 4NQ0A 4JXTA 3FUDA 2GW1A 3CVPA 4EPZA 5A23A 3B7UX 4RSYA 2CHWA 4PUCA 3MV2B 4I43A 1E96B 4Q69A 1X5BA 3APCA 4ILGA 3RRMB 4EECA 1E8WA 5JHAA 3MYVA 1SZ9A 3NF1A 3U64A 2YINA 4CT4A 3RIBA 4PH4B 3CVUA 4FLHA 4GYWA 4A1GA 3PEVB 2WVIA 2KZTB 3SNXA 4AY6A 4GCOA 3B7SA 5G55A 3LY8A 3D3MA 3IBEA 4NURA 3VLFA 2XPZA 2J4BA 4EQFA 2FEZA 5A6CA 5ARGA 3R7QA 3D9KA 4GZDA 2E2EA 3FH5A 3CVVA 5J90A 2I9CA 2PQRA 4GZ6A 4J8SA 4FLBA 3U9WA 3EHNA 3ESLA 2IOSA 4Y6CA 4I17A 2VGXA 3MKQB 3AS4A 3CVNA 3CHOA 3ENEA 4GMJA 4J6IA 1OWNA 4L23A 1OWPA 5CMYA 4U0UA 4N3AA 5DBKA 2WXJA 3GZ2A 3HVEA 3B13A 4B8CB 2PL2A 1EPUA 4GA1A 1IQRA 3P2BA 5FQ8A 4A55A 4KYOB 5LCWC 4FJYA 3G2WA 3LVRE 4JC8A 4MS6A 3Q15A 4AP2A 2Y4UA 4G25A 5AJDA 2V4LA 1HZ4A 5BT1A 4U04A 3CVQA 2KATA 3LXUX 4XZ4A 4XE0A 2OVBA 3FU5A 2KM4A 2R5SA 3TGOA 3FDHA 4EBAG 3CVYA 2J9QA 5D0OD 3LDZA 3DPDA 2GRMA 3FTZA 2PZIA 3G2VA 3ML9A 3QWWA 4UQYA 4BSXA 4UWHA 2AXZA 1QQEA 3FTUA 4JEUA 1FCHA 4EZJA 3Q47B 3PZDA 2WXQA 3ESKA 2OV8A 2PM6A 2DCPA 4TUUA 2X6FA 2XGSA 3AS8A 4Q96A 3MZLB 2XQ0A 4G24A 5A7DB 4GYYA 5EKQD 3UT7A 4AEZC 3CVXA 3RKVA 3PS6A 4AJWA 1GW6A 5G2NA 2RG8A 1KT1A 5CCMA 4GPKA 1HE8A 3ASHA 4MKTA 3FHEA 2WXRA 5LOZA 3R7RA 4I1MA 1HG2A 3FTWA 3QOUA 1E8XA 4E85A 4XX5A 4YVQC 2UY1B 3APDA 4KT6B 4AOFA 4DPRA 3KD7A 4G23A 4ILHB 3G2SA 2Q7FA 3HVEB 2IQCA 1HH8A 4KZ0A 5FQ6A 3SGHA 4A3TA 4F53A 1E8YA 3NQPA 1NP7A 3EJNA 5CHEE 1ZU2A 4GZ3A 1E8ZA 2VSXE 1SZAA 4N5CA 1MQSA 3G2UA 5ANRA 5EX3A 1PC2A 3SBTB 3CEQA 5FJYA 2WXNA 4C0MA 2MOWA 4DK5A 5LP0A 4JZYA 5BUZA 3PE4A 4U0ZA 2WXKA 5FZRA 2CHXA 4M3OA 4XKCA 3QDNA 1HS6A 5KJMA 2UWJG 4CDMA 3PNTB 2FBNA 3TG4A 2WXFA 3ZYLA 3ZIMA 2KCVA 2YNQA 4I6EA 4HOQA 4UI9J 2ZU6B 4CDNA 3MX3A 2LSUA 1EDUA 3CK7A 4KVMA 1N54A 3ULQA 2I1KA 4JHKA 1B89A 3N71A 3NZUA 3O4ZA 1H2VC 4HFGA 3HYMB 3TXNA 3CLJA 2BTDA 3C98A 5ARFA 1HF8A 3P1UA 4GAAA 2NXPA 5JHBA 2WXMA 5JJ6A 3UPVA 3GW4A 4JA9A 5BW8C 5BV0A 2Y3AA 4XI9A 2C2LA 3PE3A 4FHKA 2X6JA 3QNKA 4CT0A 1UG3A 2XRYA 1JPLA 2NC9A 2X6KA 4RG9A 3WXXA 4KZCA 4A3VA 4DJAA 1P5QA 4GZCA 4PS3A 3ZFWA 4JHRA 4WWOA 1KLXA 4H7XA 2Y4TA 4WNFA 3D9LA 4GYOA 4UWKA 4GMLA 2JLBA 4UI9C 3AU4A 1XGWA 3ZHEA 4I9EA 4HXIA 4PDXA 3FUHA 5M72A 4HOTA 4D10C 3ASDA 2FI7A 5G04C 3RK6A 1IQUA 3RO3A 3I4GA 2J07A 1ELKA 3MV3B 4GA2A 1E90A 3FWVA 5C1DA 3S2AA 2KCLA 2UY1A 4AM9A 1E7UA 2QY7A 2XCCA 5G04J 2WXPA 4XI0A 5LCWJ 1INZA 3L54A 4HVBA 5J08A 2C0MA 3GZSA 4MLPA 2VSOE 4JW1A 1N52A 2QFCA 3R9AB 5T3RA 5FWQA 3EDTB 2VYIA 4WNGA 3SFZA 3D9IA 4I6GA 1IHGA 4RG6A 4JHJA 4UWFA 4DLQA 2AXUA 3ZEFA 5FTPA 4IN3B 2XCBA 4BTBA 2WQ7A 4CGWA 3CHMA 3FH7A 3TAXA 4HOUA 3LPZA 4B94A 3L6AA 3CHRA 4LEUA 5G05J 3U3WA 3ZN3A 2IFUA 4JEHA 1Z3XA 4N2QA 3MCXA 3I5PA 2CG3A 5FQ4A 3PDNA 3ZYQA 4KMOA 2RD0A 3CR3A 2VTBB 3UMVA 4C9BB 2V5FA 3LY9A 5EDSA 4H7YA 1U3CA 4TV3A 2J49A 2XGMA 2LSVA 5G05C 5HI7A 2ILRA 2X3MA 5BV1A 1L5JA 1QNFA 3PUJA 2VSNA 2XRZA 3UX4A 4LCTA 4GCNA 3U66A 3FU3A 3D9JA 3FTXA 4G2VA 1Z3YA 4I2WA 1SQMA 5E75A 3SBSA 1PAQA 2WM9A 3FP3A 5BNWA 3ZYKA 3FU6A 5T4YA 5KJLA 4IRUA 1UN9A 1Y6IA 3QAQA 4WAFA 3OXLA 1S0PA 4CRWA 5ANLA 4AIFA 4L2YA 3CVLA 3URZA 5AENA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NA0 A;  2UWJ G;  3Q5M A;  5EX0 A;  2IF4 A;  4AY5 A;  4NQ0 A;  2FBN A;  2YHC A;  3TG4 A;  5KJK A;  2GW1 A;  2C0L A;  3CVP A;  3CKB A;  3FFL A;  2KCV A;  4HOQ A;  4UI9 J;  3MV2 B;  1E96 B;  4J8E A;  4JL0 A;  1HXI A;  2VGY A;  2LSU A;  4G26 A;  4BTA A;  2HO1 A;  2PQN A;  3CK7 A;  3NF1 A;  3S7B A;  3K9I A;  4HOT A;  3RIB A;  2L6J A;  2WQH A;  3KS2 A;  3ULQ A;  4GYW A;  3Q4A B;  1B89 A;  3N71 A;  4N3C A;  4W9R A;  4GCO A;  4AY6 A;  5FT9 A;  3HYM B;  4BT9 A;  4KBQ A;  