1WM5A

Crystal structure of the n-terminal tpr domain (1-203) of p67phox
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
207
structure length
205
Chain Sequence
AMGSMSLVEAISLWNEGVLAADKKDWKGALDAFSAVQDPHSRICFNIGCMYTILKNMTEAEKAFTRSINRDKHLAVAYFQRGMLYYQTEKYDLAIKDLKEALIQLRGNQLIDYKILGLQFKLFACEVLYNIAFMYAKKEEWKKAEEQLALATSMKSEPRHSKIDKAMECVWKQKLYEPVVIPVGKLFRPNERQVAQLKDYLGKAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Neutrophil cytosol factor 2
publication title Crystal structure of the N-terminal TPR domain (1-203) of p67phox
rcsb
source organism Homo sapiens
molecule tags Hormone/growth factor
total genus 75
structure length 205
sequence length 207
ec nomenclature
pdb deposition date 2004-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13181 TPR_8 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 1wm5A00
2FEZA 2LSUA 4APOA 4GPKA 3U4TA 4N3BA 2J9QA 1NA3A 3Q4AB 4N2QA 3RKVA 2FF4A 4UI9K 2UWJG 4J0UA 1KT0A 3OXLA 4GA0A 2OOEA 5D0OD 3BEEA 1B89A 3GYZA 4AIFA 4I9EA 4KXKB 5ARGA 3SF4A 1WAO1 3FFLA 3N71A 4UQZA 4HORA 4ABNA 4G1TA 2Y4UA 2UY1A 4CDRA 4Y6WA 2QFCA 3RO3A 2PL2A 3HYMB 2XPIA 3KS2A 4G24A 1ZU2A 4JHRA 2YQ8A 3O48A 3CK7A 4BT8A 3QWWA 3TAXA 5JJ7A 3PE3A 4WNFA 3UUXA 5G05C 2E2EA 4GZ5A 3MV3B 4U0UA 4KYOB 4A1SA 2KATA 3GZ2A 5CHEE 3CVLA 3LYAA 5DIZA 2HR2A 3VTYA 2VSYA 4BT9A 4BTBA 3ULQA 2KCVA 3LY8A 4XIFA 3KD7A 5M72A 1Y8MA 4LEUA 2UY1B 4JA7A 3RU0A 4U07A 3AS4A 5AYWD 5A6CA 3LPZA 4WNEA 1W3BA 3QOUA 4J8FA 2FI7A 4GA1A 2XGOA 5FT9A 4JA9A 3CK9A 3ZFWA 2VYIA 5KJNA 5DBKA 4U0SA 4G2VA 3TG4A 4BTAA 3CVQA 4J8EA 2PQRA 2WQHA 2ONDA 4B94A 2FBNA 3K9IA 3PE4A 5FZSA 1HXIA 2VGXB 3UQ3A 3S7DA 2I6HA 4G25A 1ELWA 3VTXA 4GYYA 4AM9A 4XI9A 4HOQA 5HI7A 3AS5A 3CEQA 1QZ2A 1A17A 2WPVA 1E96B 3LY9A 1IHGA 3SZ7A 5BW8C 4I9CA 4IN3B 4N3CA 4EQFA 4GCNA 4CGWA 5CCMA 4UQYA 2BUGA 3MV2B 1ELRA 4U0ZA 1OUVA 5LCWJ 3ZPJA 3MA5A 2VGYA 4H7YA 5FTPA 3QDNA 1XNFA 2PQNA 2R5SA 3CKCA 3RJVA 3OXFA 2KCLA 2LNIA 1NZNA 5CCLA 2XCBA 5D0QD 3CK8A 3RIBA 2C0LA 4N3AA 3TG5A 5A7DB 2C2LA 3JYSA 2L6JA 4G26A 3GW4A 5EX3A 1FCHA 2HYZA 2HO1A 4AY6A 3AS8A 4GA2A 3WXXA 3ZHEA 4NRHB 4AY5A 5KJLA 5G05J 5BNWA 2JLBA 4NQ0A 2KC7A 4UI9J 5G04J 2V5FA 2Y4TA 3MKRA 3UPVA 3CVNA 3ZN3A 3FP3A 4O6FA 3TGOA 3GZ1A 3S7JA 5C1DA 1QQEA 2XCCA 1ZBPA 3ASFA 4ME2A 4XI0A 3RO2A 3OXGA 5LCWC 3QWPA 4YVOA 5KJKA 3Q49B 4YNDA 2XGMA 2PZIA 4UQXA 4WNDA 3Q5MA 4F3VA 1IYGA 2Q7FA 1PC2A 2NC9A 3ZHEB 1KT1A 2XEVA 4I1AA 5JJTA 1HH8A 2AVPA 2FO7A 2XGSA 4HOSA 4RG6A 3QKYA 2DBAA 1TJCA 3ESKA 4U04A 1KLXA 1P5QA 4HOUA 3ZGQA 4YVQC 3Q47B 4W9RA 4JL0A 2MHKA 5FZRA 5HQ8A 4GYWA 4GZ6A 1NA0A 2IF4A 2KCKA 1YA0A 3LKUA 5BT1A 2YHCA 3LCAA 3LY7A 3MEKA 4N5CA 3URZA 4RG9A 3IEGA 2LSVA 4N2SA 3CVPA 3ASDA 3R9AB 5FZQA 3S7FA 4I2ZA 4WUYA 3PDNA 2IFUA 4CGVA 2VSNA 4UI9C 5G04C 2P58C 3Q15A 4I2WA 4GYOA 3S7BA 2VGXA 5KJMA 4Y6CA 3EDTB 3FWVA 3ASGA 4BWRA 3E4BA 5ARFA 2GW1A 5EKQD 3ASHA 4HOTA 4KBQA 1HZ4A 4WNGA 4G23A 4GCOA 2C0MA 3CKBA 3KAEA 3NF1A 4GZ3A 4H7XA 5EX0A 5FJYA 4I17A 5JJ6A 4N39A 2VQ2A 4J8DA 1WM5A 3CV0A 3QWVA 3U3WA
chains in the Genus database with same CATH superfamily
4HRNA 2J9QA 1NA3A 5HKPA 4N2QA 2FF4A 3KEZA 3TWQA 2UWJG 5CMYA 4J0UA 3OXLA 4Q96A 2WXOA 1LD7A 4UWFA 3BEEA 5EIDA 3GYZA 3HXFA 2P2CP 4KXKB 1WAO1 3FFLA 4UQZA 4HORA 4ABNA 4N5QA 1E8YA 1UN9A 1YYHA 1K8KG 4CDRA 5H7PA 3RRMB 4A1GA 2PL2A 2YHEA 1Z5SC 3KS2A 3RRNB 2AXVA 3VLDA 4FA6A 1ZU2A 1N54A 3U9WA 4BT8A 5B3SE 4K5BA 5BV1A 3I4RB 2BKGA 2WXQA 4OVUA 2IEJA 1WY6A 4YDYA 1S0PA 3DPDA 3CHPA 3AAAC 3FUFA 2KATA 3JCKC 5CHEE 3CVLA 4DLQA 3DXMG 1O1RA 4F6RD 4L2YA 2LAIA 5AARA 3VTYA 4U63A 4OVVA 4DJAA 2KCVA 2KZTB 4UWLA 2X6KA 2UY1B 2IQCA 3EJNA 4U07A 3RAUA 2CHZA 3QOUA 1EPUA 3V30A 4WWNA 4J8FA 2FI7A 3MZLB 5FT9A 4X8QA 2WXNA 5CBOA 5DBKA 2IOLA 2QYJA 2XPYA 3FTVA 2BKKB 3CVQA 1TNUA 3TXMA 3TXNA 4HNAD 2FBNA 4EZKA 3CVXA 5ENTD 2OVBA 3C3OA 5FZSA 3R9MA 3V2OA 3UQ3A 1S63A 2OEWA 3UMVA 4LCTA 3ZYLA 1AP7A 4FP7A 3B13A 4PH4B 4GYYA 3FUJA 5KNHD 4CRWA 1E96B 2QYUA 1FT1A 2F8YA 4RQIA 2J09A 2EIKE 4N3CA 2EILE 5CCMA 2H6FA 2BUGA 3IV0A 4XE0A 2ZIRA 3APCA 1ELRA 2IJGX 4ACLA 2Y1LE 4OYSA 5LFAA 4JZYA 3PZ1A 5AQ7A 4UUCA 1EYHA 4H7YA 2OCCE 3C98A 2V4HC 2PQNA 2WQ6A 3LS8A 4DPRA 3ZYQA 2NXPA 3JQ1A 2Y3AA 4KVMA 1O1SA 3RSEG 3T9KA 5D0QD 3CK8A 4YDEA 1E8XA 1RW2A 2IU1A 1A5EA 1Z3YA 5AQAA 4G26A 4DLOA 5EX3A 5ITZF 3DSTA 4HI8A 5B1BE 2ZISA 4KVOA 2P9UG 4KZ0A 4YDWA 2WM9A 3HIZA 4JVSA 5BNWA 2WMNA 3QC1A 5HS0A 3FHEA 3D9OA 2P9LG 2B6CA 3QK0A 2V5QC 5G04J 4FULA 4EBAG 2DYRE 3APDA 2R05A 1DC2A 3PEVB 3BQOA 3ASFA 2F37A 4ME2A 2H6HA 4XI0A 1N95A 3G2WA 3T5XA 5LCWC 4O1PA 3FUMA 3DXKG 4M7CA 2XZTG 4EECA 3PNTB 2PZIA 3CSTA 1LD8A 2Q7FA 1K1BA 2PNNA 3SBSA 5JJTA 1HH8A 2XGSA 4B8CB 4J8YA 4GTPA 2OVFA 2XRZA 2J07A 4JD2G 4U04A 2L9BA 1KLXA 1SZ9A 4GPMA 3Q47B 3ONLA 3PZ3A 3UT7A 3NZSA 5HQ8A 1Z6TA 4GZ6A 4JPSA 3FH7A 4K03A 3LKUA 5BT1A 2YHCA 3FTXA 4BFRA 3IEGA 3FH5A 5FQ7A 1YCSB 4HVBA 3CHQA 3O4ZA 1N0RA 4OAUC 3MKQB 4C9BB 3EIJA 5EYPF 3AU5A 3FULA 1TN6A 3D9HA 1S70B 4CGVA 4HXIA 4NIKA 3CIAA 2P58C 4EBAA 4MBGA 1JWGA 4I1MA 3S7BA 1BLXB 4FHKA 5E76A 2VSXE 5FWQA 4BWRA 3FEXA 4CT4A 3FTZA 4AP2A 3ASHA 3VLFA 4BEPA 4WNGA 3NF1A 4FU3A 3D9MA 4AXHA 2I9CA 5AJLA 1LF8A 3WG7E 5D66A 3EU5A 4IULA 3CHSA 4M3OA 5ENRD 3NBNB 2CFUA 2FEZA 1NI1A 3MYVA 5AIJA 5CERB 3B7RL 5BPPA 2ZGGA 4GPKA 4N3BA 2V8SE 3CSFA 5G55A 5LP0A 1JUQA 4UI9K 1OXJA 3TL5A 4NURA 4PS3A 4YDOA 1V54E 4LERA 4I9EA 5ARGA 3R7RA 2GRNB 4DX2A 3CVVA 3SI5A 4DI4A 1TJFA 4G11A 4Y6WA 5BXOA 5B1AE 4GTVA 2CHXA 2YQ8A 