1WMAA

Crystal structure of human cbr1 in complex with hydroxy-pp
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
275
structure length
275
Chain Sequence
SGIHVALVTGGNKGIGLAIVRDLCRLFSGDVVLTARDVTRGQAAVQQLQAEGLSPRFHQLDIDDLQSIRALRDFLRKEYGGLDVLVNNAGIAFKVADPTPFHIQAEVTMKTNFFGTRDVCTELLPLIKPQGRVVNVSSIMSVRALKSCSPELQQKFRSETITEEELVGLMNKFVEDTKKGVHQKEGWPSSAYGVTKIGVTVLSRIHARKLSEQRKGDKILLNACCPGWVRTDMAGPKATKSPEEGAETPVYLALLPPDAEGPHGQFVSEKRVEQW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title An unbiased cell morphology-based screen for new, biologically active small molecules
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords Carbonyl reductase [NADPH] 1
total genus 106
structure length 275
sequence length 275
ec nomenclature ec 1.1.1.184: Carbonyl reductase (NADPH).
pdb deposition date 2004-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1wmaA00
3DO5A 4M89A 1WDKA 4WLEA 1DRVA 3H7AA 4OKNA 4UUNA 1YVEI 3ETDA 3DMTA 5BSFA 2AEMA 2EKLA 3CMCO 2VCYA 5L3ZA 3HB5X 4DQUA 2J3IA 2Q4BA 3PWZA 4OIMA 5I9NA 4GX5A 2VHVA 2FP4A 4DQXA 3KV3O 4XD2A 1I10A 2I65A 3FTPA 4ID9A 4YXFA 4Q3EA 1HKUA 3E9QA 3UW3A 4EDFA 2QHXA 2ET6A 1NFQA 2YV2A 4DPLA 4GMGA 3BMQA 4U6SA 3WNVA 1EE9A 3PYMA 3WYEA 5JO9A 1HRDA 2C2YA 1BHSA 4GQAA 4RORA 4YTEA 4D3FA 1HWYA 2C07A 2IEBA 4MKRA 3K5PA 2HU2A 4BQRA 4NFSA 2HMVA 1BGVA 2QZ9A 3FPLA 4IMRA 1WXDA 1LEHA 4XR9A 4YJHA 2X4GA 4YBZA 5BR7A 3UCEA 1B3RA 3KSDO 2ZB7A 2DTEA 2JAPA 2IEDA 4J2HA 1JTVA 1X7DA 1IZ9A 4WCFB 4YJDA 5AYVA 2C7VA 3EYWA 4J3FA 4AJHA 4P4LA 3NX4A 4NK4A 4XB1A 4LVUA 1U4SA 3QE3A 3VZQA 3AUUA 3JYNA 2CZCA 4WEOA 4I5FA 5JO0A 4CM3A 1P45A 2AA3A 3CIFA 5A4DA 3IS3A 4HWKA 3RU9A 3DMTC 4CLEA 1Q7GA 5DOZA 1HE5A 4JX8A 2HDHA 2Z1NA 5A05A 3KYDB 1MX3A 2A35A 4CL8A 3TRIA 4CM5A 1GY8A 4WNIA 3C1AA 4GX0A 2PGJA 3GZNA 4OOFA 1AXEA 3ZNPA 1UP6A 1C0PA 3E1KA 4PLCA 4PGFA 5G4KA 3B6ZA 1VSVA 1E3JA 1GEGA 2IZ0A 2WJPA 4Y8VA 2X0JA 2CVZA 2XXJA 5MDHA 4Y6RA 4JP3A 3OFSA 4RQTA 5DCUA 4FFOA 3L6OO 3HQ4O 3OIGA 3E03A 1PGPA 3KEOA 1UDAA 4F45A 1F8FA 1HE4A 3F4LA 3OMLA 5HRUA 4E5PA 3GVCA 2QQ5A 3B1JA 3S2GA 1K89A 1DBVO 3VPFA 4DYVA 2ZYAA 2ZTMA 1Y6JA 2DUWA 2O3TA 5TIIA 3PDJA 3PVZA 4GKVA 4P8RA 2P5UA 4U7WA 3JQBA 4GMFA 2AQ8A 4KQWA 2V6BA 2WSBA 3HSKA 2PD3A 4BOYA 4ZQHA 4CM4A 1HT0A 3RUHA 2WE7A 1PWXA 1HEUA 4IDFA 2QG4A 3GDGA 4EEXA 3IP3A 1MFPA 4XYGA 4XYLA 1ZMOA 5DBIA 4BMVA 4YAGA 2W4QA 1K5HA 3RC7A 4L75A 2W90A 2H9IA 4CLHA 2Q1UA 2UV8A 1UXHA 5C7LO 3V2UA 2NTVA 4IZHA 3WJAA 4BS9A 2O2SA 3E6AA 2FPGA 1EVJA 4AFNA 3P2YA 2A92A 2ZYGA 3Q2IA 1C1DA 1PTJA 5COAA 1DIRA 1EK5A 1P0CA 1Z7BA 3NTOA 1YS4A 4FGWA 1MUUA 1HXHA 5G0TA 1NQ5A 5ES3A 2E6UX 4M54A 2FZEA 2VT3A 2G5CA 2BFAA 2Y99A 1EUZA 1Y8QB 4PRLA 4R1TA 5L7YA 3U09A 5TF4A 3PZBA 1ZK2A 3LF1A 2NNLD 4NNJA 5ENDA 1GQQA 1UDBA 1Q0QA 1QSGA 4K6FA 2HQ1A 1KC1A 5T57A 2AEJA 2O4CA 3PFWO 4XRRA 5F21A 4UUPA 4I5EA 4ZRNA 5A3JA 1EBUA 4IDGA 2ZQYA 4FFNA 3BA1A 3PJDA 4ZQFA 4CL3A 2YV1A 5FYDA 4F3YA 1NQAO 4QO8A 5ENVA 4JJGA 2HRZA 2WYVA 1OFGA 2AQHA 2FHSA 3GVPA 4XA8A 3AI1A 5DNAA 5A5EA 4KUEA 3QIVA 4YWJA 4GVLA 4JP2A 4ND3A 3GGPA 3KBOA 1DSSG 2DC1A 1DPGA 4W9NA 4DL9A 3M6IA 3SBOA 4M87A 1K2WA 4E4YA 2HMWA 4S3MA 2BD0A 4P22A 1ADCA 2YHUA 1O89A 4Q3BA 3KLMX 3WLFA 4RF3A 5JS6A 2IE0A 4NBWA 3SC6A 3GPIA 3EAGA 2VUSA 3HN2A 4FW8A 4XR4A 2GN6A 4J7UA 1BTOA 2VYNA 3ZV4A 2UDPA 2NADA 1W8DA 1GL3A 3H3JA 2PZJA 3TN7A 5CEFA 4RPJA 4AICA 1TI7A 4BO7A 4RLHA 5K9ZA 4WJZA 1C1DB 2IXBA 3N7UA 5AVOA 4GAEA 1R12A 5GZ1A 3IJRA 1BMDA 3OJLA 2BH9A 3L77A 3U5TA 1LRLA 1Q0LA 3IUSA 3LQFA 2QYSA 4CUKA 2Q2VA 1H5QA 1N1EA 2PLAA 1GAEO 4GBJA 2JFGA 2Y66A 1E7RA 5C3MA 4MVJH 4MJLA 1LSOA 4WE3A 4D45A 4YQZA 3PFFA 5LDHA 1ZFNA 2YZ7A 3ZWCA 2X0IA 2AE2A 2G0TA 1HE2A 4CQMD 4NI5A 2NVUA 3N74A 1Y9EA 2C20A 4OOEA 5EIOA 2GO1A 4NJMB 3ZWBA 2J5QA 4AJ2A 2RHRA 3IP1A 3D3WB 4YYZA 2VTDA 1UZLA 1ISGA 1LSSA 1U3TA 5ILOA 1DDOA 3GMSA 4L74A 4UVHA 3BMOA 1T1SA 3K2BA 5H82A 1T2CA 2YFQA 4RVDA 1V6AA 1B2LA 4B7CA 5JW6A 1H9BA 5HWSA 3HZZA 4OXKA 2OFPA 1YWGO 1MXHA 2PTGA 2AE1A 1SNYA 3HDHA 4PZCA 4Z9XA 2BFOA 5JAIA 1AUPA 1DB3A 4BHTA 1H2BA 1LUAA 1N7GA 4RF4A 1HZZA 4E5NA 4S1VA 1VLLA 4PG4A 1TT5A 2RAFA 1YRLA 1K6JA 2Y1GA 3SJ7A 3JYPA 1E1MA 2EV9A 2OBYA 1I3NA 3BMCA 1NR7A 2NUAA 4DIFA 3ZU2A 1ULSA 5F5NA 1FDSA 5THKA 3WLEA 3SLGA 4FC6A 2VRCD 4UVEA 1HE3A 5JAQA 3JQCA 4ALMA 3TDKA 3WMWA 1R4NA 3CZMA 2E82A 1QXSA 1JA9A 3GNQA 3HDJA 3RUFA 4UVIA 1R15A 4UEKA 3ONEA 5IAAA 1GQ2A 3E48A 1VKNA 4QUKA 3FI9A 1PJQA 4J91A 1C0LA 1R4MB 1VKOA 1EUDA 1RKXA 1UH5A 2I76A 3ANNA 2VZ9A 4WCFA 1EDZA 2Y1FA 4OJNA 4IJWA 3DBVO 3OICA 4YJFA 4CM1A 3AOEC 1BSVA 1PSDA 5BSEA 2H6EA 2X9GA 3WICA 3GR6A 3PQFA 1JAYA 4WPGA 1ZUD1 4BKOA 4YAIA 3RCBA 3AUTA 4FFPA 4FN4A 4GWGA 3SLKA 1GUZA 4E2XA 3ULKA 4H7PA 4BGEA 3AFNA 3KSUA 4M1QA 5KJ6A 5I8WA 3LDHA 4Z9FA 1L7DA 1GADO 3I9KA 3LT0A 3H8VA 5B4VA 3Q1LA 4MVJE 3HUDA 4UULA 3AU9A 5JXWA 1ARZA 2YHIA 3SC4A 3E8XA 3DBHA 4AJKA 4IIVA 3UCXA 3GGGA 3P5SA 3WIDA 1E7WA 3AY7A 4MP8A 4IXTA 4ZQBA 1PQUA 2DBQA 1Z6ZA 3T7EA 3B20A 1QLHA 2B37A 1LXCA 2RCYA 2VT2A 3QJ5A 1X13A 1V8BA 4IQGA 1PEDA 5HM8A 3LC2O 1WWKA 2B4TO 3BHIA 1PZEA 1XSEA 1DFHA 3VPXA 2PKRA 1HDGO 3NGLA 5JPIA 2O3UA 5DCWA 2NWQA 3DFUA 3ONFA 5ER9A 3PLRA 4C7JA 4CMGA 