5ARF A;  3ZHE B;  3LY8 A;  2XPI A;  4UI9 K;  1Y8M A;  4HOR A;  5JJ6 A;  1W3B A;  4GA0 A;  4EQF A;  2FEZ A;  3GW4 A;  4JA9 A;  4N3B A;  4UQX A;  4NRH B;  4G1T A;  4XI9 A;  5ARG A;  2C2L A;  2DBA A;  2BUG A;  3PE3 A;  3ZGQ A;  2E2E A;  4F3V A;  2HR2 A;  2NC9 A;  2PQR A;  4GZ6 A;  4KXK B;  1ELR A;  3IEG A;  4RG9 A;  3WXX A;  3CKC A;  4CDR A;  1P5Q A;  4U07 A;  4N2S A;  3ZFW A;  4APO A;  5CCL A;  4Y6C A;  4I17 A;  2VGX A;  4JHR A;  4ABN A;  2XEV A;  1KLX A;  3AS4 A;  3AS5 A;  2Y4T A;  3CVN A;  4H7X A;  4ME2 A;  4GYO A;  3QWP A;  4WNF A;  4UI9 C;  2JLB A;  5DBK A;  4U0U A;  4N3A A;  3ZHE A;  3GZ2 A;  3UPV A;  4I9E A;  4I9C A;  5LCW C;  4YVO A;  2PL2 A;  4GA1 A;  5M72 A;  1WAO 1;  3ASD A;  3SF4 A;  2FI7 A;  4KYO B;  4WND A;  5G04 C;  5JJT A;  2HYZ A;  3ZPJ A;  5D0Q D;  3RO3 A;  3Q15 A;  3MKR A;  2Y4U A;  4G25 A;  3S7D A;  1A17 A;  1HZ4 A;  3OXG A;  5DIZ A;  4U04 A;  5BT1 A;  3CVQ A;  2KAT A;  3GYZ A;  1IYG A;  3MV3 B;  3VTY A;  4GA2 A;  3FWV A;  4J0U A;  2R5S A;  5C1D A;  2P58 C;  2KCL A;  2UY1 A;  2OND A;  2J9Q A;  3GZ1 A;  4I1A A;  5D0O D;  5AYW D;  4AM9 A;  5G04 J;  2XCC A;  3QWW A;  2KCK A;  4UQY A;  2PZI A;  4GZ5 A;  4XI0 A;  4XIF A;  3RU0 A;  5LCW J;  3JYS A;  2C0M A;  3MEK A;  1QQE A;  1TJC A;  3CV0 A;  1FCH A;  3Q47 B;  2KC7 A;  2QFC A;  3BEE A;  2I6H A;  3R9A B;  3S7J A;  3ESK A;  3TG5 A;  3EDT B;  5HQ8 A;  2VYI A;  4U0S A;  4WNG A;  4Y6W A;  3S7F A;  1IHG A;  2XGS A;  4RG6 A;  3AS8 A;  1OUV A;  5FTP A;  4IN3 B;  2XCB A;  4G24 A;  5A7D B;  3U4T A;  4GYY A;  5EKQ D;  4BTB A;  2FO7 A;  4CGW A;  3ASF A;  4HOU A;  3LPZ A;  3RKV A;  4O6F A;  3TAX A;  4B94 A;  2VSY A;  4LEU A;  5G05 J;  3U3W A;  1NZN A;  2FF4 A;  2IFU A;  3ZN3 A;  4N2Q A;  4N39 A;  1KT1 A;  5CCM A;  4GPK A;  3MA5 A;  3PDN A;  1WM5 A;  3ASH A;  4JA7 A;  3UQ3 A;  2AVP A;  3CK8 A;  4WNE A;  2V5F A;  3LY9 A;  2VQ2 A;  1XNF A;  4H7Y A;  3RO2 A;  3QOU A;  4J8F A;  2OOE A;  5BW8 C;  2XGM A;  2LSV A;  5G05 C;  5HI7 A;  4WUY A;  4YVQ C;  2UY1 B;  1ELW A;  5FZQ A;  3KD7 A;  3O48 A;  3OXF A;  4G23 A;  1NA3 A;  2Q7F A;  2VSN A;  1HH8 A;  4I2Z A;  4HOS A;  3QKY A;  3CK9 A;  3TGO A;  1KT0 A;  1ZBP A;  2MHK A;  4GCN A;  1QZ2 A;  5A6C A;  2XGO A;  5CHE E;  1ZU2 A;  4GZ3 A;  3UUX A;  4CGV A;  4G2V A;  1YA0 A;  4I2W A;  3Q49 B;  3RJV A;  3LCA A;  2WPV A;  5KJN A;  4A1S A;  3LYA A;  4N5C A;  5JJ7 A;  3FP3 A;  1PC2 A;  5EX3 A;  5BNW A;  3LKU A;  3KAE A;  3CEQ A;  5FJY A;  4J8D A;  4BT8 A;  4BWR A;  5KJL A;  3LY7 A;  3SZ7 A;  4UQZ A;  3ASG A;  2VGX B;  4YND A;  5FZS A;  3VTX A;  3OXL A;  3E4B A;  3PE4 A;  4U0Z A;  4AIF A;  2LNI A;  5FZR A;  3QWV A;  2YQ8 A;  3QDN A;  3CVL A;  3URZ A;  5KJM A; 
#chains in the Genus database with same CATH topology
 4M7C A;  2I2O A;  3TXM A;  5ENP D;  4JL0 A;  1HXI A;  4G26 A;  2HO1 A;  3K9I A;  2RKK A;  1RW2 A;  1UJJ A;  4N3C A;  4GTM A;  4L2L A;  4BT9 A;  5CER B;  2WXO A;  2NYJ A;  4FAD A;  4F3V A;  1ELR A;  5CCL A;  1DNP A;  2XEV A;  1Z5S C;  3UI2 A;  1FVH A;  3IHY A;  2BED A;  1WAO 1;  4WND A;  3D9N A;  2LAH A;  3PNL B;  3ZPJ A;  4B8A A;  3FEX A;  2R59 A;  2WMN A;  4I1A A;  3BG1 B;  3IHV A;  3OAW A;  4BX9 A;  2EIJ E;  1VDY A;  3TWU A;  4MRU A;  2ETC A;  2A5U A;  4OVV A;  3TWT A;  1NZN A;  5HRY A;  3QJZ A;  1H0A A;  4WNE A;  3CGH A;  3EUV A;  1TN7 A;  3OXF A;  4PS8 A;  3CST A;  4ATG A;  4HS2 A;  5CMW A;  4ANV A;  1JCR A;  3RJV A;  2WB2 A;  2WPV A;  4F1S A;  4BT8 A;  4XKB A;  2JEK A;  3L13 A;  2V0P A;  3FUM A;  1NA0 A;  4BY6 A;  2EQX A;  2YHC