1WMAA

Crystal structure of human cbr1 in complex with hydroxy-pp
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
275
structure length
275
Chain Sequence
SGIHVALVTGGNKGIGLAIVRDLCRLFSGDVVLTARDVTRGQAAVQQLQAEGLSPRFHQLDIDDLQSIRALRDFLRKEYGGLDVLVNNAGIAFKVADPTPFHIQAEVTMKTNFFGTRDVCTELLPLIKPQGRVVNVSSIMSVRALKSCSPELQQKFRSETITEEELVGLMNKFVEDTKKGVHQKEGWPSSAYGVTKIGVTVLSRIHARKLSEQRKGDKILLNACCPGWVRTDMAGPKATKSPEEGAETPVYLALLPPDAEGPHGQFVSEKRVEQW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title An unbiased cell morphology-based screen for new, biologically active small molecules
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords Carbonyl reductase [NADPH] 1
total genus 106
structure length 275
sequence length 275
ec nomenclature ec 1.1.1.184: Carbonyl reductase (NADPH).
pdb deposition date 2004-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1wmaA00
2AHRA 4NFHA 1O9BA 4H7PA 1X0VA 9LDBA 3M2TA 2Z5LA 3Q6IA 2WTBA 1I36A 1DHTA 3QVXA 4IIVA 4Z0TA 1XWFA 2GGSA 3DEYX 4KQXA 5AOVA 1UP4A 3DTTA 3LC7O 4XX0A 4CMEA 3KYDB 4PIVA 4L0QA 5ITWA 2JJYA 2UV8A 3FHLA 2E82A 1A7AA 1DBVO 3GVHA 4CQLA 4XR9A 2J5RA 3ASUA 4LVUA 3DO5A 4MP6A 4B4VA 2O3UA 1I33A 1OC4A 1GDHA 4P38A 4OXYA 1P1KA 1BRMA 1PR9A 5TLSA 1GR0A 3GMSA 2NU9A 1XU9A 3JQDA 3KRTA 3UICA 5F21A 3WGIA 1GY8A 5JC8A 3QWFA 5JS6A 1M76A 4DIFA 3RROA 4MJLA 4XIYA 2Q45A 3PJDA 5TC4A 5KVVA 1ARZA 1LSJA 2R00A 3E1KA 3PHIA 4UVGA 4XDZA 5ES3A 2J3KA 3AUSA 1LLQA 4UUOA 1RM4A 4XQGA 3OIGA 2XOXA 4L4RA 3HQ4O 3PQFA 3WJ7A 3PK0A 2GASA 4BKQA 5DT9A 3TNLA 3KV3O 1MC5A 5L51A 3PFFA 2Y66A 3QVTA 3IQDB 2CD9A 5DNAA 1PZEA 4IZIA 3FI9A 3GHHA 5TS3A 2C59A 4W7IA 4CL8A 2JFHA 5EPOA 4PZCA 1J49A 4EYEA 3K5PA 3MWDB 4M55A 3BYZA 3RJ5A 1IY8A 1U7TA 4MKXA 1DRVA 1E3IA 2B37A 2JAHA 3TWOA 3GHYA 4HV4A 2EGGA 1MFPA 1H6DA 2ZJ1A 1R4NB 4XB1A 1NQOA 2E6UX 2VNSA 4L8VA 4Z0HO 2GCGA 3QLJA 4MVJM 3MJVA 1WDMA 4C4OA 1I2CA 3E6AA 2QX7A 1PL8A 5BSGA 1L7DA 1B15A 1E3JA 1AGNA 2XXBA 2BH9A 1H6AA 1XCBA 2ZQZA 1GAEO 2D59A 4XYEA 3RUEA 3VZQA 2E37A 2P91A 2FOIA 4IDDA 3AW9A 5GZ6A 1YBAA 1E3LA 1NP3A 4BKOA 1CETA 3ENNA 1U2DA 3WNVA 2B36A 2UAGA 4HKTA 5B1YA 2O3QA 5JAIA 4D0SA 3HB4X 3BMNA 4CMIB 4XYGA 1EUCA 1TEHA 2FR1A 3K2BA 3L0DA 1IZ9A 4FN4A 1A5ZA 4BVAA 3SJUA 1UDCA 2OO5A 1BHSA 5T6BA 1W0CA 2LDXA 1UH5A 1PIWA 3CMMA 1L7EA 5FFFA 5KVSA 4AJKA 4UEJA 4I5GA 3H9UA 3WLFA 5I7SA 4YR9A 4YJHB 3U4CA 1U9JA 1PEDA 3C1OA 2HMWA 4GLOA 4CQLB 4FW8A 2D5CA 3NDRA 3OJ0A 4FBGA 2OP1A 2NNLD 3FWZA 4ND4A 4I5DA 1LDGA 4DQUA 1I3LA 3R6DA 3TOZA 2X5OA 1I8TA 1M67A 2VZ8A 1SB9A 1R16A 1ONOA 3DZKA 1DC6A 2VYVD 2VHXA 3V8BA 1R0SA 3A1NA 2FHSA 1FMCA 3AU8A 3U4IA 5I7EA 5JNLA 3TL2A 2W2LA 3OEYA 4YRBA 4Q9NA 2X9NA 3MZ0A 3AUAA 4BHTA 3DL2A 3FRJA 3F1LA 4KP7A 3WTCA 4CMJA 4YXFA 4PLPA 4B79A 3HFGA 3F5SA 4MKRA 5MDHA 4ZJUA 1A72A 3PWKA 5I8ZA 3PWSA 3KEOA 1PS9A 3D3WB 1PZHA 4I9UA 1GZ4A 4YA6A 1X0XA 3RU9A 4CLRB 3AFNA 2EW8A 3HDHA 3WDSA 1LA2A 4BNWA 