1TB4A 1ZK4A 4TROA 2Q1TA 3ZWPA 5IFLA 4AVYA 5A9SB 1UR5A 4DPKA 4E5MA 3OH8A 4QQRA 4BKRA 4AJ1A 3H4VA 2P5YA 2ILTA 1LJ8A 3JCZA 5LDGA 5EL0A 3ZW8A 4JIGA 2FZWA 4KOAA 4Q3DA 3G79A 1E3WB 1XGKA 1IULA 3OF2A 4RZIA 2HJRA 4F6CA 1ONNA 1PJ3A 1ENZA 2JKVA 3OHSX 1NVMB 2IDZA 3VPSA 3D7LA 1WW8A 1A4IA 4DQVA 1KY5A 2P4QA 3U4HA 2DFDA 3KB6A 4MVJG 2P2SA 2VWHA 2GF2A 1NM5A 2NSDA 1SB9A 3I9LA 3NTQA 5IN4A 3JD0A 3DC2A 4IMPA 1J0XO 4GLLA 4HUJA 4NG5A 3NDRA 4PLGA 1M75A 1LNQA 3F1LA 3DBHB 4ONEA 3IOYA 3U9LA 4NR0A 1LC3A 4E5YA 4HX5A 2EP7A 1HSOA 3OEYA 4WKGA 3ASVA 1SOWA 2HMTA 3JYQA 4D7AA 2YHIB 3LT4A 1JU9A 3IJPA 1B7GO 1R0KA 5CFZA 1MFZA 1H93A 4ITUA 1YE3A 4DPMA 3BYZA 3GG9A 3EW7A 3F46A 2GDZA 4N54A 4BMSA 3JQ6A 2XF8A 1MXFA 4CV3A 2AMFA 4CMAA 4BO8A 5DCYA 2Q46A 3OQ1A 4JXKA 3WBFA 2AQKA 3GT0A 4XWYA 3RSHA 3PJFA 4PG8A 3FR7A 1B15A 3SJUA 1J49A 1E5QA 1MGOA 3E82A 3GY0A 2LDBA 4A10A 5KVSA 1EVZA 1MV8A 4AJPA 2QRLA 4A5OA 4Y6SA 2JAHA 2A94A 4PLPA 4Z6KA 1E92A 3HDQA 4RVGA 1R37A 5BQFA 3JD3A 2PFGA 1U7TA 3EMKA 3MJVA 4URFA 4FPXA 3KRTA 1YBAA 2JHFA 4Y6PA 3OJ0A 1A72A 3C1TA 4J4TA 3WQSB 2ZATA 3F5SA 2VOJA 1O6ZA 3GNTA 4EUEA 4L73A 1AHIA 4YAEA 1E1NA 1TEHA 4R1UA 5IF3A 1U28A 5L4SA 4CR7A 5B4UA 1GDHA 1WLYA 2H1SA 2OL4A 1LDBA 1Q2XA 3CMMA 1PZFA 1PR3A 3GHYA 4NFYA 2IYOA 1XQ1A 4WEQA 2OO5A 1QR6A 1UZNA 1PJSA 3M2TA 5U1PA 4R68A 2FR1A 4TZKA 4D3SA 1V3VA 1LLDA 1ID1A 4L8VA 5FI3A 3OM9A 4HFRA 4Q3AA 3ADOA 1LI4A 2OMEA 4CV0A 3VC7A 4LMRA 1N5DA 3VPGA 2X0RA 3VH3A 3K96A 1RM3A 2GN4A 4NIMA 2DFVA 4OSPA 1XQ6A 2VWQA 4MP6A 1ZBQA 3I9NA 4C7KA 4IS2A 3HB4X 3ITKA 2RIRA 3QV1A 3GRKA 4FJ0A 3ROMA 3T7CA 2ZKLA 3D3EA 1DC3A 1W73A 2GZ3A 3BMNB 2JCVA 4JLWA 3PWSA 1A4UA 4GKBA 5BSGA 3GRPA 1YQGA 4KWIA 3DR3A 5G4KB 1HETA 1BXKA 1GYPA 2Y1EA 3JV7A 2WM3A 4UVDA 1CETA 3GGOA 1N92A 2V6GA 2YQ5A 3JD2A 4YPOA 4QTZA 4JJFA 3AM4A 3WGHA 1OBFO 3NV9A 1QYVA 1EE2A 3KETA 3IKTA 2X1HA 3GK3A 2Q4EA 2O3SA 3W1VA 5GMOA 3ZI0A 4GGOA 3TQHA 5HS4A 3U4CA 5FF9A 3WBBA 5U4QA 2VTEA 4TRJA 3H9QA 1IHYA 4CMIA 2X58A 3ADPA 2CSUA 3OJEA 4IDCA 1A7AA 4B4OA 2X22A 3VVCA 1P33A 2BI8A 2I67A 4XIJA 3ZU3A 5KJEA 3WSVA 1H6BA 1GZ6A 1A9YA 1BG6A 1U5AA 5C5IA 4FIZA 2NU7A 2BGMA 1HLPA 1JDJA 1QYWA 1KC3A 2OXIA 2VUUA 5A1TA 5JCJD 3PHLA 4CR8A 1HYHA 1LU9A 2ZQZA 1ZZEA 2YUTA 2FSSA 3FHLA 4BNXA 1SPXA 2B69A 2Z1MA 1E3WA 4PLHA 5TJ9A 2DAPA 3C7CB 4MIEA 5B37A 5GY7A 1WP4A 1KBZA 3C1OA 3QP9A 1BW9A 7MDHA 3A9WA 3VH4A 3DHEA 2ZYDA 3F4BA 2J5KA 5GZ3A 1TT7A 1IB6A 1MA0A 3W8DA 1NR1A 3RUIA 5JDCC 5JSFA 4G2NA 1Y8RA 3TSCA 5C7IO 1YDEA 2FPIA 4R3NA 2EJVA 4NHEA 1WNTA 1I36A 2J6IA 3QRWA 3ZNNA 5IXSA 3QW2A 1XELA 3ZWWA 5L4NA 3HHPA 3ZGYA 1GYQA 3PQDA 1J5PA 1HYEA 1FDUA 1C1XA 4JJIA 1YL5A 4PLVA 4P38A 4BQPA 4DBVO 3RKUA 1DJQA 3UVEA 4XKJA 1SCUA 1JQBA 4HKTA 1T2DA 1FDTA 2NTNA 5CPFA 1X0XA 4PFJA 3FF4A 1GPJA 1U9JA 3A4VA 3HADA 4MDHA 4E33A 4GSLA 3FBTA 1LDYA 4BNKA 2PK3A 1H9AA 3TNLA 1YJ8A 4CMIB 1C1XB 2UAGA 3Q9NA 3TZQA 4DRYA 4JGBA 2HSDA 2BLLA 2IYPA 4J1NA 3UAGA 3ZWAA 2JD1A 2WYWA 5JFOA 4RF5A 4J1TA 3DZGA 3O03A 4PLTA 4NU6A 4Q9NA 4TZTA 3B1FA 2ZJ1A 1ZO8A 4CR6A 1T24A 2EXXA 4E6PA 1TLTA 2QRJA 1Y1PA 1T4DA 4OMUA 1O95A 3WIEA 4WOJA 4J0EA 3VH1A 2B4RO 1O94A 4I9UA 3TOXA 1JWBB 1EQUA 2EG9A 4J6FA 4YR9A 3KTDA 4MKXA 2NQTA 3PWKA 2Y1DA 3K6JA 5JYEA 1BXZA 1ADGA 3EZYA 4JROA 4L76A 2R00A 1S6YA 3Q0EA 3UUWA 2CY0A 2PD4A 3WFIA 3CEAA 3DBLA 2Y93A 1GV1A 2EGHA 4R01A 2BKAA 4LRTB 4B3HA 5ICSA 4J1QA 1IOLA 2GSDA 1LRKA 1IY8A 4D43A 3VOSA 4CQLB 3C7DB 3VKVA 2VHYA 4TRNA 4GI2A 5T6BA 1GV0A 1QYXA 2GD1O 4WGGA 3F3SA 4W7HA 1YB1A 4EJ0A 3ROPA 1DLJA 2O7SA 4PLYA 1ZXLA 1YH3A 2EIHA 1RM5A 4CV2A 2YW9A 1L1FA 3AOGA 3GMDA 2J3JA 1IHXA 4HFMA 3WR5A 1SC6A 5KKAA 3BHJA 3WFJA 1ML3A 2YQ4A 2RH8A 1VE9A 3L4BA 4IUYA 1T2EA 3WXBA 5I7VA 3WGOA 1NFFA 1NQTA 1P1JA 4EW6A 3GLQA 4B3JA 1A27A 3TF5A 4XX0A 4J16A 1O0SA 4XGNA 3RAJA 1ZNQO 1GZ3A 5B12A 3ZN2A 2GRAA 5LC1A 1HDZA 1VL8A 2E4AA 2PY6A 2AW5A 3OP4A 2B0JA 2JFHA 1E77A 4A2CA 3VZRA 2PH5A 1HDOA 1K0UA 2OOSA 2FSVA 1MP0A 1PZHA 2PR2A 3O38A 4LISA 4OGWA 3GC6A 3RKRA 3DZIA 3E18A 5TRTA 4WLFA 2PGDA 5KOIA 2XAAA 2GERA 4YT4A 5EQDA 4IIUA 4RJTA 5FEUA 1PJ2A 3HG7A 1PIWA 3JQFA 4ALJA 4TSKA 4I9NA 4TQGA 3C24A 3N58A 2GASA 2VHZA 4E2ZA 1DC4A 1I24A 4BV8A 4RCVA 1JAXA 2NACA 3TZHA 4YT2A 3NDJA 1BRMA 1DO8A 1PL7A 1VC2A 4OSOA 3PHIA 4G65A 2VYND 2XXBA 2VZ0A 5EINA 4XQGA 1Z7EA 1NASA 5DULA 1EMDA 3E5MA 3Q6IA 3UN1A 3GOHA 4PRKA 1FF9A 1DAOA 5CDYA 3V2GA 5F1PA 2YJZA 5T8KA 4FD3A 5L9AA 4BO2A 2OBNA 2AG8A 4FQ8A 6ADHA 3W4KA 3FR8A 3PXXA 5DDIP 5EJ2A 4D44A 4BNFA 1D3AA 3D1LA 5BNTA 5JCXA 3S2EA 1GEEA 3DWFA 4UVGA 5I9LA 4BO5A 4D0SA 3DL2A 3F6YA 1SOVA 2HMSA 1IL0A 1XR3A 2EGGA 3S8MA 4Q3NA 1F06A 4BO6A 1GQYA 1KEPA 1Z82A 5L95A 5KTKA 1ZJZA 2JJYA 4BV9A 3WGTA 4XQEA 1BDMA 3WNQA 1X15A 3QWHA 4QECA 5IDQA 2VWPA 2NVBA 4BKPA 3RJ5A 2B83A 1OC4A 4J43A 4BNWA 1F17A 2HCTA 2EWMA 3I9JA 2O3JA 4HP8A 4RVUA 4YEDA 4YT8A 1P1HA 3KO8A 1N1GA 1NFRA 3F47A 1H6CA 3GF4A 5TGDA 2BFMA 2UUOA 4BNJA 1QP8A 1Y8QA 3DBRA 3JTMA 1Q7BA 4RDIA 3ROQA 4BB6A 3GA0A 5AQ1A 2WD7A 1I0ZA 1IUKA 3L4SO 2YFHA 1SBYA 2QIOA 1UXKA 4KUGA 4ALIA 3AUSA 5TNXA 4DWVA 4IGEA 5IZCC 2D8AA 2F1KA 4O0LA 4RPLA 4CQMA 1OZAA 3I52A 2G1UA 4AJNA 1JKIA 4Y67A 1ADBA 1PGQA 3PTZA 1KEWA 4O59O 3PGJA 3BTOA 4MINA 3GAFA 4Q39A 