A;  1N0Q A;  1UOH A;  1H2U A;  3OTN A;  4BTA A;  3IV0 A;  2P9S G;  3SQV A;  1IXV A;  3NOG D;  5BPP A;  2WQH A;  4K5C A;  3T5X A;  2GRQ B;  2XPI A;  4UI9 K;  2R02 A;  4GA0 A;  4N3B A;  3VLD A;  3ZGQ A;  2BUG A;  4ILI A;  1FVF A;  2EIL E;  2QYU A;  4APO A;  4ABN A;  2LXL A;  3Q75 A;  4ME2 A;  2EIK E;  2P9U G;  2WQ6 A;  3JUI A;  2KZT A;  5CBN A;  4ANX A;  3S7D A;  4I6J A;  5D2M C;  2KCK A;  3B7R L;  3ASN E;  3PUK A;  3JYS A;  4G11 A;  5KBA A;  1BPO A;  4RVB A;  5HQ8 A;  3PEU B;  1OWL A;  3S7F A;  4O6F A;  3JCK C;  3LS8 A;  4O1O A;  1TJF A;  2LUH A;  1WM5 A;  4JA7 A;  3CK8 A;  1FT1 A;  4L7T A;  3QC1 A;  2EIM E;  3KEZ A;  1WY6 A;  1OWM A;  3IKO B;  1ELW A;  2CG2 A;  3AG2 E;  4GTO A;  4RQI A;  3FUE A;  2ZIS A;  2VGE A;  1IKN D;  5IY5 E;  3VLE A;  3FY4 A;  3T8M A;  3UM3 A;  4G8K A;  1TEZ A;  2YQ8 A;  3B95 A;  1WG0 A;  3HDX A;  2IF4 A;  4NQ0 A;  3CVP A;  1O1R A;  4RSY A;  4ILG A;  1E8W A;  1OCZ E;  4GYW A;  3SNX A;  5G55 A;  3D3M A;  3IBE A;  3R7Q A;  4U7E B;  4BET A;  2IO2 C;  2VGX A;  1MZC A;  3MKQ B;  4J6I A;  1OWN A;  4L23 A;  4HRL A;  2DWZ A;  3B13 A;  2PL2 A;  5FQ8 A;  1IQR A;  4FJY A;  4MS6 A;  4O60 A;  2KBX A;  3CVQ A;  1IHB A;  2IEJ A;  4EBA G;  3LDZ A;  2LXM A;  3QWW A;  2PZI A;  2XEE A;  3G2V A;  2AXZ A;  3AG1 E;  3ESK A;  2PM6 A;  2DCP A;  2XQ0 A;  3SY2 A;  5A7D B;  4B93 B;  3PS6 A;  2RG8 A;  1ZB1 A;  4E85 A;  5BXU A;  2R2L A;  2UY1 B;  4KT6 B;  4LNG A;  3NBN B;  3G2S A;  4F53 A;  3NQP A;  3EJN A;  3UKR G;  5ITZ F;  2DZN A;  1E8Z A;  4YDE A;  4CZ2 D;  4N5C A;  3RSE G;  1PC2 A;  2A5E A;  3DEP A;  1H6P A;  1YMP A;  4C0M A;  4OAU C;  5BUZ A;  5KWD A;  3PE4 A;  5BXO A;  2UWJ G;  4DRX E;  3T8K A;  4CDM A;  3PNT B;  2WXF A;  3ZIM A;  4HOQ A;  4UI9 J;  2LSU A;  1EDU A;  4DX2 A;  3CK7 A;  1TN6 A;  3N71 A;  4HFG A;  1TNU A;  3TXN A;  5ARF A;  1JCQ A;  2NXP A;  5JJ6 A;  5BW8 C;  2C2L A;  3PE3 A;  4CT0 A;  1UG3 A;  4RG9 A;  3UKU G;  4U8V D;  4H7X A;  4F6R D;  4I9E A;  5H7P A;  4A63 B;  3FUH A;  2J8S D;  4D10 C;  5G04 C;  4GTT A;  3I4G A;  1ELK A;  3MV3 B;  2HE0 A;  2KCL A;  1E7U A;  5G04 J;  2WXP A;  4BSZ B;  3L54 A;  2C0M A;  3Q78 A;  2QFC A;  2RFA A;  3ABL E;  4WNG A;  4DLQ A;  2AXU A;  1Q2Z A;  3F6Q A;  4YDW A;  3TAX A;  4B94 A;  3U3W A;  3ZN3 A;  4N2Q A;  2XZD G;  2CG3 A;  1N94 A;  3PDN A;  3V79 K;  3UMV A;  4HI8 A;  3V2O A;  1U3C A;  2J49 A;  5HI7 A;  2ILR A;  1BLX B;  5ENO D;  4HI9 A;  4LCT A;  3D9J A;  2WM9 A;  3FP3 A;  3TWW A;  5CEC B;  3DRA A;  1UN9 A;  1Y6I A;  4WAF A;  3URZ A;  5AEN A;  4AY5 A;  4IYP A;  2XS1 A;  2VGY A;  5D66 A;  3S7B A;  5KNG A;  2WXH A;  3DXK G;  1U3D A;  3CQC B;  3DSV A;  3SD5 A;  1O1T A;  3ZHE B;  5AQB A;  1W3B A;  2GRL A;  4G8L A;  4NIK A;  4CCA A;  5CRU A;  3IEG A;  4N2S A;  4U8Y D;  3ZKJ A;  1S63 A;  4Q94 A;  3E37 A;  3QWP A;  4TXQ A;  4HLE A;  4K0R A;  2GGF A;  3UT8 A;  3ZRH A;  5DIZ A;  4DX7 D;  3JQ1 A;  2CFZ A;  3NAW A;  2NSZ A;  3HXF A;  4XIF A;  3R9M A;  3AU5 A;  1NL4 A;  3BEE A;  3S7J A;  3DSU A;  1BU9 A;  1EYH A;  4URK A;  4Y6W A;  3UT4 A;  1OUV A;  4EBA A;  4U8H A;  4LNB A;  4PS7 A;  4UUC A;  2VSY A;  3EHM A;  4BFR A;  4B89 A;  3D9M A;  3L08 A;  1LF8 A;  1OCO E;  1BI7 B;  3CHS A;  3CVW A;  4B0Z A;  4FHJ A;  3ABK E;  1Z6T A;  3TWR A;  3TL5 A;  1QZ2 A;  4N5Q A;  4LER A;  2WXG A;  3AG3 E;  3RAU A;  3KSL A;  2X38 A;  5AIJ A;  4YND A;  2LNI A;  1KZO A;  4FJZ A;  2WXI A;  5KJK A;  2J09 A;  4YDO A;  1N4R A;  1OCC E;  3ZVV A;  3KS2 A;  3Q4A B;  4W9R A;  1RZ4 A;  3V31 A;  1Y8M A;  4QQI A;  