3O48A 4ACKA 1OCRE 5G2NA 3PH0C 2KBXA 5AAOA 4MRUA 4WNFA 3UUXA 2ZXWE 4GZ5A 2BTDA 3MV3B 4U0UA 2M63A 1MX6A 3AG4E 3FTYA 3UXGA 2PM7A 4A1SA 1IXVA 4GTMA 4TUMA 4QQIA 3UKUG 3BU8A 3CHRA 3IXEA 3LY8A 1ELKA 3AG2E 2X6HA 1MX4A 4DK5A 3HVEA 3KD7A 5M72A 4C0MA 4JA7A 5CEAA 1Y6IA 3AS4A 5AYWD 4TUUA 4C48B 5A6CA 4B8AA 1E7VA 3ML8A 4ANUA 3NQPA 2VTBA 1JWFA 2QY7A 5CMWA 4XZ4A 2DCPA 4I1OB 3EHRA 2AJAA 3KSQA 3FUNA 4BTAA 5KNGA 4J8EA 2PQRA 4E85A 3D9JA 4B0ZA 3K9IA 2J8SD 5A23A 3PE4A 3Q9UC 3SY2A 3ZXSA 5ENNA 1HXIA 4JW1A 1BD8A 2GRRB 3SGHA 4G25A 2IONA 1MQSA 2GRPB 2WVIA 4EZLA 1ELWA 3FH8A 5FIOA 5FINA 4HOQA 3CEQA 3L17A 2WPVA 2V0PA 1K3ZD 3HXBA 1NFIE 4EPZA 3E37A 2IO3C 3PZ4A 3SNXA 4U96D 5CEDB 4IN3B 4EQFA 5CECB 3IBEA 4AOFA 4CGWA 3RK6A 2H6IA 2WXHA 1U2VG 3MX3A 5CBNA 3MV2B 4CCAA 4Q94A 3NB2A 3T8MA 1OUVA 5LCWJ 5KWDA 3ZPJA 4R7LA 1KZOA 1N4QA 3FUDA 3L6AA 1SQMA 4JHKA 1XNFA 4FJZA 2EINE 2QZAA 3CKCA 3L82A 4JHJA 3OXFA 3J5PA 1N94A 4APFA 3NOCD 3ENEA 5E75A 2L0IA 5BUZA 4B93B 3RIBA 3TG5A 5A7DB 5D2MC 2RD0A 2L6JA 5ENOD 4MLPA 2VGEA 2GROB 2XEHA 3J5QB 2MOWA 2HYZA 3UX4A 4AY6A 1HX8A 2F8XK 4BY6A 2WXJA 1JCRA 4GA2A 1Q2ZA 3ZHEA 3PUJA 4BERA 5LX8A 1H6OA 3ABKE 1BI8B 4QFVA 2WB2A 5KJLA 4K5AB 4V3IA 3QARA 2V5FA 3UT8A 3MKRA 4FLHA 4TXPA 4UWGA 1G3NB 3D9KA 5ANLA 3X2QE 4XX5A 1UJKA 4JEUA 5C1DA 2XCCA 4PS7A 3FUIA 1ZBPA 4FADA 1OWLA 2XRYA 1SVXA 1PY1A 3T8KA 5KJKA 3BG1B 1X5BA 3W9GA 2XGMA 3AG1E 2J08A 1IYGA 4JB8P 1KT1A 4UWKA 4J6IA 4I1AA 3C3RA 4HS2A 4KMOA 3QKYA 2DBAA 4GB9A 3ULEG 4HQDA 4O1OA 2IO2C 5CRUA 4F7AA 4U8VD 4YVQC 2MHKA 5FZRA 4LNBA 1MX2A 4E6HA 3EUVA 3LY7A 3JXIA 3AU4A 1N4PA 4RVBA 3ZYKA 2X6JA 3HHMA 2MYOA 1TEZA 2LSVA 4N2SA 3JXJA 2ETBA 3R9AB 2HM8A 3DEOA 3Q7FA 4RSYA 4I2ZA 4A63B 4WUYA 4U8YD 2VSNA 3DSVA 4UI9C 4I43A 3G2UA 4GMLA 2VSOE 2RKKA 4GYOA 1PAQA 1DCEA 1OY3D 1U3CA 5KJMA 3FU0A 3P1UA 3ASGA 4B89A 4D10C 3E4BA 3SFXA 2XENA 2CFZA 3UT4A 5EKQD 3UM0A 4G23A 4GCOA 5EYLA 3CKBA 3QJZA 4GZ3A 3DRAA 3V2XA 5EX0A 1INZA 5FJYA 4I17A 2XS8A 1JCSA 3U64A 3D9LA 2VQ2A 3FUKA 4HI9A 4ANWA 2A4ZA 3ABME 2IOSA 3QWVA 2DYSE 3ZVVA 4ATGA 4BETA 2WQ7A 3U3WA 2LSUA 1UG3A 3U4TA 3UKRG 1SA4A 3UM2A 3RRUA 2L0TB 3D3MA 5C2YA 1JPLA 3ABLE 2A5EA 2HE0A 1KT0A 2OOEA 5D0OD 3TWVA 3TJPA 1B89A 1Z3XA 4AIFA 5IY5E 3C3QA 5JHBA 4TXQA 4HFGA 5ENPD 3ZYMA 2QFCA 3RO3A 2XPIA 5AQBA 3ZW3A 3OAWA 3SQVA 5KCMA 3SFZA 3CLJA 3CK7A 3E30A 2R2LA 4DI3A 2WXFA 3L54A 3PE3A 3HDXA 4HLLA 3D9PA 3TWTA 2P9SG 2ZU6B 1U3DA 3UI2A 1SZAA 3LYAA 5DIZA 1E8ZA 3CHOA 3UIPC 5AJDA 4EHMA 4WAFA 1QBQA 3PZ2A 4A3VA 2VSYA 4BT9A 4BTBA 1NP7A 4LUNU 3TWWA 3B7UX 2XS1A 2WXLA 4XIFA 3RU0A 2B0OE 3KSLA 4J7WA 2XQ0A 3R7QA 1E90A 3CK9A 3ZFWA 3L13A 1IHBA 1DVPA 3FTSA 2VYIA 5LOZA 4DX6D 5J08A 4G2VA 1UW4B 5EN5D 2WQHA 1SW6A 3FU5A 3AG3E 2VGXB 5EILA 2LO6A 3ZU7B 2OV8A 5KBAA 1N11A 3IHVA 4TXRA 2IY0C 5FQ6A 3S7DA 3SBTB 2YINA 3I4GA 1O5MA 3VTXA 4AM9A 3CGHA 3AS5A 1A17A 3HVEB 3SZ7A 1LTXA 2ILRA 3E33A 3G2TA 5BW8C 1ZB1A 2R03A 4GCNA 3ZIMA 3CVUA 2QC9A 2VTBB 3I3NA 4LRZA 4ILGA 3SD5A 3W9FA 2RFMA 1OCCE 4U0ZA 3QNKA 2DWZA 1TN8A 3V79K 3E32A 1WDYA 2VGYA 4U95D 4PDXA 5FTPA 5J90A 4U7EB 2WXIA 4URKA 2R5SA 2XZDG 4GTQA 3RJVA 4O60A 3GZSA 2ETCA 1RZ4A 3Q79A 1H0AA 4GAAA 3Q75A 3SO8A 2MRIA 4WWOA 2X38A 2F0YA 4GMRA 1MYOA 2ZGDA 3IHYA 3ASNE 3EHMA 2V4LA 3L08A 3Q78A 1QNFA 2HO1A 3AS8A 4NRHB 3DBSA 5FQ8A 3QAQA 4AY5A 1TYQG 2Y0BG 5G05J 1MHQA 5T8IA 4UI9J 4DRXE 2R59A 2WXPA 4DX1A 3CVNA 1E8WA 1FVHA 4EZJA 3TGOA 3S7JA 1QQEA 1YMPA 1QYMA 3HRAA 3RO2A 3FUHA 2VJ8A 4YVOA 3D9IA 2P9PG 1MJ0A 3Q49B 3CQGB 4BESA 1BU9A 3SFYA 4WNDA 3Q5MA 1IQUA 3ZHEB 4ANVA 2XEVA 2X6FA 1N4SA 1BI7B 3DSUA 2AVPA 1MZCA 4LSZE 3DSXA 4HOSA 2LUHA 4RG6A 3ML9A 3ZRHA 1TJCA 3ESKA 2JEKA 2LXMA 3ZXPA 1FT2A 4NACA 1P5QA 3DPYA 4HOUA 3PNLB 3ZGQA 2J4DA 4TRQA 3TWUA 1OWPA 4G8KA 4PUCA 1NA0A 4CZ2D 4LG6A 3LJNA 4AEZC 3HXCA 4ILIA 3ISMC 4L23A 4N5CA 3CVWA 1HE8A 1D9SA 2DZNA 1UN8A 1FVFA 2X6IA 3CVPA 3ASDA 2RG8A 4Z68A 1N9AA 3P2BA 2IFUA 1TNBA 4BSZB 3PRZA 4PS8A 3EHQA 4CT0A 1OCZE 4CEMA 3Q15A 2NYJA 2LAHA 3V31A 2GRMA 1L5JA 1TN7A 1X81A 2AW6A 2A5UA 3HXDA 4BX8A 4P29A 3F6QA 1TNOA 4U8HA 2GW1A 2WXGA 4ILHB 1HG5A 3LVRE 2R02A 3FTUA 4MKTA 4TV3A 4KBQA 1HZ4A 1SA5A 4AV7A 1TNZA 2DIWA 4H7XA 1H2TC 5JJ6A 4N39A 4ZFHA 2BF0X 2LXLA 4F1PA 3FY4A 3VLEA 4APOA 3B95A 2GRQB 4FJYA 3DEPA 2CHWA 3Q4AB 3RKVA 4XEIG 2WMOA 4I6JA 3JUEA 1XGWA 4GA0A 2XPZA 2BEDA 3APFA 3OTNA 3IKOB 2KZTA 3B7BA 3SF4A 3LEWA 4ZHBA 3N71A 3UM3A 4G1TA 2Y4UA 2UY1A 3KEAA 3C72A 2PM6A 4HRMB 3HYMB 3EIQC 1HS6A 3MJWA 4G24A 2I2OA 3JQ0A 3UIOC 4CDNA 2EIME 4FC8A 4JHRA 3I5PA 3QWWA 3TAXA 3UINC 5JJ7A 3EU9A 1HG2A 3ZEFA 1UJJA 3HXEA 5G05C 1N4RA 2E2EA 4LNGA 3AJIA 3NZUA 4KYOB 3NAWA 1H6PA 1OCOE 3GZ2A 2JABA 1N52A 4L2LA 1H2UA 4I6GA 3ZUVB 4C0EA 2HR2A 5EDSA 5HRYA 1KPSB 3TWRA 2GRLA 3JUIA 3ULQA 3BUAA 1S64A 4AJWA 3D9NA 1Y8MA 4LEUA 4DX5D 1HO8A 4CYMD 2WXRA 2YNQA 3LPZA 4WNEA 1W3BA 2FULA 1H19A 3PVLA 4GA1A 2GGFA 1IKND 1VDYA 2XGOA 4JA9A 2P9IG 4GU5A 5KJNA 1D8EA 3S2AA 4U0SA 4K0RA 3HG0D 3TG4A 3DWLG 4G8LA 3ZNGA 2ONDA 4B94A 4HBDA 3LVQE 1OWMA 5AENA 1BPOA 3FU3A 3LDZA 1EDUA 4XKCA 2H6GA 2I6HA 3LJ3A 4XI9A 5HI7A 5EIBE 1QZ2A 1H2VC 5FQ4A 3LY9A 1IHGA 4GMJA 4UWHA 3G2SA 4FHJA 1NL4A 4I9CA 3L16A 4KT6B 4GZCA 4DUIA 1TR4A 4UQYA 4CDMA 3ONKA 1FPPA 2E0IA 2KXPC 3FTWA 4BSXA 3E34A 2Y69E 2CG3A 3MA5A 3Q9NC 4GTSA 1JCQA 3QB2A 4RLYA 1WG0A 3QDNA 3T5VA 3ZKJA 3U66A 2KCLA 2CG2A 1HF8A 2LNIA 1NZNA 5CCLA 2XCBA 4IYPA 2R17C 5CRVA 2EIJE 3TWSA 2C0LA 4GTTA 4N3AA 2C2LA 3JYSA 1OWOA 3MCXA 3GW4A 1K1AA 1FCHA 3DSSA 3Q7AA 2J49A 3MGBA 