5JDIA 5JC1A 2HO5A 2B4QA 4EJMA 2Y05A 5CAEA 2ZTUA 2E48A 4B7XA 1HDXA 3H2ZA 2CFCA 1YL6A 3JQ7B 5I7SA 2AG5A 3PHJA 4ND1A 1M66A 1XCBA 4IJUA 3RBZA 5B4TA 1NXQA 3W8EA 5CEEA 1GD1O 1KVSA 1IZ0A 3AWDA 4NQZA 1G1AA 4IPTA 3M2PA 4R41A 4XQ9A 3RI3A 3WQQA 1QG6A 2X86A 2X9NA 1K6IA 1E1KA 3ZNQA 1IPFA 3JQ8B 3NDIA 4WECA 4XJSA 3V1UA 1I3LA 2WDZA 1ZXBA 4B8WA 4IQ0A 4N5NA 3JQ9C 1N7HA 3P7MA 2Q99A 4R9RA 3U4IA 4OAQA 2OHXA 3D5QA 1V0JA 1DXYA 4NZ9A 3KYBA 1EQ2A 3CZRA 3FWNA 5CPBA 1QV6A 2JCXA 3FD8A 5L40A 1P1IA 3Q11A 2ZCUA 3PI7A 2DTXA 5JE8A 2PZLA 1WDMA 3T4XA 4BNNA 2WE8A 4BB5A 1MG5A 1A7KA 2BMAA 4CM7A 4IS3A 4M55A 3JQ9A 3DXFA 5TT0A 1I32A 3KLPX 2I5PO 1YQXA 2X5KO 3CUKA 4OH1A 4R1NA 3GPDG 4R4JA 3SEFA 1PS0A 2DPHA 4E12A 2IXAA 1NAHA 1V35A 5CDTA 1DJNA 3AJRA 4NJMA 2DT5A 3RIHA 2OUIA 3EZLA 2POQX 2Q1WA 4Z0TA 4NDNE 5H83A 1NHGA 3ANLA 4J4BA 3I4CA 4E2YA 5TQVA 2CD9A 1E7SA 1SAYA 2EF1A 4IJVA 4IDEA 2W2KB 3RBVA 2H5LA 3QLJA 3QWIA 1ZSNA 2O50A 4PG5A 3ITDA 4Z9YA 3UF0A 3G49A 4BGUA 2GLXA 3B70A 4QX6A 3WYCA 1EFKA 4JBHA 1AHHA 3EDMA 1G0NA 1OC2A 2P9CA 3I23A 3ENKA 5G0SA 4E31A 4MO2A 1XU9A 4ZRMA 4IGFA 1LX6A 4WCFC 2HK7A 2W2KA 1LLUA 3OA2A 1PJLA 4RVHA 1W0CA 2W2LA 1YXMA 3PP8A 3D3WA 5JMPA 1Z73A 3LC7O 1OI7A 3MOGA 2O23A 1GCUA 3VTFA 3PJEA 3IAHA 3S1LA 1RWBA 3KZVA 2QX7A 4EITA 5G2OA 3Q9UA 4ZA2A 3RROA 3AK4A 4BO3A 1DHRA 3WQRA 1DC5A 2CDAA 2Q50A 3ZNOA 4BNIA 3GVIA 3H9UA 2Y1CA 3ZW9A 2NLOA 5AXCA 3GFBA 3W4JA 2V6MA 3DZBA 3ZZNA 2C5EA 1X7GA 3LSYA 3PGXA 4MOWA 4RPHA 3TL3A 4CM8A 2X7HA 4L4SA 1M6HA 1T4BA 1D1TA 1HDRA 3HWRA 4M49A 3GDOA 3OSUA 2PA3A 4LK3A 2ZTVA 4BL5A 4I1IA 4IBOA 1ISHA 4K1LA 1UXGA 5G0UA 3C8MA 1HF3A 3OJOA 5KWEA 3FNEA 1HDCA 1UUFA 4YRBA 4FOSA 3JD1A 1T26A 2EW2A 3FCOA 5EESA 1ZSYA 4GPD1 3PHHA 3E9NA 3V8BA 4J2OA 4PG7A 5G0WA 2O3QA 1NNUA 2WTBA 3PDUA 1Z75A 4CJXA 1QKIA 3UCFA 4DTIA 5A06A 4H16A 1H6DA 4N7RA 1MB4A 3RC2A 4PZDA 2B35A 3OA0A 2YDYA 1R66A 1A9ZA 3DBLB 3NJ4A 5I8ZA 4RL6A 4EUFA 3DMYA 3UOGA 2GN9A 2HK9A 4DVJA 3O26A 9LDBA 4XYEA 4DLBA 3I1JA 2IZ1A 8ADHA 3ZHBA 4BNTA 4NBRA 1NPTO 1GYRA 3STHA 1OAAA 3KM0A 3CE6A 2NU6A 3DAGA 1KVUA 4G81A 2V65A 2X23A 2Y68A 4FSHA 4LMPA 3AY3A 3MWDB 4BNMA 3DONA 4KUHA 2D1YA 1IE3A 1TT5B 4D42A 1SEVA 3LVFO 3NJ8A 4B3IA 4GGPA 1NWHA 4PCVA 5K6AA 1KVRA 4A26A 4CLOA 5L53A 4K6CA 2Z5LA 5T5QA 1UAYA 4BNGA 3O8QA 4I5DA 4K9DA 1U8XX 2ZJ0A 4BGIA 1KVQA 4N5LA 4K26A 3AM5A 3H9JA 3GVXA 3PEFA 4LCEA 1ISMA 2JD0A 5KVVA 1DIGA 4NFHA 1V3TA 1DFIA 1ZMTA 3H9EO 1EBFA 4JNKA 4F46A 3RQSA 1RYDA 1YOVA 1I2CA 4TVBA 1EUCA 4PG6A 2FY8A 3F5QA 1PQPA 4DUPA 3GG2A 1F12A 3AOEA 5COBA 3IMFA 1ZEMA 4J7XA 3LT2A 2NM0A 3WX0A 1I01A 2A9FA 1Q7CA 3WJ7A 2OP0A 3RU7A 2IZZA 1Y8RB 4XCVA 3UH1A 2EJWA 4CLRB 1U1IA 1X1TA 3MEQA 4DLLA 2LDXA 2HKIA 3RD5A 5HTOA 3MJTA 3KYCB 1YO6A 1Y5RA 3OQ6A 2HLPA 1DRWA 4EGFA 4NMHA 5TJHA 3W8FA 5L45A 2J3KA 4Z3KA 4BO0A 3L6EA 4YB8A 2YY7A 1CQIA 1HTBA 1W4ZA 2PZKA 4HADA 4MIYA 3VTZA 5KIAA 2P9EA 2PD6A 2PNFA 3QHAA 4ZHSA 2RHCA 3WGGA 1PGJA 4EEZA 2ZCVA 1Q1NA 2JFFA 1S7CA 2DPGA 2VZ8A 3WTBA 1XIVA 2R00C 1ONOA 4IM7A 4LVCA 5TC4A 4ZQGA 4Y98A 3WWZA 3I83A 1XWFA 5IDWA 5EPOA 4CLRA 3NAQA 2R2GA 5JDIC 1ZIDA 3I6QA 3NT2A 1NYTA 2Y1OA 1WVGA 4XRGA 2W98A 1I2ZA 4RVFA 4L4RA 3GDFA 2CMDA 4GX2A 2QZZA 1YONA 4CM9A 2VRCA 5CP8A 4U8GA 4FBGA 3L9XA 3WGYA 3IKVA 4MVJA 3QVTA 1NP3A 3D4OA 3RVDA 1XKQA 5F3RA 5CDGA 4CMEC 3V5NA 3NT4A 1KERA 1R0LA 1XLTA 4E30A 4A73A 3U0BA 4JN6B 3R3JA 3GAZA 3K9QO 1GUYA 2QYTA 2EKPA 2GNAA 3L0DA 3PIDA 2RBEA 2H63A 2Q45A 5JMWA 5HS6A 2VNAA 4BO9A 1FDVA 3JQAA 2Q1SA 4YQYA 5TSDA 3UGKA 1B8UA 3D4PA 1PJCA 4PLFA 2VHXA 1SB8A 5THQA 3GN1A 1X14A 4RZHA 5HBRA 3BMNA 1B0AA 2QRKA 4CM8B 5F1OA 3HN7A 4L4XA 5BSHA 1O9BA 1H0KA 4ZGWA 1NTOA 1GUFA 5KJFA 2I3GA 1LC0A 4WASA 4FFRA 1DEHA 2I3AA 1E6EA 2C82A 3L07A 4MVJI 5IG2A 1B8PA 3X2FA 1P1RA 1R6DA 4UREA 3ZWNA 3GZ4A 3I3OA 1XDWA 3DEYX 3INGA 2DBVO 2O48X 3EGOA 1NPYA 3L6DA 2X8LA 1G6KA 2YDXA 4CODB 3ZWOA 1LA2A 1KEUA 3DOCA 3DOOA 5A9RA 4MVJP 4DYDA 5L4LA 5JLAA 4IZIA 3ZV3A 2V7PA 2BF7A 2NVUB 2P91A 4EI2A 2PGLA 1V9LA 3BTUA 1EEHA 4PN3A 3ZH2A 4BMNA 3WGZA 2C54A 3VHRA 4GSKA 1WMBA 3K73O 1Q0HA 1IPEA 3QA9A 4CUZA 2CVOA 4XIYA 1B14A 1ZW1A 3NUGA 3RFVA 1E1LA 1H94A 1YB4A 1PJBA 3AW9A 3GN2A 4CMBA 4CQMB 4D46A 4DIBA 5CG1A 2FN7A 1JWAB 3H6KA 4BNVA 1C0IA 2Y0DA 2Y0EA 1QRRA 4PLZA 4J49A 2BI7A 3EK2A 3K31A 4AJIA 4CMHA 4AJEA 3IL2A 1JVBA 2PWZA 3VPHA 4AJOA 3HFSA 5IJZA 1T25A 3B1KA 4XZ3A 4DLAA 5A02A 4TWRA 5KCZA 5TX7A 4OKIA 3V1YA 1CRWG 1RM0A 5MGBA 4LGVA 4MVJD 4NH4A 4MKZA 5ER6A 4CLOB 2O7QA 2PH3A 4OHUA 4FFMA 5JAMA 1NWCA 3TPCA 3LLVA 4FGSA 4FDAA 3MTGA 1PQWA 1YKFA 1U3UA 4A7PA 5H81A 1N9GB 1E5LA 3JYOA 4D0RA 2UVDA 3AI2A 1I8TA 1ENPA 3DHNA 5HA5A 1E3EA 1A5ZA 4FR5A 5DBFA 3ST7A 2C29D 3JQEA 4ALNA 4TVOA 3CKYA 3M1LA 4RO0A 4DC1A 2VNSA 4NPCA 1B8VA 1Y5MA 4JQCA 4WLNA 2JHGA 4WCDA 2X9VA 3O9ZA 1LSJA 4CQLA 4DIOA 1GPDG 4RGBA 3D64A 3ZV6A 3EVTA 4CM6A 5C7OO 1U2GA 1U8FO 1QORA 2CF6A 4XYMA 1XHLA 2NTJA 3FNGA 4I8XA 4B79A 1PWZA 2ZB4A 3ICCA 5L7TA 3SX2A 4FJ1A 1FMCA 2D59A 3RC9A 5I7FA 4XJTA 1YB5A 1VSUA 3GEGA 1LSUA 1H2HA 1FXSA 5GZ6A 4BO1A 3RWBA 1QLJA 3ETGA 5DBGA 1MC5A 1DLIA 3IDSA 2VYVA 4GWKA 4JBIA 1E7MA 2I6TA 1AE1A 4MIOA 1P31A 3JQGB 1PS9A 2GZ1A 3DTYA 4W82A 1F14A 5COQA 4Z0PA 1NX6A 2NVWA 1OMOA 