2XEN A;  4ZFH A;  3FUN A;  3X2Q E;  2A4Z A;  4X8Q A;  2MRI A;  4EZK A;  1G3N B;  5LX8 A;  1LTX A;  4FUL A;  2E0I A;  3CQG B;  3CHP A;  4QFV A;  3NZS A;  5AN8 A;  3PZ3 A;  3FTV A;  4OVU A;  3GYZ A;  2EIN E;  4GU5 A;  2IU1 A;  3V30 A;  4ANW A;  4L1B A;  3J5P A;  3L22 A;  1U2V G;  1S64 A;  4KVO A;  4DX1 A;  3MEK A;  2KC7 A;  2I6H A;  4DI3 A;  3W9G A;  4DLO A;  2L0I A;  3U4T A;  3JXI A;  4WWN A;  1KPS B;  4ATZ D;  2BF0 X;  3UTM A;  3HHM A;  1UW4 B;  2AVP A;  1JCS A;  1XNF A;  5FQ7 A;  2GRO B;  1E7V A;  3EIQ C;  3E30 A;  3LJN A;  3QKY A;  1KT0 A;  5EYL A;  1IYG A;  3Q7F A;  5KJN A;  1HFA A;  4A1S A;  4L9P A;  4C0E A;  3KSQ A;  3SHF A;  3TWQ A;  4UQZ A;  2F8X K;  4EZL A;  1N4Q A;  3AJI A;  1K1A A;  4U63 A;  3Q5M A;  5EIL A;  5A23 A;  3B7U X;  2QC9 A;  1BD8 A;  3MV2 B;  5FIO A;  3RRM B;  4EEC A;  5JHA A;  2AJA A;  1SZ9 A;  3NF1 A;  3U64 A;  3RIB A;  1N11 A;  4GCO A;  3T9K A;  4Z68 A;  4NUR A;  2J4B A;  2R03 A;  5A6C A;  3FH5 A;  1H6O A;  5J90 A;  2I9C A;  4FLB A;  3EHN A;  4I17 A;  3CVN A;  1D9S A;  1OWP A;  4U0U A;  3HVE A;  2PNN A;  4GA1 A;  4KYO B;  3Q15 A;  4G25 A;  3LXU X;  4XZ4 A;  4XE0 A;  5AAR A;  2J9Q A;  5D0O D;  1TNZ A;  3FTZ A;  2GRM A;  4UQY A;  4BSX A;  3ZU7 B;  4UWH A;  3FTU A;  4JEU A;  4EZJ A;  1KZP A;  2BKG A;  2XGS A;  2H6H A;  4Q96 A;  3MZL B;  4JD2 G;  3CVX A;  4AEZ C;  3RKV A;  4AJW A;  1GW6 A;  5G2N A;  1TN8 A;  4GPK A;  3ASH A;  3R7R A;  3HXC A;  3QOU A;  1E8X A;  4XX5 A;  4YVQ C;  5AAO A;  2P9P G;  3APD A;  4RLY A;  4AOF A;  4ILH B;  2IY0 C;  2Q7F A;  1HH8 A;  4GZ3 A;  3EHR A;  3G2U A;  3SBT B;  3WG7 E;  1D8D A;  4DK5 A;  5LP0 A;  4JZY A;  3DST A;  1N4S A;  3ASO E;  2WXK A;  3TG4 A;  3JXJ A;  3UM2 A;  2KCV A;  4I6E A;  2BKK B;  4CDN A;  3MX3 A;  3TWS A;  4KVM A;  4JHK A;  2XEH A;  1BI8 B;  5JHB A;  3DXM G;  4TUM A;  3UPV A;  3GW4 A;  2P9N G;  2Y3A A;  1JPL A;  3WXX A;  2X6K A;  3IXE A;  4KZC A;  1P5Q A;  4GPM A;  4JHR A;  3D9L A;  2JLB A;  3ZHE A;  4HOT A;  2FI7 A;  3RK6 A;  2UY1 A;  4AM9 A;  2QY7 A;  4JW1 A;  4BEP A;  5T3R A;  2GRR B;  4UWF A;  5AQA A;  3EU5 A;  4CGW A;  2DYS E;  3FH7 A;  3L6A A;  4LEU A;  1Z3X A;  4K5B A;  5FQ4 A;  4KMO A;  2RD0 A;  3CR3 A;  2V5F A;  3LY9 A;  5EDS A;  2LSV A;  5G05 C;  3C3R A;  2FO1 E;  1QNF A;  3PUJ A;  2XRZ A;  3C72 A;  3U66 A;  4G2V A;  1YYH A;  1Z3Y A;  4I2W A;  5E75 A;  3ZYK A;  5T4Y A;  3OXL A;  4F1P A;  5CRV A;  5EX0 A;  2IO3 C;  3CKB A;  3FFL A;  5ENT D;  2J4D A;  3ONL A;  4MBG A;  2ZXW E;  4JB8 P;  3FUF A;  2PQN A;  5AQ7 A;  2WMO A;  1LD7 A;  1OT8 A;  2ZGG A;  4IUL A;  2PM7 A;  2DYR E;  3LJ3 A;  3BG0 B;  2ETA A;  2HR2 A;  1JWG A;  4U07 A;  4LRZ A;  1N0R A;  4TXR A;  4P29 A;  4YVO A;  3SF4 A;  2H6G A;  5JJT A;  2J08 A;  5D0Q D;  3FH8 A;  1OWO A;  1HG5 A;  4AV7 A;  3OXG A;  1DVP A;  3FUL A;  3VTY A;  4APF A;  2P58 C;  3CIA A;  5AYW D;  3RU0 A;  2IOL A;  3FU0 A;  3UIP C;  1MYO A;  1MHQ A;  2XHE A;  1H6K A;  4U0S A;  4FP7 A;  1PY1 A;  3D9P A;  3G2T A;  5ENN A;  1NFI E;  4E6H A;  3FTS A;  2FO7 A;  3ZW3 A;  4ACK A;  3EU9 A;  5JMN D;  2FF4 A;  2L6B A;  1K3Z D;  4N39 A;  3RRU A;  5C2Y A;  3MA5 A;  2VQ2 A;  4J8F A;  5T8I A;  4I2Z A;  4GMR A;  3JUE A;  3UUX A;  1YA0 A;  2CFU A;  4JPS A;  3KAE A;  5LFA A;  4J8D A;  3LY7 A;  5FZS A;  1NI1 A;  3B7T A;  3FEY A;  2V5Q C;  4GTS A;  4R7L A;  1S70 B;  2IJG X;  3EIJ A;  4XEI G;  4J8E A;  1H2T C;  5E76 A;  3QB2 A;  1WDY A;  4KBQ A;  4ANU A;  4LUN U;  3APF A;  4UQX A;  4G1T A;  3UIN C;  2FUL A;  2OVF A;  1H19 A;  2H6F A;  5CED B;  