3PS6A 1KZPA 4DX7D 3ULYA 4L7TA 1EF1C 3WXXA 1OT8A 2J4BA 3PREA 2P9NG 5AQ9A 4OAVB 2JLBA 4NQ0A 2KC7A 2OEVA 3CR3A 3UM1A 2ETAA 2Y4TA 3UPVA 4BX9A 2EQXA 3ZN3A 3Q73A 5JA4D 3FP3A 4O6FA 3GZ1A 4JC8A 1AWCB 3PZDA 4L9PA 1HU3A 1N0QA 3DSWA 2RFAA 2DZOA 3OXGA 3QWPA 3TWXA 3MKQA 4XKBA 4JEHA 4YNDA 2WXMA 5BXUA 4UQXA 3BG0B 5ENQD 5AN8A 4F3VA 1PC2A 2NC9A 2FO1E 3ASOE 2FO7A 3B7TA 4HLEA 1UOHA 2NSZA 2XHEA 3C5RA 3FU6A 4GTRA 1E7UA 4F1SA 3B7SA 4L1BA 4W9RA 4JL0A 2L6BA 4FLBA 4GYWA 5ANRA 2X3MA 2IF4A 2KCKA 1YA0A 3FEYA 4MS6A 4GZDA 3LCAA 3NOGD 3MEKA 2KM4A 3UTMA 4KZCA 4LNUD 3URZA 1H6KA 4RG9A 5ENSD 4ANXA 2I1KA 5JMND 2AXZA 1O1TA 4F53A 2XEEA 4IRUA 5JHAA 5T4YA 5FZQA 3FUEA 3S7FA 4WWPA 3SHFA 3PDNA 4HB5A 4A3TA 5G04C 4AVXA 5T3RA 3EHNA 4I2WA 1HFAA 4JXTA 3CVYA 2VGXA 4ATZD 1DNPA 2DVWA 4Y6CA 3EDTB 3FWVA 4K5CA 4Q69A 3G2VA 3CQCB 2WXKA 3PUKA 1V55E 5BV0A 1GW6A 4J8SA 5ARFA 2P9KG 3ESLA 1OWNA 3LXUX 4GTOA 4I6EA 4HOTA 2AWIA 2C0MA 3KAEA 3L9TA 2I1JA 4HRLA 3PEUB 1TNYA 2AXUA 1D8DA 4J8DA 1WM5A 3FDHA 3CHMA 1DCQA 3L22A 3CV0A 1IQRA 4A55A
chains in the Genus database with same CATH topology
2CFUA 2FEZA 2LSUA 3MYVA 4APOA 5AIJA 1UG3A 3B7RL 5BPPA 4GPKA 3U4TA 4N3BA 2J9QA 3RRUA 2L0TB 1NA3A 2V8SE 3D3MA 4FJYA 2CHWA 3Q4AB 5C2YA 3CSFA 5G55A 5LP0A 4N2QA 1JPLA 3RKVA 1JUQA 2WMOA 2FF4A 3KEZA 4I6JA 4UI9K 2UWJG 5CMYA 4J0UA 1KT0A 3OXLA 2WXOA 4Q96A 1XGWA 4GA0A 2OOEA 5D0OD 3TL5A 3ZVVA 4UWFA 3TJPA 2XPZA 3APFA 3BEEA 4NURA 4PS3A 1B89A 3OTNA 3GYZA 4LERA 1Z3XA 4AIFA 4I9EA 3IKOB 2KZTA 4KXKB 5ARGA 3SF4A 3R7RA 3LEWA 1WAO1 3FFLA 3N71A 3CVVA 4UQZA 5JHBA 4HORA 4ABNA 3SI5A 4DI4A 4HFGA 1E8YA 1TJFA 1UN9A 2Y4UA 4G1TA 2UY1A 4G11A 3ZYMA 4CDRA 3RRMB 2PM6A 4Y6WA 2QFCA 3RO3A 2PL2A 3HYMB 4A1GA 2YHEA 2XPIA 3EIQC 1HS6A 3KS2A 3RRNB 3MJWA 2AXVA 3OAWA 2CHXA 4G24A 3VLDA 2I2OA 3JQ0A 3ZW3A 4FA6A 4CDNA 4FC8A 1ZU2A 5KCMA 3SFZA 4JHRA 1N54A 2YQ8A 3I5PA 3U9WA 3O48A 3CLJA 4ACKA 3CK7A 4BT8A 4DI3A 3QWWA 3TAXA 5JJ7A 2WXFA 5BV1A 3I4RB 5G2NA 3L54A 3PH0C 3PE3A 1HG2A 3ZEFA 4MRUA 1UJJA 4WNFA 3UUXA 5G05C 2E2EA 4GZ5A 2WXQA 4OVUA 2BTDA 3MV3B 4U0UA 2M63A 3HDXA 3NZUA 1WY6A 3FTYA 1S0PA 2PM7A 3D9PA 4KYOB 3DPDA 4A1SA 3CHPA 3FUFA 2KATA 3GZ2A 3JCKC 2ZU6B 5CHEE 3CVLA 1U3DA 4DLQA 1N52A 1SZAA 4L2LA 1H2UA 3LYAA 4I6GA 5DIZA 4L2YA 2LAIA 1E8ZA 3CHOA 4C0EA 2HR2A 5AJDA 5EDSA 4WAFA 2GRLA 3VTYA 4A3VA 4U63A 2VSYA 3JUIA 4OVVA 3CHRA 4DJAA 4BT9A 4BTBA 1NP7A 3ULQA 2KCVA 4LUNU 2KZTB 4UWLA 3LY8A 1ELKA 2X6HA 2X6KA 4AJWA 4DK5A 3D9NA 3HVEA 3B7UX 2WXLA 3KD7A 4XIFA 5M72A 1Y8MA 4LEUA 4C0MA 2UY1B 4JA7A 2IQCA 1HO8A 3EJNA 2WXRA 3RU0A 4U07A 1Y6IA 3AS4A 5AYWD 4TUUA 2YNQA 5A6CA 3LPZA 1E7VA 4B8AA 4WNEA 3ML8A 1W3BA 2CHZA 3QOUA 4ANUA 2FULA 1EPUA 3NQPA 1H19A 3PVLA 4J8FA 2FI7A 4GA1A 2GGFA 1VDYA 2XGOA 2XQ0A 3MZLB 1E90A 4JA9A 5FT9A 3R7QA 2VTBA 3CK9A 3ZFWA 3L13A 2WXNA 1DVPA 4GU5A 3FTSA 1JWFA 2VYIA 5LOZA 2QY7A 5KJNA 5DBKA 5CMWA 4XZ4A 2DCPA 2IOLA 4I1OB 4K0RA 4U0SA 3S2AA 5J08A 2XPYA 4G2VA 1UW4B 3FUNA 3FTVA 3TG4A 4BTAA 3CVQA 4J8EA 2PQRA 3TXMA 3TXNA 2WQHA 4E85A 3FU5A 2ONDA 3D9JA 2FBNA 4B0ZA 3K9IA 4B94A 4EZKA 3CVXA 3LVQE 5A23A 1OWMA 3PE4A 2OVBA 5AENA 5FZSA 3ZXSA 1BPOA 3FU3A 5ENNA 3LDZA 1HXIA 2VGXB 1EDUA 2LO6A 4JW1A 4XKCA 4WWNA 3UQ3A 2OV8A 3IHVA 3SGHA 5FQ6A 3UMVA 3S7DA 4LCTA 3ZYLA 2I6HA 4FP7A 2IONA 4G25A 1MQSA 2WVIA 2YINA 3I4GA 3LJ3A 1ELWA 3B13A 3SBTB 3FH8A 4EZLA 3VTXA 4PH4B 4GYYA 3FUJA 4AM9A 4XI9A 3CGHA 4HOQA 5HI7A 3AS5A 3CEQA 1QZ2A 1H2VC 3L17A 1A17A 2WPVA 4CRWA 3HVEB 2V0PA 5FQ4A 1E96B 3LY9A 1IHGA 4GMJA 3SZ7A 4EPZA 4UWHA 3G2SA 2ILRA 3G2TA 4FHJA 2J09A 3SNXA 5BW8C 4I9CA 4IN3B 4N3CA 4EQFA 3IBEA 3L16A 4GCNA 4AOFA 4KT6B 4GZCA 3ZIMA 5CCMA 4CGWA 3RK6A 3CVUA 4UQYA 2VTBB 2WXHA 3MX3A 3I3NA 4LRZA 2BUGA 3IV0A 4XE0A 3MV2B 4ILGA 3SD5A 4CCAA 4Q94A 4CDMA 3APCA 3ONKA 1ELRA 2IJGX 4U0ZA 3T8MA 4ACLA 2E0IA 4OYSA 1OUVA 5LCWJ 3QNKA 3FTWA 5LFAA 4JZYA 3ZPJA 4BSXA 4R7LA 2CG3A 3MA5A 2VGYA 1EYHA 4H7YA 3QB2A 3FUDA 4PDXA 3L6AA 5FTPA 3C98A 5J90A 1SQMA 2WXIA 3QDNA 1XNFA 2PQNA 4JHKA 4FJZA 4URKA 2R5SA 3CKCA 3T5VA 2WQ6A 3LS8A 3U66A 3RJVA 4JHJA 2NXPA 3JQ1A 2KCLA 2Y3AA 3OXFA 3ZYQA 3GZSA 2CG2A 4DPRA 4APFA 4KVMA 1HF8A 2LNIA 1NZNA 5CCLA 2XCBA 5D0QD 3CK8A 4IYPA 3ENEA 5E75A 2L0IA 2R17C 5BUZA 1H0AA 4GAAA 3RIBA 2C0LA 4N3AA 2MRIA 3TG5A 4WWOA 5A7DB 1E8XA 2IU1A 2RD0A 2C2LA 3JYSA 2X38A 1Z3YA 1OWOA 2L6JA 4MLPA 3MCXA 4G26A 3GW4A 4DLOA 5EX3A 1FCHA 3IHYA 2MOWA 2HYZA 3EHMA 2J49A 2V4LA 3MGBA 3L08A 4KVOA 3UX4A 1QNFA 4KZ0A 3PS6A 2HO1A 4AY6A 1HX8A 4BY6A 2WXJA 3AS8A 4GA2A 4L7TA 1EF1C 3WXXA 3PUJA 3ZHEA 4NRHB 5LX8A 2WM9A 3DBSA 2J4BA 3HIZA 3PREA 4JVSA 5FQ8A 4QFVA 2WB2A 3QAQA 4AY5A 5KJLA 5G05J 5BNWA 2WMNA 3QC1A 1MHQA 2JLBA 4NQ0A 3FHEA 4V3IA 2KC7A 3D9OA 3CR3A 5T8IA 3QK0A 3QARA 4UI9J 4FULA 5G04J 2V5FA 2Y4TA 3UT8A 2R59A 3MKRA 3UPVA 2WXPA 4FLHA 4EBAG 4BX9A 4UWGA 2EQXA 3CVNA 3ZN3A 1E8WA 1FVHA 3D9KA 4EZJA 3APDA 3FP3A 5ANLA 4O6FA 3TGOA 3GZ1A 4JC8A 3S7JA 4XX5A 1UJKA 4JEUA 5C1DA 1QQEA 2XCCA 3FUIA 3PEVB 1ZBPA 3PZDA 4PS7A 4FADA 1HU3A 1OWLA 3ASFA 4ME2A 4XI0A 3RO2A 3OXGA 3G2WA 3T5XA 3FUHA 5LCWC 2VJ8A 2XRYA 3QWPA 3FUMA 1PY1A 4YVOA 3D9IA 3BG1B 5KJKA 3MKQA 3Q49B 4XKBA 1X5BA 4EECA 4JEHA 3CQGB 4YNDA 2XGMA 3PNTB 2PZIA 2J08A 2WXMA 3CSTA 4UQXA 4WNDA 3BG0B 3Q5MA 1IQUA 4F3VA 1IYGA 2Q7FA 1PC2A 2NC9A 3ZHEB 1KT1A 4ANVA 2XEVA 3SBSA 2X6FA 4UWKA 4J6IA 4I1AA 5JJTA 1HH8A 2AVPA 2FO7A 3B7TA 4HLEA 2XGSA 2NSZA 2XHEA 4HS2A 4B8CB 4HOSA 2OVFA 4RG6A 3FU6A 4KMOA 3ML9A 3QKYA 3ZRHA 2XRZA 2DBAA 1E7UA 2J07A 1TJCA 4GB9A 3ESKA 2JEKA 