3ZCXA 3ZV5A 4BNLA 3ZWVA 2BGLA 3UICA 1E3IA 4CMKA 4ILKA 4INAA 5JDCA 1LRJA 4GLOA 3INRA 2HAEA 4P4GA 4U5QA 2IRWA 1X1EA 3EC7A 1J4AA 4R5MA 1BXGB 1YOVB 4W99A 1HYGA 3CINA 3OIFA 1P74A 4BKUA 4E32A 4LCJA 1LQTA 4IDDA 5JC8A 5KKCA 1T2FA 5DOVA 1DAPA 5EERA 1CDOA 3JSAA 1NAIA 1AN9A 1EK6A 2FMUA 2VOEA 2E49A 1BW9B 1RYEA 3R1IA 2I66A 3DQPA 1KY4A 1X0VA 4FJ2A 2AHRA 3VDRA 1JW9B 2A4KA 1V3UA 5CDSA 3MOIA 3NYWA 4II2A 2WWRA 4OM8A 4CMEA 1KYQA 4OQYA 3S2IA 3DZKA 2UYYA 3GUYA 2PZMA 1WPQA 4YJFB 3K8ZA 2CDBA 2P4HX 1C3VA 5IDYA 1XA0A 2D5CA 2CUKA 3GZNB 5AOVA 3ZWMA 3TJRA 3MJ4A 1N8KA 3G0OA 4E3ZA 4PVDA 5DN9A 1ISJA 3OJFA 4XEHA 4QT0A 5AXAA 1EFLA 3KYDA 2HJSA 2DBZA 4OXNA 3NT5A 3RC1A 4IXWA 4QXMA 4NJOA 5KNLA 1Z74A 3JD4A 3FNHA 1ZK0A 3O4RA 4BUCA 1I30A 3OEWA 3Q3CA 2VRBA 3BTVA 1UP7A 5EMHA 2EERA 3FPCA 1CJCA 3DHYA 2ZB3A 3K92A 1JN0A 2VWGA 5AXDA 2D5AA 5I7EA 1VJ1A 3FWZA 1VL6A 1Y7TA 1VJ0A 3JQAD 3C85A 1NVGA 4ALLA 3K2EA 3R6DA 1FDWA 1K6XA 4I08A 4MVJF 1PGOA 3BMCB 3MJCA 4G5HA 4J7CA 4QO7A 4D41A 3DBRB 4DMLA 9LDTA 5J23A 1P9LA 1KETA 4KP7A 4PLWA 3DFZA 4ALKA 4EZBA 3NKLA 3VDQA 5F1KA 2J5RA 5DF1A 4ND5A 3MZ0A 4CLXA 3QVWA 4KTVE 4CMJA 3H5NA 4KDEA 4CV1A 4ZU3A 2EEZA 5LCXA 4W6ZA 3BMOB 4BKQA 4IDAA 4E13A 4DGSA 5CHEA 3H2SA 1GU7A 4WK6A 3NEPX 1RJWA 3BAZA 3H9GA 4U0JA 1U7HA 3LF2A 3L9WA 4WLOA 2EHDA 1PJTA 3CTMA 5AXBA 4W7IA 3TZKA 4YACA 3P19A 4B4VA 4YA6A 2GYYA 4M8SA 4KWHA 3WDSA 1J6UA 1FK8A 1SEPA 1LDMA 5ILGA 4J9UE 1ULUA 4RV9A 4JBGA 4TKLA 3DZFA 3DTTA 3TOZA 1ADFA 2DLDA 3QWAA 3PPIA 5G4LA 4XDYA 2XOXA 2VQ3A 2HMUA 1U3VA 4HNHA 3WSWA 5JY1A 3JQDA 1AGNA 1MG0A 2GPTA 5L51A 4NBTA 3ASUA 5ITWA 3IIEA 4OXYA 5K0ZA 1ISIA 4GX1A 1MLDA 2O4UX 3E5RA 5K6AC 2WYUA 3ICPA 4QEDA 4LN1A 2W2LD 5JAZA 1E7YA 3HE3A 3DOJA 3ROKA 4DBZA 1E6UA 5TT1A 4DMMA 4FS3A 1AXGA 1TVEA 2J3HA 4EJ6A 2ZB8A 3KYCA 2EP5A 3PRJA 5KJ1A 4IQ8A 1D1SA 2P68A 4KMSA 4HV4A 3BHMA 1P77A 3H3FA 3NTRA 3VVBA 1SZJG 1YJQA 5KVCA 1NQOA 5EN4A 1WDLA 4P4NA 4XB2A 1R0SA 4OL9A 3WMXA 3UFXA 2OZPA 1ISFA 4PZEA 4LW8A 4U6QA 4YVFA 1ZK1A 3JQAB 3OBBA 3F9IA 3AFMA 2HUNA 4BO4A 1UZMA 4GVXA 2C5AA 3RUCA 1N2SA 3RUEA 4EYEA 4EBFA 3DAFA 1ZVMA 4NBVA 4YJGA 4ZN6A 4YJGB 1P0FA 1GCOA 5TS3A 3HDYA 3WG9A 3GNSA 1B3BA 3S2FA 3PZRA 1M76A 1JLLA 4WNCA 4CM9D 3G3EA 4WLVA 5JYDA 1XEAA 5A03A 1Z45A 2Y0CA 2W8ZA 3QWFA 2B5WA 3LK7A 2VN8A 5IXYA 2OORA 4YAKA 4MPDA 1UJMA 2JD2A 1R16A 1ZJYA 1QV7A 3IQDB 3WGQA 5A9TA 3WS7A 2C59A 1D7OA 1SMKA 1PL8A 3BXXA 4LRSB 1R4MA 4J4HA 1KEVA 4DC0A 4A03A 1HDYA 3PQEA 4RF2A 1YL7A 3C7AA 3FSRA 3I5MA 3QVOA 2IODA 3MCVA 5JCJA 1W6UA 3EY4A 4AL4A 1E3SA 3RJ9A 5T64A 3AM3A 3GUCA 3U3XA 3GEDA 1GZ4A 4UUOA 3W6UA 3ZWXA 3CH6A 3VAZA 1F8GA 7ADHA 2V6FA 3M1AA 4R5HA 4HXYA 3ANMA 4UEJA 5JNLA 2WD7B 3AUAA 3BMQB 3WOHA 3KSZO 3R3SA 4LSMA 3I4FA 5CG2A 2FOIA 3SXPA 3I6IA 2DTDA 3TZ6A 4BNZA 3A28A 4OQZA 3V2HA 3LT1A 1WZIA 1L7EA 4LSWA 1JKFA 1WAMA 1EDOA 1VJTA 1MC4A 1I3MA 3VZPA 2Q49A 4E0BA 4TKMA 4E2WA 4E21A 3QY9A 3ZDFA 2FRDA 2ZTLA 1BDBA 1U4OA 3VKUA 3NGXA 2C0CA 3DZJA 1P3DA 4NK5A 4Q3CA 4AG3A 1VL0A 2R6JA 3AY6A 3I9MA 4R54A 1UAGA 4YT5A 1Y9AA 2C2XA 3ENNA 3HFGA 4UUMA 4ZQEA 4QFCA 2HK8A 3TFOA 2FR8A 4U0KA 1LDEA 4J1SA 5L7WA 3QVSA 3HJAA 1FJHA 1ZK3A 1KVTA 4ROSA 2EKQA 3JQ8A 1NPDA 1PL6A 3EUWA 1U5CA 4WLUA 1TXGA 1WZEA 1HZJA 3V1TC 1Y81A 1CF2O 5A3VA 3T4EA 4I9HA 4O6VA 3K30A 3OECA 3ZHZA 3FTNA 4A27A 2Q2QA 3LC1O 4W9NC 5ICMA 4X54A 2TMDA 4UEOA 1UXIA 4FOOA 4R1SA 3TFQA 4BNYA 4B7UA 4ZVVA 2AQIA 3WYBA 3BZUA 6LDHA 2NV6A 3ZWYA 5I9MA 4AJLA 4YCAA 1ZKMA 4RDHA 4BVAA 2RH4A 3HNPA 2PV7A 1CYDA 1VPDA 1WMAA 3MTJA 4UAGA 1UXJA 1N9GA 3CPSA 4H3VA 5DZSA 2CVQA 2PKQO 1M67A 2DQ4A 2FWMX 2PKQP 3C3XA 4I5GA 3RUAA 3SVTA 3BIOA 5G0VA 4O63O 4N18A 2G82A 3RASA 5B1YA 5BNFA 2P9GA 1NVTA 3S55A 2B5VA 2VUTA 4M86A 2NU8A 2EW8A 4RPKA 3LU1A 2WEKA 3ONDA 4K28A 2JL1A 4CM4B 2CF5A 3E9MA 3Q2KA 4FCCA 4J90A 1CEQA 2FR0A 3W4IA 3DAPA 4NBUA 4PVCA 4D3DA 5IZCA 1XG5A 4B4WA 1I5RA 1KOLA 4EUHA 4YRDA 4IINA 3ON5A 2GN8A 1E0DA 3MJSA 3VH2A 1ZEJA 2DU8A 5A04A 1GFSA 1K3TA 3KUXA 4F6LA 3JYLA 4XQCA 2GR9A 4RPGA 3MJEA 1CIVA 2NQ8A 4D79A 3PYXA 4A0SA 2DBRA 5JBIA 1HL3A 2SCUA 4FFLA 4CLDA 1I3KA 5T67A 2TMGA 2Q2WA 1ZH8A 2X6TA 1CWUA 1YQDA 1CQJA 1DOHA 1ONPA 2AEFA 4J9VA 1BVRA 3PK0A 1P1FA 3QVXA 1KIFA 1YBMA 2DM6A 5KVQA 1PU2A 2Q3EA 1LLCA 8LDHA 3QWBA 4ESOA 2G17A 3NRCA 1P44A 3RFTA 3RFXA 1CERA 3H5RA 1U2DA 2D0IA 3U4DA 1E7QA 2JCYA 4R16A 4YAJA 4WUVA 4XDZA 3FN4A 2D3TA 2X5OA 4OO3A 1C14A 4RLSA 4YDRA 1F0YA 1DIHA 1QYCA 2B36A 3KVOA 3R0IA 4HY3A 3JQGA 2O3RA 1XU7A 2OP1A 3GHHA 3UKOA 5C37A 4TMFA 4Z3DA 1ZSVA 3IC5A 1LDNA 5F5LA 1LTHR 3KHUA 4N5MA 2GCGA 3ZHYA 3WGIA 3GEMA 4DA9A 1QMGA 3LZ6A 4TRMA 4QSMA 2BHLA 1PJ4A 2I99A 3U49A 1T1RA 1EVIA 3G17A 1A71A 1M6WA 1JVSA 4HFJA 3JQBC 4PIVA 4CMCA 3OIDA 5FWNA 3ZU4A 1TA4A 1DIBA 5T8KC 2DUUA 3TWOA 1GTMA 1RM4A 2C7GA 2DVMA 3G1TA 3PJGA 3FNFA 4MP3A 4DREA 3GVHA 1ORRA 4KTTE 3KEQA 4L0QA 1BVUA 5IN5A 2BELA 1C0KA 1DFGA 1P1KA 2QW8A 1E6WA 3DZHA 3D5TA 1BWSA 4HFNA 5ADHA 1LBEA 5ITVA 4HBGA 1DHTA 1VI2A 4RVSA 4XGKA 4GH5A 5FFFA 1LLQA 2DKNA 1YDWA 3GQVA 5A5FA 2YV3A 3GFGA 4R51A 3KXDA 3X2EA 5TLSA 1DC6A 3CXRA 3CSDA 3I9OA 2FPPA 3D4NA 3PYLA 5BT9A 1EZ4A 4AJ4A 2BRUA 1ZCJA 4ND2A 2YYYA 2E37A 2XPCA 3H5AA 1NHWA 1X7HA 2D2IA 1EVYA 3UHAA 1LDGA 