4WWP A;  4I9C A;  4DI4 A;  1DC2 A;  4J8Y A;  4DX5 D;  3MKR A;  1A17 A;  3UIO C;  2HM8 A;  2V8S E;  5KCM A;  3JQ0 A;  2P9K G;  4UWG A;  2OND A;  3ZNG A;  1HU3 A;  4GZ5 A;  4JVS A;  2VJ8 A;  3TG5 A;  2YHE A;  1UN8 A;  2LO6 A;  2Y69 E;  4LSZ E;  1UJK A;  3L9T A;  4K03 A;  5ENR D;  3ML8 A;  1DCQ A;  5EN5 D;  2OOE A;  3ONK A;  2X6H A;  3QAR A;  1JWF A;  2AWI A;  5FZQ A;  5AJL A;  3FUJ A;  4HOS A;  2MHK A;  3ZXS A;  2QZA A;  2L0T B;  2VGX B;  3MKQ A;  4CEM A;  1X81 A;  3MJW A;  1DCE A;  3FUD A;  2GW1 A;  4EPZ A;  5HKP A;  2CHW A;  4I43 A;  4Q69 A;  1X5B A;  2YIN A;  4CT4 A;  4PH4 B;  2WVI A;  2KZT B;  4AY6 A;  3B7S A;  2B6C A;  3LY8 A;  3VLF A;  5CEA A;  2XPZ A;  4EQF A;  2FEZ A;  5ARG A;  2E2E A;  4J8S A;  2PQR A;  1SVX A;  4GZ6 A;  3U9W A;  4OAV B;  3ESL A;  2IOS A;  4CYM D;  4Y6C A;  3AS4 A;  3CHO A;  5CMY A;  5DBK A;  5B1B E;  2WXJ A;  3GZ2 A;  4B8C B;  3P2B A;  4A55 A;  3G2W A;  2Y4U A;  5AJD A;  5BT1 A;  4U04 A;  2KAT A;  2OVB A;  2KM4 A;  3CVY A;  3HXB A;  3DPD A;  1QQE A;  1FCH A;  3Q47 B;  2OV8 A;  4O1P A;  4TUU A;  2X6F A;  2XZT G;  3AS8 A;  4ZHB A;  4GYY A;  3UT7 A;  3HXD A;  4DX6 D;  1HE8 A;  4MKT A;  3SO8 A;  2WXR A;  5LOZ A;  4I1M A;  1HG2 A;  3FTW A;  3DSS A;  1N4P A;  1YCS B;  3KD7 A;  3HVE B;  5FQ6 A;  2IQC A;  2V4H C;  4LNU D;  5CHE E;  1ZU2 A;  1MQS A;  4HRN A;  5EX3 A;  5FJY A;  2WXN A;  4GTR A;  2CHX A;  4HLL A;  4M3O A;  3QDN A;  4XKC A;  1HS6 A;  2DVW A;  3SFY A;  5B3S E;  1N54 A;  3ULQ A;  1B89 A;  1H2V C;  3CLJ A;  3B7B A;  3C98 A;  4TXP A;  4GAA A;  1N95 A;  4JA9 A;  4XI9 A;  3SFX A;  4FHK A;  3HXE A;  3QNK A;  1K8K G;  4DJA A;  2NC9 A;  3ISM C;  4A3V A;  2P9I G;  4GZC A;  3ZFW A;  1KLX A;  4WNF A;  4GYO A;  1TR4 A;  3AU4 A;  1XGW A;  5M72 A;  1SW6 A;  3RO3 A;  2ZIR A;  5C1D A;  3S2A A;  2XCC A;  5LCW J;  4K5A B;  1INZ A;  4HVB A;  3GZS A;  2VSO E;  1OCR E;  1N52 A;  3L82 A;  3EDT B;  3D9I A;  1IHG A;  3ZEF A;  5FTP A;  4IN3 B;  2XCB A;  2WQ7 A;  3CHM A;  4HOU A;  4HQD A;  4JEH A;  3E34 A;  1MX4 A;  2VTB B;  4C9B B;  4TV3 A;  2XGM A;  2Y0B G;  2VSN A;  4BES A;  1V55 E;  4GCN A;  3UXG A;  1OY3 D;  1SQM A;  2GRP B;  3EHQ A;  3SBS A;  5BNW A;  3FU6 A;  5KJL A;  1S0P A;  4CRW A;  4L2Y A;  2ZGD A;  3ZYM A;  1QBQ A;  2C0L A;  4BX8 A;  3FUK A;  2VTB A;  2WXL A;  2L6J A;  5EIB E;  3DSX A;  5FT9 A;  3PVL A;  4FA6 A;  3D9O A;  2CHZ A;  4NRH B;  5AQ9 A;  2DBA A;  4KXK B;  4AXH A;  3QK0 A;  3CKC A;  3PRE A;  5EYP F;  1TNO A;  4OYS A;  3BUA A;  3AS5 A;  4GTV A;  2ION A;  3PZ1 A;  3Q9N C;  2L9B A;  4UWL A;  4J0U A;  3GZ1 A;  2OEV A;  1EF1 C;  1HO8 A;  3T5V A;  4FU3 A;  4C48 B;  1TJC A;  2H6I A;  4LG6 A;  1FT2 A;  3CHQ A;  2RFM A;  3Q7A A;  1MJ0 A;  3FTY A;  2F8Y A;  3ASF A;  5JA4 D;  3TWV A;  2AXV A;  1JUQ A;  3ABM E;  3UM0 A;  3DPY A;  3RO2 A;  3UM1 A;  1D8E A;  3O48 A;  1NA3 A;  2M63 A;  3CK9 A;  3FUI A;  1ZBP A;  3D9H A;  4TRQ A;  3PRZ A;  1TNY A;  2DIW A;  2P2C P;  4GTQ A;  3AAA C;  4BWR A;  3SZ7 A;  3ULE G;  3ASG A;  3NB2 A;  4ACL A;  3E4B A;  4NAC A;  3I4R B;  3PH0 C;  1FPP A;  1SA4 A;  3ULY A;  3TWX A;  3LVQ E;  1QYM A;  3PZ2 A;  2LAI A;  4HOR A;  3HIZ A;  3W9F A;  4CDR A;  3L17 A;  1MX6 A;  4I1O B;  2ETB A;  3C3Q A;  2MYO A;  3I3N A;  4FC8 A;  2HYZ A;  3LEW A;  3SI5 A;  5HS0 A;  2P9L G;  1HX8 A;  4GB9 A;  2B0O E;  3CV0 A;  3MGB A;  1N9A A;  3CSF A;  3RRN B;  4U96 D;  2R17 C;  5EID A;  3C3O A;  3UQ3 A;  3HG0 D;  3L16 A;  1O5M A;  3BQO A;  2JAB A;  4WUY A;  2I1J A;  3TJP A;  4F7A A;  2R05 A;  3Q79 A;  4HNA