1WM9A

Structure of gtp cyclohydrolase i from thermus thermophilus hb8
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
185
structure length
185
Chain Sequence
b'EVDLERLQALAAEWLQVIGEDPGREGLLKTPERVAKAWAFLTRGYRQRLEEVVGGAVFPAEGSEMVVVKGVEFYSMCEHHLLPFFGKVHIGYIPDGKILGLSKFARIVDMFARRLQVQERLAVQIAEAIQEVLEPQGVGVVVEGVHLCMMMRGVEKQHSRTVTSAMLGVFRENQKTREEFLSHLR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTP cyclohydrolase I
publication title Novel Reaction Mechanism of GTP Cyclohydrolase I. High-Resolution X-Ray Crystallography of Thermus thermophilus HB8 Enzyme Complexed with a Transition State Analogue, the 8-Oxoguanine Derivative.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Hydrolase
total genus 58
structure length 185
sequence length 185
chains with identical sequence B, C, D, E
ec nomenclature ec 3.5.4.16: GTP cyclohydrolase I.
pdb deposition date 2004-07-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01227 GTP_cyclohydroI GTP cyclohydrolase I
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.286.10 Mainly Alpha Orthogonal Bundle GTP Cyclohydrolase I; Chain A, domain 1 GTP Cyclohydrolase I; Chain A, domain 1 1wm9A01
3.30.1130.10 Alpha Beta 2-Layer Sandwich GTP Cyclohydrolase I, domain 2 GTP Cyclohydrolase I, domain 2 1wm9A02
3UXJA 4AEYA 2O90A 1RS4A 1DHNA 1FBXA 1RRYA 2NM3A 1WPLA 3S19A 1SQLA 3BP1A 3R2EA 3RJ4A 4FGCA 2CG8A 4DU6A 2DHNA 3V9OA 1Z9WA 4F8BA 1FB1A 5FARA 1A8RA 1RSDA 4GHMA 2NM2A 1GTPA 1IS7A 1N3SA 3UXVA 1WURA 1RRIA 1U68A 1WM9A 4IQIA 1N3RA 1RRWA 3RZPA 1NBUA 5F3MA 4UQFA 1IS8A 1B9LA 1WUQA 1RS2A 1A9CA 1NBUB 3O1KA 1RSIA 1N3TA 1NBUC
chains in the Genus database with same CATH superfamily
2O90A 1DHNA 3LW5G 3BMBA 3RJ4A 2CG8A 2LNZA 1RSDA 4GHMA 4R8QA 1IS7A 3B0BC 2WSCK 5F3MA 1IS8A 1N3SA 1RSIA 1EL6A 2O01G 2PN0A 4Q7JA 5DMZA 1RRYA 2WSCG 4E45B 2WSFK 1WPLA 3S19A 4DU6A 2DHNA 1Z9WA 4JA3A 4NE3B 4NE5B 1WURA 2WSFG 1B9LA 1NBUC 3UXJA 4QPMA 1RS4A 2LO0A 1FBXA 4DRAE 1SQLA 1TFEA 1A8RA 4DRBJ 1EFUB 2WSEK 3VEJA 2P11A 4E44B 1U68A 4NE6B 1N3RA 3RZPA 4UQFA 1RS2A 3R2EA 3O1KA 2KR1A 2WSEG 4AEYA 2NM3A 3BP1A 4FGCA 4F8BA 3V9OA 1FB1A 5FARA 2NM2A 1GTPA 3UXVA 1RRIA 4IQIA 1WM9A 1RRWA 3LW5K 1AIPC 1NBUA 1WUQA 1A9CA 1NBUB 1N3TA
chains in the Genus database with same CATH topology