1YBVA 1VRWA 4QFDA 2VHWA 3U62A 3MWEB 1PS8A 4B4UA 3A14A 1YGYA 2D4AA 3W6ZA 3TL2A 2VYVD 4MVJM 4R9SA 1D4FA 2Z95A 4R69A 3ETEA 3COSA 1UDCA 3WB9A 3TZCA 4XYBA 3AI3A 3BTSA 4FB5A 4BIIA 4HNGA 4NU5A 2GZ2A 1PX0A 3EVNA 4ZJUA 3G1UA 5CEJA 3L4BC 1OOEA 1XYGA 2WMDA 4E5KA 5KJCA 3DB2A 4KQXA 4BNUA 3JQ7A 3QSGA 4J0FA 5DP1A 4WOKA 5IDXA 4C4OA 5JY6A 2X5JO 2I9PA 3FRJA 3OQBA 1BXGA 1PR9A 4FC7A 3INTA 5CDUA 4II3A 4IY1A 4L9RA 5U9CA 4JK3A 1ENYA 1JKJA 4OYRA 3PHGA 4Y9DA 3PIIA 3WTCA 4AJJA 1B16A 3JQFC 1GR0A 3F1KA 4ZICA 5A9SA 3GH3A 2F00A 1HSZA 5DP2A 5DT9A 3A06A 3D0OA 4O1MA 3LYLA 3RUDA 1NBOA 4Z0HO 4BGVA 5IZ4A 1E3LA 3KOUA 4ZD6A 2O2YA 2Y67A 3WWYA 4IDBA 3ZHXA 4GL4A 3OETA 4IJKA 4RQUA 4YJHB 3ABIA 1O5IA 2WD8A 4KZPA 3PLNA 2UUPA 4JCOA 1O8CA 1RPNA 3ORFA 5FI5A 4XGIA 3FBGA 3UXYA 3P2OA 4DXHA 1KS9A 2AXQA 3IUPA 3DDNA 2NU9A 3H65A 3LLSA 1LQUA 4TRRA 2HRBA 2BFPA 3VZSA 1DRUA 4BNHA 1SO8A 5EQFA 3QQPA 4O5OA 1PGNA 1R4NB 1VM6A 2CNBA 3EHEA 5BNIA 1UP4A 1HLDA 4YRAA 1ENOA 2G76A 2X0NA 2ZK7A 1M2WA 4W4TA 3ZU5A 4H15A 1DIAA 1I33A 4CUJA 1G0OA 2CDCA 4R3WA 1IYZA 1QYDA 1H6AA 4B8ZA 3A1NA 4CPDA 2GUGA 3O8QB 1PZGA 1T2AA 4KDFA 1D8AA 4ND4A 2ZIZA 2GGSA 2BGKA 3AU8A 2OGUA 1U3WA 1I2BA 1B26A 3RBXA 2J8ZA
chains in the Genus database with same CATH superfamily
1TFUA 3DO5A 4S0ZA 4YV0A 1SIOA 4OKNA 4Q66C 4MDEA 4MPRA 2BM8A 2AEMA 3CMCO 2PYIA 2XMZA 5KYTA 1G5TA 2XHZA 3HB5X 5F78A 5FXMA 3O47A 3QVLA 5I4KA 2LGJA 4Z9AA 4IF6A 1ZM2A 5A4FS 2FP4A 4DQXA 5FOVA 4E5DA 5EYPB 1I10A 4M37A 5CJPA 4DS3A 1AVTA 2JFYA 3PQ8A 4ID9A 5JZMA 1RLMA 4AX4A 1VE5A 3OD5A 2PGXA 5H5JA 4JSYA 4MRMA 2IYRA 2EATA 3QEMA 2YFKA 4CHGA 1HRDA 1BHSA 2VP2A 3MRVA 3Q8LA 2X1MA 1YS9A 3E2IA 2I78A 1YCFA 3T4UA 3NC1C 3JR3A 3K5PA 2QGZA 4EJSA 4BQRA 2P65A 2WVHA 5J2TF 4QE3A 3DUFB 2OFOA 1R9MA 4AN0A 1WXDA 1LEHA 2PQ2A 3OFJA 3RVMA 1BMFD 1IWBB 3CEPB 3HRKA 2NZXA 4GUDA 1M8PA 1THGA 2IYLD 4UDOA 1XNJA 4YBZA 2QP4A 3SHTA 4MLZA 4AX8A 2XE8A 4IQFA 1TKBA 1VECA 2CV0A 3KSDO 2DTEA 1HC7A 1LH0A 2IEDA 2JAPA 3N2GA 5KTNA 1X7DA 4JP5A 8OHMA 4GT1A 4J3FA 4WY8A 1F6WA 2UZ1A 3SGLA 4AJHA 5TR9A 4DJFC 1YFJA 3FYUA 1X6VA 4P2GA 1NJ5A 1IH8A 5A7FA 2IGBA 3VHLB 4XVHA 4J7AA 2ERCA 3K70C 3WISA 3PX7A 3AUUA 4EAQA 3UATA 2CZCA 1R6XA 4HC4A 1M0TA 1WSBA 5C4MA 1P45A 5EUBA 2GXUA 4EARA 4RLFA 1CLEA 2Z2KA 1OF1A 2AA3A 3EEFA 5A4DA 9MHTA 4TPKA 3EEYA 2C3PA 3U7RA 3ZI4A 1JQDA 4JX8A 1NJ6A 2HDHA 3IOCA 4LHEA 4V0QA 4QJ3A 3WSTA 4OHYA 3TMAA 4AZTA 2G5TA 4R2JA 3AEKA 1CVRA 3L1IA 4URHA 3TRIA 4AZSA 2LD4A 2RDMA 3HV2A 3EQ8A 2C57A 1U0TA 1CRZA 4L3OA 4DNFA 4GEKA 4ITVA 3ZKWA 3TNJA 4D6PA 5JZ9A 4OXRA 4Y9SA 2PWYA 2DWOA 3U4AA 3R7WA 1XDSA 2BRUC 2C83A 2DSNA 1U8ZA 3M5WA 2O8FB 5G4KA 2XUJA 1GKUB 3CNLA 2BHTA 1GL9B 1VSVA 3DVLA 3OPVA 1GEGA 2A9JA 1E62A 2GH1A 3K8QA 3OFSA 4UE3S 3Q41A 5IYZA 3ZDAA 1N8TA 4KPUA 1G38A 1BAPA 4Q47A 3F97A 1W59A 2GBIA 3P9KA 2ZI7A 3L6OO 3OIGA 3E03A 4LV5B 4RHYA 3DS8A 1UDAA 5DO9A 3CEHA 5HF8A 1HE4A 2O2ZA 3N2KB 1OLOA 4RIFA 2J4DA 4D2IA 4XIGS 1T5LA 3IKLA 4FI3F 3GVCA 4NAVA 1QHIA 4ZGGA 3PICA 2WMNB 2P6OA 4FNGA 1U7UA 3CA8A 1K89A 3WLSA 2BBOA 4QYIB 4UUQA 3PU6A 3WMFA 1Y6JA 4CKYA 4ARVA 5CVTA 2O3TA 1SM4A 1U90A 3FI0A 3LUKA 3WL7A 4A0HA 1INLA 1Y3AA 2FUEA 1WJGA 1FTNA 2AMVA 2P3LA 2V6BA 1S8FA 1CR2A 3MT9A 2WSBA 4DHEA 1DWQA 2QNRA 3RIGA 4EG0A 3UHOA 2WE7A 4R83A 3NMUF 1HEUA 4PY2A 3HS3A 3GLHE 1LFAA 4XYGA 3I53A 4XYLA 4PSVA 5DBIA 4YY3B 2XCIA 2EFEB 4BMVA 2P4EA 4BMCA 3FSJX 1K5HA 1WMSA 2A0UA 2AL7A 2OMKA 2Z9DA 4PZYA 5KYWB 5CDFA 3KR0A 1JR4A 1GTJ1 4IFIA 1PWYE 4IV8A 1U7WA 4CLHA 2Q1UA 4PZZA 2JG3A 5LP1A 4FCWA 5DLQC 3FSEA 1NX9A 1QC5B 5C7LO 3V2UA 3O7MA 4MW4A 4Q3LA 3W78A 4BS9A 1M0SA 2FPGA 2BCJQ 5B58T 5LP6B 2A92A 3HLKA 5H3LA 3Q2IA 1PTJA 3IP8A 2VDQB 4WXRA 4A36A 1ZBDA 3IO3A 2PSEA 2PWAA 3I72A 3D6JA 4RXUA 1FW6A 3G8AA 2I29A 4FGWA 3WI7A 3ZVRA 2E85A 1HG0A 1HXHA 1NQ5A 3HWX1 2W0SA 1R5NA 3WJ2A 3RYHB 4EB0A 1JVNA 2E6UX 4M54A 4OQNA 4BFZA 4HDRA 2G5CA 5DFAA 5L7YA 4PRLA 1YMQA 2WM2A 1FPMA 1DKMA 3SYNA 1LI5A 5I45A 3LY9A 2NP7A 5TMEA 4Q9JA 1ZK2A 1P4AA 3LF1A 2OCYC 2QN8A 1UDBA 1QSGA 3VI4B 2C7RA 4K6FA 2OR3A 1GO2A 2VJKA 4L6IA 1A2KC 4V24A 5EGNA 5T57A 3LDUA 3ZHOA 4DT1A 3ZHQA 1Z8HA 3RWOA 2WB2A 4UUBA 3KR9A 1V9SA 1EFRA 5F21A 5B7GA 1KZYC 4UUPA 2Z3VA 3KQUA 3L7CA 3QU2A 3FG9A 5A4JA 2ZRMA 3TLGB 5DM70 2GEVA 4CTKA 1MB0A 2WWXA 4KL8S 4CEIB 4IDGA 1YNSA 2QY6A 1XEXA 4FFNA 2MSWA 5D3MB 1Z0ZA 2QWXA 4EMUA 4KXXA 4MUNA 4ZQFA 5BYKA 3VR5D 3MJRA 3PF8A 4F93B 1TTQB 2OESA 2VJYA 1ZM9A 2AD1A 4X1OA 5CX1A 4F3YA 1E79D 4OBXA 5ENZA 2RB5A 3OTHA 3QKRB 2P0YA 2FHSA 3GVPA 3A9RA 3AI1A 3KQSA 5DTRA 3QIVA 3RF6A 2QENA 3G9QA 1MABA 1GT6A 1COWD 2DC1A 2D7DA 4MKIA 1D6NA 1PFVA 2QQEA 4MB2A 1A1VA 3T15A 2F1HA 4HAWA 1IXKA 3R7AA 2HSZA 2AI3A 2MINA 1WHTA 2GK6A 2WP8J 3W0LB 4E4YA 5IKXA 5E4TA 1KMHB 2BD0A 2CMFA 5HKKA 3Q7TA 4Q3BA 1EDEA 5K3OA 5GAJA 3BXZA 4BFUA 4OHPA 5KPJA 3KLMX 1A9QA 3UXMA 3NBUA 4RF3A 1DT5A 2ZJOA 5A5VA 1AQIA 2GPYA 4NBWA 3SNKA 4JKOA 4Y2PA 3EAGA 1XKLA 2N46A 3HN2A 3ZXXA 1QRUA 4BY9E 3CX8A 3O3OB 2ZYUX 4R31A 3ZV4A 1M2JA 2UVPB 3GJSA 5CBKA 1H1DA 4HK4A 3MF4A 1W8DA 1PYDA 1NGSA 1TL7C 1H1LA 3BN3A 1GL3A 3H3JA 3L1KA 4OMDA 3WWCA 1TC1A 4BMXA 3TN7A 4RIGA 1G98A 1Q2UA 5IAGA 3FOEC 4HDKA 4LZZA 1D1PA 1N4AA 2C31A 4OQMA 5BMVF 