4F1SA 4U04A 2L9BA 1KLXA 1P5QA 3B7SA 4NACA 4HOUA 1SZ9A 3PNLB 4L1BA 4F7AA 3ZGQA 4YVQC 3Q47B 3ONLA 4W9RA 4JL0A 2MHKA 5FZRA 3UT7A 2J4DA 3NZSA 5HQ8A 4TRQA 4FLBA 1Z6TA 1OWPA 4GYWA 4GZ6A 2X3MA 5ANRA 4JPSA 4PUCA 1NA0A 4E6HA 2IF4A 3FH7A 2KCKA 4AEZC 1YA0A 3FEYA 3LKUA 4ILIA 4GZDA 4K03A 2YHCA 3LCAA 3LY7A 4MS6A 4L23A 5BT1A 3FTXA 3MEKA 2KM4A 4N5CA 3AU4A 3CVWA 1HE8A 4RVBA 4KZCA 3URZA 3ZYKA 4BFRA 2X6JA 1H6KA 4RG9A 3IEGA 4ANXA 3FH5A 5FQ7A 2I1KA 3HHMA 1TEZA 2LSVA 4N2SA 2AXZA 1UN8A 1FVFA 2X6IA 4HVBA 3CHQA 3CVPA 3ASDA 2RG8A 3O4ZA 4F53A 4IRUA 3R9AB 5T4YA 5JHAA 3MKQB 2HM8A 4C9BB 4RSYA 3P2BA 5FZQA 3EIJA 3AU5A 3FUEA 3S7FA 4I2ZA 4WWPA 3FULA 3SHFA 4WUYA 3PDNA 2IFUA 4A3TA 4HXIA 4CGVA 3PRZA 4PS8A 2VSNA 4UI9C 5G04C 4CT0A 3CIAA 2P58C 4AVXA 5T3RA 4EBAA 4CEMA 3Q15A 4I43A 3EHNA 4I2WA 1HFAA 2LAHA 4JXTA 3G2UA 4GMLA 2VSOE 3CVYA 1JWGA 4I1MA 4GYOA 1PAQA 2GRMA 3S7BA 2VGXA 1U3CA 1L5JA 5KJMA 1DNPA 4Y6CA 3EDTB 3FWVA 2AW6A 4FHKA 2A5UA 3G2VA 3FU0A 5E76A 3CQCB 4P29A 4BX8A 4Q69A 2VSXE 3P1UA 5FWQA 2WXKA 3ASGA 4BWRA 4B89A 3PUKA 4D10C 4U8HA 3E4BA 5BV0A 1GW6A 3FEXA 4J8SA 5ARFA 4CT4A 3FTZA 2CFZA 3UT4A 3ESLA 1OWNA 3LXUX 2GW1A 2WXGA 4ILHB 1HG5A 5EKQD 3LVRE 4I6EA 3ASHA 4AP2A 3FTUA 4HOTA 4MKTA 3VLFA 4TV3A 4KBQA 1HZ4A 2AWIA 4WNGA 4G23A 4GCOA 2C0MA 3CKBA 3KAEA 3QJZA 3NF1A 4AV7A 2I1JA 4FU3A 3D9MA 2DIWA 4GZ3A 4H7XA 3PEUB 4AXHA 1H2TC 2I9CA 5AJLA 5EX0A 5FJYA 1LF8A 4I17A 1INZA 5JJ6A 4N39A 2BF0X 3U64A 2AXUA 3D9LA 2VQ2A 3FUKA 4IULA 4J8DA 3CHSA 4ANWA 1WM5A 3FDHA 3FY4A 2A4ZA 3CHMA 4M3OA 3VLEA 3L22A 3CV0A 2IOSA 3QWVA 1IQRA 4A55A 4ATGA 3U3WA 2WQ7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FEZ A;  2LSU A;  4APO A;  4GPK A;  3U4T A;  4N3B A;  2J9Q A;  1NA3 A;  3Q4A B;  4N2Q A;  3RKV A;  2FF4 A;  4UI9 K;  2UWJ G;  4J0U A;  1KT0 A;  3OXL A;  4GA0 A;  2OOE A;  5D0O D;  3BEE A;  1B89 A;  3GYZ A;  4AIF A;  4I9E A;  4KXK B;  5ARG A;  3SF4 A;  1WAO 1;  3FFL A;  3N71 A;  4UQZ A;  4HOR A;  4ABN A;  4G1T A;  2Y4U A;  2UY1 A;  4CDR A;  4Y6W A;  2QFC A;  3RO3 A;  2PL2 A;  3HYM B;  2XPI A;  3KS2 A;  4G24 A;  1ZU2 A;  4JHR A;  2YQ8 A;  3O48 A;  3CK7 A;  4BT8 A;  3QWW A;  3TAX A;  5JJ7 A;  3PE3 A;  4WNF A;  3UUX A;  5G05 C;  2E2E A;  4GZ5 A;  3MV3 B;  4U0U A;  4KYO B;  4A1S A;  2KAT A;  3GZ2 A;  5CHE E;  3CVL A;  3LYA A;  5DIZ A;  2HR2 A;  3VTY A;  2VSY A;  4BT9 A;  4BTB A;  3ULQ A;  2KCV A;  3LY8 A;  4XIF A;  3KD7 A;  5M72 A;  1Y8M A;  4LEU A;  2UY1 B;  4JA7 A;  3RU0 A;  4U07 A;  3AS4 A;  5AYW D;  5A6C A;  3LPZ A;  4WNE A;  1W3B A;  3QOU A;  4J8F A;  2FI7 A;  4GA1 A;  2XGO A;  5FT9 A;  4JA9 A;  3CK9 A;  3ZFW A;  2VYI A;  5KJN A;  5DBK A;  4U0S A;  4G2V A;  3TG4 A;  4BTA A;  3CVQ A;  4J8E A;  2PQR A;  2WQH A;  2OND A;  4B94 A;  2FBN A;  3K9I A;  3PE4 A;  5FZS A;  1HXI A;  2VGX B;  3UQ3 A;  3S7D A;  2I6H A;  4G25 A;  1ELW A;  3VTX A;  4GYY A;  4AM9 A;  4XI9 A;  4HOQ A;  5HI7 A;  3AS5 A;  3CEQ A;  1QZ2 A;  1A17 A;  2WPV A;  1E96 B;  3LY9 A;  1IHG A;  3SZ7 A;  5BW8 C;  4I9C A;  4IN3 B;  4N3C A;  4EQF A;  4GCN A;  4CGW A;  5CCM A;  4UQY A;  2BUG A;  3MV2 B;  1ELR A;  4U0Z A;  1OUV A;  5LCW J;  3ZPJ A;  3MA5 A;  2VGY A;  4H7Y A;  5FTP A;  3QDN A;  1XNF A;  2PQN A;  2R5S A;  3CKC A;  3RJV A;  3OXF A;  2KCL A;  2LNI A;  1NZN A;  5CCL A;  2XCB A;  5D0Q D;  3CK8 A;  3RIB A;  2C0L A;  4N3A A;  3TG5 A;  5A7D B;  2C2L A;  3JYS A;  2L6J A;  4G26 A;  3GW4 A;  5EX3 A;  1FCH A;  2HYZ A;  2HO1 A;  4AY6 A;  3AS8 A;  4GA2 A;  3WXX A;  3ZHE A;  4NRH B;  4AY5 A;  5KJL A;  5G05 J;  5BNW A;  2JLB A;  4NQ0 A;  2KC7 A;  4UI9 J;  5G04 J;  2V5F A;  2Y4T A;  3MKR A;  3UPV A;  3CVN A;  3ZN3 A;  3FP3 A;  4O6F A;  3TGO A;  3GZ1 A;  3S7J A;  5C1D A;  1QQE A;  2XCC A;  1ZBP A;  3ASF A;  4ME2 A;  4XI0 A;  3RO2 A;  3OXG A;  5LCW C;  3QWP A;  4YVO A;  5KJK A;  3Q49 B;  4YND A;  2XGM A;  2PZI A;  4UQX A;  4WND A;  3Q5M A;  4F3V A;  1IYG A;  2Q7F A;  1PC2 A;  2NC9 A;  3ZHE B;  1KT1 A;  2XEV A;  4I1A A;  5JJT A;  1HH8 A;  2AVP A;  2FO7 A;  2XGS A;  4HOS A;  4RG6 A;  3QKY A;  2DBA A;  1TJC A;  3ESK A;  4U04 A;  1KLX A;  1P5Q A;  4HOU A;  3ZGQ A;  4YVQ C;  3Q47 B;  4W9R A;  4JL0 A;  2MHK A;  5FZR A;  5HQ8 A;  4GYW A;  4GZ6 A;  1NA0 A;  2IF4 A;  2KCK A;  1YA0 A;  3LKU A;  5BT1 A;  2YHC A;  3LCA A;  3LY7 A;  3MEK A;  4N5C A;  3URZ A;  4RG9 A;  3IEG A;  2LSV A;  4N2S A;  3CVP A;  3ASD A;  3R9A B;  5FZQ A;  3S7F A;  4I2Z A;  4WUY A;  3PDN A;  2IFU A;  4CGV A;  2VSN A;  4UI9 C;  5G04 C;  2P58 C;  3Q15 A;  4I2W A;  4GYO A;  3S7B A;  2VGX A;  5KJM A;  4Y6C A;  3EDT B;  3FWV A;  3ASG A;  4BWR A;  3E4B A;  5ARF A;  2GW1 A;  5EKQ D;  3ASH A;  4HOT A;  4KBQ A;  1HZ4 A;  4WNG A;  4G23 A;  4GCO A;  2C0M A;  3CKB A;  3KAE A;  3NF1 A;  4GZ3 A;  4H7X A;  5EX0 A;  5FJY A;  4I17 A;  5JJ6 A;  4N39 A;  2VQ2 A;  4J8D A;  1WM5 A;  3CV0 A;  3QWV A;  3U3W A; 
#chains in the Genus database with same CATH topology