D;  4AVX A;  2XPY A;  2XGO A;  4CGV A;  3DBS A;  3Q49 B;  4V3I A;  3LCA A;  3LYA A;  5JJ7 A;  2AW6 A;  3LKU A;  3VTX A;  3QWV A;  1OXJ A;  2X6I A;  4JXT A;  4YDY A;  3AG4 E;  4PUC A;  1E96 B;  3APC A;  1SA5 A;  3Q9U C;  3MYV A;  1A5E A;  3CVU A;  4FLH A;  4A1G A;  3PEV B;  3D9K A;  4U95 D;  4GZD A;  3CVV A;  1O1S A;  5ENQ D;  4GMJ A;  3ENE A;  4N3A A;  1EPU A;  5LCW C;  2Y1L E;  4JC8 A;  3LVR E;  4AP2 A;  3ZXP A;  2V4L A;  1AWC B;  1HZ4 A;  4HRM B;  4HBD A;  3NOC D;  3FU5 A;  2R5S A;  3TGO A;  3FDH A;  3KEA A;  3ML9 A;  3DEO A;  3PZD A;  2WXQ A;  1TYQ G;  4G24 A;  5EKQ D;  4EHM A;  3DSW A;  1KT1 A;  5CCM A;  3FHE A;  5ENS D;  4HB5 A;  4J7W A;  4DPR A;  4DUI A;  4G23 A;  4KZ0 A;  4A3T A;  3SGH A;  1E8Y A;  1NP7 A;  2VSX E;  1SZA A;  4GTP A;  5ANR A;  3CEQ A;  2MOW A;  4U0Z A;  5FZR A;  5KJM A;  2FBN A;  3ZYL A;  2YNQ A;  1AP7 A;  2ZU6 B;  2XS8 A;  2I1K A;  3NZU A;  3O4Z A;  3HYM B;  2BTD A;  3E32 A;  1HF8 A;  3P1U A;  2WXM A;  2DZO A;  5BV0 A;  3HRA A;  2OEW A;  3DWL G;  2OCC E;  3E33 A;  2X6J A;  3C5R A;  2XRY A;  4PS3 A;  4WWO A;  2Y4T A;  3PZ4 A;  5B1A E;  4UWK A;  4GML A;  4UI9 C;  2GRN B;  4HXI A;  4PDX A;  3ASD A;  1LD8 A;  1IQU A;  3V2X A;  3ZUV B;  2J07 A;  3Q73 A;  4GA2 A;  1E90 A;  3FWV A;  4BER A;  4XI0 A;  5J08 A;  4MLP A;  3R9A B;  5FWQ A;  2VYI A;  3SFZ A;  4I6G A;  4RG6 A;  4JHJ A;  2F0Y A;  5FIN A;  4BTB A;  3J5Q B;  3LPZ A;  3CHR A;  5G05 J;  2IFU A;  3MCX A;  3I5P A;  3ZYQ A;  1K1B A;  1V54 E;  2QYJ A;  4H7Y A;  1MX2 A;  5KNH D;  2KXP C;  2X3M A;  5BV1 A;  1L5J A;  3UX4 A;  1TNB A;  5CBO A;  3FU3 A;  3FTX A;  3BU8 A;  1PAQ A;  4IRU A;  2F37 A;  3QAQ A;  5ANL A;  4AIF A;  3CVL A; 
#chains in the Genus database with same CATH homology
 5EX0 A;  4AY5 A;  3ZYM A;  4IYP A;  2C0L A;  2I2O A;  3CKB A;  3FFL A;  4BX8 A;  3TXM A;  2J4D A;  3ONL A;  3FUK A;  4JL0 A;  1HXI A;  2VGY A;  4G26 A;  2HO1 A;  3FUF A;  2VTB A;  2PQN A;  3S7B A;  3K9I A;  2WMO A;  2L6J A;  2WXL A;  2WXH A;  1UJJ A;  4N3C A;  1U3D A;  3CQC B;  5FT9 A;  3SD5 A;  4IUL A;  3PVL A;  4L2L A;  4BT9 A;  4FA6 A;  3ZHE B;  2PM7 A;  2WXO A;  1W3B A;  2GRL A;  3LJ3 A;  3D9O A;  2CHZ A;  3BG0 B;  4NRH B;  4FAD A;  4CCA A;  2DBA A;  4F3V A;  2HR2 A;  4KXK B;  1ELR A;  1JWG A;  3IEG A;  3QK0 A;  3CKC A;  3PRE A;  4U07 A;  4AXH A;  4LRZ A;  4N2S A;  5CCL A;  4OYS A;  1DNP A;  2XEV A;  3AS5 A;  4Q94 A;  3QWP A;  4HLE A;  4K0R A;  4P29 A;  2GGF A;  1FVH A;  2ION A;  3IHY A;  3UT8 A;  4YVO A;  3ZRH A;  1WAO 1;  3SF4 A;  4WND A;  5JJT A;  2J08 A;  3D9N A;  2LAH A;  3PNL B;  5D0Q D;  3ZPJ A;  4B8A A;  3FH8 A;  1OWO A;  1HG5 A;  5DIZ A;  3OXG A;  4AV7 A;  1DVP A;  3FUL A;  2L9B A;  3FEX A;  3JQ1 A;  4UWL A;  3VTY A;  2CFZ A;  4J0U A;  4APF A;  2P58 C;  2R59 A;  2WMN A;  3CIA A;  3GZ1 A;  4I1A A;  5AYW D;  2NSZ A;  3RU0 A;  3BG1 B;  2IOL A;  3IHV A;  3FU0 A;  1EF1 C;  1HO8 A;  4XIF A;  4FU3 A;  3AU5 A;  1TJC A;  3T5V A;  3OAW A;  1MHQ A;  3BEE A;  2XHE A;  3S7J A;  1VDY A;  4BX9 A;  1H6K A;  4U0S A;  1EYH A;  4URK A;  4FP7 A;  4Y6W A;  1PY1 A;  3D9P A;  3G2T A;  5ENN A;  3UT4 A;  1OUV A;  4EBA A;  3CHQ A;  4U8H A;  4MRU A;  3FTS A;  4E6H A;  4PS7 A;  2A5U A;  3FTY A;  2FO7 A;  3ZW3 A;  3ASF A;  4ACK A;  4OVV A;  2AXV A;  2VSY A;  1NZN A;  2FF4 A;  3EHM A;  1JUQ A;  3RRU A;  4N39 A;  4BFR A;  5C2Y A;  4B89 A;  3D9M A;  3MA5 A;  3QJZ A;  1H0A A;  4WNE A;  3L08 A;  2VQ2 A;  1LF8 A;  3CGH A;  3RO2 A;  4J8F A;  3CHS A;  5T8I A;  3CVW A;  4B0Z A;  4FHJ A;  1Z6T A;  