1WM5A

Crystal structure of the n-terminal tpr domain (1-203) of p67phox
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
207
structure length
205
Chain Sequence
b'AMGSMSLVEAISLWNEGVLAADKKDWKGALDAFSAVQDPHSRICFNIGCMYTILKNMTEAEKAFTRSINRDKHLAVAYFQRGMLYYQTEKYDLAIKDLKEALIQLRGNQLIDYKILGLQFKLFACEVLYNIAFMYAKKEEWKKAEEQLALATSMKSEPRHSKIDKAMECVWKQKLYEPVVIPVGKLFRPNERQVAQLKDYLGKAT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Neutrophil cytosol factor 2
publication title Crystal structure of the N-terminal TPR domain (1-203) of p67phox
rcsb
source organism Homo sapiens
molecule tags Hormone/growth factor
total genus 75
structure length 205
sequence length 207
ec nomenclature
pdb deposition date 2004-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13181 TPR_8 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 1wm5A00
1TJCA 3LPZA 3JYSA 4U0ZA 3Q47B 4O6FA 2VYIA 2AVPA 4GCNA 5G05C 3QKYA 3RU0A 3CEQA 5DIZA 5FTPA 4YNDA 2HR2A 3CVLA 3PE4A 3LCAA 2QFCA 3Q4AB 3ZPJA 3AS4A 4GZ6A 4G26A 3KS2A 5ARFA 3FWVA 5FZRA 2DBAA 3S7FA 2LSVA 5EX0A 3OXLA 3VTYA 3RIBA 2KC7A 3MA5A 4BTAA 4N2QA 3S7DA 3U3WA 4N3AA 2VGXA 5D0QD 5JJ7A 3LKUA 3WXXA 4XI0A 4G1TA 5LCWC 3GW4A 4GYOA 4U07A 2VGYA 4UQXA 3LY8A 4HOQA 4GA2A 4KXKB 1WM5A 3ZGQA 3ASGA 4UI9J 3RO3A 3MKRA 4WUYA 4GZ3A 5LCWJ 4BTBA 2XCCA 3S7JA 3CV0A 3Q5MA 1QZ2A 2IF4A 3LY7A 5JJ6A 4G2VA 4YVOA 3CKBA 3CVQA 4ME2A 4J8EA 3FP3A 3S7BA 2P58C 4H7XA 2UY1B 1QQEA 2I6HA 2OOEA 1HH8A 3N71A 3Q49B 3SF4A 1KLXA 3R9AB 2FO7A 4GZ5A 4F3VA 3MV3B 3LYAA 3TG5A 3QWPA 3EDTB 4U04A 4J8FA 2HYZA 4WNGA 4U0SA 3CK7A 2LNIA 4WNFA 5C1DA 2YHCA 2WPVA 2XGMA 3QDNA 4U0UA 4GA0A 1B89A 1A17A 5FZQA 4HOTA 2KCVA 5G05J 3QWWA 3TGOA 2FF4A 3ASHA 4G24A 2IFUA 1ELRA 5BW8C 5A6CA 4N3BA 2C0MA 5EKQD 2FBNA 3ESKA 4G23A 3RO2A 2XCBA 4AY5A 3ZHEA 3CK9A 4H7YA 1WAO1 2NC9A 3Q15A 4I2ZA 4GYWA 2E2EA 3BEEA 5FT9A 3QOUA 1YA0A 2PZIA 3IEGA 2XPIA 1NZNA 4G25A 4KYOB 4HORA 3K9IA 1NA0A 3SZ7A 3QWVA 4AM9A 2GW1A 2XGOA 2PQNA 5EX3A 1ZU2A 4J0UA 4NQ0A 5CCMA 2R5SA 5HQ8A 2MHKA 4N2SA 3CK8A 2Y4TA 3PE3A 5AYWD 4KBQA 4W9RA 1KT0A 4JL0A 3VTXA 5KJKA 1ELWA 1Y8MA 4B94A 3OXGA 3O48A 5KJNA 4JA7A 4N5CA 4Y6CA 5D0OD 1NA3A 3CVPA 4CGWA 3LY9A 2FI7A 1W3BA 3ZN3A 4A1SA 3NF1A 5A7DB 1IHGA 4UQZA 2C2LA 4I2WA 5FJYA 5FZSA 3MEKA 4I17A 2VGXB 4N3CA 2VQ2A 4JA9A 3CVNA 2XEVA 2ONDA 2VSNA 1IYGA 3GZ1A 2FEZA 4UI9K 2YQ8A 4BWRA 2KCKA 2KCLA 4J8DA 3UUXA 1HXIA 1ZBPA 4WNDA 4WNEA 4RG9A 4EQFA 3ASFA 3URZA 2WQHA 4N39A 5G04C 3UQ3A 3U4TA 3KD7A 5M72A 4RG6A 1XNFA 3OXFA 4GCOA 3KAEA 4LEUA 3RKVA 3MV2B 2PL2A 2V5FA 1FCHA 5CCLA 5DBKA 1PC2A 2XGSA 2Q7FA 4Y6WA 2BUGA 5G04J 4CDRA 4CGVA 4I1AA 2UY1A 2VSYA 3ASDA 5KJMA 2Y4UA 1P5QA 5KJLA 4I9EA 4UQYA 1E96B 4HOSA 3E4BA 3GYZA 5BT1A 4UI9C 2HO1A 1OUVA 4I9CA 3FFLA 1KT1A 4BT9A 3TAXA 2LSUA 5CHEE 3AS5A 4NRHB 4YVQC 3UPVA 4BT8A 2JLBA 4IN3B 5ARGA 5BNWA 4XI9A 5JJTA 4GPKA 4GYYA 4GA1A 4AIFA 3CKCA 3HYMB 2KATA 4HOUA 3PDNA 3ULQA 2L6JA 5HI7A 4JHRA 2C0LA 3ZFWA 1HZ4A 2PQRA 3TG4A 2J9QA 4AY6A 3AS8A 3ZHEB 4XIFA 3RJVA 3GZ2A 2UWJG 4APOA 4ABNA
chains in the Genus database with same CATH superfamily
1S63A 2XRYA 4IYPA 4DX1A 3TWQA 4CCAA 3Q47B 4K5AB 4XZ4A 5G05C 3FU3A 4I6EA 3CEQA 5DIZA 5CEDB 4EZJA 3ESLA 3ABME 3P1UA 5FTPA 3L54A 5CRVA 2V0PA 4BETA 3LCAA 4KMOA 4KVOA 4I6GA 3CQGB 2QFCA 4GZ6A 2DBAA 3S7FA 4ATGA 5EX0A 3Q78A 3V79K 5EYLA 2KC7A 1MQSA 3NOCD 1K3ZD 2RKKA 3U3WA 3KEZA 1IXVA 1AWCB 4N3AA 5ANLA 2GRMA 4GTRA 3B13A 4K5CA 2VGXA 1E7UA 1N52A 4JB8P 3PREA 4GYOA 1SQMA 3APDA 2MYOA 2VGYA 2WM9A 3DPYA 2X38A 3RK6A 2CHXA 4HOQA 4FU3A 4OAUC 2OEVA 4KXKB 3LVRE 4P29A 1S70B 3MKRA 5AQBA 2Y1LE 3DPDA 1BD8A 3J5QB 3U9WA 1OCRE 2XCCA 3S7JA 2IF4A 5JJ6A 2PM6A 4G2VA 4J8EA 2MOWA 4DLOA 1TNOA 4NURA 3V31A 1Y6IA 2J8SD 2P58C 2X3MA 3WG7E 3TWUA 1N9AA 2Y3AA 3UM0A 2IEJA 1MX2A 3SF4A 3R9AB 5HKPA 2EIJE 3IHYA 1OWLA 4CT0A 3FH5A 3Q75A 1O1SA 3QWPA 2P9SG 2IO2C 3BU8A 4U04A 4J8FA 3CK7A 2LNIA 4WNFA 2F37A 1MX6A 3HXDA 4WWOA 4DI4A 4WWPA 2XGMA 3NB2A 1QYMA 3QDNA 3Q7FA 4BFRA 3L9TA 3CQCB 3IV0A 4GA0A 2V8SE 4HOTA 2KCVA 3TGOA 2WMNA 4G24A 2WXNA 2AXUA 4K0RA 2X6IA 4G11A 3V2XA 1N54A 2EIME 1H2VC 2GRLA 4J7WA 5AJDA 3QC1A 3IBEA 4X8QA 3NZSA 4V3IA 4DX2A 1HG2A 3UXGA 4GYWA 2E2EA 3BEEA 4O1PA 3FUHA 5FT9A 5FQ4A 3QOUA 1YYHA 3TWVA 3SFYA 4L2YA 4KYOB 3K9IA 1NA0A 2OVBA 4U8YD 3CHSA 3DEOA 4AM9A 3Q73A 5FWQA 4J0UA 4NQ0A 4L23A 1MYOA 4FP7A 3FUFA 4DUIA 4HFGA 4F1PA 5KJNA 3HIZA 4N5CA 4YDEA 3SHFA 4GMLA 1H6KA 1KZPA 3T9KA 4CGWA 5D66A 4HI9A 4JD2G 1DC2A 4KT6B 2X6JA 1W3BA 2C2LA 4HRLA 2YHEA 2QYUA 3ZIMA 1H19A 3AU4A 2EIKE 5AENA 2WXKA 4A3TA 3Q7AA 3HHMA 3PZDA 1HXIA 1ZBPA 2H6FA 4WNEA 4EPZA 1N4SA 4CRWA 1U2VG 2WQHA 4HXIA 4XE0A 1UJKA 5CBNA 5AQ7A 5AJLA 3HVEA 1FVFA 4LEUA 2DIWA 2PL2A 1FCHA 3PH0C 3HXEA 4PS7A 1JWGA 5AN8A 2J07A 2XEEA 1MHQA 3ML9A 4CGVA 4F53A 3PVLA 3J5PA 2I9CA 2LXLA 5AIJA 1P5QA 2H6IA 1ZB1A 4HOSA 3E4BA 5FINA 3GYZA 3EHRA 4UI9C 2A4ZA 5T3RA 3C5RA 4N5QA 2XPYA 4I9CA 4JPSA 3DBSA 4O60A 2QYJA 2JLBA 1V54E 5EIDA 3Q79A 4OVUA 4LG6A 1S64A 1LF8A 3QAQA 2AXZA 4GPKA 4GA1A 2R05A 4LRZA 2IONA 1NL4A 3V2OA 4DPRA 3HYMB 4HOUA 3D9MA 2AXVA 3IKOB 2L6JA 3B7TA 4JHRA 3MYVA 3E37A 1MX4A 1HU3A 2MRIA 1H2TC 2BEDA 1O1TA 3D9NA 3L22A 4G8LA 5JMND 3AS8A 2R59A 4RVBA 2BKKB 2IOLA 2XS8A 3DXMG 3D9KA 5E76A 2UWJG 2WXOA 4APOA 4ABNA 1TJCA 3HXCA 3P2BA 4DK5A 3CIAA 2WXQA 3L16A 3G2WA 3LPZA 3JYSA 4LNUD 2FULA 2GRNB 1H2UA 2OV8A 3RRUA 2HR2A 3PE4A 3DSUA 1UJJA 3ZPJA 3QARA 1HG5A 4CYMD 3AS4A 2BF0X 3FWVA 5FZRA 1BPOA 1H0AA 4LCTA 3DEPA 