4TZ0A 3R3ZA 3IXLA 3R3UA 3DP7A 3IJRA 4YCMA 3N59A 5JJCA 3VYSB 2BH9A 4RELA 3U5TA 1X74A 4JL5A 3IUSA 4MV5A 4E3WA 2H1VA 4O33A 5ABPA 2CT8A 1KQFA 2F4VB 2Q2VA 2PLAA 1CUYA 4NV1A 4BAUA 4ZCIA 3I0NA 3RABA 2JGLA 4RESA 5LZ8A 2B82A 5JATA 5FWYA 2I7VA 1J00A 2R0QC 2VS1A 2G0AA 5AVRA 3PGA1 1Z28A 3DUFA 3ZWCA 2DHEA 3CVXA 2X0IA 4GRAA 4FR0A 3THSA 2XNSA 1HE2A 3ISVA 2C20A 1YZQA 3ZWBA 1E2FA 1ORWA 1T6BY 2V45A 1CU1A 3E7XA 3G7NA 4JA0A 1LJLA 1NF9A 2CEAA 3M33A 1XFDA 3RU3A 4B3DA 3ZVNA 3UUGA 5B1HA 3OZUA 1QAQA 4DLWA 3IP1A 1ZHOA 2WHXA 1WUKS 4S24A 2ZYHA 5GGYA 1ISGA 4GRDA 1CULC 4D4IA 3TQTA 2AFIE 5DXAA 4C7BA 5FLYA 1D2CA 1U3TA 4G0XA 4IDPA 1PDWA 1DDOA 3ISJA 3GMSA 4MS1A 5EIHA 3SHWA 2Y1KA 2IY9A 1L5HB 1XLVA 3K2BA 3V6MA 1DINA 4US0R 1IRXA 1T2CA 2YFQA 5JW6A 1N7IA 4I14A 4GPIB 1PHPA 3HZZA 2C4MA 3D0QA 5BN3B 3MHTA 1MXHA 3ROTA 3D8UA 2PTGA 1KJ8A 4C3ZA 3O82A 5JAIA 1TEVA 2BFOA 2QPOA 4BHTA 1H8EA 1YDGA 4DEVA 4RF4A 2I62A 3IEKA 1HZZA 3T3MB 1VLLA 4O4LF 2P0EA 1JLSA 1XZLA 4PYKA 1TT5A 1JAHA 2RAFA 4MA0A 5FFNA 4ANFA 4EKIA 3SZUA 5BNZA 2UXCB 2WSYB 1CEEA 1AUXA 2WYOA 2NUAA 5EZYA 1ULSA 1RYFA 1U1CA 4M1SA 1FDSA 5THKA 1HQYE 2E7ZA 2V4UA 5K8VA 3ZD9A 4LDAA 4TYYA 4GP7A 4WV3A 1HE3A 5EXDA 1ZHFA 3JQCA 4GG1A 5JAQA 4ALMA 4OI4A 5KTSA 3C70A 3MD0A 3HVJA 3ENVA 3TDKA 3EH2A 3WMWA 1R4NA 1J2RA 3OEED 4KHZA 2E82A 5G1PA 3U48A 2RONA 1A7JA 1NN1A 3HDJA 1RXYA 3DMNA 3F4KA 2XRYA 4IH4A 2RJ3A 4A8PA 2AYXA 1OV4A 3ZE7A 4JR1A 4F8YA 3NVKI 1P5FA 5E1BA 3YASA 1C0LA 3LA6A 2CBXA 5C35A 4PSCA 1K1EA 2H65A 1V2HE 2I76A 4F3RA 1ZLYA 4Y2GA 2VDJA 3CY6A 2Y1FA 5EZYB 1OFUX 4IJWA 3OICA 4A5SA 3LP8A 2Q0SA 2ZT7A 4Y0NA 2FW6A 1NOKA 1F1JA 1YI0A 2IPAB 3GW8A 3KKOA 4Q3OA 3RC8A 2AG6A 2V5VA 3CLKA 3ZE9A 2M2IA 3Q3EA 2ECKA 2EL7A 3WLHA 1ZOPA 3TB4A 6GPBA 4G8DA 5LQKA 2XIQA 4EHHA 3PHCA 4E2XA 4ZV7A 1G18A 3FUXA 3R8CA 1QOPB 3IEPA 1DKNA 4CIXA 3ZVKA 2R6FA 3LDHA 1UC8A 2VL7A 4Z9FA 2RK4A 4FIDA 1R0CA 3LT0A 5HFNA 3NHRA 3H8VA 1U8AA 2OYRA 1FFYA 3HUDA 3AU9A 2QPLA 2YHIA 4WFIA 3OLXA 1T0BA 2NZ2A 3SY8A 4P08A 5CFRA 4OHRA 3GGGA 5AVZA 2VDLB 3EZFA 2L69A 4F9EA 1C3XA 2R1TB 1JPNA 2WSLA 4BN4A 4IJ6A 3UJ9A 4C0XA 1JR3A 1ETHA 4PZPA 3B89A 1Z6ZA 5FORA 2GBLC 3EWSA 4TUYF 5KCMA 1HFJA 2RCYA 3URMA 4LJAA 4IQGA 4KQ9A 3O74A 4Z0NA 2XDQA 4ETNA 1Q7EA 5KTOA 3EPPA 1WWKA 2GDJA 3CPEA 1PZEA 1FP4A 2Y6UA 3MBIA 4U2CA 4BTLA 4EHDA 1KJZA 1DFHA 1OH8A 2QVYX 1T6XA 3TLEA 1RI1A 3BKWA 4DLSA 1U65A 1B6GA 3NGLA 1A7UA 5JPIA 3AESB 4KVFA 5DCWA 2CHGA 5I8PA 4B32A 2V98A 3ONFA 2PX0A 5ER9A 1QFJA 1U2TA 2C8JA 3LUDA 4PIPA 2PRKA 4PYNA 2XB6A 4I9GA 1QZXA 3JWPA 3QX9A 4TROA 3ZWPA 1F20A 4AVYA 3R24A 1NTRA 2BR3A 3KIPA 3JCZA 5LDGA 1P7ZA 3E05A 3EXAA 3FHCB 5BVGB 1V45E 5IM4F 4Q3DA 2V6IA 3MQ2A 4ZODA 3WIBA 4PRZA 1JFSA 2W2OA 1BA3A 1PJ3A 1WXEA 1XTRA 1QOZA 5JBIA 3LGXA 3A6DA 1HNXB 4EYOA 4S35A 1NVMB 1QHXA 2PWBA 4NATA 1X77A 3M6WA 2CJFA 2XGOA 3D7LA 5ILQA 1WW8A 4X24A 1A4IA 4C08A 5AKYA 2HBZA 2OEPA 2WD9A 2GAOA 3AFGA 4DQVA 5SYAA 3O8CA 2H2WA 4QOEA 2PH7A 3COYA 2VWHA 2GF2A 4AUNA 4QPZA 4QT4A 1SB9A 1SHZA 1X1SA 2DFNA 1Q3HA 3E9RA 4IX9A 4XM0A 5IN4A 1FJXA 1GPH1 3DC2A 3L0CA 4IMPA 2JIBA 4GVPA 3NDRA 2MU1A 3NB0A 4PLGA 4R05A 4BJ6A 1RBMA 1P72A 4DABA 4TXNA 4POOA 5KWIA 3ZJVA 3IQGX 3LJKA 3P9NA 3NHBA 1XD8A 3NRBA 4BZQA 3UMVA 2X4IA 4ONEA 1KPHA 2CLIB 2BSXA 5AD1A 1NVKA 3U0VA 4F4HA 4C29A 4LMAA 4NR0A 5GQSA 1C5KA 4RZQA 5CB4A 1POXA 1S3IA 4HX5A 2Z83A 3OEYA 1ZRMA 4EKYA 3GRUA 3CISA 2R1VB 4U6NA 1NW8A 4X00A 4A23A 1B7GO 3K9BA 2QQ0A 1KAHA 4YRNA 5LYJA 3BSYA 2PRYA 4DPMA 3BYZA 4Z3OA 1P73A 1WCIA 3E1SA 5DNVA 1H8ED 2BGGA 1HX7A 3VKGA 4N54A 3BSFA 3CZQA 1OZ0A 2HYDA 2HWYA 2XF8A 2D3WA 4QYXA 2O6HA 1JG1A 5ISMA 1G41A 2Q46A 2D6FA 4XWYA 3CN7A 4QAQA 3RSHA 3PJFA 1KDYA 3MLEA 4DA6A 1M2VA 1YS1X 1ZM7A 3H2KA 5AKLA 4DY6A 4OFWA 5B36A 2K2QB 4Y7CA 1XQVA 2O1EA 1FZQA 2JVKA 5DI3A 4JLAA 4G26A 4ZAFA 4KOEC 1WZCA 3R4VA 4AJPA 2R7NA 1USUA 2QRLA 1UZAA 2NAPA 4M1MA 4Y6SA 2JAHA 1Z35A 1IEWA 4OHKA 3TLBA 2H1RA 5CITA 5LWQA 2CSXA 1E92A 2CHEA 3MS4A 4DWOA 3R9WA 4QJ5A 5C2JB 4GBGA 4FZVA 3BKXA 1R0RE 1JXQA 2HPAA 1U7TA 4DA7A 4URFA 1VLHA 2QLNA 1R00A 3IDFA 4Y6PA 4GNKA 4II7A 1A72A 2YJTD 3GT7A 3VPCA 3C1TA 4BWGA 1AKNA 1NLYA 3KFLA 4ZOBA 3FDZB 1W5FA 4D4GA 1T9GS 3BRCA 4WKOA 2IP4A 2H8GA 4L5AA 3WLAA 3FB1A 2F62A 4EUEA 3BFPA 4I81A 2ZUDA 4FDLA 1AHIA 3FVVA 5FOXA 4XOIA 2CE2X 4CR7A 5B4UA 1PUIA 4IMIB 4LXIA 1WLYA 3Q3GE 2EAUA 1P0QA 4XOUA 3CMMA 4EJSB 2SHKA 2VYFA 2XLBA 3CUEF 3LDAA 3SWWA 4QM7A 5LSAA 2OO5A 4JD5A 1QR6A 1UZNA 2I54A 2WM9B 1JFRA 1OSNA 2ZBVA 2AJLI 3M2TA 4HH4A 5FOTA 5LP6C 5NLLA 3DFIA 3M89A 1LLDA 4JZYA 4D9HA 2UUBB 1XZQA 4L8VA 2HTFA 3HKDB 4HFRA 4L7VA 4MARA 3ADOA 3GJTA 1RSZA 4YK7A 3REQB 3VC7A 4M88A 9ABPA 1PV4A 3TQCA 2NO1A 3LFTA 3OESA 3UHPA 2VQEB 1RYBA 4QBGB 1AKYA 3K96A 4KKXB 2EFHB 3C15C 4F4CA 3LPCA 2OCBA 1IEVA 1RRMA 2ZRBA 3I9NA 3O83A 1U2EA 3OLCX 3C3WA 3INNA 4B5KA 1E0JA 2RIRA 3M9XA 2H7YA 5DLEA 3T7CA 2AN1A 2PDAA 3GFQA 1T8YA 3HCEA 3BMNB 4JLWA 2R8OA 1Q0ZA 5J5CA 5TF0A 3QA3E 1ST3A 2ZRHA 2LUOA 3PFKA 4EVQA 3F73A 1YQGA 5CNJA 3AF1A 3U2QA 3DR3A 1ZA2A 3JV7A 4UVDA 4YPOA 1T4GA 1J7JA 3GGOA 3GXOA 1BRTA 1XLUA 3HJTA 3MJHA 4QTZA 3WK6A 3DLBA 4JJFA 3RRFA 1XVLA 4CETA 3AM4A 3IDOA 5LQSA 3WGHA 1QYVA 5T4FA 1MT0A 2PL5A 3MIZA 2X1HA 