4J1NA 2PZKA 4K26A 4BIIA 4YPOA 1WNTA 3C8MA 1NFQA 3ZWXA 2V6MA 4BNFA 2HK9A 2X22A 4NU5A 1LBEA 1HDRA 2ZB4A 4CM8B 4CLEA 5A05A 4IJVA 3DBRB 2CDAA 3PHJA 2HK8A 4AJIA 5GY7A 1U2GA 2C0CA 1K6XA 3ZV3A 3HNPA 3RKRA 2WD8A 2BFOA 4B4UA 1TXGA 1HDXA 3GGGA 4OHUA 4P4NA 2JAPA 5EIOA 2BGKA 4S3MA 5JCJD 3D4PA 4FJ0A 5AYVA 3C24A 2UUOA 3ST7A 3AU9A 1HETA 3M6IA 4LRSB 2GZ1A 1ZK3A 3ZNOA 3OJLA 2DTEA 1P33A 4IY1A 3LSYA 5TX7A 3QRWA 3ZU2A 1ZMTA 4FFRA 4E5KA 1N8KA 1E1LA 2FSVA 1BTOA 4LCJA 5A4DA 3PZBA 4PLZA 4DYVA 1B3BA 1CIVA 3NDJA 4M8SA 4W4TA 1NFFA 2GSDA 3DHEA 1EFLA 4AJPA 5TRTA 1WDLA 4HWKA 4J7UA 4HXYA 4YJHA 5JFOA 1T4DA 2D0IA 4GLLA 4J0FA 3HJAA 3E9NA 2EJVA 3KO8A 2Q46A 3LLVA 1NXQA 3PXXA 3DZGA 5DCUA 2Q49A 3IJPA 3BIOA 2Q1WA 2W90A 2PWZA 4A0SA 3ZWWA 4B3IA 1YL6A 5CPBA 2HU2A 2Z95A 2JFFA 4WGGA 2EIHA 3HB5X 2Y1CA 4TZKA 2Y1GA 2TMDA 4L73A 2BI7A 1QV7A 4NBVA 3QA9A 1ZJZA 1D1SA 4FJ2A 1SB8A 2CF6A 4WNCA 4CUZA 3F6YA 3QJ5A 1T25A 4K6CA 4EDFA 4I1IA 4MVJI 4D7AA 4RV9A 3P7MA 3ZWBA 4N5MA 2PKRA 1ZEJA 1Y7TA 1P45A 1LDBA 1C1XB 1DO8A 3I4CA 3TRIA 5THKA 5T5QA 4A2CA 4YT8A 1YB4A 3ZWYA 1K6JA 4MOWA 4CV0A 3I52A 4KDEA 1YQDA 4OOEA 1XG5A 4IDEA 4NK5A 5TJ9A 2Z1MA 4TWRA 2ET6A 3H4VA 4CQMB 5HA5A 4FB5A 1KS9A 1ISFA 3BHJA 1HF3A 4J90A 1U3WA 1DAOA 3LT0A 2IXAA 3L9XA 4FDAA 3R0IA 3AI2A 4R54A 1SOWA 2O3RA 3JQ8B 4WLOA 4D44A 2GRAA 1UXHA 2OOSA 1QMGA 2CUKA 1ENYA 3JV7A 5KJ1A 4CM9D 4CMGA 1ZSYA 4R9SA 3ZZNA 3MJ4A 4TSKA 2VNAA 3E82A 3JQEA 3K96A 2OFPA 2QRLA 3UKOA 1F06A 2CY0A 1E1KA 3GOHA 4IQ0A 4PLYA 3B1KA 3GRKA 2AXQA 3D5QA 2WYWA 3EZYA 4DPLA 2Q99A 4ALIA 4IDCA 1P1HA 4GWGA 4R5HA 1UXGA 2V6FA 1U28A 3W4JA 1IE3A 1Q0HA 2OUIA 2EP7A 2VYNA 1YJQA 4IM7A 5JO9A 3RU7A 4PLCA 3W6UA 3U4HA 5KTKA 4RF3A 2O2SA 1WP4A 3FSRA 4WASA 2JFGA 5ILGA 4WLFA 4PG6A 3LK7A 3WG9A 1J4AA 4ESOA 1Y8RB 4OIMA 4XQEA 3NGXA 3UGKA 1XR3A 2A9FA 4GGOA 1H5QA 1XLTA 3LVFO 4B3HA 4BQRA 1U4SA 1B0AA 3QWAA 3H5RA 3G1TA 4F3YA 2D3TA 1ZW1A 2HCTA 2PGDA 4Y6PA 3ZGYA 1ZJYA 4D41A 1HTBA 3QWIA 1XKQA 5CDTA 4WNIA 2FWMX 3RQSA 1LQTA 1EK6A 1G6KA 1IULA 4JNKA 3N58A 2IYOA 4UEKA 3VAZA 1H2HA 2PK3A 3EAGA 4MVJE 5KOIA 1SEPA 2P5UA 4NK4A 2CVZA 1FJHA 1I30A 3PLNA 4YJFA 3ZU3A 4RLHA 3P5SA 2VT3A 4J49A 4IDGA 4GVLA 1OOEA 1PQUA 3EZLA 4B8ZA 4ZICA 3SJ7A 3G79A 4WECA 1H93A 3AUTA 2P9GA 3ZWMA 3ABIA 4J6FA 4BKUA 3IIEA 2QYSA 4J3FA 1P9LA 1NVGA 1KVQA 4MIOA 4Q39A 1C0KA 4HNGA 5CDSA 3BMQB 3SXPA 3H3FA 4FR5A 3TZHA 4YJDA 3D64A 4G5HA 4MVJP 4GL4A 4MPDA 4S1VA 2V6GA 2AG5A 2GR9A 2QYTA 3HUDA 3NRCA 4B8WA 1WW8A 3PGXA 5IZCA 2VZ0A 5IG2A 1VSUA 3O8QB 2DPHA 3IP3A 2NVUA 3WGQA 4MVJG 3PYMA 1Y9AA 4FC6A 1LNQA 1N9GA 4R3WA 4A26A 3DTYA 4QQRA 1R4MB 5LC1A 1SPXA 3DFUA 4DUPA 3BAZA 3LDHA 1I32A 2OZPA 2YHIA 3W8DA 3ZHXA 3ADPA 2BGMA 2A35A 3GVXA 2J5KA 3OJFA 4HP8A 4JQCA 3VPSA 3ZN2A 4J4HA 4Q3NA 1UXKA 3V1YA 3PP8A 1NTOA 3RC1A 3RD5A 4DIOA 3KSUA 2X0RA 1NM5A 3OIDA 4ZVVA 4U0JA 4JBGA 3GH3A 3PYXA 3E03A 2CDCA 2HMUA 1ONPA 1AE1A 3DXFA 3TQHA 1HZZA 5HRUA 4J7CA 1PJTA 