3MA5A 2I2OA 3B7SA 3CVUA 5T8IA 3SFZA 4IULA 4U63A 1UN8A 4GTSA 5BV1A 2XS1A 2P9UG 3LKUA 3WXXA 1TNZA 2R17C 3DSSA 3T8MA 4XI0A 4CDNA 3GW4A 3D9HA 2P9NG 3AJIA 2ZU6B 4ZHBA 4GA2A 2JABA 1EDUA 1WM5A 1JCRA 3RO3A 3QB2A 1TR4A 2M63A 3UM1A 3HDXA 1TNUA 4AXHA 1S0PA 3FTVA 4PS8A 5AQAA 3CV0A 1QZ2A 2CHZA 3LY7A 3OAWA 1JCQA 4YVOA 4BESA 5BV0A 3CVQA 4ME2A 4C0MA 5CERB 4RSYA 1OCOE 4XX5A 1SVXA 3CLJA 3DWLG 3TXNA 4Q69A 4H7XA 3EU5A 1QQEA 5CECB 4JXTA 2OOEA 1HH8A 1DCQA 4G8KA 3FUIA 2FO7A 4GZ5A 3T5XA 4U8VD 1QBQA 4APFA 4FHJA 3EDTB 1MJ0A 4I1OB 3FTUA 5CMYA 5G55A 1QNFA 2YHCA 2LAHA 4HRNA 1FT2A 1IQRA 4J8YA 2ZXWE 4A63B 2WMOA 4NIKA 1Z3YA 2A5UA 2DYSE 5ENSD 4KVMA 4U0UA 1OWOA 3GZSA 3C3QA 3HRAA 4HNAD 3ASOE 3SO8A 3FULA 3FTYA 1LTXA 4JVSA 2IFUA 4MKTA 1UW4B 2XHEA 2I1KA 5ENTD 2FBNA 3ZUVB 4DX5D 3D9JA 2WQ7A 2IOSA 4AJWA 3AAAC 3CK9A 1UOHA 4RQIA 2NC9A 4TV3A 1KZOA 4GMJA 3L82A 3V30A 3QNKA 4K5BA 2V4HC 4BY6A 3ZXPA 3ZEFA 3AG1E 3IEGA 4R7LA 1NZNA 2YINA 1TN6A 3DSWA 1D9SA 4I1MA 1JPLA 4G25A 2R02A 3FTXA 3KEAA 2L9BA 2XEHA 3HVEB 3QWVA 2PQNA 4U96D 2J49A 2IU1A 5CCMA 4CEMA 3FUEA 5HQ8A 4I6JA 4JZYA 5CMWA 2ILRA 3UINC 5T4YA 3W9FA 1Y8MA 3O48A 4JA7A 4PUCA 3IXEA 5D0OD 3CVPA 3FEXA 4DLQA 4JEUA 3ZU7B 3ZN3A 2EQXA 3FH8A 5A7DB 3UM2A 5FJYA 5FZSA 3MEKA 3NZUA 1TNYA 3FDHA 3TWWA 2XEVA 2WB2A 4ILHB 3SGHA 2VSNA 3GZ1A 4TXRA 4M7CA 2FEZA 4UI9K 2YQ8A 2GRRB 4BWRA 5G2NA 2KCLA 4HLLA 4AVXA 4RG9A 2R03A 1WG0A 3URZA 1TJFA 5G04C 5IY5E 3U4TA 4E6HA 1FVHA 3QK0A 3CSFA 3UKRG 4AOFA 2HM8A 3LXUX 1OCZE 3UTMA 3RKVA 3PRZA 1DCEA 3Q9NC 1U3CA 5CCLA 5DBKA 3Q9UC 2XGSA 3TJPA 3FTSA 4Y6WA 3D3MA 3RSEG 2BKGA 4CDRA 4C9BB 1XGWA 2AW6A 4ZFHA 3HXFA 5H7PA 3PEVB 4I9EA 2ZISA 3SFXA 3CVWA 1V55E 5KBAA 4TXQA 5BT1A 4LERA 4UWHA 1D8EA 4LUNU 3X2QE 5JHBA 1OUVA 3MJWA 3FFLA 1KT1A 2VTBB 2P9LG 3AS5A 4NRHB 4YVQC 2ETCA 3UPVA 5BNWA 4JEHA 3EIJA 2H6GA 3TWRA 2LUHA 3U64A 3TWTA 3EIQC 4NACA 2L0IA 4HVBA 3NQPA 2OVFA 2DCPA 2IY0C 3CKCA 4FJZA 3L17A 4KZ0A 2KATA 3ULQA 3PDNA 1BU9A 4U7EB 3ZFWA 4XKBA 3ULEG 3RRMB 2LXMA 2J08A 5EILA 5C2YA 3GZ2A 2WQ6A 3HXBA 5B1BE 1TNBA 3EUVA 3FUDA 1WDYA 3PNLB 3CHOA 1FT1A 3PUJA 3EHMA 2Y69E 1FPPA 2EINE 1E8YA 5KCMA 4U0ZA 2P9KG 3ZXSA 4GTTA 4O6FA 2AVPA 3QKYA 1DNPA 2L0TB 4YNDA 1LD8A 5LP0A 2VSXE 3B7UX 3KS2A 2DVWA 2WXLA 4UWLA 2LSVA 3VTYA 2ZGDA 4HBDA 3RIBA 2FO1E 2OEWA 5ENNA 2ETBA 4BTAA 2GGFA 2CHWA 3B7BA 4DX7D 1RZ4A 4ILGA 1O1RA 3LJNA 4OYSA 4MLPA 5D0QD 3ABKE 4G1TA 4PDXA 5LCWC 3CVYA 2JEKA 2XPZA 1IKND 3LY8A 4ATZD 2LAIA 4GU5A 3FEYA 5D2MC 5JA4D 4A1GA 4UWKA 3ZGQA 3ASGA 4WUYA 4GZ3A 4L1BA 4EHMA 4A3VA 3FTWA 3Q5MA 4F1SA 2YNQA 5EYPF 4AV7A 2XENA 2V4LA 3CKBA 4XEIG 3BG0B 4B8AA 4FJYA 3S7BA 4GTMA 2A5EA 2WXMA 2WXPA 2UY1B 1EPUA 2CG2A 3ZKJA 2H6HA 1D8DA 3Q49B 3EU9A 3ONKA 4IRUA 3ZYLA 3MV3B 3LYAA 2XQ0A 2GRPB 1OWNA 4DX6D 1N94A 2HYZA 3NBNB 4TRQA 3JXIA 1IQUA 3CGHA 4GB9A 4FC8A 2WPVA 2VTBA 1EF1C 3AG2E 3FHEA 3PUKA 4ACKA 2RFMA 1PY1A 3DRAA 3JUIA 4URKA 1B89A 5ANRA 1K1AA 4FHKA 2X6FA 5G05J 3QWWA 2FF4A 4TXPA 3ASHA 4N3BA 2X6HA 3B7RL 2C0MA 3DXKG 5EKQD 2DYRE 5KNGA 2EILE 4QFVA 3R9MA 2CG3A 3F6QA 4XKCA 3ESKA 4G23A 3RO2A 3E34A 3SBTB 1OXJA 5LFAA 1OY3D 4AY5A 3DSVA 3FUMA 5BXOA 5EIBE 4H7YA 3Q15A 3PZ2A 2P9PG 2XRZA 3FY4A 2I1JA 1JCSA 1YA0A 2XPIA 2ZIRA 2BTDA 4D10C 1G3NB 1UN9A 3ZYKA 5JHAA 3FTZA 2IO3C 3TWXA 2V5QC 2XGOA 5BUZA 3MKQB 1INZA 5EX3A 5BXUA 2R5SA 3AU5A 4YDYA 2MHKA 1OT8A 2WVIA 1HX8A 1X81A 2Y4TA 4CZ2D 5ENQD 5AYWD 3FUNA 4MBGA 1KT0A 4OAVB 4JL0A 3RRNB 1HS6A 4B93B 1BI8B 4Y6CA 1NA3A 3VLDA 1BLXB 2KM4A 3ABLE 4GZCA 3LY9A 3D9OA 3NF1A 4UQZA 4I2WA 4C48B 5AAOA 3APFA 4CT4A 4N3CA 2VQ2A 3CVNA 1KPSB 3TXMA 1K1BA 4J6IA 2KCKA 1SA5A 4J8DA 1OCCE 4UWGA 4L7TA 3UT4A 4B0ZA 2DZOA 4EQFA 5HS0A 4N39A 2GROB 4BSXA 2RFAA 4RLYA 4HLEA 3E32A 3KD7A 3AG3E 3LVQE 1XNFA 3OXFA 2XZTG 4GCOA 1K8KG 3ZNGA 3NAWA 2NYJA 3SI5A 3L13A 3PZ3A 5G04J 4EECA 2J4DA 2KZTA 3EHNA 3UX4A 2UY1A 3LJ3A 2OCCE 2VSYA 4FLBA 5KWDA 3ASDA 2Y4UA 2F8XK 2LO6A 5KJLA 3O4ZA 1E8XA 3FUKA 1Q2ZA 3MZLB 4UQYA 1O5MA 4BERA 3T5VA 4TUMA 1E96B 3I3NA 4LNBA 3MCXA 4EZLA 1A5EA 4HQDA 2VSOE 4FADA 2E0IA 3ML8A 2HO1A 3ZYMA 4YDWA 4TUUA 4C0EA 3TAXA 2LSUA 4BT8A 4WAFA 5ARGA 4XI9A 5JJTA 4GYYA 4DRXE 2XZDG 1OWMA 4AIFA 2AWIA 4KZCA 3CVXA 4CDMA 5HI7A 4PH4B 1HE8A 5CBOA 1Z3XA 1N11A 3UT7A 2PQRA 3G2SA 1HO8A 3FH7A 4PS3A 2ZGGA 4AP2A 2R2LA 3TL5A 3ZHEB 2B6CA 3APCA 2NSZA 4ILIA 4GZDA 5FIOA 3CHQA 3RJVA 1N4RA 3NOGD 4AEZC 4FA6A 3SY2A 4BSZB 4ACLA 2WXIA 4Q94A 3T8KA 4L2LA 3MGBA 2VYIA 4GCNA 3RU0A 2CFZA 4WWNA 4DI3A 4L9PA 2WXHA 3MKQA 3CVLA 3ENEA 4U8HA 1SA4A 3IHVA 1JWFA 3Q4AB 3KSLA 3LEWA 3C3OA 1N95A 4G26A 5ARFA 4HS2A 2ETAA 4F7AA 3OXLA 1SZ9A 5HRYA 4N2QA 3S7DA 3I5PA 4HRMB 3W9GA 5AQ9A 3PNTB 5CEAA 5JJ7A 5ENRD 2QY7A 4GAAA 4JHJA 4U07A 1UG3A 5AARA 1E7VA 2WXRA 4UQXA 4UWFA 1OWPA 4UI9J 4HI8A 5B1AE 5LCWJ 1JUQA 4BTBA 2HE0A 4O1OA 2DWZA 4FLHA 3JCKC 1NFIE 4JW1A 1TEZA 3G2VA 5ENPD 1X5BA 4FULA 4B89A 3FP3A 3PZ4A 4ANWA 1EYHA 3JQ0A 5A23A 4I43A 1NI1A 2RD0A 3JQ1A 5ENOD 5EDSA 1SZAA 3C72A 1TN7A 5B3SE 2WXFA 3ULYA 2GRQB 2I6HA 3TWSA 3CR3A 3N71A 3S2AA 1KLXA 4F3VA 1Z5SC 3TG5A 4BEPA 3SBSA 3SNXA 3D9LA 5KNHD 3CSTA 3ISMC 3EJNA 4WNGA 4U0SA 5C1DA 1N0RA 2DZNA 3ZYQA 3U66A 4DJAA 1Z6TA 4GMRA 1YMPA 3UMVA 1ELKA 4J8SA 1RW2A 3D9PA 1H6PA 1L5JA 2QC9A 3BQOA 3UT8A 1A17A 3HG0D 4GTQA 2WXGA 5FZQA 4YDOA 4B8CB 1GW6A 2CFUA 1U3DA 3BG1B 1ELRA 5BW8C 5LOZA 5A6CA 2PNNA 2F8YA 2NXPA 2XCBA 4LNGA 5ITZF 2J4BA 3ZHEA 1HFAA 1WAO1 3SD5A 4A55A 4I2ZA 2P2CP 4E85A 4QQIA 3JUEA 3DSTA 3FU6A 4M3OA 3CHPA 4JHKA 4GTPA 1HF8A 2F0YA 2PZIA 2X6KA 