3O48 A;  3OXF A;  4PS8 A;  1NA3 A;  2M63 A;  3CST A;  4I2Z A;  4HS2 A;  4ATG A;  3CK9 A;  3FUI A;  1ZBP A;  5CMW A;  3TL5 A;  4ANV A;  1QZ2 A;  4TRQ A;  3UUX A;  1YA0 A;  3RJV A;  2WB2 A;  2WPV A;  3PRZ A;  2DIW A;  2CFU A;  4LER A;  4JPS A;  3KAE A;  5LFA A;  2WXG A;  4J8D A;  4F1S A;  4BT8 A;  2X38 A;  4XKB A;  2JEK A;  4BWR A;  3LY7 A;  3SZ7 A;  5AIJ A;  3ASG A;  4YND A;  5FZS A;  3L13 A;  4ACL A;  3E4B A;  4NAC A;  2LNI A;  3B7T A;  2V0P A;  3FEY A;  3FUM A;  1NA0 A;  4R7L A;  4FJZ A;  4BY6 A;  2IJG X;  2WXI A;  2EQX A;  3EIJ A;  2YHC A;  5KJK A;  1H2U A;  3I4R B;  2J09 A;  3PH0 C;  4J8E A;  3OTN A;  4BTA A;  3IV0 A;  3ZVV A;  1H2T C;  5BPP A;  2WQH A;  3KS2 A;  3Q4A B;  3LVQ E;  5E76 A;  3QB2 A;  4W9R A;  3T5X A;  4KBQ A;  2LAI A;  4ANU A;  2XPI A;  4LUN U;  4UI9 K;  1Y8M A;  3APF A;  4HOR A;  4GA0 A;  4UQX A;  4N3B A;  3VLD A;  3HIZ A;  4G1T A;  3ZGQ A;  2BUG A;  2FUL A;  3FUN A;  2OVF A;  4ILI A;  1FVF A;  4CDR A;  2A4Z A;  2MRI A;  1H19 A;  4APO A;  4EZK A;  4ABN A;  3L17 A;  5LX8 A;  4FUL A;  4I1O B;  4ME2 A;  2E0I A;  3CQG B;  4WWP A;  4I9C A;  3CHP A;  2WQ6 A;  3JUI A;  2KZT A;  3I3N A;  4DI4 A;  4FC8 A;  4QFV A;  3NZS A;  2HYZ A;  4ANX A;  3FTV A;  3MKR A;  3S7D A;  1A17 A;  3LEW A;  4OVU A;  3GYZ A;  3SI5 A;  4GU5 A;  2IU1 A;  2HM8 A;  2V8S E;  5KCM A;  4ANW A;  4L1B A;  3JQ0 A;  3L22 A;  4UWG A;  2OND A;  4I6J A;  1HU3 A;  2KCK A;  3B7R L;  4GZ5 A;  1HX8 A;  4KVO A;  3PUK A;  4JVS A;  3JYS A;  4GB9 A;  4G11 A;  3MEK A;  3CV0 A;  2KC7 A;  2I6H A;  4DI3 A;  2VJ8 A;  3TG5 A;  1BPO A;  3MGB A;  4RVB A;  5HQ8 A;  3PEU B;  1OWL A;  2YHE A;  3S7F A;  4DLO A;  2L0I A;  1UN8 A;  2LO6 A;  3CSF A;  3U4T A;  4WWN A;  3RRN B;  4O6F A;  1UJK A;  2BF0 X;  3JCK C;  3LS8 A;  3HHM A;  1UW4 B;  2R17 C;  1TJF A;  4JA7 A;  1WM5 A;  3UQ3 A;  2AVP A;  3CK8 A;  4K03 A;  4L7T A;  3QC1 A;  3ML8 A;  1XNF A;  3L16 A;  3KEZ A;  1WY6 A;  5FQ7 A;  2OOE A;  3ONK A;  2X6H A;  3QAR A;  1OWM A;  1JWF A;  3IKO B;  4WUY A;  1E7V A;  2I1J A;  2AWI A;  3TJP A;  1ELW A;  5FZQ A;  5AJL A;  4F7A A;  3EIQ C;  2CG2 A;  3FUJ A;  3QKY A;  4HOS A;  1KT0 A;  2MHK A;  4AVX A;  2XPY A;  2XGO A;  1IYG A;  4CGV A;  3DBS A;  3Q49 B;  4V3I A;  3LCA A;  1HFA A;  5KJN A;  4A1S A;  3LYA A;  5JJ7 A;  2AW6 A;  3FUE A;  3ZXS A;  4C0E A;  3LKU A;  2L0T B;  3SHF A;  4UQZ A;  2VGX B;  3MKQ A;  3VLE A;  3FY4 A;  3T8M A;  3VTX A;  4EZL A;  4CEM A;  3QWV A;  1TEZ A;  2YQ8 A;  4U63 A;  3Q5M A;  3MJW A;  3HDX A;  2X6I A;  2IF4 A;  4NQ0 A;  4JXT A;  3FUD A;  2GW1 A;  3CVP A;  4EPZ A;  5A23 A;  3B7U X;  4RSY A;  2CHW A;  4PUC A;  3MV2 B;  4I43 A;  1E96 B;  4Q69 A;  1X5B A;  3APC A;  4ILG A;  3RRM B;  4EEC A;  1E8W A;  5JHA A;  3MYV A;  1SZ9 A;  3NF1 A;  3U64 A;  2YIN A;  4CT4 A;  3RIB A;  4PH4 B;  3CVU A;  4FLH A;  4GYW A;  4A1G A;  3PEV B;  2WVI A;  2KZT B;  3SNX A;  4AY6 A;  4GCO A;  3B7S A;  5G55 A;  3LY8 A;  3D3M A;  3IBE A;  4NUR A;  3VLF A;  2XPZ A;  2J4B A;  4EQF A;  2FEZ A;  5A6C A;  5ARG A;  3R7Q A;  3D9K A;  4GZD A;  2E2E A;  3FH5 A;  3CVV A;  5J90 A;  2I9C A;  2PQR A;  4GZ6 A;  4J8S A;  4FLB A;  3U9W A;  3EHN A;  3ESL A;  2IOS A;  4Y6C A;  4I17 A;  2VGX A;  3MKQ B;  3AS4 A;  3CVN A;  3CHO A;  3ENE A;  4GMJ A;  4J6I A;  1OWN A;  4L23 A;  1OWP A;  5CMY A;  4U0U A;  4N3A A;  5DBK A;  2WXJ A;  3GZ2 A;  3HVE A;  3B13 A;  4B8C B;  2PL2 A;  1EPU A;  4GA1 A;  1IQR A;  3P2B A;  5FQ8 A;  4A55 A;  4KYO B;  5LCW C;  4FJY A;  3G2W A;  3LVR E;  4JC8 A;  4MS6 A;  3Q15 A;  4AP2 A;  