5G2OA 4K1LA 4QFDA 2JCYA 3MCVA 4MVJD 5A02A 5CDUA 5BR7A 3FBGA 2W2KB 2CDBA 4LN1A 2ZYDA 3P2OA 4J43A 4XQCA 5T67A 1YQXA 1O8CA 4HBGA 3PYLA 4EITA 1ENZA 2C07A 3I6IA 4FGWA 1VL0A 5ICMA 3DOCA 5K0ZA 1U4OA 1B2LA 3WLEA 3H6KA 4OOFA 4Y9DA 3HN2A 2OHXA 1C1DB 4Q3EA 4BMSA 5H83A 1YBMA 3Q9UA 3ROKA 4DIBA 1EEHA 1HDZA 1P3DA 1EFKA 3BMOA 3M2PA 3QSGA 3QY9A 2JCXA 4P4GA 5HWSA 3H3JA 3DONA 3W4KA 4D3FA 3JQFA 3K6JA 2PTGA 2VOEA 1CYDA 2EXXA 1H9AA 3NTOA 1LDNA 1HDOA 4HY3A 3JCZA 3QE3A 4YT2A 2IEBA 1N7GA 4E0BA 5JCXA 2ZKLA 1DFGA 1U1IA 5DCYA 1NR7A 3COSA 1MC4A 2O7SA 2I99A 1BGVA 3WIDA 3C7CB 3WQQA 4DA9A 1WZIA 1ZXBA 2EP5A 2GNAA 3UHAA 2C5EA 3GFGA 3IP1A 5IDYA 3H9QA 1ZUD1 1ZH8A 2VCYA 4PLWA 5THQA 3RWBA 4BNLA 5G0UA 5T64A 3BMQA 3JD1A 1HDGO 1DLIA 2UDPA 1YQGA 3IKVA 4DBZA 3LU1A 4WLUA 3CEAA 1FK8A 1KC1A 3DR3A 3WYEA 2Y1OA 2WEKA 1KEUA 1GUFA 2I3GA 2SCUA 4TROA 3EGOA 3JD2A 3JQ6A 4HUJA 4R1SA 1W73A 2IODA 3ZHBA 3GUYA 1LX6A 3OECA 3RUFA 4AJNA 3C85A 1KIFA 1O0SA 4QXMA 1ISJA 3WGHA 3HN7A 2OXIA 1KY5A 1B3RA 2D1YA 4WKGA 5CDYA 2YHIB 1K6IA 4EJ6A 2CVOA 2PLAA 1HDCA 2V65A 5MGBA 4FFPA 1T24A 5AXCA 1Y81A 3WYCA 1ZK2A 1GQ2A 1RM3A 3NAQA 4J4BA 4IDFA 1BVUA 2D8AA 4E33A 3S55A 4CV2A 1PGOA 5JDCA 5C5IA 3T7EA 1UAYA 3UCXA 4G81A 4MVJF 4ND5A 4IINA 2DC1A 1JKFA 4PZEA 4YWJA 3OJEA 3RUAA 1U8XX 1KY4A 4CUKA 2B35A 3L6DA 1IZ0A 3GVPA 4DC0A 5L45A 5BSFA 1K89A 1V8BA 1PQWA 1YOVA 3PDUA 3TZCA 4Z3KA 4I9HA 3NTRA 3SEFA 4ALJA 4CM4A 1UP6A 1OZAA 3CPSA 4CM8A 5AXBA 4PVDA 2C7VA 5LCXA 4BO5A 1DFIA 5AQ1A 5I8WA 1JWBB 1QORA 1C1DA 3GAFA 4YAIA 5HS6A 2R6JA 1XEAA 2JKVA 3AOEA 2Q4BA 3LT1A 4UVHA 3OQ6A 2ZCUA 4CMHA 2VHWA 4KUEA 2DU8A 3OHSX 3S2IA 3V2UA 1I3NA 3GK3A 3B1FA 3RC7A 4DTIA 2EKLA 3UXYA 2AEMA 5GZ1A 3JQGA 4R1NA 5I9NA 3RC9A 5EN4A 2PH3A 4J7XA 1DJNA 4QSMA 3VZRA 4D45A 1KC3A 1YBVA 5IN4A 1YVEI 2I3AA 1YWGO 2YQ4A 4FC7A 4XYMA 3UVEA 2RH8A 2EEZA 3NKLA 2GDZA 1AUPA 4U7WA 3UCEA 1PS0A 3WWYA 4J16A 2WE8A 5BQFA 4OGWA 3PDJA 3RUCA 5B4TA 4EW6A 4A03A 4QEDA 2X9VA 3ZU5A 2EG9A 5A3VA 3KYCA 2Q1SA 1ONNA 4HFRA 3ZNPA 1FXSA 1NVMB 3LF2A 1BG6A 1X7DA 1G0NA 4Z9YA 5EL0A 1E3SA 3ZV4A 2BI8A 3U9LA 4AJJA 1IPFA 3VKVA 1HE2A 3F4BA 4XCVA 4XRRA 3G3EA 3DOJA 2DKNA 4G2NA 3F3SA 2QRJA 2BFAA 4DLAA 2HDHA 3A06A 1GEGA 3VH3A 4Z0PA 1NYTA 5A9TA 1P31A 3RVDA 3L9WA 3SVTA 3EDMA 1ADBA 3CSDA 1PS8A 4QX6A 3VPGA 1E77A 1SEVA 1IB6A 1WLYA 3BXXA 2POQX 2PA3A 3WBFA 3WBBA 2IDZA 4R68A 1BDBA 3PZRA 3BMCB 1JAXA 1FDTA 4O6VA 4JLWA 4ALMA 1UZLA 3HDJA 1DHRA 4UAGA 4GVXA 3I3OA 4U8GA 1RPNA 2X5KO 3K30A 3PQDA 4TVOA 3I83A 4YAGA 4FFLA 3AI1A 1LJ8A 1PGJA 3GNSA 4A5OA 4DLLA 2NTVA 3ITKA 4CM9A 3CH6A 3H8VA 1M6HA 3RFXA 2X6TA 1ENOA 1E7SA 1PX0A 2NUAA 3I9NA 4CMEC 4I5EA 1XU7A 4W7HA 3WOHA 3GA0A 4DMMA 3D4NA 5IZ4A 3EVNA 3GRPA 4CM4B 4MKZA 4FSHA 1LLUA 4NIMA 3F47A 3K9QO 1UP7A 1LRKA 4LMRA 4MO2A 4N5NA 3JYOA 3OQBA 2VRBA 3GT0A 4OKIA 4CM5A 4PFJA 4TKLA 3H9EO 4UREA 3WR5A 3DHNA 1SO8A 3JQBC 1KVSA 5TF4A 1HEUA 4PRKA 3F1KA 1LDEA 5L4LA 2I9PA 5DZSA 