1N4PA 3ZRHA 5BPPA 4EBAA 4HORA 4U95D 3SZ7A 2GW1A 5LX8A 3UIOC 1ZU2A 4OVVA 1N4QA 4N2SA 3CK8A 4JC8A 3PE3A 2L6BA 4KBQA 3I4GA 4HB5A 4W9RA 3R7QA 1TYQG 3VTXA 3UIPC 2KZTB 5KJKA 1ELWA 2QZAA 3LS8A 4B94A 3OXGA 5FQ6A 2IJGX 4ANVA 3C98A 3LDZA 3VLEA 1LD7A 2FI7A 4F6RD 4A1SA 1IHGA 3ZW3A 3ASNE 3QJZA 2B0OE 3R7RA 4I17A 2VGXB 4JA9A 2ONDA 1DVPA 1IYGA 1SW6A 4BX9A 3PS6A 1YCSB 3RAUA 3UUXA 2PM7A 2RG8A 4WNDA 1TN8A 3ASFA 1MZCA 1E90A 1BI7B 5FQ8A 3ZVVA 5CRUA 3UQ3A 3E33A 3SQVA 5M72A 3B95A 4Q96A 4RG6A 3OTNA 3KAEA 3KSQA 3VLFA 3MV2B 2V5FA 2P9IG 3PEUB 1PC2A 2Q7FA 5FQ7A 3ONLA 2BUGA 3BUAA 3D9IA 3FUJA 1PAQA 4I1AA 2VGEA 4K03A 5KJMA 1N0QA 4LSZE 4EZKA 1IHBA 3UKUG 5J90A 3JXJA 3L6AA 1NP7A 3CVVA 1E8WA 2Y0BG 4BT9A 5CHEE 3I4RB 3UI2A 3AG4E 4IN3B 3PZ1A 3FU0A 4MRUA 5J08A 4BX8A 1AP7A 1H6OA 3G2TA 3E30A 4GPMA 1WY6A 4GTOA 3L08A 2KXPC 2WXJA 2IQCA 3CHMA 3MX3A 5E75A 4ANUA 2C0LA 3FU5A 5EN5D 4EBAG 1HZ4A 1VDYA 3C3RA 3TG4A 4UUCA 3CHRA 2J9QA 2AJAA 3G2UA 4GTVA 4AY6A 4MS6A 4ANXA 2J09A 4Z68A 4XIFA 2KBXA 3DSXA 2VJ8A 1E8ZA 3UM3A 3EHQA
chains in the Genus database with same CATH topology
1TJCA 3EHMA 2XRYA 4FA6A 4F3VA 3P2BA 4DK5A 3CIAA 2WXQA 3L16A 4ACLA 3G2WA 3LPZA 4IYPA 1E8YA 2WXIA 4Q94A 5KCMA 3JYSA 4L2LA 4U0ZA 3ZXSA 4CCAA 3MGBA 3Q47B 4O6FA 2VYIA 2AVPA 4GCNA 4XZ4A 5G05C 3QKYA 3FU3A 2FULA 4I6EA 3RU0A 3CEQA 1DNPA 5DIZA 4EZJA 3ESLA 2CFZA 4WWNA 1H2UA 2OV8A 3RRUA 2L0TB 4DI3A 3P1UA 5FTPA 3L54A 2WXHA 4YNDA 2HR2A 3MKQA 3CVLA 3PE4A 2V0PA 3ENEA 4U8HA 3LCAA 4KMOA 3IHVA 4KVOA 4I6GA 1JWFA 3CQGB 2QFCA 1UJJA 3Q4AB 3ZPJA 3QARA 1HG5A 2VSXE 5LP0A 3LEWA 3AS4A 4GZ6A 2BF0X 3B7UX 3KS2A 4G26A 4HS2A 5ARFA 3FWVA 2WXLA 4UWLA 5FZRA 1BPOA 2DBAA 2LSVA 3S7FA 4ATGA 5EX0A 4F7AA 3OXLA 3VTYA 1H0AA 4LCTA 3RIBA 1SZ9A 1MQSA 2KC7A 5ENNA 3MA5A 4BTAA 4N2QA 2GGFA 3S7DA 2I2OA 3I5PA 2CHWA 3B7SA 3CVUA 3U3WA 3KEZA 5T8IA 4ILGA 3SFZA 4IULA 4U63A 1UN8A 4N3AA 4OYSA 5ANLA 2GRMA 4MLPA 3B13A 2VGXA 5BV1A 3PNTB 1E7UA 5D0QD 5JJ7A 2QY7A 3LKUA 3WXXA 4GAAA 1N52A 4JHJA 2R17C 3T8MA 4XI0A 4G1TA 4CDNA 4PDXA 5LCWC 3GW4A 3PREA 4GYOA 1SQMA 3APDA 4U07A 3CVYA 1UG3A 2JEKA 2VGYA 2WM9A 2XPZA 1E7VA 2WXRA 2X38A 4UQXA 3LY8A 3RK6A 2ZU6B 2CHXA 2LAIA 4GU5A 3FEYA 4HOQA 4GA2A 4UWFA 4FU3A 4KXKB 3LVRE 1EDUA 1WM5A 1OWPA 4A1GA 4UWKA 4P29A 3ZGQA 3ASGA 4UI9J 3RO3A 3QB2A 3MKRA 4WUYA 2M63A 4GZ3A 4L1BA 5LCWJ 3DPDA 1JUQA 4A3VA 3U9WA 3HDXA 4BTBA 2XCCA 3S7JA 4AXHA 1S0PA 3FTVA 3FTWA 4FLHA 4PS8A 3CV0A 3Q5MA 1QZ2A 2CHZA 2IF4A 3LY7A 3JCKC 4F1SA 5JJ6A 4JW1A 2PM6A 1TEZA 3OAWA 3G2VA 2YNQA 4AV7A 1X5BA 2V4LA 4G2VA 4YVOA 3CKBA 5BV0A 3CVQA 4FULA 4B89A 4ME2A 4J8EA 2MOWA 4C0MA 4DLOA 3BG0B 3FP3A 4ANWA 1EYHA 4NURA 3JQ0A 5A23A 4I43A 1Y6IA 2RD0A 3JQ1A 4FJYA 3S7BA 4B8AA 2P58C 4RSYA 2X3MA 5EDSA 1SZAA 4XX5A 2WXMA 2WXPA 3CLJA 4Q69A 3TXNA 4H7XA 2UY1B 2Y3AA 2WXFA 1EPUA 1QQEA 2I6HA 4JXTA 2CG2A 2OOEA 1HH8A 3CR3A 3N71A 3S2AA 3Q49B 3ONKA 3SF4A 1KLXA 3FUIA 3R9AB 4IRUA 2FO7A 4GZ5A 3IHYA 3ZYLA 3MV3B 3LYAA 1OWLA 3SBSA 3T5XA 3SNXA 3FH5A 3TG5A 3ULQA 3D9LA 4CT0A 2XQ0A 3CSTA 3QWPA 4APFA 3EJNA 1OWNA 4FHJA 3EDTB 4U04A 4I1OB 5CMYA 3FTUA 4J8FA 5G55A 2HYZA 4WNGA 1QNFA 3CK7A 4TRQA 2LNIA 4U0SA 1IQUA 3CGHA 4WNFA 5C1DA 2YHCA 2LAHA 4GB9A 4WWOA 3ZYQA 3U66A 1IQRA 4DJAA 4FC8A 4DI4A 4WWPA 1Z6TA 2WPVA 2WMOA 2VTBA 2XGMA 1EF1C 1Z3YA 3UMVA 1ELKA 2A5UA 3FHEA 4KVMA 3PUKA 4J8SA 3QDNA 3D9PA 4U0UA 4ACKA 4BFRA 1PY1A 1OWOA 1L5JA 3GZSA 3JUIA 3CQCB 3IV0A 4GA0A 4URKA 1B89A 5ANRA 3UT8A 2V8SE 1A17A 2WXGA 4FHKA 5FZQA 4HOTA 2X6FA 2KCVA 5G05J 3QWWA 4B8CB 3TGOA 2FF4A 1GW6A 2CFUA 3ASHA 2WMNA 3FTYA 3FULA 4G24A 1U3DA 4JVSA 2WXNA 2IFUA 3BG1B 1ELRA 4MKTA 5BW8C 5LOZA 4N3BA 5A6CA 2X6HA 2AXUA 3B7RL 2C0MA 5EKQD 1UW4B 4K0RA 2XHEA 2X6IA 4G11A 4QFVA 2I1KA 2CG3A 2FBNA 1N54A 4XKCA 2NXPA 3ESKA 1H2VC 4G23A 3D9JA 3RO2A 2WQ7A 2IOSA 3SBTB 4AJWA 2XCBA 2GRLA 5LFAA 4AY5A 2J4BA 5AJDA 3FUMA 3ZHEA 3QC1A 3IBEA 3CK9A 1HFAA 4H7YA 1WAO1 2NC9A 3Q15A 4TV3A 3SD5A 4A55A 3NZSA 4I2ZA 4E85A 4V3IA 4GMJA 2XRZA 1HG2A 3FY4A 2I1JA 4GYWA 3FU6A 3QNKA 4M3OA 3CHPA 4JHKA 4BY6A 2E2EA 3BEEA 3FUHA 5FT9A 5FQ4A 3QOUA 1YA0A 1HF8A 3ZEFA 2PZIA 3IEGA 2X6KA 2XPIA 4R7LA 1NZNA 2BTDA 2YINA 4D10C 1UN9A 4I1MA 1JPLA 4G25A 4L2YA 3ZRHA 4KYOB 3ZYKA 3FTZA 4EBAA 5BPPA 5JHAA 4HORA 3K9IA 1NA0A 2OVBA 3FTXA 2L9BA 3CHSA 3SZ7A 3HVEB 3QWVA 4AM9A 2GW1A 5LX8A 2XGOA 5BUZA 2PQNA 3MKQB 5FWQA 1INZA 5EX3A 1ZU2A 2J49A 4J0UA 2IU1A 4NQ0A 4OVVA 4CEMA 5CCMA 2R5SA 3AU5A 3FUEA 5HQ8A 2MHKA 2WVIA 4N2SA 1HX8A 3CK8A 4I6JA 2Y4TA 4JC8A 4JZYA 4L23A 3PE3A 5AYWD 5CMWA 4KBQA 2ILRA 3I4GA 3FUNA 4FP7A 4W9RA 1KT0A 3FUFA 3R7QA 4JL0A 3VTXA 5T4YA 2KZTB 4HFGA 5KJKA 3RRNB 1ELWA 1Y8MA 3LS8A 4B94A 3OXGA 3O48A 5KJNA 3HIZA 5FQ6A 4JA7A 4PUCA 2IJGX 4N5CA 1HS6A 3SHFA 4GMLA 4Y6CA 5D0OD 1H6KA 1NA3A 3CVPA 3FEXA 3VLDA 4ANVA 4DLQA 4CGWA 3C98A 3LDZA 2KM4A 4JEUA 4GZCA 3LY9A 3VLEA 4KT6B 2FI7A 2X6JA 3D9OA 1W3BA 3ZN3A 4A1SA 2EQXA 3NF1A 3FH8A 1IHGA 4UQZA 5A7DB 2C2LA 3ZW3A 4I2WA 5FJYA 3QJZA 5FZSA 3APFA 2YHEA 3R7RA 3MEKA 4I17A 4CT4A 2VGXB 3NZUA 4N3CA 2VQ2A 4JA9A 3CVNA 3FDHA 2XEVA 2WB2A 4ILHB 2ONDA 3SGHA 2VSNA 1DVPA 3GZ1A 3ZIMA 1IYGA 1H19A 3AU4A 4BX9A 3TXMA 3PS6A 2FEZA 2WXKA 4UI9K 2YQ8A 4J6IA 4A3TA 2KCKA 4BWRA 5AENA 5G2NA 2KCLA 3HHMA 3PZDA 4J8DA 4UWGA 3UUXA 2PM7A 4L7TA 4AVXA 2RG8A 1HXIA 1ZBPA 4WNDA 4WNEA 3UT4A 4B0ZA 4EPZA 4RG9A 4CRWA 3ASFA 4EQFA 3URZA 1TJFA 1E90A 2WQHA 4N39A 4HXIA 4XE0A 5FQ8A 3ZVVA 4BSXA 5G04C 1UJKA 3UQ3A 3U4TA 4E6HA 1FVHA 3QK0A 4HLEA 3KD7A 3CSFA 4AOFA 2HM8A 5M72A 4Q96A 5AJLA 