3UMCA 3WLTA 3U3JA 2QTRA 3V1KA 3AR6A 3MW8A 2Z98A 2C4HA 3NXKA 2IEYA 3RLIA 2O3SA 2YWFA 4IWNA 4DCCA 4ZREA 3BF8A 2R7MA 3WBBA 5U4QA 2V7VA 1RWKA 2VTEA 1T8UA 1AX9A 2ZRJA 1XP5A 3UV3A 1UEIA 2DLCX 3GCDA 1ZI8A 1ZUWA 4AF6A 4UNQA 1HH4A 1R3DA 4WZAA 1XI2A 3VVCA 2GPNA 1P33A 2IPOA 5FOUA 2J3DA 4XIJA 4IIFA 4ZAZA 2IH4A 1GZ6A 1BG6A 2Q2NA 4EUNA 1U5AA 5KX5A 5DTIA 3N8IA 3OKFA 4RD4A 4S1NA 4IRXA 5EIBC 1EXWA 1S8NA 1XEWY 4FIZA 2VR1A 1P62B 4LKRA 5CB8A 3DGEC 2OXIA 2R48A 4UNSA 4RK7A 3V4FA 5C8VA 2NO5A 3FHLA 1GLGA 1WS6A 3C6BA 1QS0A 1TQ2A 5KX5B 1SPXA 2HIMA 2VP0A 2VNHA 1A96A 4IL5A 4PLHA 1NOIA 5TJ9A 4FWTA 3BB1A 5DKFA 3FLMA 5BN1A 2P6UA 1OHHD 3IGFA 2F9MA 1IG0A 3BFVA 5HMMA 3MT8A 4ZARA 3AUKA 5GV7A 3IVRA 1B74A 1BW9A 3HH8A 3NHJA 4FM9A 1UJ2A 1O2DA 5DN6A 4Q7KA 1EHCA 1HNZB 3DHEA 3BQ9A 3QUCA 2ZYDA 3F4BA 3O4VA 5A3QA 5GZ3A 1TT7A 1MA0A 2H4WA 4KNYA 3CX3A 2D0PB 4IHAA 4P0PB 2VXCA 1Z4JA 5IEBA 3EWAA 2L82A 4NZYA 1BIFA 5IAJA 2X9LA 1M0EA 3J81k 4JB3A 4BBJA 1U02A 5C7IO 2EX1A 1YDEA 2ODAA 4NBLA 1I36A 2J45A 3SYKA 3PEWA 2C8LA 2M6SA 3QW2A 3NXSA 4E4TA 4F2GA 4YUZA 2VPYA 2DUNA 5L4NA 2FJPA 1J97A 1GYQA 3PQDA 4HNQA 3EF1A 3TKLA 3KWFA 4CKZA 2WSSA 1J5PA 1GZ7A 5TDHA 2IH2A 4WOBA 3GRFA 4NYJR 3IVGA 3LHKA 2W00A 4QPPA 4LXUA 5DPMA 4CG0A 3ZKWB 5B7QA 2AN3A 3RRXA 1L4YA 2R8YA 1DJQA 3T95A 3DTVB 3LOPA 3LC0A 2YJNA 5HOEA 1UFRA 5FV7A 5IUNC 4KWTA 2X5XA 5LL6P 3QOXA 1SVNA 2KE5A 1X0XA 1YK1A 2AZTA 3SLRA 1ZW6A 1GPJA 1U9JA 4MDHA 5TQ0B 4D9FA 4GSLA 3FBTA 4BBZA 4JL8A 1H9AA 1DWUA 2JI6A 4YMWA 5KPDA 1JJBA 1ACLA 1DTWA 2IVFA 5KVAA 1C1XB 3Q9NA 3TZQA 4DRYA 3ZD6A 4JGBA 3VO2A 4EVSA 1VKJA 1DWPA 2BLLA 2IYPA 2VJBA 5ITZA 5LU8A 1E98A 4U5XA 2A59A 2JIQA 2DT8A 4XSVA 3H1FA 3SHOA 4J1TA 3PUZA 1XZKA 4Q7MB 5EXEA 1VG0B 3QPAA 4D3XA 3EGXB 4L28A 4CR6A 2Y0BA 4R7ZA 1ZOLA 3A4IA 3C2QA 3D6UA 1PBNA 1QVVA 4BCDA 2BONA 1V16A 3BE8A 3DZCA 1T5HX 1PUJA 4AP5A 5DNUA 1O94A 4ARZA 1FLNA 5JIBA 2PUAA 4UFOA 3AP2A 1SUSA 3GEHA 3IVXA 4J6FA 4HGOA 2CXUA 2HRCA 1C3OB 3TGPA 2GETA 2NQTA 3K6JA 5JYEA 1G8AA 3T7KA 2GZRA 4JROA 4UTPA 4MMZB 1S6YA 4L8GA 3RS0A 3Q0EA 2GHRA 1LBIA 1LJUA 2AK2A 4D8UA 2EDCA 1W19A 2PD4A 3WFIA 1T2UA 3N07A 3O93A 5AK5A 2EGHA 4KYTA 1QO9A 5K7SA 1WRBA 4Q00A 4R01A 1AV6A 3OURA 1GGEA 2FSUA 3SSMA 2BKAA 1FFSA 3BB3A 1MHPA 1P2TA 5ICSA 4EPTA 1E4EB 3HB7A 1IOLA 3PD1A 5JS1A 4OGKA 3SJAA 4F6RB 1IY8A 2IXTA 3DLPX 4IAOA 5ALYA 4CQLB 4D43A 3VKVA 2IYEA 4B85A 1K8XB 2GD1O 2OG2A 3CO5A 4WGGA 3ZUPA 2XRMA 1SD1A 4EZIA 1SXQA 3VGPA 1U8UA 1SCAA 2F2TA 1SHTX 2XDQB 3EXG2 1TMOA 1YH3A 3KZMA 4PLYA 3WQBA 3HJRA 3HBMA 1RM5A 3R09A 1L1FA 3B3QA 3RREA 3RPEA 4RS3A 3WR5A 4EYQA 1Z2CA 1L8AA 1RZRD 1T4MA 3BHJA 5KKAA 2I2DA 5CCDA 4HVAA 1EJ0A 1WXHA 2YQ4A 4XWAA 5K3FB 4BJHB 1EUYA 4FGZA 1T2EA 4WVFA 5DSXA 5LQAA 4G84A 1NQTA 2VQFB 4MUKA 4WRRA 4E6EA 1C8VB 3A1VA 4JLSA 1A27A 3EYAA 1KE1A 3DYIA 4BLQA 4B3JA 1DG9A 3S8YA 2LWIA 3TF5A 1IB0A 1O0SA 2ID9A 4XGNA 3M4JA 1IIRA 1ZNQO 1GZ3A 2FG5A 1YRWA 1XTZA 3BGVA 4KQ1A 1UFKA 3ZWKA 4U7GA 1HDZA 5D01A 1VL8A 2PY6A 2OB2A 2P9JA 2MHCA 2RGDA 2HC9A 3L6CA 1HDOA 3W5DA 3USES 2AZMA 3NHSA 2FX5A 1PZHA 2OV4A 4NU0A 1G8FA 1R9GA 4B2LA 2I6XA 3GC6A 2GCNA 2B34A 2R8ZA 5KYGA 4GPAA 4NJEB 2BMVA 1P6QA 2PGDA 3CEMA 3FGOA 4IRMA 1MU0A 3L8YA 4JT4A 1FC0A 4YT4A 4JFAA 5EQDA 4W9MC 3ZIAA 1GFWA 2NZJA 1XJ0A 4C0LA 1PJ2A 2ZJ6A 3HG7A 4ALJA 3T3EA 3V8NA 1DE0A 4CTOA 3GGSA 1XTUA 2UYGA 3L04A 2AXNA 2HPHA 2O7VA 4QIHA 5AKZA 1ZXXA 2EBHX 1U3DA 3C0KA 2WJ4A 1DO8A 3NDJA 5EY5B 1QRSA 2XVYA 2Y76A 3PHIA 3GH1A 4G65A 4RY0A 3IRUA 3MCTA 1AZSC 2VYND 2FJUA 2ORIA 3OE7A 4XQGA 1Z7EA 2QSUA 3EZXA 2ZIEA 2G9VA 5DULA 1TEXA 1EMDA 4JJKA 2CXRA 1QGED 4RC9A 4YJ3B 2FSGA 1ZDMA 2F6RA 2I2CA 4PRKA 4DMKA 3HXTA 3D6TB 2WU3A 5K4HA 1FXWF 3JAMA 4KR3A 1NMZA 1W48A 3CSSA 5KYKA 3Q15C 3IHLA 2KM1A 2YJZA 1DNPA 1Z88A 4GM1A 5B1DA 1NUQA 3DV0B 4TWBA 4Y6OA 4BO2A 2OBNA 4YMIA 3DDCA 5HZGA 3PXXA 5DDIP 1AKRA 4BNFA 3DF7A 3QU5A 3C8ZA 3VKWA 5AHOA 3G23A 4Z8YA 2PUHA 1IBCA 3SK0A 1SC3A 4LQLA 5JCXA 3L8FA 3TTSA 1XCJA 3CKLA 1VHDA 1ZVJA 4JHXA 4YLEA 5I9BA 2O07A 3BWYA 3DBIA 3DL2A 4BO5A 3N6RA 2XUGA 1Y6QA 1MPXA 3VRHA 2VDWB 5K3SA 4LECA 2XT6A 3NOVA 1PSWA 3S8MA 1QF7A 2O2JA 4LGCA 1F06A 4Q3NA 2AWOA 3W9YA 1MIOA 3VYTB 2R65A 4FE7A 1JQAA 4FWIB 2YTZA 2VXYA 1Z82A 3B7GA 1RJDA 5KNBD 3WB1A 1M7BA 2JJYA 3VVMA 2B6HA 1U0EA 3GZJA 3HYCA 1FSSA 2WSSD 5GONB 1IEXA 1G20B 2Q2OA 1SA0B 3HCBA 3WNQA 5IDQA 3C5WP 4FFBA 1H8HA 2NVBA 3AP1A 3K2IA 2OXTA 1JLKA 2EQBA 2XUFA 3RSZA 3PNLA 1EVLA 2AFVA 1GAJA 2C5SA 2CFIA 3W5SA 4FLEA 5LLDA 4CT0A 2XCTB 1FRFS 1O3YA 3SIXA 4PO1A 5I47A 1E1CB 4HNUA 1BOOA 3I9JA 4IHJA 2B1IA 4RVUA 1MENA 1TA9A 3KO8A 1KQNA 1N1GA 3EARA 3AMVA 5K51A 3RT9A 1NFRA 1TAUA 4CF5A 1BU5A 3DCYA 3ETJA 4PYJA 4D6XA 4K9NA 1SRQA 5TGDA 1RI5A 1ZQ9A 1DDIA 1AC5A 2BFMA 2UUOA 3U40A 1CCWA 1QP8A 1U2QA 3THXA 3KQWA 5JYCA 3M34A 4DIMA 1BYUA 2WW8A 4HTAA 3K0FB 4HEHA 1NRXA 2XMBA 3MGAA 2JGDB 4IGAA 4GR5A 1L5OA 1ZI6A 4ALIA 2IITA 2XXAA 2DKFA 5CFOA 2GO7A 2IDJA 4I4CA 2EQAA 2CZQA 3UAOA 4CI0B 1HLGA 3I52A 1JKIA 4JLKA 3D6HA 2C4TA 3EE6A 2IBMA 3O3CA 4MQEB 3GAFA 4O59O 4YCBA 3ZOKA 5JNWA 1OGJA 1YCGA 4OATA 1FSGA 2CVFA 4GHWA 1TO2E 4B3GA 1UDXA 4XPIB 2C96A 5E6UA 4B7XA 4TLAA 1JHMA 4UU1A 4RHFA 2YVKA 2GVDC 3A6JA 3JQ7B 4E22A 4EB6A 