2E49A 4YT4A 1SBYA 1TT5A 2C7GA 1WVGA 2X58A 4NNJA 2HKIA 2DLDA 1N1EA 2NVWA 3G17A 3GAZA 5BSHA 1I3MA 1BW9B 1G1AA 1LEHA 3GFBA 4N18A 1XELA 2ZTUA 1DSSG 4R5MA 5JCJA 2PD3A 5TIIA 1OC2A 3W1VA 4JROA 2H9IA 1Y8QA 4J9VA 4JK3A 2Y1EA 4QUKA 2CVQA 1O89A 5JLAA 5C3MA 5L53A 3IOYA 1UDBA 4KQWA 3D3EA 2IRWA 3JQ7A 4RVDA 2X4GA 2NSDA 2C2XA 3AUUA 3RASA 1HSZA 3MJEA 2G17A 3KYDA 5CDGA 1GYQA 3UUWA 2A4KA 2XF8A 2DBVO 4DPKA 4JP3A 3N7UA 1D7OA 2VUSA 2J5QA 1Z82A 1F0YA 2GD1O 3UAGA 3DBLB 4QT0A 3GG9A 3B70A 2JHGA 1BXGB 4PG4A 3I1JA 4WPGA 3WICA 3JQBA 4W6ZA 3FD8A 4PVCA 3PGJA 1SAYA 4N54A 4RORA 4RPLA 3E9MA 1ZSVA 4E21A 1AHIA 2HJRA 2YDXA 2Y68A 4FFOA 3ZWVA 2FR8A 4OKNA 1VM6A 4F46A 4N5LA 5FWNA 4AJEA 4XIJA 1PJ3A 1NQ5A 5EESA 5HS4A 4BL5A 1SZJG 4BV9A 4NI5A 1PJ2A 3BMNB 4CMIA 1ZVMA 2FZEA 4TZTA 5JXWA 1LC3A 2EW2A 2B4TO 4E5YA 1HWYA 5JMPA 3UOGA 4FFNA 4BO6A 5T8KA 2FY8A 5L7YA 1E7WA 2A94A 3FNEA 4WLNA 4PN3A 2DBQA 1MFZA 2ZYAA 4R9RA 3TSCA 5GMOA 5A3JA 2P5YA 1N7HA 4OSOA 4WEQA 1ISIA 5CEJA 2PNFA 1J0XO 4E32A 3K2EA 2EKPA 3HFSA 3ZDFA 1X1EA 3SBOA 2AA3A 2BKAA 1GTMA 4E4YA 1GEEA 2VTEA 4BNXA 5I9LA 3WFJA 3T4XA 5EERA 4M54A 3UFXA 3VHRA 2O7QA 4QFCA 4WCFA 1A9YA 4BQPA 1JWAB 4GH5A 4QO8A 2JCVA 1HDYA 1R4MA 2NVBA 4OQZA 2W2LD 4M87A 3WTBA 1XQ1A 4KMSA 4H3VA 1NR1A 2VWPA 5U9CA 4ITUA 1GZ6A 4B7CA 1JAYA 3RI3A 3ONDA 2NADA 3JQ8A 1PJBA 1T1SA 3GNQA 2JD2A 1T2AA 4FOOA 5G4KB 3WQSB 3WWZA 3BTVA 4ZGWA 4R3NA 4URFA 3CMCO 4NJMA 3PTZA 4AJ2A 3CZMA 4PG8A 4NR0A 3IUPA 3PHHA 1Z75A 3OEWA 5KKCA 1EMDA 1VRWA 4E2XA 5LDGA 1MXFA 1WZEA 5ENVA 1TT7A 1ML3A 1X7GA 4RDHA 4J91A 2P2SA 1EQ2A 1ZK0A 3F9IA 5F5NA 1QYDA 4D46A 2DM6A 3WYBA 4CMAA 1YS4A 1EUDA 4Y98A 3KLPX 4WEOA 3O9ZA 3ICPA 2Q4EA 3INGA 1E6UA 2Y67A 3ZWOA 5CFZA 2WM3A 1EUZA 1HE5A 4FIZA 4XD2A 5TQVA 1B26A 1PJQA 2HMVA 1KVTA 2YY7A 1A27A 1O6ZA 2OMEA 2P68A 4P8RA 1YB5A 2BD0A 4KWIA 3K8ZA 1QV6A 4OO3A 1Z7BA 3UN1A 3O8QA 5FI3A 4E3ZA 3AY6A 2CFCA 3BMOB 2W8ZA 1ADFA 2PGJA 5KVQA 2XXJA 5JE8A 1RYEA 3ZHYA 2NACA 3KSZO 3EMKA 1VL6A 3M1LA 4IBOA 3QVWA 3Q3CA 3JSAA 1VE9A 4RVFA 4GX5A 1E7YA 4E5NA 3UH1A 7MDHA 2YV1A 4A7PA 1WMBA 4IPTA 1D1TA 1VKOA 3LT4A 2V7PA 5JDIA 4E30A 3PRJA 3WGTA 3KTDA 4LK3A 3X2EA 3KZVA 1C3VA 2WYUA 1K0UA 4OM8A 1CERA 4CLDA 1EBUA 1IUKA 1WPQA 5A04A 1GYRA 4CV1A 4BNJA 3E8XA 3MJSA 1YO6A 1MXHA 3I23A 5DOVA 5K6AA 1JKIA 3GR6A 3A9WA 3ADOA 1DRUA 1UDAA 3H9JA 4MVJA 1FDUA 3K92A 5B37A 5L95A 3BTSA 4L76A 2NM0A 5JBIA 1W4ZA 4AVYA 3I5MA 3NT4A 3ONEA 1MP0A 1Y6JA 2I76A 4DL9A 1F14A 1OFGA 1GCUA 2VZ9A 4IXWA 1GPJA 3VPFA 2RCYA 3WGYA 4U0KA 4AJHA 3F4LA 4IIUA 4E2WA 3VDRA 4BS9A 4R69A 2BRUA 4XB2A 3VDQA 1DEHA 1NHGA 4CV3A 1U3TA 3DBVO 4ALKA 1J6UA 4TRJA 4YJGB 4TQGA 1UZNA 3DFZA 3TOXA 1EVYA 4RZIA 4AJLA 1T2CA 4L75A 5FYDA 3VTFA 5IXYA 3ETEA 2CNBA 4B7XA 4A73A 2O3SA 1PJSA 5A9RA 4BMVA 2VRCA 3OFSA 3NT5A 1DAPA 1HSOA 1EVJA 4GI2A 1YXMA 1OAAA 5KIAA 3ZV6A 2OORA 4XKJA 4UUNA 1Z45A 2QIOA 5A5EA 4ZQHA 5ICSA 2FN7A 4GX1A 1F8GA 2ZQYA 2B69A 4OH1A 4RPGA 3OM9A 