4RG6A 3LVQE 1XNFA 3HVEA 3LXUX 3OXFA 3OTNA 1FVFA 4GCOA 3KAEA 4LEUA 3RKVA 2DIWA 3VLFA 3MV2B 3PRZA 2PL2A 2V5FA 1FCHA 3PH0C 4PS7A 1U3CA 3PEUB 5CCLA 5DBKA 1JWGA 1PC2A 2XGSA 2J07A 2Q7FA 3FTSA 4Y6WA 5FQ7A 3D3MA 3TJPA 3SI5A 3ONLA 3L13A 2BUGA 3D9IA 3FUJA 1MHQA 3ML9A 1PAQA 5G04J 4CDRA 4EECA 4CGVA 4C9BB 2J4DA 4F53A 4I1AA 2KZTA 3EHNA 3PVLA 3UX4A 2UY1A 2I9CA 3LJ3A 5AIJA 1XGWA 2VSYA 4FLBA 2AW6A 3ASDA 4K03A 5KJMA 2Y4UA 1P5QA 2LO6A 5KJLA 3O4ZA 1E8XA 3PEVB 3FUKA 4I9EA 3MZLB 4UQYA 3T5VA 4EZKA 1E96B 3I3NA 3CVWA 5J90A 4HOSA 3E4BA 3MCXA 4EZLA 3GYZA 5BT1A 2VSOE 2A4ZA 4LERA 4UI9C 4UWHA 5T3RA 4FADA 2E0IA 3ML8A 2HO1A 3L6AA 4LUNU 1NP7A 3ZYMA 3CVVA 5JHBA 1E8WA 2XPYA 1OUVA 3MJWA 4I9CA 4TUUA 3FFLA 1KT1A 4JPSA 4BT9A 4C0EA 3DBSA 3TAXA 2LSUA 2VTBB 5CHEE 3AS5A 4NRHB 4YVQC 3I4RB 3UPVA 4BT8A 2JLBA 4WAFA 4IN3B 5ARGA 5BNWA 4JEHA 3EIJA 4XI9A 3FU0A 4MRUA 3U64A 5J08A 4BX8A 4OVUA 3G2TA 5JJTA 1LF8A 3QAQA 3EIQC 4NACA 2AXZA 2L0IA 4GPKA 4GYYA 3NQPA 4GA1A 1WY6A 2OVFA 4HVBA 3L08A 4LRZA 2DCPA 2IONA 1OWMA 4AIFA 2AWIA 2WXJA 2IQCA 4DPRA 3CHMA 3CKCA 4KZCA 3CVXA 4FJZA 3HYMB 3L17A 4KZ0A 2KATA 4HOUA 4CDMA 3D9MA 2AXVA 3IKOB 2L6JA 3PDNA 3B7TA 3MX3A 4PH4B 1HE8A 4JHRA 5E75A 5HI7A 2C0LA 4ANUA 3FU5A 3ZFWA 3MYVA 4XKBA 4EBAG 1HZ4A 1Z3XA 1VDYA 3UT7A 2PQRA 1HU3A 2MRIA 1H2TC 3G2SA 1HO8A 3TG4A 3FH7A 4PS3A 3CHRA 2J9QA 3RRMB 3D9NA 3L22A 3G2UA 4AP2A 4AY6A 3AS8A 4MS6A 4ANXA 2J09A 3TL5A 2R59A 3APCA 4RVBA 3ZHEB 2J08A 2NSZA 4ILIA 4XIFA 4GZDA 2IOLA 3CHQA 3D9KA 2VJ8A 5C2YA 3RJVA 3GZ2A 1E8ZA 2WQ6A 5E76A 2UWJG 2WXOA 3FUDA 4AEZC 4APOA 3PNLB 3CHOA 4ABNA 3PUJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TJC A;  3LPZ A;  3JYS A;  4U0Z A;  3Q47 B;  4O6F A;  2VYI A;  2AVP A;  4GCN A;  5G05 C;  3QKY A;  3RU0 A;  3CEQ A;  5DIZ A;  5FTP A;  4YND A;  2HR2 A;  3CVL A;  3PE4 A;  3LCA A;  2QFC A;  3Q4A B;  3ZPJ A;  3AS4 A;  4GZ6 A;  4G26 A;  3KS2 A;  5ARF A;  3FWV A;  5FZR A;  2DBA A;  3S7F A;  2LSV A;  5EX0 A;  3OXL A;  3VTY A;  3RIB A;  2KC7 A;  3MA5 A;  4BTA A;  4N2Q A;  3S7D A;  3U3W A;  4N3A A;  2VGX A;  5D0Q D;  5JJ7 A;  3LKU A;  3WXX A;  4XI0 A;  4G1T A;  5LCW C;  3GW4 A;  4GYO A;  4U07 A;  2VGY A;  4UQX A;  3LY8 A;  4HOQ A;  4GA2 A;  4KXK B;  1WM5 A;  3ZGQ A;  3ASG A;  4UI9 J;  3RO3 A;  3MKR A;  4WUY A;  4GZ3 A;  5LCW J;  4BTB A;  2XCC A;  3S7J A;  3CV0 A;  3Q5M A;  1QZ2 A;  2IF4 A;  3LY7 A;  5JJ6 A;  4G2V A;  4YVO A;  3CKB A;  3CVQ A;  4ME2 A;  4J8E A;  3FP3 A;  3S7B A;  2P58 C;  4H7X A;  2UY1 B;  1QQE A;  2I6H A;  2OOE A;  1HH8 A;  3N71 A;  3Q49 B;  3SF4 A;  1KLX A;  3R9A B;  2FO7 A;  4GZ5 A;  4F3V A;  3MV3 B;  3LYA A;  3TG5 A;  3QWP A;  3EDT B;  4U04 A;  4J8F A;  2HYZ A;  4WNG A;  4U0S A;  3CK7 A;  2LNI A;  4WNF A;  5C1D A;  2YHC A;  2WPV A;  2XGM A;  3QDN A;  4U0U A;  4GA0 A;  1B89 A;  1A17 A;  5FZQ A;  4HOT A;  2KCV A;  5G05 J;  3QWW A;  3TGO A;  2FF4 A;  3ASH A;  4G24 A;  2IFU A;  1ELR A;  5BW8 C;  5A6C A;  4N3B A;  2C0M A;  5EKQ D;  2FBN A;  3ESK A;  4G23 A;  3RO2 A;  2XCB A;  4AY5 A;  3ZHE A;  3CK9 A;  4H7Y A;  1WAO 1;  2NC9 A;  3Q15 A;  4I2Z A;  4GYW A;  2E2E A;  3BEE A;  5FT9 A;  3QOU A;  1YA0 A;  2PZI A;  3IEG A;  2XPI A;  1NZN A;  4G25 A;  4KYO B;  4HOR A;  3K9I A;  1NA0 A;  3SZ7 A;  3QWV A;  4AM9 A;  2GW1 A;  2XGO A;  2PQN A;  5EX3 A;  1ZU2 A;  4J0U A;  4NQ0 A;  5CCM A;  2R5S A;  5HQ8 A;  2MHK A;  4N2S A;  3CK8 A;  2Y4T A;  3PE3 A;  5AYW D;  4KBQ A;  4W9R A;  1KT0 A;  4JL0 A;  3VTX A;  5KJK A;  1ELW A;  1Y8M A;  4B94 A;  3OXG A;  3O48 A;  5KJN A;  4JA7 A;  4N5C A;  4Y6C A;  5D0O D;  1NA3 A;  3CVP A;  4CGW A;  3LY9 A;  2FI7 A;  1W3B A;  3ZN3 A;  4A1S A;  3NF1 A;  5A7D B;  1IHG A;  4UQZ A;  2C2L A;  4I2W A;  5FJY A;  5FZS A;  3MEK A;  4I17 A;  2VGX B;  4N3C A;  2VQ2 A;  4JA9 A;  3CVN A;  2XEV A;  2OND A;  2VSN A;  1IYG A;  3GZ1 A;  2FEZ A;  4UI9 K;  2YQ8 A;  4BWR A;  2KCK A;  2KCL A;  4J8D A;  3UUX A;  1HXI A;  1ZBP A;  4WND A;  4WNE A;  4RG9 A;  4EQF A;  3ASF A;  3URZ A;  2WQH A;  4N39 A;  5G04 C;  3UQ3 A;  3U4T A;  3KD7 A;  5M72 A;  4RG6 A;  1XNF A;  3OXF A;  4GCO A;  3KAE A;  4LEU A;  3RKV A;  3MV2 B;  2PL2 A;  2V5F A;  1FCH A;  5CCL A;  5DBK A;  1PC2 A;  2XGS A;  2Q7F A;  4Y6W A;  2BUG A;  5G04 J;  4CDR A;  4CGV A;  4I1A A;  2UY1 A;  2VSY A;  3ASD A;  5KJM A;  2Y4U A;  1P5Q A;  5KJL A;  4I9E A;  4UQY A;  1E96 B;  4HOS A;  3E4B A;  3GYZ A;  5BT1 A;  4UI9 C;  2HO1 A;  1OUV A;  4I9C A;  3FFL A;  1KT1 A;  4BT9 A;  3TAX A;  2LSU A;  5CHE E;  3AS5 A;  4NRH B;  4YVQ C;  3UPV A;  4BT8 A;  2JLB A;  4IN3 B;  5ARG A;  5BNW A;  4XI9 A;  5JJT A;  4GPK A;  4GYY A;  4GA1 A;  4AIF A;  3CKC A;  3HYM B;  2KAT A;  4HOU A;  3PDN A;  3ULQ A;  2L6J A;  5HI7 A;  4JHR A;  2C0L A;  3ZFW A;  1HZ4 A;  2PQR A;  3TG4 A;  2J9Q A;  4AY6 A;  3AS8 A;  3ZHE B;  4XIF A;  3RJV A;  3GZ2 A;  2UWJ G;  4APO A;  4ABN A; 
#chains in the Genus database with same CATH topology