 4HRN A;  2J9Q A;  1NA3 A;  5HKP A;  4N2Q A;  2FF4 A;  3KEZ A;  3TWQ A;  2UWJ G;  5CMY A;  4J0U A;  3OXL A;  4Q96 A;  2WXO A;  1LD7 A;  4UWF A;  3BEE A;  5EID A;  3GYZ A;  3HXF A;  2P2C P;  4KXK B;  1WAO 1;  3FFL A;  4UQZ A;  4HOR A;  4ABN A;  4N5Q A;  1E8Y A;  1UN9 A;  1YYH A;  1K8K G;  4CDR A;  5H7P A;  3RRM B;  4A1G A;  2PL2 A;  2YHE A;  1Z5S C;  3KS2 A;  3RRN B;  2AXV A;  3VLD A;  4FA6 A;  1ZU2 A;  1N54 A;  3U9W A;  4BT8 A;  5B3S E;  4K5B A;  5BV1 A;  3I4R B;  2BKG A;  2WXQ A;  4OVU A;  2IEJ A;  1WY6 A;  4YDY A;  1S0P A;  3DPD A;  3CHP A;  3AAA C;  3FUF A;  2KAT A;  3JCK C;  5CHE E;  3CVL A;  4DLQ A;  3DXM G;  1O1R A;  4F6R D;  4L2Y A;  2LAI A;  5AAR A;  3VTY A;  4U63 A;  4OVV A;  4DJA A;  2KCV A;  2KZT B;  4UWL A;  2X6K A;  2UY1 B;  2IQC A;  3EJN A;  4U07 A;  3RAU A;  2CHZ A;  3QOU A;  1EPU A;  3V30 A;  4WWN A;  4J8F A;  2FI7 A;  3MZL B;  5FT9 A;  4X8Q A;  2WXN A;  5CBO A;  5DBK A;  2IOL A;  2QYJ A;  2XPY A;  3FTV A;  2BKK B;  3CVQ A;  1TNU A;  3TXM A;  3TXN A;  4HNA D;  2FBN A;  4EZK A;  3CVX A;  5ENT D;  2OVB A;  3C3O A;  5FZS A;  3R9M A;  3V2O A;  3UQ3 A;  1S63 A;  2OEW A;  3UMV A;  4LCT A;  3ZYL A;  1AP7 A;  4FP7 A;  3B13 A;  4PH4 B;  4GYY A;  3FUJ A;  5KNH D;  4CRW A;  1E96 B;  2QYU A;  1FT1 A;  2F8Y A;  4RQI A;  2J09 A;  2EIK E;  4N3C A;  2EIL E;  5CCM A;  2H6F A;  2BUG A;  3IV0 A;  4XE0 A;  2ZIR A;  3APC A;  1ELR A;  2IJG X;  4ACL A;  2Y1L E;  4OYS A;  5LFA A;  4JZY A;  3PZ1 A;  5AQ7 A;  4UUC A;  1EYH A;  4H7Y A;  2OCC E;  3C98 A;  2V4H C;  2PQN A;  2WQ6 A;  3LS8 A;  4DPR A;  3ZYQ A;  2NXP A;  3JQ1 A;  2Y3A A;  4KVM A;  1O1S A;  3RSE G;  3T9K A;  5D0Q D;  3CK8 A;  4YDE A;  1E8X A;  1RW2 A;  2IU1 A;  1A5E A;  1Z3Y A;  5AQA A;  4G26 A;  4DLO A;  5EX3 A;  5ITZ F;  3DST A;  4HI8 A;  5B1B E;  2ZIS A;  4KVO A;  2P9U G;  4KZ0 A;  4YDW A;  2WM9 A;  3HIZ A;  4JVS A;  5BNW A;  2WMN A;  3QC1 A;  5HS0 A;  3FHE A;  3D9O A;  2P9L G;  2B6C A;  3QK0 A;  2V5Q C;  5G04 J;  4FUL A;  4EBA G;  2DYR E;  3APD A;  2R05 A;  1DC2 A;  3PEV B;  3BQO A;  3ASF A;  2F37 A;  4ME2 A;  2H6H A;  4XI0 A;  1N95 A;  3G2W A;  3T5X A;  5LCW C;  4O1P A;  3FUM A;  3DXK G;  4M7C A;  2XZT G;  4EEC A;  3PNT B;  2PZI A;  3CST A;  1LD8 A;  2Q7F A;  1K1B A;  2PNN A;  3SBS A;  5JJT A;  1HH8 A;  2XGS A;  4B8C B;  4J8Y A;  4GTP A;  2OVF A;  2XRZ A;  2J07 A;  4JD2 G;  4U04 A;  2L9B A;  1KLX A;  1SZ9 A;  4GPM A;  3Q47 B;  3ONL A;  3PZ3 A;  3UT7 A;  3NZS A;  5HQ8 A;  1Z6T A;  4GZ6 A;  4JPS A;  3FH7 A;  4K03 A;  3LKU A;  5BT1 A;  2YHC A;  3FTX A;  4BFR A;  3IEG A;  3FH5 A;  5FQ7 A;  1YCS B;  4HVB A;  3CHQ A;  3O4Z A;  1N0R A;  4OAU C;  3MKQ B;  4C9B B;  3EIJ A;  5EYP F;  3AU5 A;  3FUL A;  1TN6 A;  3D9H A;  1S70 B;  4CGV A;  4HXI A;  4NIK A;  3CIA A;  2P58 C;  4EBA A;  4MBG A;  1JWG A;  4I1M A;  3S7B A;  1BLX B;  4FHK A;  5E76 A;  2VSX E;  5FWQ A;  4BWR A;  3FEX A;  4CT4 A;  3FTZ A;  4AP2 A;  3ASH A;  3VLF A;  4BEP A;  4WNG A;  3NF1 A;  4FU3 A;  3D9M A;  4AXH A;  2I9C A;  5AJL A;  1LF8 A;  3WG7 E;  5D66 A;  3EU5 A;  4IUL A;  3CHS A;  4M3O A;  5ENR D;  3NBN B;  2CFU A;  2FEZ A;  1NI1 A;  3MYV A;  5AIJ A;  5CER B;  3B7R L;  5BPP A;  2ZGG A;  4GPK A;  4N3B A;  2V8S E;  3CSF A;  5G55 A;  5LP0 A;  1JUQ A;  4UI9 K;  1OXJ A;  3TL5 A;  4NUR A;  4PS3 A;  4YDO A;  1V54 E;  4LER A;  4I9E A;  5ARG A;  3R7R A;  2GRN B;  4DX2 A;  3CVV A;  3SI5 A;  4DI4 A;  1TJF A;  4G11 A;  4Y6W A;  5BXO A;  5B1A E;  4GTV A;  2CHX A;  2YQ8 A;  3O48 A;  4ACK A;  1OCR E;  5G2N A;  3PH0 C;  2KBX A;  5AAO A;  4MRU A;  4WNF A;  3UUX A;  2ZXW E;  4GZ5 A;  2BTD A;  3MV3 B;  4U0U A;  2M63 A;  1MX6 A;  3AG4 E;  3FTY A;  3UXG A;  2PM7 A;  4A1S A;  1IXV A;  4GTM A;  4TUM A;  4QQI A;  3UKU G;  3BU8 A;  3CHR A;  3IXE A;  3LY8 A;  1ELK A;  3AG2 E;  2X6H A;  1MX4 A;  4DK5 A;  3HVE A;  3KD7 A;  5M72 A;  4C0M A;  4JA7 A;  5CEA A;  1Y6I A;  3AS4 A;  5AYW D;  4TUU A;  4C48 B;  5A6C A;  4B8A A;  1E7V A;  3ML8 A;  4ANU A;  3NQP A;  2VTB A;  1JWF A;  2QY7 A;  5CMW A;  4XZ4 A;  2DCP A;  4I1O B;  3EHR A;  2AJA A;  3KSQ A;  3FUN A;  4BTA A;  5KNG A;  4J8E A;  2PQR A;  4E85 A;  3D9J A;  4B0Z A;  3K9I A;  2J8S D;  5A23 A;  3PE4 A;  3Q9U C;  3SY2 A;  3ZXS A;  5ENN A;  1HXI A;  4JW1 A;  1BD8 A;  2GRR B;  3SGH A;  4G25 A;  2ION A;  1MQS A;  2GRP B;  2WVI A;  4EZL A;  1ELW A;  3FH8 A;  5FIO A;  5FIN A;  4HOQ A;  3CEQ A;  3L17 A;  2WPV A;  2V0P A;  1K3Z D;  3HXB A;  1NFI E;  4EPZ A;  3E37 A;  2IO3 C;  3PZ4 A;  3SNX A;  4U96 D;  5CED B;  4IN3 B;  4EQF A;  5CEC B;  3IBE A;  4AOF A;  4CGW A;  3RK6 A;  2H6I A;  2WXH A;  1U2V G;  3MX3 A;  5CBN A;  3MV2 B;  4CCA A;  4Q94 A;  3NB2 A;  3T8M A;  1OUV A;  5LCW J;  5KWD A;  3ZPJ A;  4R7L A;  1KZO A;  1N4Q A;  3FUD A;  3L6A A;  1SQM A;  4JHK A;  1XNF A;  4FJZ A;  2EIN E;  2QZA A;  3CKC A;  3L82 A;  4JHJ A;  3OXF A;  3J5P A;  1N94 A;  4APF A;  3NOC D;  3ENE A;  5E75 A;  2L0I A;  5BUZ A;  4B93 B;  3RIB A;  3TG5 A;  5A7D B;  5D2M C;  2RD0 A;  2L6J A;  5ENO D;  4MLP A;  2VGE A;  2GRO B;  2XEH A;  3J5Q B;  2MOW A;  2HYZ A;  3UX4 A;  4AY6 A;  1HX8 A;  2F8X K;  4BY6 A;  2WXJ A;  1JCR A;  4GA2 A;  1Q2Z A;  3ZHE A;  3PUJ A;  4BER A;  5LX8 A;  1H6O A;  3ABK E;  1BI8 B;  4QFV A;  2WB2 A;  5KJL A;  4K5A B;  4V3I A;  3QAR A;  2V5F A;  3UT8 A;  3MKR A;  4FLH A;  4TXP A;  4UWG A;  1G3N B;  3D9K A;  5ANL A;  3X2Q E;  4XX5 A;  1UJK A;  4JEU A;  5C1D A;  2XCC A;  4PS7 A;  3FUI A;  1ZBP A;  4FAD A;  1OWL A;  2XRY A;  1SVX A;  1PY1 A;  3T8K A;  5KJK A;  3BG1 B;  1X5B A;  3W9G A;  2XGM A;  3AG1 E;  2J08 A;  1IYG A;  4JB8 P;  1KT1 A;  4UWK A;  4J6I A;  4I1A A;  3C3R A;  4HS2 A;  4KMO A;  3QKY A;  2DBA A;  4GB9 A;  3ULE G;  4HQD A;  4O1O A;  2IO2 C;  5CRU A;  4F7A A;  4U8V D;  4YVQ C;  2MHK A;  5FZR A;  4LNB A;  1MX2 A;  4E6H A;  3EUV A;  3LY7 A;  3JXI A;  3AU4 A;  1N4P A;  4RVB A;  3ZYK A;  2X6J A;  