3TL3A 1YL7A 1PZGA 3FF4A 1DB3A 2IZ1A 2D2IA 2VHYA 3IAHA 3G0OA 4GQAA 3UW3A 4DPMA 6LDHA 2X5JO 1YGYA 1LTHR 3LF1A 5DBGA 5FEUA 4CR8A 4I5FA 5TT1A 2H6EA 1DPGA 1T2FA 4FJ1A 3NGLA 5TJHA 4Y67A 1M75A 1N1GA 2YZ7A 4JN6B 4YBZA 4IS3A 3DMTA 2FSSA 3FR8A 3JYNA 4BO0A 3P19A 1W8DA 2VN8A 5JYEA 2HK7A 1GCOA 2NU7A 4NG5A 2Y1FA 1P74A 2PR2A 5K6AC 3RSHA 1V35A 1C0IA 3M1AA 1MV8A 3AM4A 5A9SB 3PHGA 5L7WA 3U4DA 4CJXA 3ZWNA 1YE3A 3D1LA 1E1NA 1KYQA 4ND3A 3OJOA 3W8FA 4BGUA 4ILKA 4E13A 4UVIA 3DC2A 4XGNA 2UVDA 2DTXA 3VH4A 2DAPA 3MTGA 4A27A 5EMHA 4F6LA 5JO0A 3DAFA 3U5TA 1PL7A 1JN0A 3DZIA 1UXJA 2PZJA 1XIVA 4GKBA 3A28A 3LZ6A 4RDIA 5TT0A 3SX2A 3W4IA 3E18A 4WOKA 1Z7EA 2JHFA 3MOGA 4MIEA 5EQFA 1B16A 2YHUA 3ETGA 4RCVA 1ADCA 1E1MA 1AXGA 4R16A 2NV6A 2NTNA 4TRNA 5CG1A 5IXSA 3ZWAA 5ILOA 4E12A 4LSMA 3SLGA 5ITVA 1NPTO 1UZMA 1JA9A 1YDEA 1CF2O 4RVSA 1KVUA 1GU7A 3IJRA 3DQPA 5L7TA 4CM7A 4Y8VA 3ZHZA 4E2YA 1I2BA 1YRLA 3WJAA 3GNTA 3ROMA 3KVOA 2QHXA 5L4NA 4LISA 3O4RA 2IZZA 4BKPA 1JU9A 3CIFA 4DBVO 1ID1A 4NBUA 5G0VA 2FPGA 2WSBA 1PGQA 4I8XA 4W99A 2Q3EA 3GG2A 2B0JA 4PZDA 3EHEA 3I9KA 1KVRA 4IS2A 1I2ZA 4BB6A 3OICA 5A5FA 4BNNA 3ASVA 4RL6A 4YJFB 2OBNA 4MIYA 3VH1A 4HNHA 5JPIA 1PGPA 1JTVA 2NU6A 3MEQA 5F1PA 1F8FA 3ZU4A 3RBXA 1A71A 2IYPA 4TRMA 5IN5A 4WUVA 1EVZA 3GGPA 4BNTA 3WIEA 3ITDA 1CJCA 1DIBA 1GZ3A 1SOVA 3H2ZA 4BO9A 4BNKA 4YVFA 1B14A 1LDYA 3MOIA 1X7HA 3OA0A 2UYYA 5B12A 5IZCC 5KJ6A 3H7AA 3H5NA 1Q0QA 3LYLA 4L4XA 4DWVA 3GDOA 4WLEA 2EERA 2PD4A 4TRRA 1TI7A 4I08A 1VJTA 1QKIA 4ROSA 3G1UA 3C1TA 3WSVA 5KJFA 4NU6A 1V3TA 2J3HA 3GQVA 3B20A 1NPDA 3DMTC 1PJLA 1QYCA 4ZHSA 4FFMA 1V0JA 4RPKA 2BLLA 4GKVA 1GUYA 1UAGA 2Y93A 3KYCB 1Q1NA 1IPEA 5F5LA 2DVMA 4BOYA 4HFMA 1CQJA 3ZV5A 1VKNA 4B4WA 2HSDA 3HZZA 1X15A 4ZU3A 3GPIA 2RIRA 2VRCD 4CLOB 4B7UA 4N7RA 3HDQA 1VC2A 3WQRA 4IDAA 2O4CA 4PLHA 5C7IO 3L4BC 3S1LA 3TZQA 5L40A 4ZN6A 1P0CA 1CQIA 3KUXA 3WMWA 1NAIA 1QYWA 2UUPA 2BF7A 1DLJA 2G82A 3FNFA 3AM3A 3S2EA 4BGVA 3GN1A 1WMAA 4W9NA 1HYHA 4W82A 3V1TC 3Q9NA 2I67A 4CPDA 4GMGA 2QQ5A 3DZJA 2PKQP 3SC6A 2HJSA 3H5AA 3LC2O 2E4AA 3O03A 1EE2A 3MWEB 2YDYA 2VTDA 3R3JA 4M1QA 4AJOA 1FDWA 3S2FA 4BNVA 1CEQA 1OI7A 3JD4A 3PIIA 5TSDA 4MINA 1GQQA 1DIAA 4EUFA 2X0IA 3GDGA 7ADHA 1LLDA 1E7QA 3OIFA 4XR4A 3H2SA 4YT5A 1D3AA 4BNUA 1F12A 5JAMA 2Q1TA 3GZNB 4DMLA 3K73O 4KWHA 3D4OA 2Q2VA 2J6IA 2DBZA 1K3TA 1LQUA 2NWQA 2VWQA 3OF2A 3PJEA 3FBTA 4YB8A 4RVGA 3GPDG 1JQBA 3VTZA 1DXYA 4BNYA 4PG5A 3RFVA 3WSWA 5B4UA 3K31A 5HTOA 2VYVA 1C0PA 5JDCC 4IGEA 5DDIP 3QQPA 2HQ1A 3Q2KA 1TVEA 2GN4A 2HAEA 3CKYA 3GC6A 2GPTA 4CR7A 3JTMA 3OP4A 1ZFNA 4XZ3A 4HADA 4O63O 4BNIA 3FTNA 1QLHA 4EJ0A 4O1MA 4J1SA 2YFQA 4M89A 4FCCA 5JDIC 3L6OO 1OBFO 4MDHA 4AJ1A 3DB2A 1RWBA 2Z1NA 1I24A 4J2HA 4YAEA 3GZ4A 4UEOA 1QP8A 1TLTA 4Z9XA 2D4AA 2I66A 5L9AA 4J9UE 1JW9B 3QV1A 3AJRA 4U6QA 5ENDA 4M86A 2VHZA 4ZQEA 1WWKA 1ZK4A 2TMGA 4CLHA 4BO8A 3GLQA 1DOHA 1UUFA 1R0LA 1P1JA 2Y0DA 3TFQA 1JKJA 