 1S63 A;  2XRY A;  4IYP A;  4DX1 A;  3TWQ A;  4CCA A;  3Q47 B;  4K5A B;  4XZ4 A;  5G05 C;  3FU3 A;  4I6E A;  3CEQ A;  5DIZ A;  5CED B;  4EZJ A;  3ESL A;  3ABM E;  3P1U A;  5FTP A;  3L54 A;  5CRV A;  2V0P A;  4BET A;  3LCA A;  4KMO A;  4KVO A;  4I6G A;  3CQG B;  2QFC A;  4GZ6 A;  2DBA A;  3S7F A;  4ATG A;  5EX0 A;  3Q78 A;  3V79 K;  5EYL A;  2KC7 A;  1MQS A;  3NOC D;  1K3Z D;  2RKK A;  3U3W A;  3KEZ A;  1IXV A;  1AWC B;  4N3A A;  5ANL A;  2GRM A;  4GTR A;  3B13 A;  4K5C A;  2VGX A;  1E7U A;  1N52 A;  4JB8 P;  3PRE A;  4GYO A;  1SQM A;  3APD A;  2MYO A;  2VGY A;  2WM9 A;  3DPY A;  2X38 A;  3RK6 A;  2CHX A;  4HOQ A;  4FU3 A;  4OAU C;  2OEV A;  4KXK B;  3LVR E;  4P29 A;  1S70 B;  3MKR A;  5AQB A;  2Y1L E;  3DPD A;  1BD8 A;  3J5Q B;  3U9W A;  1OCR E;  2XCC A;  3S7J A;  2IF4 A;  5JJ6 A;  2PM6 A;  4G2V A;  4J8E A;  2MOW A;  4DLO A;  1TNO A;  4NUR A;  3V31 A;  1Y6I A;  2J8S D;  2P58 C;  2X3M A;  3WG7 E;  3TWU A;  1N9A A;  2Y3A A;  3UM0 A;  2IEJ A;  1MX2 A;  3SF4 A;  3R9A B;  5HKP A;  2EIJ E;  3IHY A;  1OWL A;  4CT0 A;  3FH5 A;  3Q75 A;  1O1S A;  3QWP A;  2P9S G;  2IO2 C;  3BU8 A;  4U04 A;  4J8F A;  3CK7 A;  2LNI A;  4WNF A;  2F37 A;  1MX6 A;  3HXD A;  4WWO A;  4DI4 A;  4WWP A;  2XGM A;  3NB2 A;  1QYM A;  3QDN A;  3Q7F A;  4BFR A;  3L9T A;  3CQC B;  3IV0 A;  4GA0 A;  2V8S E;  4HOT A;  2KCV A;  3TGO A;  2WMN A;  4G24 A;  2WXN A;  2AXU A;  4K0R A;  2X6I A;  4G11 A;  3V2X A;  1N54 A;  2EIM E;  1H2V C;  2GRL A;  4J7W A;  5AJD A;  3QC1 A;  3IBE A;  4X8Q A;  3NZS A;  4V3I A;  4DX2 A;  1HG2 A;  3UXG A;  4GYW A;  2E2E A;  3BEE A;  4O1P A;  3FUH A;  5FT9 A;  5FQ4 A;  3QOU A;  1YYH A;  3TWV A;  3SFY A;  4L2Y A;  4KYO B;  3K9I A;  1NA0 A;  2OVB A;  4U8Y D;  3CHS A;  3DEO A;  4AM9 A;  3Q73 A;  5FWQ A;  4J0U A;  4NQ0 A;  4L23 A;  1MYO A;  4FP7 A;  3FUF A;  4DUI A;  4HFG A;  4F1P A;  5KJN A;  3HIZ A;  4N5C A;  4YDE A;  3SHF A;  4GML A;  1H6K A;  1KZP A;  3T9K A;  4CGW A;  5D66 A;  4HI9 A;  4JD2 G;  1DC2 A;  4KT6 B;  2X6J A;  1W3B A;  2C2L A;  4HRL A;  2YHE A;  2QYU A;  3ZIM A;  1H19 A;  3AU4 A;  2EIK E;  5AEN A;  2WXK A;  4A3T A;  3Q7A A;  3HHM A;  3PZD A;  1HXI A;  1ZBP A;  2H6F A;  4WNE A;  4EPZ A;  1N4S A;  4CRW A;  1U2V G;  2WQH A;  4HXI A;  4XE0 A;  1UJK A;  5CBN A;  5AQ7 A;  5AJL A;  3HVE A;  1FVF A;  4LEU A;  2DIW A;  2PL2 A;  1FCH A;  3PH0 C;  3HXE A;  4PS7 A;  1JWG A;  5AN8 A;  2J07 A;  2XEE A;  1MHQ A;  3ML9 A;  4CGV A;  4F53 A;  3PVL A;  3J5P A;  2I9C A;  2LXL A;  5AIJ A;  1P5Q A;  2H6I A;  1ZB1 A;  4HOS A;  3E4B A;  5FIN A;  3GYZ A;  3EHR A;  4UI9 C;  2A4Z A;  5T3R A;  3C5R A;  4N5Q A;  2XPY A;  4I9C A;  4JPS A;  3DBS A;  4O60 A;  2QYJ A;  2JLB A;  1V54 E;  5EID A;  3Q79 A;  4OVU A;  4LG6 A;  1S64 A;  1LF8 A;  3QAQ A;  2AXZ A;  4GPK A;  4GA1 A;  2R05 A;  4LRZ A;  2ION A;  1NL4 A;  3V2O A;  4DPR A;  3HYM B;  4HOU A;  3D9M A;  2AXV A;  3IKO B;  2L6J A;  3B7T A;  4JHR A;  3MYV A;  3E37 A;  1MX4 A;  1HU3 A;  2MRI A;  1H2T C;  2BED A;  1O1T A;  3D9N A;  3L22 A;  4G8L A;  5JMN D;  3AS8 A;  2R59 A;  4RVB A;  2BKK B;  2IOL A;  2XS8 A;  3DXM G;  3D9K A;  5E76 A;  2UWJ G;  2WXO A;  4APO A;  4ABN A;  1TJC A;  3HXC A;  3P2B A;  4DK5 A;  3CIA A;  2WXQ A;  3L16 A;  3G2W A;  3LPZ A;  3JYS A;  4LNU D;  2FUL A;  2GRN B;  1H2U A;  2OV8 A;  3RRU A;  2HR2 A;  3PE4 A;  3DSU A;  1UJJ A;  3ZPJ A;  3QAR A;  1HG5 A;  4CYM D;  3AS4 A;  2BF0 X;  3FWV A;  5FZR A;  1BPO A;  1H0A A;  4LCT A;  3DEP A;  3MA5 A;  2I2O A;  3B7S A;  3CVU A;  5T8I A;  3SFZ A;  4IUL A;  4U63 A;  1UN8 A;  4GTS A;  5BV1 A;  2XS1 A;  2P9U G;  3LKU A;  3WXX A;  1TNZ A;  2R17 C;  3DSS A;  3T8M A;  4XI0 A;  4CDN A;  3GW4 A;  3D9H A;  2P9N G;  3AJI A;  2ZU6 B;  4ZHB A;  4GA2 A;  2JAB A;  1EDU A;  1WM5 A;  1JCR A;  3RO3 A;  3QB2 A;  1TR4 A;  2M63 A;  3UM1 A;  3HDX A;  1TNU A;  4AXH A;  1S0P A;  3FTV A;  4PS8 A;  5AQA A;  3CV0 A;  1QZ2 A;  2CHZ A;  3LY7 A;  3OAW A;  1JCQ A;  4YVO A;  4BES A;  5BV0 A;  3CVQ A;  4ME2 A;  4C0M A;  5CER B;  4RSY A;  1OCO E;  4XX5 A;  1SVX A;  3CLJ A;  3DWL G;  3TXN A;  4Q69 A;  4H7X A;  3EU5 A;  1QQE A;  5CEC B;  4JXT A;  2OOE A;  1HH8 A;  1DCQ A;  4G8K A;  3FUI A;  2FO7 A;  4GZ5 A;  3T5X A;  4U8V D;  1QBQ A;  4APF A;  4FHJ A;  3EDT B;  1MJ0 A;  4I1O B;  3FTU A;  5CMY A;  5G55 A;  1QNF A;  2YHC A;  2LAH A;  4HRN A;  1FT2 A;  1IQR A;  4J8Y A;  2ZXW E;  4A63 B;  2WMO A;  4NIK A;  1Z3Y A;  2A5U A;  2DYS E;  5ENS D;  4KVM A;  4U0U A;  1OWO A;  3GZS A;  3C3Q A;  3HRA A;  4HNA D;  3ASO E;  3SO8 A;  3FUL A;  3FTY A;  1LTX A;  4JVS A;  2IFU A;  4MKT A;  1UW4 B;  2XHE A;  2I1K A;  5ENT D;  2FBN A;  3ZUV B;  4DX5 D;  3D9J A;  2WQ7 A;  2IOS A;  4AJW A;  3AAA C;  3CK9 A;  1UOH A;  4RQI A;  2NC9 A;  4TV3 A;  1KZO A;  4GMJ A;  3L82 A;  3V30 A;  3QNK A;  4K5B A;  2V4H C;  4BY6 A;  3ZXP A;  3ZEF A;  3AG1 E;  3IEG A;  4R7L A;  1NZN A;  2YIN A;  1TN6 A;  3DSW A;  1D9S A;  4I1M A;  1JPL A;  4G25 A;  2R02 A;  3FTX A;  3KEA A;  2L9B A;  2XEH A;  3HVE B;  3QWV A;  2PQN A;  4U96 D;  2J49 A;  2IU1 A;  5CCM A;  4CEM A;  3FUE A;  5HQ8 A;  4I6J A;  4JZY A;  5CMW A;  2ILR A;  3UIN C;  5T4Y A;  3W9F A;  1Y8M A;  3O48 A;  4JA7 A;  4PUC A;  3IXE A;  5D0O D;  3CVP A;  3FEX A;  4DLQ A;  4JEU A;  3ZU7 B;  3ZN3 A;  2EQX A;  3FH8 A;  5A7D B;  3UM2 A;  5FJY A;  5FZS A;  3MEK A;  3NZU A;  1TNY A;  3FDH A;  3TWW A;  2XEV A;  2WB2 A;  4ILH B;  3SGH A;  2VSN A;  3GZ1 A;  4TXR A;  4M7C A;  2FEZ A;  4UI9 K;  2YQ8 A;  2GRR B;  4BWR A;  5G2N A;  2KCL A;  4HLL A;  4AVX A;  4RG9 A;  2R03 A;  1WG0 A;  3URZ A;  1TJF A;  5G04 C;  5IY5 E;  3U4T A;  4E6H A;  1FVH A;  3QK0 A;  3CSF A;  3UKR G;  4AOF A;  2HM8 A;  3LXU X;  1OCZ E;  3UTM A;  3RKV A;  3PRZ A;  1DCE A;  3Q9N C;  1U3C A;  5CCL A;  5DBK A;  3Q9U C;  2XGS A;  3TJP A;  3FTS A;  4Y6W A;  3D3M A;  3RSE G;  2BKG A;  4CDR A;  4C9B B;  1XGW A;  2AW6 