3HHM A;  2MYO A;  1TEZ A;  2LSV A;  4N2S A;  3JXJ A;  2ETB A;  3R9A B;  2HM8 A;  3DEO A;  3Q7F A;  4RSY A;  4I2Z A;  4A63 B;  4WUY A;  4U8Y D;  2VSN A;  3DSV A;  4UI9 C;  4I43 A;  3G2U A;  4GML A;  2VSO E;  2RKK A;  4GYO A;  1PAQ A;  1DCE A;  1OY3 D;  1U3C A;  5KJM A;  3FU0 A;  3P1U A;  3ASG A;  4B89 A;  4D10 C;  3E4B A;  3SFX A;  2XEN A;  2CFZ A;  3UT4 A;  5EKQ D;  3UM0 A;  4G23 A;  4GCO A;  5EYL A;  3CKB A;  3QJZ A;  4GZ3 A;  3DRA A;  3V2X A;  5EX0 A;  1INZ A;  5FJY A;  4I17 A;  2XS8 A;  1JCS A;  3U64 A;  3D9L A;  2VQ2 A;  3FUK A;  4HI9 A;  4ANW A;  2A4Z A;  3ABM E;  2IOS A;  3QWV A;  2DYS E;  3ZVV A;  4ATG A;  4BET A;  2WQ7 A;  3U3W A;  2LSU A;  1UG3 A;  3U4T A;  3UKR G;  1SA4 A;  3UM2 A;  3RRU A;  2L0T B;  3D3M A;  5C2Y A;  1JPL A;  3ABL E;  2A5E A;  2HE0 A;  1KT0 A;  2OOE A;  5D0O D;  3TWV A;  3TJP A;  1B89 A;  1Z3X A;  4AIF A;  5IY5 E;  3C3Q A;  5JHB A;  4TXQ A;  4HFG A;  5ENP D;  3ZYM A;  2QFC A;  3RO3 A;  2XPI A;  5AQB A;  3ZW3 A;  3OAW A;  3SQV A;  5KCM A;  3SFZ A;  3CLJ A;  3CK7 A;  3E30 A;  2R2L A;  4DI3 A;  2WXF A;  3L54 A;  3PE3 A;  3HDX A;  4HLL A;  3D9P A;  3TWT A;  2P9S G;  2ZU6 B;  1U3D A;  3UI2 A;  1SZA A;  3LYA A;  5DIZ A;  1E8Z A;  3CHO A;  3UIP C;  5AJD A;  4EHM A;  4WAF A;  1QBQ A;  3PZ2 A;  4A3V A;  2VSY A;  4BT9 A;  4BTB A;  1NP7 A;  4LUN U;  3TWW A;  3B7U X;  2XS1 A;  2WXL A;  4XIF A;  3RU0 A;  2B0O E;  3KSL A;  4J7W A;  2XQ0 A;  3R7Q A;  1E90 A;  3CK9 A;  3ZFW A;  3L13 A;  1IHB A;  1DVP A;  3FTS A;  2VYI A;  5LOZ A;  4DX6 D;  5J08 A;  4G2V A;  1UW4 B;  5EN5 D;  2WQH A;  1SW6 A;  3FU5 A;  3AG3 E;  2VGX B;  5EIL A;  2LO6 A;  3ZU7 B;  2OV8 A;  5KBA A;  1N11 A;  3IHV A;  4TXR A;  2IY0 C;  5FQ6 A;  3S7D A;  3SBT B;  2YIN A;  3I4G A;  1O5M A;  3VTX A;  4AM9 A;  3CGH A;  3AS5 A;  1A17 A;  3HVE B;  3SZ7 A;  1LTX A;  2ILR A;  3E33 A;  3G2T A;  5BW8 C;  1ZB1 A;  2R03 A;  4GCN A;  3ZIM A;  3CVU A;  2QC9 A;  2VTB B;  3I3N A;  4LRZ A;  4ILG A;  3SD5 A;  3W9F A;  2RFM A;  1OCC E;  4U0Z A;  3QNK A;  2DWZ A;  1TN8 A;  3V79 K;  3E32 A;  1WDY A;  2VGY A;  4U95 D;  4PDX A;  5FTP A;  5J90 A;  4U7E B;  2WXI A;  4URK A;  2R5S A;  2XZD G;  4GTQ A;  3RJV A;  4O60 A;  3GZS A;  2ETC A;  1RZ4 A;  3Q79 A;  1H0A A;  4GAA A;  3Q75 A;  3SO8 A;  2MRI A;  4WWO A;  2X38 A;  2F0Y A;  4GMR A;  1MYO A;  2ZGD A;  3IHY A;  3ASN E;  3EHM A;  2V4L A;  3L08 A;  3Q78 A;  1QNF A;  2HO1 A;  3AS8 A;  4NRH B;  3DBS A;  5FQ8 A;  3QAQ A;  4AY5 A;  1TYQ G;  2Y0B G;  5G05 J;  1MHQ A;  5T8I A;  4UI9 J;  4DRX E;  2R59 A;  2WXP A;  4DX1 A;  3CVN A;  1E8W A;  1FVH A;  4EZJ A;  3TGO A;  3S7J A;  1QQE A;  1YMP A;  1QYM A;  3HRA A;  3RO2 A;  3FUH A;  2VJ8 A;  4YVO A;  3D9I A;  2P9P G;  1MJ0 A;  3Q49 B;  3CQG B;  4BES A;  1BU9 A;  3SFY A;  4WND A;  3Q5M A;  1IQU A;  3ZHE B;  4ANV A;  2XEV A;  2X6F A;  1N4S A;  1BI7 B;  3DSU A;  2AVP A;  1MZC A;  4LSZ E;  3DSX A;  4HOS A;  2LUH A;  4RG6 A;  3ML9 A;  3ZRH A;  1TJC A;  3ESK A;  2JEK A;  2LXM A;  3ZXP A;  1FT2 A;  4NAC A;  1P5Q A;  3DPY A;  4HOU A;  3PNL B;  3ZGQ A;  2J4D A;  4TRQ A;  3TWU A;  1OWP A;  4G8K A;  4PUC A;  1NA0 A;  4CZ2 D;  4LG6 A;  3LJN A;  4AEZ C;  3HXC A;  4ILI A;  3ISM C;  4L23 A;  4N5C A;  3CVW A;  1HE8 A;  1D9S A;  2DZN A;  1UN8 A;  1FVF A;  2X6I A;  3CVP A;  3ASD A;  2RG8 A;  4Z68 A;  1N9A A;  3P2B A;  2IFU A;  1TNB A;  4BSZ B;  3PRZ A;  4PS8 A;  3EHQ A;  4CT0 A;  1OCZ E;  4CEM A;  3Q15 A;  2NYJ A;  2LAH A;  3V31 A;  2GRM A;  1L5J A;  1TN7 A;  1X81 A;  2AW6 A;  2A5U A;  3HXD A;  4BX8 A;  4P29 A;  3F6Q A;  1TNO A;  4U8H A;  2GW1 A;  2WXG A;  4ILH B;  1HG5 A;  3LVR E;  2R02 A;  3FTU A;  4MKT A;  4TV3 A;  4KBQ A;  1HZ4 A;  1SA5 A;  4AV7 A;  1TNZ A;  2DIW A;  4H7X A;  1H2T C;  5JJ6 A;  4N39 A;  4ZFH A;  2BF0 X;  2LXL A;  4F1P A;  3FY4 A;  3VLE A;  4APO A;  3B95 A;  2GRQ B;  4FJY A;  3DEP A;  2CHW A;  3Q4A B;  3RKV A;  4XEI G;  2WMO A;  4I6J A;  3JUE A;  1XGW A;  4GA0 A;  2XPZ A;  2BED A;  3APF A;  3OTN A;  3IKO B;  2KZT A;  3B7B A;  3SF4 A;  3LEW A;  4ZHB A;  3N71 A;  3UM3 A;  4G1T A;  2Y4U A;  2UY1 A;  3KEA A;  3C72 A;  2PM6 A;  4HRM B;  3HYM B;  3EIQ C;  1HS6 A;  3MJW A;  4G24 A;  2I2O A;  3JQ0 A;  3UIO C;  4CDN A;  2EIM E;  4FC8 A;  4JHR A;  3I5P A;  3QWW A;  3TAX A;  3UIN C;  5JJ7 A;  3EU9 A;  1HG2 A;  3ZEF A;  1UJJ A;  3HXE A;  5G05 C;  1N4R A;  2E2E A;  4LNG A;  3AJI A;  3NZU A;  4KYO B;  3NAW A;  1H6P A;  1OCO E;  3GZ2 A;  2JAB A;  1N52 A;  4L2L A;  1H2U A;  4I6G A;  3ZUV B;  4C0E A;  2HR2 A;  5EDS A;  5HRY A;  1KPS B;  3TWR A;  2GRL A;  3JUI A;  3ULQ A;  3BUA A;  1S64 A;  4AJW A;  3D9N A;  1Y8M A;  4LEU A;  4DX5 D;  1HO8 A;  4CYM D;  2WXR A;  2YNQ A;  3LPZ A;  4WNE A;  1W3B A;  2FUL A;  1H19 A;  3PVL A;  4GA1 A;  2GGF A;  1IKN D;  1VDY A;  2XGO A;  4JA9 A;  2P9I G;  4GU5 A;  5KJN A;  1D8E A;  3S2A A;  4U0S A;  4K0R A;  3HG0 D;  3TG4 A;  3DWL G;  4G8L A;  3ZNG A;  2OND A;  4B94 A;  4HBD A;  3LVQ E;  1OWM A;  5AEN A;  1BPO A;  3FU3 A;  3LDZ A;  1EDU A;  4XKC A;  2H6G A;  2I6H A;  3LJ3 A;  4XI9 A;  5HI7 A;  5EIB E;  1QZ2 A;  1H2V C;  5FQ4 A;  3LY9 A;  1IHG A;  4GMJ A;  4UWH A;  3G2S A;  4FHJ A;  1NL4 A;  4I9C A;  3L16 A;  4KT6 B;  4GZC A;  4DUI A;  1TR4 A;  4UQY A;  4CDM A;  3ONK A;  1FPP A;  2E0I A;  2KXP C;  3FTW A;  4BSX A;  3E34 A;  2Y69 E;  2CG3 A;  3MA5 A;  3Q9N C;  4GTS A;  1JCQ A;  3QB2 A;  4RLY A;  