1EL6A 3UXJA 2KR1A 4QPMA 4AEYA 2O90A 2PN0A 1RS4A 4Q7JA 2LO0A 1FBXA 5DMZA 1DHNA 1RRYA 2NM3A 4DRAE 4E45B 3BMBA 1WPLA 3S19A 1SQLA 3BP1A 3R2EA 3RJ4A 4FGCA 1NBUB 2CG8A 4DU6A 2DHNA 3V9OA 1Z9WA 4F8BA 1TFEA 1FB1A 5FARA 2LNZA 1A8RA 4DRBJ 1EFUB 4JA3A 1RSDA 4GHMA 4R8QA 2NM2A 1GTPA 1IS7A 4NE3B 3B0BC 3VEJA 2P11A 4E44B 4NE5B 1WURA 1RRIA 1U68A 1WM9A 4IQIA 4NE6B 3UXVA 1N3RA 1RRWA 3RZPA 1AIPC 1NBUA 5F3MA 4UQFA 1IS8A 1B9LA 1WUQA 1RS2A 1A9CA 1N3SA 3O1KA 1RSIA 1N3TA 1NBUC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UXJ A;  4AEY A;  2O90 A;  1RS4 A;  1DHN A;  1FBX A;  1RRY A;  2NM3 A;  1WPL A;  3S19 A;  1SQL A;  3BP1 A;  3R2E A;  3RJ4 A;  4FGC A;  2CG8 A;  4DU6 A;  2DHN A;  3V9O A;  1Z9W A;  4F8B A;  1FB1 A;  5FAR A;  1A8R A;  1RSD A;  4GHM A;  2NM2 A;  1GTP A;  1IS7 A;  1N3S A;  3UXV A;  1WUR A;  1RRI A;  1U68 A;  1WM9 A;  4IQI A;  1N3R A;  1RRW A;  3RZP A;  1NBU A;  5F3M A;  4UQF A;  1IS8 A;  1B9L A;  1WUQ A;  1RS2 A;  1A9C A;  1NBU B;  3O1K A;  1RSI A;  1N3T A;  1NBU C; 
#chains in the Genus database with same CATH topology
 2O90 A;  1DHN A;  3LW5 G;  3BMB A;  3RJ4 A;  2CG8 A;  2LNZ A;  1RSD A;  4GHM A;  4R8Q A;  1IS7 A;  3B0B C;  2WSC K;  5F3M A;  1IS8 A;  1N3S A;  1RSI A;  1EL6 A;  2O01 G;  2PN0 A;  4Q7J A;  5DMZ A;  1RRY A;  2WSC G;  4E45 B;  2WSF K;  1WPL A;  3S19 A;  4DU6 A;  2DHN A;  1Z9W A;  4JA3 A;  4NE3 B;  4NE5 B;  1WUR A;  2WSF G;  1B9L A;  1NBU C;  3UXJ A;  4QPM A;  1RS4 A;  2LO0 A;  1FBX A;  4DRA E;  1SQL A;  1TFE A;  1A8R A;  4DRB J;  1EFU B;  2WSE K;  3VEJ A;  2P11 A;  4E44 B;  1U68 A;  4NE6 B;  1N3R A;  3RZP A;  4UQF A;  1RS2 A;  3R2E A;  3O1K A;  2KR1 A;  2WSE G;  4AEY A;  2NM3 A;  3BP1 A;  4FGC A;  4F8B A;  3V9O A;  1FB1 A;  5FAR A;  2NM2 A;  1GTP A;  3UXV A;  1RRI A;  4IQI A;  1WM9 A;  1RRW A;  3LW5 K;  1AIP C;  1NBU A;  1WUQ A;  1A9C A;  1NBU B;  1N3T A; 
#chains in the Genus database with same CATH homology
 1EL6 A;  3UXJ A;  2KR1 A;  4QPM A;  4AEY A;  2O90 A;  2PN0 A;  1RS4 A;  4Q7J A;  2LO0 A;  1FBX A;  5DMZ A;  1DHN A;  1RRY A;  2NM3 A;  4DRA E;  4E45 B;  3BMB A;  1WPL A;  3S19 A;  1SQL A;  3BP1 A;  3R2E A;  3RJ4 A;  4FGC A;  1NBU B;  2CG8 A;  4DU6 A;  2DHN A;  3V9O A;  1Z9W A;  4F8B A;  1TFE A;  1FB1 A;  5FAR A;  2LNZ A;  1A8R A;  4DRB J;  1EFU B;  4JA3 A;  1RSD A;  4GHM A;  4R8Q A;  2NM2 A;  1GTP A;  1IS7 A;  4NE3 B;  3B0B C;  3VEJ A;  2P11 A;  4E44 B;  4NE5 B;  1WUR A;  1RRI A;  1U68 A;  1WM9 A;  4IQI A;  4NE6 B;  3UXV A;  1N3R A;  1RRW A;  3RZP A;  1AIP C;  1NBU A;  5F3M A;  4UQF A;  1IS8 A;  1B9L A;  1WUQ A;  1RS2 A;  1A9C A;  1N3S A;  3O1K A;  1RSI A;  1N3T A;  1NBU C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...