2B4RO 3KYBA 4DRYA 1K2WA 2VUUA 2H63A 1MG5A 3E9QA 2O23A 4FQ8A 2H5LA 3AWDA 3GEDA 3HHPA 3HSKA 4IMRA 4KUHA 4YQYA 3V5NA 3NT2A 3RIHA 3D0OA 2RHRA 4AFNA 2FP4A 4GPD1 2C29D 1VJ0A 4MVJH 1ZXLA 1OMOA 4F45A 5L4SA 5CAEA 3DBHA 3JQAD 1HZJA 1HKUA 1M66A 1H6BA 3JYLA 5H81A 3HADA 6ADHA 4BO7A 2NTJA 4CLOA 3IKTA 1M2WA 1BXGA 1T4BA 5DOZA 1I5RA 3HDYA 4KZPA 3AOGA 2WMDA 3BZUA 2DFDA 4BKRA 1GV0A 4XGIA 2FR0A 3GEMA 1O94A 3DZHA 3NDIA 4JXKA 1N9GB 1YL5A 3F5QA 3L4SO 2IEDA 2Y99A 3QHAA 2HLPA 2VOJA 3QWBA 4GWKA 1P77A 4UUPA 4L9RA 1NPYA 2XPCA 4CMBA 2EV9A 2Y05A 4JBIA 1LXCA 1H6CA 3JQFC 4CM6A 3KM0A 4DGSA 2DFVA 4RZHA 5CPFA 1DC4A 3BTUA 5CHEA 1LI4A 4NBWA 4XQ9A 3L4BA 5DN9A 3NYWA 1IOLA 3S2GA 1YOVB 4J2OA 3RBZA 4GX0A 1BW9A 2F1KA 4KTTE 4BNZA 4YAJA 1S7CA 4DVJA 1XSEA 2R2GA 3C3XA 3IC5A 2EWMA 2YQ5A 4WE3A 3GZNA 1NASA 4E5PA 1DJQA 2GUGA 3D3WA 1HT0A 1MGOA 3PJGA 1BMDA 2Q2WA 2V6BA 4R4JA 3ZW8A 3INRA 4R1UA 3KBOA 1HYEA 3FNHA 1QG6A 2HRBA 3C1AA 1CDOA 1ISGA 2Y0EA 1L1FA 1VL8A 1P0FA 4BNMA 4IQGA 1HE3A 4FD3A 2VUTA 1EQUA 4NFSA 4R41A 3JQ9A 1LSOA 3TZKA 5I7VA 4CQMD 1YDWA 4TKMA 1I01A 4EZBA 3DMYA 5AXAA 4AG3A 2ZB8A 5JAZA 3NEPX 4NPCA 2G1UA 4C7JA 2ZTMA 4IZHA 1E3EA 3G49A 4XYBA 4D3SA 1GADO 3B1JA 2IZ0A 3V2HA 3Q11A 1X14A 3P2YA 1H0KA 4KOAA 4LSWA 2B83A 4U5QA 4XWYA 5BNFA 1XYGA 4ONEA 5DULA 5DBIA 2EF1A 3I9OA 3RUHA 2FZWA 4RGBA 3OETA 1V9LA 1AHHA 4OSPA 4YQZA 3STHA 4CM3A 4RF4A 2X0NA 4FPXA 1Y9EA 4R51A 1GV1A 1D4FA 1U7HA 1PQPA 3JQ9C 3LLSA 4RQTA 5DCWA 3ON5A 2NQ8A 3ROPA 4D3DA 1P1RA 5KJCA 1J5PA 3T7CA 1DFHA 2B5VA 3F46A 3WS7A 1D8AA 2CZCA 3ZWCA 4YDRA 3C7AA 4I9NA 2WD7B 3BA1A 5JSFA 4INAA 5F1KA 4K9DA 3RFTA 1XGKA 1IYZA 1NAHA 1NQAO 2FRDA 2AQ8A 4GMFA 4P22A 5H82A 4YYZA 4X54A 1PWXA 4NFYA 1U5CA 5CEEA 1LSSA 3GVIA 3TJRA 3ONFA 2ZJ0A 5KVCA 4WCFB 3FR7A 4KDFA 3JYPA 2CF5A 3KOUA 1XA0A 4XDYA 3HG7A 3RJ9A 2VQ3A 1RYDA 3TF5A 1PTJA 1ZZEA 2AQHA 4FGSA 1JDJA 4JCOA 4ZQFA 5BNTA 1ZEMA 3VZPA 4OL9A 4OYRA 4PRLA 2DTDA 4ZRNA 2WE7A 2J3IA 1VI2A 1HE4A 3TZ6A 1QSGA 4EI2A 4BB5A 4UVEA 5TGDA 5ER6A 2JL1A 3DZBA 5DP1A 3JYQA 2ZB3A 1E92A 1VJ1A 4DLBA 5KJEA 1R4NA 1ULSA 3CE6A 2C5AA 4Y6RA 1T1RA 3AY7A 1DIHA 4RF2A 4L4SA 4FS3A 2YUTA 1ZSNA 2BHLA 4H15A 1DIRA 3FCOA 1JVBA 1YB1A 4LGVA 3OH8A 3RUDA 1GL3A 2G5CA 3Q1LA 1C0LA 2RHCA 4JGBA 2X1HA 4YJGA 2E48A 1ULUA 2PH5A 1DRWA 4JJIA 4JP2A 4XA8A 3H9GA 4XGKA 1CWUA 5DF1A 3HE3A 2O4UX 4ND2A 2P9CA 2ZTVA 1T26A 3GDFA 3L77A 4HFJA 1ZNQO 3PWZA 4JJGA 1MG0A 3I6QA 3S8MA 5KWEA 2ZTLA 2C82A 3CUKA 1EDOA 2DQ4A 4Q3AA 4H16A 2F00A 5C37A 1BVRA 2WWRA 2YW9A 5JW6A 4LVCA 5U4QA 2DUUA 3TDKA 3FTPA 1ZCJA 3IUSA 2I6TA 5ER9A 3QIVA 4BO2A 2CMDA 3WB9A 2GF2A 5BSEA 1SNYA 2X7HA 4ND1A 5CP8A 3JQ7B 3ANNA 5JY1A 3I9LA 4Z6KA 1Q0LA 1SC6A 4YTEA 1WDKA 4EEXA 1SMKA 4JJFA 4RPHA 3R3SA 4UVDA 3OA2A 1NNUA 4IGFA 4CLXA 3OQ1A 5AXDA 4EUHA 1XHLA 4P4LA 4YEDA 2O2YA 4NHEA 4B3JA 3EYWA 4Q3BA 4OAQA 3O26A 3INTA 5IAAA 3JD3A 4PG7A 2AQKA 2J8ZA 2R00C 3AI3A 4Y6SA 5T8KC 2WD7A 3PPIA 3E48A 4BNGA 