1WG0 A;  3QDN A;  3T5V A;  3ZKJ A;  3U66 A;  2KCL A;  2CG2 A;  1HF8 A;  2LNI A;  1NZN A;  5CCL A;  2XCB A;  4IYP A;  2R17 C;  5CRV A;  2EIJ E;  3TWS A;  2C0L A;  4GTT A;  4N3A A;  2C2L A;  3JYS A;  1OWO A;  3MCX A;  3GW4 A;  1K1A A;  1FCH A;  3DSS A;  3Q7A A;  2J49 A;  3MGB A;  3PS6 A;  1KZP A;  4DX7 D;  3ULY A;  4L7T A;  1EF1 C;  3WXX A;  1OT8 A;  2J4B A;  3PRE A;  2P9N G;  5AQ9 A;  4OAV B;  2JLB A;  4NQ0 A;  2KC7 A;  2OEV A;  3CR3 A;  3UM1 A;  2ETA A;  2Y4T A;  3UPV A;  4BX9 A;  2EQX A;  3ZN3 A;  3Q73 A;  5JA4 D;  3FP3 A;  4O6F A;  3GZ1 A;  4JC8 A;  1AWC B;  3PZD A;  4L9P A;  1HU3 A;  1N0Q A;  3DSW A;  2RFA A;  2DZO A;  3OXG A;  3QWP A;  3TWX A;  3MKQ A;  4XKB A;  4JEH A;  4YND A;  2WXM A;  5BXU A;  4UQX A;  3BG0 B;  5ENQ D;  5AN8 A;  4F3V A;  1PC2 A;  2NC9 A;  2FO1 E;  3ASO E;  2FO7 A;  3B7T A;  4HLE A;  1UOH A;  2NSZ A;  2XHE A;  3C5R A;  3FU6 A;  4GTR A;  1E7U A;  4F1S A;  3B7S A;  4L1B A;  4W9R A;  4JL0 A;  2L6B A;  4FLB A;  4GYW A;  5ANR A;  2X3M A;  2IF4 A;  2KCK A;  1YA0 A;  3FEY A;  4MS6 A;  4GZD A;  3LCA A;  3NOG D;  3MEK A;  2KM4 A;  3UTM A;  4KZC A;  4LNU D;  3URZ A;  1H6K A;  4RG9 A;  5ENS D;  4ANX A;  2I1K A;  5JMN D;  2AXZ A;  1O1T A;  4F53 A;  2XEE A;  4IRU A;  5JHA A;  5T4Y A;  5FZQ A;  3FUE A;  3S7F A;  4WWP A;  3SHF A;  3PDN A;  4HB5 A;  4A3T A;  5G04 C;  4AVX A;  5T3R A;  3EHN A;  4I2W A;  1HFA A;  4JXT A;  3CVY A;  2VGX A;  4ATZ D;  1DNP A;  2DVW A;  4Y6C A;  3EDT B;  3FWV A;  4K5C A;  4Q69 A;  3G2V A;  3CQC B;  2WXK A;  3PUK A;  1V55 E;  5BV0 A;  1GW6 A;  4J8S A;  5ARF A;  2P9K G;  3ESL A;  1OWN A;  3LXU X;  4GTO A;  4I6E A;  4HOT A;  2AWI A;  2C0M A;  3KAE A;  3L9T A;  2I1J A;  4HRL A;  3PEU B;  1TNY A;  2AXU A;  1D8D A;  4J8D A;  1WM5 A;  3FDH A;  3CHM A;  1DCQ A;  3L22 A;  3CV0 A;  1IQR A;  4A55 A; 
#chains in the Genus database with same CATH homology
 2CFU A;  2FEZ A;  2LSU A;  3MYV A;  4APO A;  5AIJ A;  1UG3 A;  3B7R L;  5BPP A;  4GPK A;  3U4T A;  4N3B A;  2J9Q A;  3RRU A;  2L0T B;  1NA3 A;  2V8S E;  3D3M A;  4FJY A;  2CHW A;  3Q4A B;  5C2Y A;  3CSF A;  5G55 A;  5LP0 A;  4N2Q A;  1JPL A;  3RKV A;  1JUQ A;  2WMO A;  2FF4 A;  3KEZ A;  4I6J A;  4UI9 K;  2UWJ G;  5CMY A;  4J0U A;  1KT0 A;  3OXL A;  2WXO A;  4Q96 A;  1XGW A;  4GA0 A;  2OOE A;  5D0O D;  3TL5 A;  3ZVV A;  4UWF A;  3TJP A;  2XPZ A;  3APF A;  3BEE A;  4NUR A;  4PS3 A;  1B89 A;  3OTN A;  3GYZ A;  4LER A;  1Z3X A;  4AIF A;  4I9E A;  3IKO B;  2KZT A;  4KXK B;  5ARG A;  3SF4 A;  3R7R A;  3LEW A;  1WAO 1;  3FFL A;  3N71 A;  3CVV A;  4UQZ A;  5JHB A;  4HOR A;  4ABN A;  3SI5 A;  4DI4 A;  4HFG A;  1E8Y A;  1TJF A;  1UN9 A;  2Y4U A;  4G1T A;  2UY1 A;  4G11 A;  3ZYM A;  4CDR A;  3RRM B;  2PM6 A;  4Y6W A;  2QFC A;  3RO3 A;  2PL2 A;  3HYM B;  4A1G A;  2YHE A;  2XPI A;  3EIQ C;  1HS6 A;  3KS2 A;  3RRN B;  3MJW A;  2AXV A;  3OAW A;  2CHX A;  4G24 A;  3VLD A;  2I2O A;  3JQ0 A;  3ZW3 A;  4FA6 A;  4CDN A;  4FC8 A;  1ZU2 A;  5KCM A;  3SFZ A;  4JHR A;  1N54 A;  2YQ8 A;  3I5P A;  3U9W A;  3O48 A;  3CLJ A;  4ACK A;  3CK7 A;  4BT8 A;  4DI3 A;  3QWW A;  3TAX A;  5JJ7 A;  2WXF A;  5BV1 A;  3I4R B;  5G2N A;  3L54 A;  3PH0 C;  3PE3 A;  1HG2 A;  3ZEF A;  4MRU A;  1UJJ A;  4WNF A;  3UUX A;  5G05 C;  2E2E A;  4GZ5 A;  2WXQ A;  4OVU A;  2BTD A;  3MV3 B;  4U0U A;  2M63 A;  3HDX A;  3NZU A;  1WY6 A;  3FTY A;  1S0P A;  2PM7 A;  3D9P A;  4KYO B;  3DPD A;  4A1S A;  3CHP A;  3FUF A;  2KAT A;  3GZ2 A;  3JCK C;  2ZU6 B;  5CHE E;  3CVL A;  1U3D A;  4DLQ A;  1N52 A;  1SZA A;  4L2L A;  1H2U A;  3LYA A;  4I6G A;  5DIZ A;  4L2Y A;  2LAI A;  1E8Z A;  3CHO A;  4C0E A;  2HR2 A;  5AJD A;  5EDS A;  4WAF A;  2GRL A;  3VTY A;  4A3V A;  4U63 A;  2VSY A;  3JUI A;  4OVV A;  3CHR A;  4DJA A;  4BT9 A;  4BTB A;  1NP7 A;  3ULQ A;  2KCV A;  4LUN U;  2KZT B;  4UWL A;  3LY8 A;  1ELK A;  2X6H A;  2X6K A;  4AJW A;  4DK5 A;  3D9N A;  3HVE A;  3B7U X;  2WXL A;  3KD7 A;  4XIF A;  5M72 A;  1Y8M A;  4LEU A;  4C0M A;  2UY1 B;  4JA7 A;  2IQC A;  1HO8 A;  3EJN A;  2WXR A;  3RU0 A;  4U07 A;  1Y6I A;  3AS4 A;  5AYW D;  4TUU A;  2YNQ A;  5A6C A;  3LPZ A;  1E7V A;  4B8A A;  4WNE A;  3ML8 A;  1W3B A;  2CHZ A;  3QOU A;  4ANU A;  2FUL A;  1EPU A;  3NQP A;  1H19 A;  3PVL A;  4J8F A;  2FI7 A;  4GA1 A;  2GGF A;  1VDY A;  2XGO A;  2XQ0 A;  3MZL B;  1E90 A;  4JA9 A;  5FT9 A;  3R7Q A;  2VTB A;  3CK9 A;  3ZFW A;  3L13 A;  2WXN A;  1DVP A;  4GU5 A;  3FTS A;  1JWF A;  2VYI A;  5LOZ A;  2QY7 A;  5KJN A;  5DBK A;  5CMW A;  4XZ4 A;  2DCP A;  2IOL A;  4I1O B;  4K0R A;  4U0S A;  3S2A A;  5J08 A;  2XPY A;  4G2V A;  1UW4 B;  3FUN A;  3FTV A;  3TG4 A;  4BTA A;  3CVQ A;  4J8E A;  2PQR A;  3TXM A;  3TXN A;  2WQH A;  4E85 A;  3FU5 A;  2OND A;  3D9J A;  2FBN A;  4B0Z A;  3K9I A;  4B94 A;  4EZK A;  3CVX A;  3LVQ E;  5A23 A;  1OWM A;  3PE4 A;  2OVB A;  5AEN A;  5FZS A;  3ZXS A;  1BPO A;  3FU3 A;  5ENN A;  3LDZ A;  1HXI A;  2VGX B;  1EDU A;  2LO6 A;  4JW1 A;  4XKC A;  4WWN A;  3UQ3 A;  2OV8 A;  3IHV A;  3SGH A;  5FQ6 A;  3UMV A;  3S7D A;  4LCT A;  3ZYL A;  2I6H A;  4FP7 A;  2ION A;  4G25 A;  1MQS A;  2WVI A;  2YIN A;  3I4G A;  3LJ3 A;  1ELW A;  3B13 A;  3SBT B;  3FH8 A;  4EZL A;  3VTX A;  4PH4 B;  4GYY A;  3FUJ A;  4AM9 A;  4XI9 A;  3CGH A;  4HOQ A;  5HI7 A;  3AS5 A;  3CEQ A;  1QZ2 A;  1H2V C;  3L17 A;  1A17 A;  2WPV A;  4CRW A;  3HVE B;  2V0P A;  5FQ4 A;  1E96 B;  3LY9 A;  1IHG A;  4GMJ A;  3SZ7 A;  4EPZ A;  4UWH A;  3G2S A;  2ILR A;  3G2T A;  4FHJ A;  2J09 A;  3SNX A;  5BW8 C;  4I9C A;  4IN3 B;  4N3C A;  4EQF A;  3IBE A;  3L16 A;  4GCN A;  4AOF A;  4KT6 B;  4GZC A;  3ZIM A;  5CCM A;  4CGW A;  3RK6 A;  3CVU A;  4UQY A;  2VTB B;  2WXH A;  3MX3 A;  3I3N A;  4LRZ A;  2BUG A;  3IV0 A;  4XE0 A;  3MV2 B;  4ILG A;  3SD5 A;  4CCA A;  4Q94 A;  4CDM A;  3APC A;  3ONK A;  1ELR A;  2IJG X;  4U0Z A;  3T8M A;  4ACL A;  2E0I A;  4OYS A;  1OUV A;  5LCW J;  3QNK A;  3FTW A;  5LFA A;  4JZY A;  3ZPJ A;  4BSX A;  4R7L A;  2CG3 A;  3MA5 A;  2VGY A;  1EYH A;  4H7Y A;  3QB2 A;  3FUD A;  4PDX A;  3L6A A;  5FTP A;  3C98 A;  5J90 A;  1SQM A;  2WXI A;  3QDN A;  1XNF A;  2PQN A;  4JHK A;  4FJZ A;  4URK A;  2R5S A;  3CKC A;  3T5V A;  2WQ6 A;  3LS8 A;  3U66 A;  3RJV A;  4JHJ A;  2NXP A;  3JQ1 A;  2KCL A;  2Y3A A;  3OXF A;  3ZYQ A;  3GZS A;  2CG2 A;  4DPR A;  4APF A;  4KVM A;  1HF8 A;  2LNI A;  1NZN A;  5CCL A;  2XCB A;  5D0Q D;  3CK8 A;  4IYP A;  3ENE A;  5E75 A;  2L0I A;  2R17 C;  5BUZ A;  1H0A A;  4GAA A;  3RIB A;  2C0L A;  4N3A A;  2MRI A;  3TG5 A;  4WWO A;  5A7D B;  1E8X A;  2IU1 A;  2RD0 A;  2C2L A;  3JYS A;  2X38 A;  1Z3Y A;  1OWO A;  2L6J A;  4MLP A;  3MCX A;  4G26 A;  3GW4 A;  4DLO A;  5EX3 A;  1FCH A;  3IHY A;  2MOW A;  2HYZ A;  3EHM A;  2J49 A;  2V4L A;  3MGB A;  3L08 A;  4KVO A;  3UX4 A;  1QNF A;  4KZ0 A;  3PS6 A;  2HO1 A;  4AY6 A;  1HX8 A;  4BY6 A;  2WXJ A;  3AS8 A;  4GA2 A;  4L7T A;  1EF1 C;  3WXX A;  3PUJ A;  3ZHE A;  4NRH B;  5LX8 A;  2WM9 A;  3DBS A;  2J4B A;  3HIZ A;  3PRE A;  4JVS A;  5FQ8 A;  4QFV A;  2WB2 A;  3QAQ A;  4AY5 A;  5KJL A;  5G05 J;  5BNW A;  2WMN A;  3QC1 A;  1MHQ A;  2JLB A;  4NQ0 A;  3FHE A;  4V3I A;  2KC7 A;  3D9O A;  3CR3 A;  5T8I A;  3QK0 A;  3QAR A;  4UI9 J;  4FUL A;  5G04 J;  2V5F A;  2Y4T A;  3UT8 A;  2R59 A;  3MKR A;  3UPV A;  2WXP A;  4FLH A;  4EBA G;  4BX9 A;  4UWG A;  2EQX A;  3CVN A;  3ZN3 A;  1E8W A;  1FVH A;  3D9K A;  4EZJ A;  3APD A;  3FP3 A;  5ANL A;  4O6F A;  3TGO A;  3GZ1 A;  4JC8 A;  3S7J A;  4XX5 A;  1UJK A;  4JEU A;  5C1D A;  1QQE A;  2XCC A;  3FUI A;  3PEV B;  1ZBP A;  3PZD A;  4PS7 A;  4FAD A;  1HU3 A;  1OWL A;  3ASF A;  4ME2 A;  4XI0 A;  3RO2 A;  3OXG A;  3G2W A;  3T5X A;  3FUH A;  5LCW C;  2VJ8 A;  2XRY A;  3QWP A;  3FUM A;  1PY1 A;  4YVO A;  3D9I A;  3BG1 B;  5KJK A;  3MKQ A;  3Q49 B;  4XKB A;  1X5B A;  4EEC A;  4JEH A;  3CQG B;  4YND A;  2XGM A;  3PNT B;  2PZI A;  2J08 A;  2WXM A;  3CST A;  4UQX A;  4WND A;  3BG0 B;  3Q5M A;  1IQU A;  4F3V A;  1IYG A;  2Q7F A;  1PC2 A;  2NC9 A;  3ZHE B;  1KT1 A;  4ANV A;  2XEV A;  3SBS A;  2X6F A;  4UWK A;  4J6I A;  4I1A A;  5JJT A;  1HH8 A;  2AVP A;  2FO7 A;  3B7T A;  4HLE A;  2XGS A;  2NSZ A;  2XHE A;  4HS2 A;  4B8C B;  4HOS A;  2OVF A;  4RG6 A;  3FU6 A;  4KMO A;  3ML9 A;  3QKY A;  3ZRH A;  2XRZ A;  2DBA A;  1E7U A;  2J07 A;  1TJC A;  4GB9 A;  3ESK A;  2JEK A;  4F1S A;  4U04 A;  2L9B A;  1KLX A;  1P5Q A;  3B7S A;  4NAC A;  4HOU A;  1SZ9 A;  3PNL B;  4L1B A;  4F7A A;  3ZGQ A;  4YVQ C;  3Q47 B;  3ONL A;  4W9R A;  4JL0 A;  2MHK A;  5FZR A;  3UT7 A;  2J4D A;  3NZS A;  5HQ8 A;  4TRQ A;  4FLB A;  1Z6T A;  1OWP A;  4GYW A;  4GZ6 A;  2X3M A;  5ANR A;  4JPS A;  4PUC A;  1NA0 A;  4E6H A;  2IF4 A;  3FH7 A;  2KCK A;  4AEZ C;  1YA0 A;  3FEY A;  3LKU A;  4ILI A;  4GZD A;  4K03 A;  2YHC A;  3LCA A;  3LY7 A;  4MS6 A;  4L23 A;  5BT1 A;  3FTX A;  3MEK A;  2KM4 A;  4N5C A;  3AU4 A;  3CVW A;  1HE8 A;  4RVB A;  4KZC A;  3URZ A;  3ZYK A;  4BFR A;  2X6J A;  1H6K A;  4RG9 A;  3IEG A;  4ANX A;  3FH5 A;  5FQ7 A;  2I1K A;  3HHM A;  1TEZ A;  2LSV A;  4N2S A;  2AXZ A;  1UN8 A;  1FVF A;  2X6I A;  4HVB A;  3CHQ A;  3CVP A;  3ASD A;  2RG8 A;  3O4Z A;  4F53 A;  4IRU A;  3R9A B;  5T4Y A;  5JHA A;  3MKQ B;  2HM8 A;  4C9B B;  4RSY A;  3P2B A;  5FZQ A;  3EIJ A;  3AU5 A;  3FUE A;  3S7F A;  4I2Z A;  4WWP A;  3FUL A;  3SHF A;  4WUY A;  3PDN A;  2IFU A;  4A3T A;  4HXI A;  4CGV A;  3PRZ A;  4PS8 A;  2VSN A;  4UI9 C;  5G04 C;  4CT0 A;  3CIA A;  2P58 C;  4AVX A;  5T3R A;  4EBA A;  4CEM A;  3Q15 A;  4I43 A;  3EHN A;  4I2W A;  1HFA A;  2LAH A;  4JXT A;  3G2U A;  4GML A;  2VSO E;  3CVY A;  1JWG A;  4I1M A;  4GYO A;  1PAQ A;  2GRM A;  3S7B A;  2VGX A;  1U3C A;  1L5J A;  5KJM A;  1DNP A;  4Y6C A;  3EDT B;  3FWV A;  2AW6 A;  4FHK A;  2A5U A;  3G2V A;  3FU0 A;  5E76 A;  3CQC B;  4P29 A;  4BX8 A;  4Q69 A;  2VSX E;  3P1U A;  5FWQ A;  2WXK A;  3ASG A;  4BWR A;  4B89 A;  3PUK A;  4D10 C;  4U8H A;  3E4B A;  5BV0 A;  1GW6 A;  3FEX A;  4J8S A;  5ARF A;  4CT4 A;  3FTZ A;  2CFZ A;  3UT4 A;  3ESL A;  1OWN A;  3LXU X;  2GW1 A;  2WXG A;  4ILH B;  1HG5 A;  5EKQ D;  3LVR E;  4I6E A;  3ASH A;  4AP2 A;  3FTU A;  4HOT A;  4MKT A;  3VLF A;  4TV3 A;  4KBQ A;  1HZ4 A;  2AWI A;  4WNG A;  4G23 A;  4GCO A;  2C0M A;  3CKB A;  3KAE A;  3QJZ A;  3NF1 A;  4AV7 A;  2I1J A;  4FU3 A;  3D9M A;  2DIW A;  4GZ3 A;  4H7X A;  3PEU B;  4AXH A;  1H2T C;  2I9C A;  5AJL A;  5EX0 A;  5FJY A;  1LF8 A;  4I17 A;  1INZ A;  5JJ6 A;  4N39 A;  2BF0 X;  3U64 A;  2AXU A;  3D9L A;  2VQ2 A;  3FUK A;  4IUL A;  4J8D A;  3CHS A;  4ANW A;  1WM5 A;  3FDH A;  3FY4 A;  2A4Z A;  3CHM A;  4M3O A;  3VLE A;  3L22 A;  3CV0 A;  2IOS A;  3QWV A;  1IQR A;  4A55 A;  4ATG A;  3U3W A;  2WQ7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...