1I7LA 3C3BA 1RJ9A 1MEOA 1W75A 1MX9A 4DM4A 4D3YA 3K1AA 2QORA 2SKEA 1JI3A 1P7VA 2BE7A 4YFVA 3TIXB 4D9IA 4ZAXA 1IZ0A 1FRQA 2VF8A 4NQZA 4BRSA 4EY8A 4YS6A 1TC2A 1ZH0A 2VFAA 3WQQA 2O5EA 1CRPA 3KL2A 3TZEA 4ZVOA 5AK3A 5JBQA 1X39A 5DM4A 3F8WA 3ZNQA 4DV4B 2B7LA 3NDIA 3OCWA 4XJSA 1MJNA 3T5TA 3V1UA 4M46A 5EHXA 2A57A 2H00A 1QVWA 2ZZMA 4N5NA 1EA7A 1W6RA 3R9IA 3P7MA 3MTAA 4KPYA 1KFEB 3ICVA 3QOYA 1YULA 4R9RA 1FTWA 3QEKA 1V0JA 4O2AB 2IA5A 4RJ2A 1EQ2A 2Z9CA 4WX2B 5CPBA 1NBIA 4MA5A 3QE9Y 3CPJB 3DOHA 3V8VA 3T9EA 4DKXA 2QS9A 4G4SO 5L40A 2VK8A 1AUOA 1OGYA 1RHKA 1P1IA 2Q5QA 2ZCUA 2DTXA 1DQPA 5JE8A 3T4XA 4BNNA 2R6R1 4CM7A 3UMSA 2LKDA 3KZNA 1E5VA 1GPKA 1I1QB 2C5FA 2I87A 2JIRA 3DXFA 3FJYA 3JQ9A 2Q3LA 2JFUA 3GA5A 2WWVD 4BX0A 4R1NA 2X5KO 4MYTA 4OH1A 4TQ9A 4LDQA 2ZJFA 1PS0A 3LPDA 1W29A 3HGTA 5LOVF 4NJMA 3FVRA 2F1JA 5DYIA 5AM4A 2R1TA 5JSQA 3T3OA 2OUIA 1PVDA 1MO5A 2ORED 2W0MA 1GA1A 2POQX 2PS3A 3EZLA 1YKGA 3OIYA 3QUQA 4OLHA 3TW8B 3W9UA 4DR4B 3KB1A 1HT2E 3HA5A 3WGUA 5BNWA 5I9IA 3AEUB 4N7BA 5C34B 4MW0A 3OQHA 4X91A 2GSWA 3NEJA 2FRDC 4IR7A 2VDKB 1Z2DA 2VXOA 2CFTA 1E7SA 4Q4JA 2CW5A 4IJVA 4BPRA 2VHUA 4IDEA 2D4HA 4K0KB 1WPGA 3OX1A 4PG5A 4Z9YA 1QE5A 1LVHA 3BAFA 3TPFA 2H2FA 3WB0A 1T29A 1TPZA 2GLXA 3B70A 1CFJA 4Q4AA 4MV4A 4M22A 1QIKA 4D57A 2WHEA 1OC2A 5AJHA 4D9MA 4ZT6A 3I23A 2IHBA 1NV8A 4FINA 5JZSA 5G0SA 3CW8X 3TAHA 5CTJA 5AW1A 4KPUB 2I2FA 1XU9A 1VSBA 2FW7A 3TZLA 1F9AA 2ZGVA 2HK7A 1LLUA 2FZLA 4RVHA 2W2LA 2WIDA 4G6ZA 1YA6A 1FPQA 1G9TA 2A3RA 3D3WA 4MKHA 2DFTA 4JEMA 3NDPA 3QKSB 2CLOB 3MOGA 5EIWA 4TVKA 3H4MA 2XMPA 2KMLA 3KZVA 4LOIA 4CFYA 2ZRCA 4U2GA 1HZZC 3O84A 3AK4A 4JI0B 5E4YA 1CUIA 5FQNA 3DE6X 2Q50A 3PNSA 2AYZA 1NYLA 4TV8B 1VGVA 2Y1CA 1FP7A 4C4RA 1YZYA 1KY3A 3CUWA 3W4JA 1JFVA 3I0MA 3DZBA 4NMLA 1T6NA 2ZWVA 4OH7A 1RWWA 4UHEA 4UZFA 3GUVA 3SZGA 3ZZNA 4FFDA 5ELXA 3LSYA 2YRFA 4RPHA 4MOWA 1NM5C 4AW9A 3EAFA 5J43A 4MGEA 3QLTA 1KI7A 2D00A 3I5XA 4B3MB 4X63A 3OSUA 2PT6A 2XGGA 2AH5A 2PA3A 3LXXA 4I5IA 2YJGA 1AKQA 4MWCA 3UHJA 2A9PA 2ALJA 2BEWB 2ZSAA 3L1JA 1FSFA 4K1LA 2ZUBA 4PICA 3C8MA 3OJOA 2ZU6A 3ZDXB 4M8LA 5KWEA 4B6GA 4CIWA 2RGCA 221PA 3LKVA 4OQ4A 2MYUA 3JD1A 3THYB 5KEIA 4K81B 4QELA 2EW2A 4N3NA 1JU3A 2WA1A 5A3SA 1FLDA 4EA9A 3W34A 2AG0A 5GINE 3BCHA 4J2OA 1ZI9A 1C9EA 1TVKA 1JR6A 3OT1A 1Q7RA 3N70A 1J8FA 4RWZA 1DMSA 4GPBA 2Z2JA 5A06A 1N5JA 1KXJA 4H16A 2BISA 2R1VA 3E3OA 1W9HA 4UAJA 3CB2A 1A95A 3RT7A 2C7PA 2IIBA 1OXUA 1U3GA 2B35A 3WRVA 1R66A 2PUJA 3ZOZA 4EUFA 1QDUA 4ZDIA 4ZCSA 2GN9A 2WT8A 3UOGA 3ZQKA 4BB9A 4LNUA 2YW2A 3SQOA 1U7ZA 3IVAA 2IZ1A 3SG0A 1R50A 1Y80A 2YASA 3ZHBA 4BNTA 4N7MA 3M3DA 4IIHA 4M2LA 4OBBA 1U8TA 1FYXA 1GYRA 5AIAA 3CE6A 4K7JA 3ZUGA 2JZOA 2I34A 2B7BA 3UA3A 2Y68A 4FSHA 4LMPA 2C2GA 4PTYA 2ZT5A 3L4EA 3HCDA 1JSXA 4WESB 3RAFC 2OORC 2P7IA 2EYUA 1FB5A 1TM3E 1V1RB 4PCVA 3EGVA 3KFVA 3D2LA 3FWYA 4OHMA 4CU5A 4K6CA 2LPMA 2Z5LA 4UZEA 3VBCA 3SFTA 2NTYC 2RC5A 3BICA 4AG5A 3VTAA 1UBTS 3GD7A 3H84A 4I5DA 4QULA 1YAJA 3MLAA 3AVWA 3NTLA 4K26A 3W79A 4QVGA 1MVNA 1KE2A 1PBTA 1VYVA 2DHRA 1KF0A 4Y9UA 3KQPA 2Z2XA 4NFHA 1Z47A 4B7ZA 1Y89A 1ZMTA 3QLVA 4KGZA 2ZANA 1C7JA 3WXMA 4X1IA 1CZUA 1EFDN 1MOZA 2IFTA 1K7FB 3O2SB 2ICAA 4F46A 3GBPA 1GXSB 2OV1A 1ESCA 4TVBA 4KO2S 5IKOA 4IUCS 1EUCA 3RG8A 2FY8A 1CHNA 2J3QA 1PQPA 3IUJA 4LRUA 2ZUFA 4X97A 3TSYA 3OQOA 5BSWA 1WXIA 1A9XA 1JDSA 3QMVA 3AOEA 4X7RA 2CXSA 3LT2A 1AUVA 1OE0A 3PE4A 3EIFA 4JI6B 5E3IA 4FGUA 2VDRB 3EVEA 2A9FA 3O8BA 3WJ7A 4EI9A 1C7FA 3RU7A 1E2EA 3AETB 2IZZA 3VR5A 2QN9A 2IZ5A 3UH1A 4FE3A 2LCIA 1N8NA 4KC0A 1IJFA 2VH5R 4NAUA 2N42A 4P35A 4HUQB 4MTCA 4CLRB 4GP9A 2RJOA 2LDXA 2QEQA 3WIUA 3HUFA 2O8CA 1XMIA 3BE5A 3OE5A 3VAYA 2J9ZB 4KH0A 1RRKA 1RQLA 4U3JA 3T9DA 4N0PA 3W8FA 1KRHA 2J3KA 4Z3KA 4BO0A 2G70A 5CLFA 13PKA 1JBKA 1RP1A 2YY7A 3EZ9A 1HTBA 1H2XA 2PZKA 3K5WA 4YB8A 3VTZA 4BUJA 1Y6FA 1KY2A 2P9EA 3KAPA 2OXFA 2RHCA 4YJ2B 1PGJA 4TXHA 4EEZA 2ZCVA 4K88A 4EPXA 1YQUA 3L0ZA 2XITA 3U3OA 3WTBA 1SU4A 2R00C 4I4TA 4Q34A 1SD2A 7AT1A 1NJ8A 5J5AA 1Y8ZA 3HSYA 5KSYA 3A1DA 2X0DA 1M3SA 3BXFA 3I83A 4S1WA 1MTZA 4NF2A 3ZVMA 5BMVA 1NUPA 2REOA 3PC2A 5GPBA 4HUQA 4CLRA 2R2GA 4GBED 2YZGA 5FTLA 1CNEA 3W3AA 1S2MA 1I9CA 2R6GA 3IMCA 5JDIC 3I6QA 3DP9A 4ZK2A 1TUEA 3DC7A 3NT2A 2AOXA 2Y1OA 2ZJ4A 3IP6A 3L49A 4KB5A 3DPIA 3PQCA 2REQB 5LKRA 2G40A 2L42A 2CMDA 4GX2A 4TMWA 1KMIY 1XZFA 2BM0A 1YONA 1IN7A 2G9UA 1LPOA 4RKYA 4WACA 2VK1A 1V43A 5CTAA 2ZPTX 4A2PA 2FFAA 3DUWA 4TTAA 4MRMB 2CE7A 3CNQS 4R8SA 3RRJA 2PRSA 2A1TS 4AWAA 5F3RA 1JEQA 3CLRD 4JH0A 4QG7A 2PL9A 3C3EA 3V5NA 2GK4A 1SJ9A 2RHHA 2AOTB 4PV7A 5F2EA 1W35A 4L1KA 3E35A 4IKOA 4ARSA 5JCOC 1L0BA 1W5SA 2CKMA 1XRQA 2QYTA 2C9OA 3GAZA 3H05A 4FS8A 1PW5A 5TMDA 2GNAA 3BJMA 3SSOA 5KC9A 4KVAA 2H63A 2QG6A 2XA2A 4WH0A 5SICE 1M5TA 3AR2A 1FTGA 3UGKA 5F52A 1OWMA 2EX4A 3LO5A 1RFGE 1CY7A 1QGAA 1ODKA 3K9GA 1TMGE 4YP0A 4WN9B 4B46A 1VLQA 4DCMA 4UOZA 3LUAA 3AKZA 4RJLA 5CA0B 2PA0A 2XB4A 2CZGA 5F1OA 2J41A 5GTDA 1C2YA 1O9BA 4DW8A 4EW1A 4ZGWA 5KJFA 4ZTUB 1PO7A 2A0YA 1LC0A 3KOWA 4FFRA 5HKLA 3VUEA 4HB2A 1YJXA 2HYIC 2IYQA 3LRPA 4MVJI 1B8PA 3X2FA 1KMNA 2PYZA 4UREA 4EWLA 2RGAA 4LTMA 1SIBE 2GKSA 2UVQA 3DEYX 1G63A 1QM5A 4GD3Q 1ZOSA