A;  4ZFH A;  3HXF A;  5H7P A;  3PEV B;  4I9E A;  2ZIS A;  3SFX A;  3CVW A;  1V55 E;  5KBA A;  4TXQ A;  5BT1 A;  4LER A;  4UWH A;  1D8E A;  4LUN U;  3X2Q E;  5JHB A;  1OUV A;  3MJW A;  3FFL A;  1KT1 A;  2VTB B;  2P9L G;  3AS5 A;  4NRH B;  4YVQ C;  2ETC A;  3UPV A;  5BNW A;  4JEH A;  3EIJ A;  2H6G A;  3TWR A;  2LUH A;  3U64 A;  3TWT A;  3EIQ C;  4NAC A;  2L0I A;  4HVB A;  3NQP A;  2OVF A;  2DCP A;  2IY0 C;  3CKC A;  4FJZ A;  3L17 A;  4KZ0 A;  2KAT A;  3ULQ A;  3PDN A;  1BU9 A;  4U7E B;  3ZFW A;  4XKB A;  3ULE G;  3RRM B;  2LXM A;  2J08 A;  5EIL A;  5C2Y A;  3GZ2 A;  2WQ6 A;  3HXB A;  5B1B E;  1TNB A;  3EUV A;  3FUD A;  1WDY A;  3PNL B;  3CHO A;  1FT1 A;  3PUJ A;  3EHM A;  2Y69 E;  1FPP A;  2EIN E;  1E8Y A;  5KCM A;  4U0Z A;  2P9K G;  3ZXS A;  4GTT A;  4O6F A;  2AVP A;  3QKY A;  1DNP A;  2L0T B;  4YND A;  1LD8 A;  5LP0 A;  2VSX E;  3B7U X;  3KS2 A;  2DVW A;  2WXL A;  4UWL A;  2LSV A;  3VTY A;  2ZGD A;  4HBD A;  3RIB A;  2FO1 E;  2OEW A;  5ENN A;  2ETB A;  4BTA A;  2GGF A;  2CHW A;  3B7B A;  4DX7 D;  1RZ4 A;  4ILG A;  1O1R A;  3LJN A;  4OYS A;  4MLP A;  5D0Q D;  3ABK E;  4G1T A;  4PDX A;  5LCW C;  3CVY A;  2JEK A;  2XPZ A;  1IKN D;  3LY8 A;  4ATZ D;  2LAI A;  4GU5 A;  3FEY A;  5D2M C;  5JA4 D;  4A1G A;  4UWK A;  3ZGQ A;  3ASG A;  4WUY A;  4GZ3 A;  4L1B A;  4EHM A;  4A3V A;  3FTW A;  3Q5M A;  4F1S A;  2YNQ A;  5EYP F;  4AV7 A;  2XEN A;  2V4L A;  3CKB A;  4XEI G;  3BG0 B;  4B8A A;  4FJY A;  3S7B A;  4GTM A;  2A5E A;  2WXM A;  2WXP A;  2UY1 B;  1EPU A;  2CG2 A;  3ZKJ A;  2H6H A;  1D8D A;  3Q49 B;  3EU9 A;  3ONK A;  4IRU A;  3ZYL A;  3MV3 B;  3LYA A;  2XQ0 A;  2GRP B;  1OWN A;  4DX6 D;  1N94 A;  2HYZ A;  3NBN B;  4TRQ A;  3JXI A;  1IQU A;  3CGH A;  4GB9 A;  4FC8 A;  2WPV A;  2VTB A;  1EF1 C;  3AG2 E;  3FHE A;  3PUK A;  4ACK A;  2RFM A;  1PY1 A;  3DRA A;  3JUI A;  4URK A;  1B89 A;  5ANR A;  1K1A A;  4FHK A;  2X6F A;  5G05 J;  3QWW A;  2FF4 A;  4TXP A;  3ASH A;  4N3B A;  2X6H A;  3B7R L;  2C0M A;  3DXK G;  5EKQ D;  2DYR E;  5KNG A;  2EIL E;  4QFV A;  3R9M A;  2CG3 A;  3F6Q A;  4XKC A;  3ESK A;  4G23 A;  3RO2 A;  3E34 A;  3SBT B;  1OXJ A;  5LFA A;  1OY3 D;  4AY5 A;  3DSV A;  3FUM A;  5BXO A;  5EIB E;  4H7Y A;  3Q15 A;  3PZ2 A;  2P9P G;  2XRZ A;  3FY4 A;  2I1J A;  1JCS A;  1YA0 A;  2XPI A;  2ZIR A;  2BTD A;  4D10 C;  1G3N B;  1UN9 A;  3ZYK A;  5JHA A;  3FTZ A;  2IO3 C;  3TWX A;  2V5Q C;  2XGO A;  5BUZ A;  3MKQ B;  1INZ A;  5EX3 A;  5BXU A;  2R5S A;  3AU5 A;  4YDY A;  2MHK A;  1OT8 A;  2WVI A;  1HX8 A;  1X81 A;  2Y4T A;  4CZ2 D;  5ENQ D;  5AYW D;  3FUN A;  4MBG A;  1KT0 A;  4OAV B;  4JL0 A;  3RRN B;  1HS6 A;  4B93 B;  1BI8 B;  4Y6C A;  1NA3 A;  3VLD A;  1BLX B;  2KM4 A;  3ABL E;  4GZC A;  3LY9 A;  3D9O A;  3NF1 A;  4UQZ A;  4I2W A;  4C48 B;  5AAO A;  3APF A;  4CT4 A;  4N3C A;  2VQ2 A;  3CVN A;  1KPS B;  3TXM A;  1K1B A;  4J6I A;  2KCK A;  1SA5 A;  4J8D A;  1OCC E;  4UWG A;  4L7T A;  3UT4 A;  4B0Z A;  2DZO A;  4EQF A;  5HS0 A;  4N39 A;  2GRO B;  4BSX A;  2RFA A;  4RLY A;  4HLE A;  3E32 A;  3KD7 A;  3AG3 E;  3LVQ E;  1XNF A;  3OXF A;  2XZT G;  4GCO A;  1K8K G;  3ZNG A;  3NAW A;  2NYJ A;  3SI5 A;  3L13 A;  3PZ3 A;  5G04 J;  4EEC A;  2J4D A;  2KZT A;  3EHN A;  3UX4 A;  2UY1 A;  3LJ3 A;  2OCC E;  2VSY A;  4FLB A;  5KWD A;  3ASD A;  2Y4U A;  2F8X K;  2LO6 A;  5KJL A;  3O4Z A;  1E8X A;  3FUK A;  1Q2Z A;  3MZL B;  4UQY A;  1O5M A;  4BER A;  3T5V A;  4TUM A;  1E96 B;  3I3N A;  4LNB A;  3MCX A;  4EZL A;  1A5E A;  4HQD A;  2VSO E;  4FAD A;  2E0I A;  3ML8 A;  2HO1 A;  3ZYM A;  4YDW A;  4TUU A;  4C0E A;  3TAX A;  2LSU A;  4BT8 A;  4WAF A;  5ARG A;  4XI9 A;  5JJT A;  4GYY A;  4DRX E;  2XZD G;  1OWM A;  4AIF A;  2AWI A;  4KZC A;  3CVX A;  4CDM A;  5HI7 A;  4PH4 B;  1HE8 A;  5CBO A;  1Z3X A;  1N11 A;  3UT7 A;  2PQR A;  3G2S A;  1HO8 A;  3FH7 A;  4PS3 A;  2ZGG A;  4AP2 A;  2R2L A;  3TL5 A;  3ZHE B;  2B6C A;  3APC A;  2NSZ A;  4ILI A;  4GZD A;  5FIO A;  3CHQ A;  3RJV A;  1N4R A;  3NOG D;  4AEZ C;  4FA6 A;  3SY2 A;  4BSZ B;  4ACL A;  2WXI A;  4Q94 A;  3T8K A;  4L2L A;  3MGB A;  2VYI A;  4GCN A;  3RU0 A;  2CFZ A;  4WWN A;  4DI3 A;  4L9P A;  2WXH A;  3MKQ A;  3CVL A;  3ENE A;  4U8H A;  1SA4 A;  3IHV A;  1JWF A;  3Q4A B;  3KSL A;  3LEW A;  3C3O A;  1N95 A;  4G26 A;  5ARF A;  4HS2 A;  2ETA A;  4F7A A;  3OXL A;  1SZ9 A;  5HRY A;  4N2Q A;  3S7D A;  3I5P A;  4HRM B;  3W9G A;  5AQ9 A;  3PNT B;  5CEA A;  5JJ7 A;  5ENR D;  2QY7 A;  4GAA A;  4JHJ A;  4U07 A;  1UG3 A;  5AAR A;  1E7V A;  2WXR A;  4UQX A;  4UWF A;  1OWP A;  4UI9 J;  4HI8 A;  5B1A E;  5LCW J;  1JUQ A;  4BTB A;  2HE0 A;  4O1O A;  2DWZ A;  4FLH A;  3JCK C;  1NFI E;  4JW1 A;  1TEZ A;  3G2V A;  5ENP D;  1X5B A;  4FUL A;  4B89 A;  3FP3 A;  3PZ4 A;  4ANW A;  1EYH A;  3JQ0 A;  5A23 A;  4I43 A;  1NI1 A;  2RD0 A;  3JQ1 A;  5ENO D;  5EDS A;  1SZA A;  3C72 A;  1TN7 A;  5B3S E;  2WXF A;  3ULY A;  2GRQ B;  2I6H A;  3TWS A;  3CR3 A;  3N71 A;  3S2A A;  1KLX A;  4F3V A;  1Z5S C;  3TG5 A;  4BEP A;  3SBS A;  3SNX A;  3D9L A;  5KNH D;  3CST A;  3ISM C;  3EJN A;  4WNG A;  4U0S A;  5C1D A;  1N0R A;  2DZN A;  3ZYQ A;  3U66 A;  4DJA A;  1Z6T A;  4GMR A;  1YMP A;  3UMV A;  1ELK A;  4J8S A;  1RW2 A;  3D9P A;  1H6P A;  1L5J A;  2QC9 A;  3BQO A;  3UT8 A;  1A17 A;  3HG0 D;  4GTQ A;  2WXG A;  5FZQ A;  4YDO A;  4B8C B;  1GW6 A;  2CFU A;  1U3D A;  3BG1 