3VVCA 3AFMA 4GBJA 5KNLA 1U3UA 4GX2A 5HM8A 1P1IA 1EK5A 3HWRA 1U5AA 1HLPA 3FNGA 3AM5A 1GD1O 3IDSA 4F6CA 2ZB7A 1PU2A 1TT5B 4R01A 1ZO8A 4ZRMA 3FN4A 1E3WA 4AJ4A 1N5DA 2I5PO 4J1QA 1FF9A 4J4TA 1K5HA 4M49A 4GAEA 1T2DA 9LDTA 2X23A 3WFIA 3PFWO 3V1UA 4RJTA 1SCUA 2X9GA 4HX5A 2PD6A 4R1TA 3ZNQA 3LQFA 4OXKA 1N92A 2OP0A 1O5IA 1I10A 1CRWG 5B4VA 1Z74A 3N74A 5BNIA 3IS3A 4CLRA 3ZI0A 4NDNE 3Q0EA 2X8LA 4EGFA 4J0EA 3DBRA 1DIGA 1H94A 3DZFA 2H1SA 4YACA 3FPCA 2VWGA 4UUMA 3JQAB 4IUYA 3KHUA 2X0JA 1Y8RA 5T57A 4Z3DA 3BHIA 3EY4A 4CMCA 1YONA 2J3JA 4WOJA 4ID9A 3QW2A 1ZMOA 1LRJA 2AMFA 5U1PA 2I65A 3ORFA 4NZ9A 1A9ZA 5KKAA 3WMXA 4IDBA 3GF4A 1X1TA 3QVSA 4WCDA 2HUNA 4BMNA 4XJTA 3ENKA 4DXHA 2PV7A 2PFGA 3U49A 3WGGA 3RUIA 4XRGA 2AE2A 1FDSA 1C14A 1E6EA 3I4FA 4CR6A 4CODB 1JLLA 4RVHA 4NJMB 1QXSA 1YH3A 2ZIZA 1UJMA 3D5TA 4LRTB 5AVOA 5A9SA 1HXHA 1A4UA 2Q1UA 2IXBA 2BGLA 4D0RA 3B6ZA 1QYXA 3A4VA 2BELA 2EHDA 2BFMA 3QWHA 3T4EA 4DREA 2OBYA 3UCFA 1GPDG 3TFOA 3DAGA 2ZK7A 2O50A 4K28A 3GN2A 3WGOA 3DWFA 3ANMA 3OMLA 4BO3A 1ISMA 4GSKA 1O95A 4AICA 4BO1A 1LDMA 3JQCA 4J1TA 4JIGA 5JC1A 1Y8QB 4L74A 1VPDA 2O3JA 2NQTA 1IHYA 4YRAA 2AQIA 3O38A 3W8EA 4DC1A 3VOSA 2X86A 4KUGA 5JYDA 5CEFA 1PR3A 2O3TA 2AG8A 1Q7CA 2B4QA 3FPLA 1U3VA 1F17A 4CUJA 5JAQA 4EEZA 4NJOA 3L6EA 5I7FA 5BT9A 1V6AA 3EW7A 1VLLA 3EC7A 4E31A 1EVIA 5IF3A 1KEWA 1RKXA 3A14A 4II3A 1G0OA 1E3WB 4GSLA 1E5QA 4E2ZA 1R6DA 3ZCXA 1W6UA 2YJZA 1NQTA 4WLVA 2PZLA 1C1XA 1E7MA 1NX6A 1NFRA 1Y1PA 2NLOA 1Y5MA 2EKQA 4IMPA 3E5RA 4IJWA 3VH2A 4CL3A 4EUEA 1NHWA 3PJFA 4IJUA 1GUZA 4BUCA 2ZYGA 2HMTA 2FMUA 4KTVE 4RLSA 5JY6A 2Y1DA 2CSUA 2YV2A 2PY6A 4YAKA 4DQXA 1PJCA 1TA4A 2YYYA 3KEQA 4NH4A 5IDWA 2GN6A 4O0LA 1E6WA 3GGOA 3MJCA 5COBA 3ZW9A 2C2YA 4NBTA 1PJ4A 5HBRA 4BV8A 1R66A 1V3VA 3QVOA 2YV3A 2ZATA 3BHMA 3RBVA 4PLTA 1HYGA 4BNHA 3OBBA 1GFSA 5EINA 3CZRA 3UF0A 1WXDA 1KEVA 3MJTA 4GGPA 2B5WA 3H65A 1EE9A 3JQAA 3NV9A 4JBHA 1MX3A 1P1FA 2HMSA 1PGNA 2GZ3A 5IDQA 1Z6ZA 1RM0A 3ETDA 5TNXA 5C7OO 1ZK1A 2GLXA 5I9MA 2WDZA 3W6ZA 5KCZA 1NWHA 3JD0A 5A1TA 2XAAA 1TB4A 3L07A 3BMCA 3GMDA 1H2BA 4WK6A 4AL4A 2Q50A 3DBLA 4LMPA 5FF9A 4NBRA 3GEGA 2DUWA 1MB4A 1R15A 8ADHA 1QRRA 4JX8A 1QR6A 4BGIA 1KOLA 1MA0A 1NWCA 1Q7GA 3Q2IA 4O5OA 4TMFA 3WNQA 3U62A 1NVTA 3R1IA 5IFLA 4W9NC 4QO7A 1R37A 3LC1O 1UXIA 1EDZA 1I3KA 3KSDO 1R12A 2W4QA 5C7LO 3RAJA 1DC3A 4MP3A 3RKUA 1KBZA 1ZKMA 1JVSA 4NQZA 4ZQGA 4DQVA 4ZD6A 2PKQO 1GQYA 3NJ8A 3U3XA 2O48X 4CQMA 5DBFA 3CTMA 5F3RA 3ZNNA 3ULKA 3TN7A 1YKFA 2OL4A 3QP9A 3ZWPA 1KEPA 1P44A 1UR5A 1ENPA 1RM5A 4WJZA 3DOOA 3DBHB 3KB6A 1BXZA 1LLCA 3GY0A 1EBFA 3E5MA 4RF5A 1BSVA 2GO1A 5DP2A 1U8FO 4OXNA 5L3ZA 2QRKA 4ALLA 4QECA 3I9JA 1DDOA 1E7RA 1BDMA 2GZ2A 2OGUA 1AN9A 2YFHA 3WXBA 4QTZA 3WX0A 4D43A 2HO5A 5G0WA 4PLFA 4HFNA 2NU8A 3DHYA 1FDVA 3EVTA 4OMUA 3SLKA 2Q2QA 3JQGB 4MP8A 4LW8A 4E5MA 1E5LA 2RAFA 2Y0CA 3AK4A 1V3UA 2GYYA 2RBEA 3SC4A 1IHXA 4C7KA 2P9EA 1NBOA 2VT2A 1MLDA 4PLGA 