2Y4U A;  4G25 A;  5AJD A;  2V4L A;  1HZ4 A;  5BT1 A;  4U04 A;  3CVQ A;  2KAT A;  3LXU X;  4XZ4 A;  4XE0 A;  2OVB A;  3FU5 A;  2KM4 A;  2R5S A;  3TGO A;  3FDH A;  4EBA G;  3CVY A;  2J9Q A;  5D0O D;  3LDZ A;  3DPD A;  2GRM A;  3FTZ A;  2PZI A;  3G2V A;  3ML9 A;  3QWW A;  4UQY A;  4BSX A;  4UWH A;  2AXZ A;  1QQE A;  3FTU A;  4JEU A;  1FCH A;  4EZJ A;  3Q47 B;  3PZD A;  2WXQ A;  3ESK A;  2OV8 A;  2PM6 A;  2DCP A;  4TUU A;  2X6F A;  2XGS A;  3AS8 A;  4Q96 A;  3MZL B;  2XQ0 A;  4G24 A;  5A7D B;  4GYY A;  5EKQ D;  3UT7 A;  4AEZ C;  3CVX A;  3RKV A;  3PS6 A;  4AJW A;  1GW6 A;  5G2N A;  2RG8 A;  1KT1 A;  5CCM A;  4GPK A;  1HE8 A;  3ASH A;  4MKT A;  3FHE A;  2WXR A;  5LOZ A;  3R7R A;  4I1M A;  1HG2 A;  3FTW A;  3QOU A;  1E8X A;  4E85 A;  4XX5 A;  4YVQ C;  2UY1 B;  3APD A;  4KT6 B;  4AOF A;  4DPR A;  3KD7 A;  4G23 A;  4ILH B;  3G2S A;  2Q7F A;  3HVE B;  2IQC A;  1HH8 A;  4KZ0 A;  5FQ6 A;  3SGH A;  4A3T A;  4F53 A;  1E8Y A;  3NQP A;  1NP7 A;  3EJN A;  5CHE E;  1ZU2 A;  4GZ3 A;  1E8Z A;  2VSX E;  1SZA A;  4N5C A;  1MQS A;  3G2U A;  5ANR A;  5EX3 A;  1PC2 A;  3SBT B;  3CEQ A;  5FJY A;  2WXN A;  4C0M A;  2MOW A;  4DK5 A;  5LP0 A;  4JZY A;  5BUZ A;  3PE4 A;  4U0Z A;  2WXK A;  5FZR A;  2CHX A;  4M3O A;  4XKC A;  3QDN A;  1HS6 A;  5KJM A;  2UWJ G;  4CDM A;  3PNT B;  2FBN A;  3TG4 A;  2WXF A;  3ZYL A;  3ZIM A;  2KCV A;  2YNQ A;  4I6E A;  4HOQ A;  4UI9 J;  2ZU6 B;  4CDN A;  3MX3 A;  2LSU A;  1EDU A;  3CK7 A;  4KVM A;  1N54 A;  3ULQ A;  2I1K A;  4JHK A;  1B89 A;  3N71 A;  3NZU A;  3O4Z A;  1H2V C;  4HFG A;  3HYM B;  3TXN A;  3CLJ A;  2BTD A;  3C98 A;  5ARF A;  1HF8 A;  3P1U A;  4GAA A;  2NXP A;  5JHB A;  2WXM A;  5JJ6 A;  3UPV A;  3GW4 A;  4JA9 A;  5BW8 C;  5BV0 A;  2Y3A A;  4XI9 A;  2C2L A;  3PE3 A;  4FHK A;  2X6J A;  3QNK A;  4CT0 A;  1UG3 A;  2XRY A;  1JPL A;  2NC9 A;  2X6K A;  4RG9 A;  3WXX A;  4KZC A;  4A3V A;  4DJA A;  1P5Q A;  4GZC A;  4PS3 A;  3ZFW A;  4JHR A;  4WWO A;  1KLX A;  4H7X A;  2Y4T A;  4WNF A;  3D9L A;  4GYO A;  4UWK A;  4GML A;  2JLB A;  4UI9 C;  3AU4 A;  1XGW A;  3ZHE A;  4I9E A;  4HXI A;  4PDX A;  3FUH A;  5M72 A;  4HOT A;  4D10 C;  3ASD A;  2FI7 A;  5G04 C;  3RK6 A;  1IQU A;  3RO3 A;  3I4G A;  2J07 A;  1ELK A;  3MV3 B;  4GA2 A;  1E90 A;  3FWV A;  5C1D A;  3S2A A;  2KCL A;  2UY1 A;  4AM9 A;  1E7U A;  2QY7 A;  2XCC A;  5G04 J;  2WXP A;  4XI0 A;  5LCW J;  1INZ A;  3L54 A;  4HVB A;  5J08 A;  2C0M A;  3GZS A;  4MLP A;  2VSO E;  4JW1 A;  1N52 A;  2QFC A;  3R9A B;  5T3R A;  5FWQ A;  3EDT B;  2VYI A;  4WNG A;  3SFZ A;  3D9I A;  4I6G A;  1IHG A;  4RG6 A;  4JHJ A;  4UWF A;  4DLQ A;  2AXU A;  3ZEF A;  5FTP A;  4IN3 B;  2XCB A;  4BTB A;  2WQ7 A;  4CGW A;  3CHM A;  3FH7 A;  3TAX A;  4HOU A;  3LPZ A;  4B94 A;  3L6A A;  3CHR A;  4LEU A;  5G05 J;  3U3W A;  3ZN3 A;  2IFU A;  4JEH A;  1Z3X A;  4N2Q A;  3MCX A;  3I5P A;  2CG3 A;  5FQ4 A;  3PDN A;  3ZYQ A;  4KMO A;  2RD0 A;  3CR3 A;  2VTB B;  3UMV A;  4C9B B;  2V5F A;  3LY9 A;  5EDS A;  4H7Y A;  1U3C A;  4TV3 A;  2J49 A;  2XGM A;  2LSV A;  5G05 C;  5HI7 A;  2ILR A;  2X3M A;  5BV1 A;  1L5J A;  1QNF A;  3PUJ A;  2VSN A;  2XRZ A;  3UX4 A;  4LCT A;  4GCN A;  3U66 A;  3FU3 A;  3D9J A;  3FTX A;  4G2V A;  1Z3Y A;  4I2W A;  1SQM A;  5E75 A;  3SBS A;  1PAQ A;  2WM9 A;  3FP3 A;  5BNW A;  3ZYK A;  3FU6 A;  5T4Y A;  5KJL A;  4IRU A;  1UN9 A;  1Y6I A;  3QAQ A;  4WAF A;  3OXL A;  1S0P A;  4CRW A;  5ANL A;  4AIF A;  4L2Y A;  3CVL A;  3URZ A;  5AEN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...