B;  1ELR A;  5BW8 C;  5LOZ A;  5A6C A;  2PNN A;  2F8Y A;  2NXP A;  2XCB A;  4LNG A;  5ITZ F;  2J4B A;  3ZHE A;  1HFA A;  1WAO 1;  3SD5 A;  4A55 A;  4I2Z A;  2P2C P;  4E85 A;  4QQI A;  3JUE A;  3DST A;  3FU6 A;  4M3O A;  3CHP A;  4JHK A;  4GTP A;  1HF8 A;  2F0Y A;  2PZI A;  2X6K A;  1N4P A;  3ZRH A;  5BPP A;  4EBA A;  4HOR A;  4U95 D;  3SZ7 A;  2GW1 A;  5LX8 A;  3UIO C;  1ZU2 A;  4OVV A;  1N4Q A;  4N2S A;  3CK8 A;  4JC8 A;  3PE3 A;  2L6B A;  4KBQ A;  3I4G A;  4HB5 A;  4W9R A;  3R7Q A;  1TYQ G;  3VTX A;  3UIP C;  2KZT B;  5KJK A;  1ELW A;  2QZA A;  3LS8 A;  4B94 A;  3OXG A;  5FQ6 A;  2IJG X;  4ANV A;  3C98 A;  3LDZ A;  3VLE A;  1LD7 A;  2FI7 A;  4F6R D;  4A1S A;  1IHG A;  3ZW3 A;  3ASN E;  3QJZ A;  2B0O E;  3R7R A;  4I17 A;  2VGX B;  4JA9 A;  2OND A;  1DVP A;  1IYG A;  1SW6 A;  4BX9 A;  3PS6 A;  1YCS B;  3RAU A;  3UUX A;  2PM7 A;  2RG8 A;  4WND A;  1TN8 A;  3ASF A;  1MZC A;  1E90 A;  1BI7 B;  5FQ8 A;  3ZVV A;  5CRU A;  3UQ3 A;  3E33 A;  3SQV A;  5M72 A;  3B95 A;  4Q96 A;  4RG6 A;  3OTN A;  3KAE A;  3KSQ A;  3VLF A;  3MV2 B;  2V5F A;  2P9I G;  3PEU B;  1PC2 A;  2Q7F A;  5FQ7 A;  3ONL A;  2BUG A;  3BUA A;  3D9I A;  3FUJ A;  1PAQ A;  4I1A A;  2VGE A;  4K03 A;  5KJM A;  1N0Q A;  4LSZ E;  4EZK A;  1IHB A;  3UKU G;  5J90 A;  3JXJ A;  3L6A A;  1NP7 A;  3CVV A;  1E8W A;  2Y0B G;  4BT9 A;  5CHE E;  3I4R B;  3UI2 A;  3AG4 E;  4IN3 B;  3PZ1 A;  3FU0 A;  4MRU A;  5J08 A;  4BX8 A;  1AP7 A;  1H6O A;  3G2T A;  3E30 A;  4GPM A;  1WY6 A;  4GTO A;  3L08 A;  2KXP C;  2WXJ A;  2IQC A;  3CHM A;  3MX3 A;  5E75 A;  4ANU A;  2C0L A;  3FU5 A;  5EN5 D;  4EBA G;  1HZ4 A;  1VDY A;  3C3R A;  3TG4 A;  4UUC A;  3CHR A;  2J9Q A;  2AJA A;  3G2U A;  4GTV A;  4AY6 A;  4MS6 A;  4ANX A;  2J09 A;  4Z68 A;  4XIF A;  2KBX A;  3DSX A;  2VJ8 A;  1E8Z A;  3UM3 A;  3EHQ A; 
#chains in the Genus database with same CATH homology
 1TJC A;  3EHM A;  2XRY A;  4FA6 A;  4F3V A;  3P2B A;  4DK5 A;  3CIA A;  2WXQ A;  3L16 A;  4ACL A;  3G2W A;  3LPZ A;  4IYP A;  1E8Y A;  2WXI A;  4Q94 A;  5KCM A;  3JYS A;  4L2L A;  4U0Z A;  3ZXS A;  4CCA A;  3MGB A;  3Q47 B;  4O6F A;  2VYI A;  2AVP A;  4GCN A;  4XZ4 A;  5G05 C;  3QKY A;  3FU3 A;  2FUL A;  4I6E A;  3RU0 A;  3CEQ A;  1DNP A;  5DIZ A;  4EZJ A;  3ESL A;  2CFZ A;  4WWN A;  1H2U A;  2OV8 A;  3RRU A;  2L0T B;  4DI3 A;  3P1U A;  5FTP A;  3L54 A;  2WXH A;  4YND A;  2HR2 A;  3MKQ A;  3CVL A;  3PE4 A;  2V0P A;  3ENE A;  4U8H A;  3LCA A;  4KMO A;  3IHV A;  4KVO A;  4I6G A;  1JWF A;  3CQG B;  2QFC A;  1UJJ A;  3Q4A B;  3ZPJ A;  3QAR A;  1HG5 A;  2VSX E;  5LP0 A;  3LEW A;  3AS4 A;  4GZ6 A;  2BF0 X;  3B7U X;  3KS2 A;  4G26 A;  4HS2 A;  5ARF A;  3FWV A;  2WXL A;  4UWL A;  5FZR A;  1BPO A;  2DBA A;  2LSV A;  3S7F A;  4ATG A;  5EX0 A;  4F7A A;  3OXL A;  3VTY A;  1H0A A;  4LCT A;  3RIB A;  1SZ9 A;  1MQS A;  2KC7 A;  5ENN A;  3MA5 A;  4BTA A;  4N2Q A;  2GGF A;  3S7D A;  2I2O A;  3I5P A;  2CHW A;  3B7S A;  3CVU A;  3U3W A;  3KEZ A;  5T8I A;  4ILG A;  3SFZ A;  4IUL A;  4U63 A;  1UN8 A;  4N3A A;  4OYS A;  5ANL A;  2GRM A;  4MLP A;  3B13 A;  2VGX A;  5BV1 A;  3PNT B;  1E7U A;  5D0Q D;  5JJ7 A;  2QY7 A;  3LKU A;  3WXX A;  4GAA A;  1N52 A;  4JHJ A;  2R17 C;  3T8M A;  4XI0 A;  4G1T A;  4CDN A;  4PDX A;  5LCW C;  3GW4 A;  3PRE A;  4GYO A;  1SQM A;  3APD A;  4U07 A;  3CVY A;  1UG3 A;  2JEK A;  2VGY A;  2WM9 A;  2XPZ A;  1E7V A;  2WXR A;  2X38 A;  4UQX A;  3LY8 A;  3RK6 A;  2ZU6 B;  2CHX A;  2LAI A;  4GU5 A;  3FEY A;  4HOQ A;  4GA2 A;  4UWF A;  4FU3 A;  4KXK B;  3LVR E;  1EDU A;  1WM5 A;  1OWP A;  4A1G A;  4UWK A;  4P29 A;  3ZGQ A;  3ASG A;  4UI9 J;  3RO3 A;  3QB2 A;  3MKR A;  4WUY A;  2M63 A;  4GZ3 A;  4L1B A;  5LCW J;  3DPD A;  1JUQ A;  4A3V A;  3U9W A;  3HDX A;  4BTB A;  2XCC A;  3S7J A;  4AXH A;  1S0P A;  3FTV A;  3FTW A;  4FLH A;  4PS8 A;  3CV0 A;  3Q5M A;  1QZ2 A;  2CHZ A;  2IF4 A;  3LY7 A;  3JCK C;  4F1S A;  5JJ6 A;  4JW1 A;  2PM6 A;  1TEZ A;  3OAW A;  3G2V A;  2YNQ A;  4AV7 A;  1X5B A;  2V4L A;  4G2V A;  4YVO A;  3CKB A;  5BV0 A;  3CVQ A;  4FUL A;  4B89 A;  4ME2 A;  4J8E A;  2MOW A;  4C0M A;  4DLO A;  3BG0 B;  3FP3 A;  4ANW A;  1EYH A;  4NUR A;  3JQ0 A;  5A23 A;  4I43 A;  1Y6I A;  2RD0 A;  3JQ1 A;  4FJY A;  3S7B A;  4B8A A;  2P58 C;  4RSY A;  2X3M A;  5EDS A;  1SZA A;  4XX5 A;  2WXM A;  2WXP A;  3CLJ A;  4Q69 A;  3TXN A;  4H7X A;  2UY1 B;  2Y3A A;  2WXF A;  1EPU A;  1QQE A;  2I6H A;  4JXT A;  2CG2 A;  2OOE A;  1HH8 A;  3CR3 A;  3N71 A;  3S2A A;  3Q49 B;  3ONK A;  3SF4 A;  1KLX A;  3FUI A;  3R9A B;  4IRU A;  2FO7 A;  4GZ5 A;  3IHY A;  3ZYL A;  3MV3 B;  3LYA A;  1OWL A;  3SBS A;  3T5X A;  3SNX A;  3FH5 A;  3TG5 A;  3ULQ A;  3D9L A;  4CT0 A;  2XQ0 A;  3CST A;  3QWP A;  4APF A;  3EJN A;  1OWN A;  4FHJ A;  3EDT B;  4U04 A;  4I1O B;  5CMY A;  3FTU A;  4J8F A;  5G55 A;  2HYZ A;  4WNG A;  1QNF A;  3CK7 A;  4TRQ A;  2LNI A;  4U0S A;  1IQU A;  3CGH A;  4WNF A;  5C1D A;  2YHC A;  2LAH A;  4GB9 A;  4WWO A;  3ZYQ A;  3U66 A;  1IQR A;  4DJA A;  4FC8 A;  4DI4 A;  4WWP A;  1Z6T A;  2WPV A;  2WMO A;  2VTB A;  2XGM A;  1EF1 C;  1Z3Y A;  3UMV A;  1ELK A;  2A5U A;  3FHE A;  4KVM A;  3PUK A;  4J8S A;  3QDN A;  3D9P A;  4U0U A;  4ACK A;  4BFR A;  1PY1 A;  1OWO A;  1L5J A;  3GZS A;  3JUI A;  3CQC B;  3IV0 A;  4GA0 A;  4URK A;  1B89 A;  5ANR A;  3UT8 A;  2V8S E;  1A17 A;  2WXG A;  4FHK A;  5FZQ A;  4HOT A;  2X6F A;  2KCV A;  5G05 J;  3QWW A;  4B8C B;  3TGO A;  2FF4 A;  1GW6 A;  2CFU A;  3ASH A;  2WMN A;  3FTY A;  3FUL A;  4G24 A;  1U3D A;  4JVS A;  2WXN A;  2IFU A;  3BG1 B;  1ELR A;  4MKT A;  5BW8 C;  5LOZ A;  4N3B A;  5A6C A;  2X6H A;  2AXU A;  3B7R L;  2C0M A;  5EKQ D;  1UW4 B;  4K0R A;  2XHE A;  2X6I A;  4G11 A;  4QFV A;  2I1K A;  2CG3 A;  2FBN A;  1N54 A;  4XKC A;  2NXP A;  3ESK A;  1H2V C;  4G23 A;  3D9J A;  3RO2 A;  2WQ7 A;  2IOS A;  3SBT B;  4AJW A;  2XCB A;  2GRL A;  5LFA A;  4AY5 A;  2J4B A;  5AJD A;  3FUM A;  3ZHE A;  3QC1 A;  3IBE A;  3CK9 A;  1HFA A;  4H7Y A;  1WAO 1;  2NC9 A;  3Q15 A;  4TV3 A;  3SD5 A;  4A55 A;  3NZS A;  4I2Z A;  4E85 A;  4V3I A;  4GMJ A;  2XRZ A;  1HG2 A;  3FY4 A;  2I1J A;  4GYW A;  3FU6 A;  3QNK A;  4M3O A;  3CHP A;  4JHK A;  4BY6 A;  2E2E A;  3BEE A;  3FUH A;  5FT9 A;  5FQ4 A;  3QOU A;  1YA0 A;  1HF8 A;  3ZEF A;  2PZI A;  3IEG A;  2X6K A;  2XPI A;  4R7L A;  1NZN A;  2BTD A;  2YIN A;  4D10 C;  1UN9 A;  4I1M A;  1JPL A;  4G25 A;  4L2Y A;  3ZRH A;  4KYO B;  3ZYK A;  3FTZ A;  4EBA A;  5BPP A;  5JHA A;  4HOR A;  3K9I A;  1NA0 A;  2OVB A;  3FTX A;  2L9B A;  3CHS A;  3SZ7 A;  3HVE B;  3QWV A;  4AM9 A;  2GW1 A;  5LX8 A;  2XGO A;  5BUZ A;  2PQN A;  3MKQ B;  5FWQ A;  1INZ A;  5EX3 A;  1ZU2 A;  2J49 A;  4J0U A;  2IU1 A;  4NQ0 A;  4OVV A;  4CEM A;  5CCM A;  2R5S A;  3AU5 A;  3FUE A;  5HQ8 A;  2MHK A;  2WVI A;  4N2S A;  1HX8 A;  3CK8 A;  4I6J A;  2Y4T A;  4JC8 A;  4JZY A;  4L23 A;  3PE3 A;  5AYW D;  5CMW A;  4KBQ A;  2ILR A;  3I4G A;  3FUN A;  4FP7 A;  4W9R A;  1KT0 A;  3FUF A;  3R7Q A;  4JL0 A;  3VTX A;  5T4Y A;  2KZT B;  4HFG A;  5KJK A;  3RRN B;  1ELW A;  1Y8M A;  3LS8 A;  4B94 A;  3OXG A;  3O48 A;  5KJN A;  3HIZ A;  5FQ6 A;  4JA7 A;  4PUC A;  2IJG X;  4N5C A;  1HS6 A;  3SHF A;  4GML A;  4Y6C A;  5D0O D;  1H6K A;  1NA3 A;  3CVP A;  3FEX A;  3VLD A;  4ANV A;  4DLQ A;  4CGW A;  3C98 A;  3LDZ A;  2KM4 A;  4JEU A;  4GZC A;  3LY9 A;  3VLE A;  4KT6 B;  2FI7 A;  2X6J A;  3D9O A;  1W3B A;  3ZN3 A;  4A1S A;  2EQX A;  3NF1 A;  3FH8 A;  1IHG A;  4UQZ A;  5A7D B;  2C2L A;  3ZW3 A;  4I2W A;  5FJY A;  3QJZ A;  5FZS A;  3APF A;  2YHE A;  3R7R A;  3MEK A;  4I17 A;  4CT4 A;  2VGX B;  3NZU A;  4N3C A;  2VQ2 A;  4JA9 A;  3CVN A;  3FDH A;  2XEV A;  2WB2 A;  4ILH B;  2OND A;  3SGH A;  2VSN A;  1DVP A;  3GZ1 A;  3ZIM A;  1IYG A;  1H19 A;  3AU4 A;  4BX9 A;  3TXM A;  3PS6 A;  2FEZ A;  2WXK A;  4UI9 K;  2YQ8 A;  4J6I A;  4A3T A;  2KCK A;  4BWR A;  5AEN A;  5G2N A;  2KCL A;  3HHM A;  3PZD A;  4J8D A;  4UWG A;  3UUX A;  2PM7 A;  4L7T A;  4AVX A;  2RG8 A;  1HXI A;  1ZBP A;  4WND A;  4WNE A;  3UT4 A;  4B0Z A;  4EPZ A;  4RG9 A;  4CRW A;  3ASF A;  4EQF A;  3URZ A;  1TJF A;  1E90 A;  2WQH A;  4N39 A;  4HXI A;  4XE0 A;  5FQ8 A;  3ZVV A;  4BSX A;  5G04 C;  1UJK A;  3UQ3 A;  3U4T A;  4E6H A;  1FVH A;  3QK0 A;  4HLE A;  3KD7 A;  3CSF A;  4AOF A;  2HM8 A;  5M72 A;  4Q96 A;  5AJL A;  4RG6 A;  3LVQ E;  1XNF A;  3HVE A;  3LXU X;  3OXF A;  3OTN A;  1FVF A;  4GCO A;  3KAE A;  4LEU A;  3RKV A;  2DIW A;  3VLF A;  3MV2 B;  3PRZ A;  2PL2 A;  2V5F A;  1FCH A;  3PH0 C;  4PS7 A;  1U3C A;  3PEU B;  5CCL A;  5DBK A;  1JWG A;  1PC2 A;  2XGS A;  2J07 A;  2Q7F A;  3FTS A;  4Y6W A;  5FQ7 A;  3D3M A;  3TJP A;  3SI5 A;  3ONL A;  3L13 A;  2BUG A;  3D9I A;  3FUJ A;  1MHQ A;  3ML9 A;  1PAQ A;  5G04 J;  4CDR A;  4EEC A;  4CGV A;  4C9B B;  2J4D A;  4F53 A;  4I1A A;  2KZT A;  3EHN A;  3PVL A;  3UX4 A;  2UY1 A;  2I9C A;  3LJ3 A;  5AIJ A;  1XGW A;  2VSY A;  4FLB A;  2AW6 A;  3ASD A;  4K03 A;  5KJM A;  2Y4U A;  1P5Q A;  2LO6 A;  5KJL A;  3O4Z A;  1E8X A;  3PEV B;  3FUK A;  4I9E A;  3MZL B;  4UQY A;  3T5V A;  4EZK A;  1E96 B;  3I3N A;  3CVW A;  5J90 A;  4HOS A;  3E4B A;  3MCX A;  4EZL A;  3GYZ A;  5BT1 A;  2VSO E;  2A4Z A;  4LER A;  4UI9 C;  4UWH A;  5T3R A;  4FAD A;  2E0I A;  3ML8 A;  2HO1 A;  3L6A A;  4LUN U;  1NP7 A;  3ZYM A;  3CVV A;  5JHB A;  1E8W A;  2XPY A;  1OUV A;  3MJW A;  4I9C A;  4TUU A;  3FFL A;  1KT1 A;  4JPS A;  4BT9 A;  4C0E A;  3DBS A;  3TAX A;  2LSU A;  2VTB B;  5CHE E;  3AS5 A;  4NRH B;  4YVQ C;  3I4R B;  3UPV A;  4BT8 A;  2JLB A;  4WAF A;  4IN3 B;  5ARG A;  5BNW A;  4JEH A;  3EIJ A;  4XI9 A;  3FU0 A;  4MRU A;  3U64 A;  5J08 A;  4BX8 A;  4OVU A;  3G2T A;  5JJT A;  1LF8 A;  3QAQ A;  3EIQ C;  4NAC A;  2AXZ A;  2L0I A;  4GPK A;  4GYY A;  3NQP A;  4GA1 A;  1WY6 A;  2OVF A;  4HVB A;  3L08 A;  4LRZ A;  2DCP A;  2ION A;  1OWM A;  4AIF A;  2AWI A;  2WXJ A;  2IQC A;  4DPR A;  3CHM A;  3CKC A;  4KZC A;  3CVX A;  4FJZ A;  3HYM B;  3L17 A;  4KZ0 A;  2KAT A;  4HOU A;  4CDM A;  3D9M A;  2AXV A;  3IKO B;  2L6J A;  3PDN A;  3B7T A;  3MX3 A;  4PH4 B;  1HE8 A;  4JHR A;  5E75 A;  5HI7 A;  2C0L A;  4ANU A;  3FU5 A;  3ZFW A;  3MYV A;  4XKB A;  4EBA G;  1HZ4 A;  1Z3X A;  1VDY A;  3UT7 A;  2PQR A;  1HU3 A;  2MRI A;  1H2T C;  3G2S A;  1HO8 A;  3TG4 A;  3FH7 A;  4PS3 A;  3CHR A;  2J9Q A;  3RRM B;  3D9N A;  3L22 A;  3G2U A;  4AP2 A;  4AY6 A;  3AS8 A;  4MS6 A;  4ANX A;  2J09 A;  3TL5 A;  2R59 A;  3APC A;  4RVB A;  3ZHE B;  2J08 A;  2NSZ A;  4ILI A;  4XIF A;  4GZD A;  2IOL A;  3CHQ A;  3D9K A;  2VJ8 A;  5C2Y A;  3RJV A;  3GZ2 A;  1E8Z A;  2WQ6 A;  5E76 A;  2UWJ G;  2WXO A;  3FUD A;  4AEZ C;  4APO A;  3PNL B;  3CHO A;  4ABN A;  3PUJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...