1GYPA 3X2FA 5G4KA 2VYND 4OJNA 4E6PA 4WCFC 1LSUA 2C54A 2EGHA 2NVUB 2D5AA 5A06A 2P4QA 4PGFA 4FOSA 4TVBA 1KERA 3EUWA 4UULA 2GN9A 1ORRA 4XYLA 4RQUA 1PZFA 1ZIDA 5G0SA 3V2GA 2HRZA 1BWSA 3NJ4A 1R0KA 4Q3DA 2AEJA 3ANLA 3C7DB 1YJ8A 1QLJA 3I9MA 2LDBA 1ZBQA 3ROQA 4CM1A 4IXTA 3KETA 2WJPA 4ALNA 2JD0A 3NTQA 1I0ZA 4YRDA 4CMKA 1B8VA 1WAMA 5J23A 5COQA 4U6SA 1Q7BA 2WYVA 4RO0A 4D79A 3NX4A 1PSDA 4XJSA 3DAPA 3DDNA 1N2SA 1AXEA 4PCVA 3KLMX 5COAA 2AEFA 3TPCA 5GZ3A 1B7GO 1T2EA 1LC0A 1XQ6A 1Z73A 1RJWA 3D7LA 1PWZA 4YCAA 3MTJA 5CG2A 8LDHA 3IL2A 2P4HX 4OQYA 1B8UA 1QYVA 1LU9A 3GVCA 3PEFA 3CXRA 1M6WA 1Y5RA 2DT5A 4EJMA 2W2KA 4B4OA 5EJ2A 1Q2XA 4LCEA 4A10A 1XDWA 5A03A 3PI7A 2W98A 1BXKA 1X13A 2G0TA 2C20A 1HLDA 3IMFA 3KXDA 4G65A 1B8PA 5IDXA 3WGZA 3AOEC 3NUGA 1DC5A 3RC2A 5FI5A 2PZMA 4K6FA 4ZQBA 3PLRA 3U09A 2GN8A 5EQDA 1HRDA 1HL3A 2AE1A 2BMAA 4D42A 1LRLA 4BGEA 3RCBA 2QZ9A 2G76A 3PHLA 5G4LA 2AW5A 2FPPA 4ZA2A 5G0TA 3FWNA 2EJWA 4DYDA 2FPIA 2A92A 1PL6A 3VC7A 4IJKA 5ADHA 3OSUA 1IL0A 4NMHA 2PGLA 4XEHA 2VHVA 3VKUA 1S6YA 5K9ZA 2QW8A 1A7KA 2RH4A 4II2A 2DPGA 3EK2A 3ZH2A 3BTOA 4Z9FA 4RVUA 3PIDA 5IJZA 3VVBA 3LT2A 2ILTA 1ISHA 1ADGA 2DBRA 5F1OA 4IQ8A 4BO4A 1E0DA 2GERA 3PVZA 3VPXA 2IE0A 3ICCA 1EZ4A 3PQEA 2JD1A 2BFPA 3VZSA 1A4IA 1KETA 3GUCA 4O59O 1MUUA 2VWHA 5LDHA 4RPJA 4PLVA 1LUAA 4Q3CA 1VSVA 3VPHA 5JMWA 3AY3A 1H9BA 3CINA 2QG4A 3U0BA 2QZZA 4EBFA 2ZCVA
chains in the Genus database with same CATH superfamily
4D9MA 3MNFA 3FCAA 3KLNA 4FMDB 5DGHA 4LQLA 2R8YA 2F3PA 3GLGE 2ZSEA 4FR0A 4KOEC 4O4HA 4BN5A 4EG5A 1YI0A 3IAXA 4L28A 3OE5A 3QVXA 1XDZA 1XP5A 4WOCA 1OF1A 3IV6A 4K3UA 1Y7IA 5AR1A 3UTDA 2H3EA 3DTTA 4KR6A 4FGKA 5CU7A 2GA9A 3KYDB 2WWHA 4X93A 1M2GA 4L0QA 1FX1A 1V5IA 2Y6UA 1G2QA 3FHLA 1TNDA 2E82A 1UFVA 3EZNA 4XR9A 2J5RA 4R2LA 4J75A 4HH4A 1UM8A 5CH8A 1A88A 4LVUA 3VU9B 4IGIA 3WMEA 5L3SA 1UWKA 4B4VA 1P2SA 1I33A 4HRYA 1RJDA 2ECPA 1GDHA 4P38A 1GGVA 2VP3A 3MGGA 5HJ5A 5HUJA 5LYJF 1BS1A 2KHZA 1XVVA 4S05A 1A96A 3TGWA 1XU9A 3EBPA 3L7NA 4R0VA 4NOKA 1VBMA 2MR6A 5EC8A 5H3LA 4EB3A 3WGIA 3ADCA 3LW8A 5JC8A 3QWFA 1WXQA 3RVNA 4DIFA 1KQGA 4LI0A 1AQLA 3UYLA 4MJLA 3RYCB 1JA1A 3PJDA 5KVVA 1TDJA 4DRZA 4HAZA 1GGEA 1KI1A 3PHIA 4XDZA 2J3KA 1RAAA 2N1BA 2NT4A 2UVPB 3AUSA 2GLTA 4MRVA 4H7JA 5DSZA 3GJRA 3K9GA 4XQGA 3OIGA 4Y1EA 5FXMA 4DLTA 1UJ6A 5BXYA 3M6MD 4INOA 3CVUA 4FEEA 3IUEA 2YZNA 1E4YA 2FUKA 3FZQA 2GASA 2JFNA 2PANA 4BKQA 4GOMD 3KV3O 4KQKA 4JBWA 5EP1A 2H4XA 4UM8B 1PZEA 1JEEA 2IF2A 2FQXA 3IEMA 4MYSA 3O3OB 4IR7A 2ZYVX 4G4SO 1W0JD 1BE8A 1ECJA 1J49A 2QD2A 2GCIA 3LUFA 3QU5A 5JECA 2QIPA 3FSGD 5KX5A 1J2RA 3MWDB 3BD7A 4GE0A 4KXNA 4M55A 3BYZA 3RT7A 4PF1A 1IY8A 1U7TA 3LH5A 5JJIA 2BP7B 1IM5A 4BMCA 4PSUA 1DRVA 1P1BA 3L04A 4K6MA 1D6NA 1EI9A 2ZWOA 5AKKA 2Q5IA 3R5KA 2XGSA 4FNAA 2DSTA 2ZJ1A 1KHTA 4BVBA 1NQOA 1JR4A 2VNSA 1QQTA 3R7WA 4FYVA 4JSRA 4F96A 3T5CA 4YP6A 4C4XA 2GCGA 1CNFA 2W0MA 3JY6A 3QLJA 4HZGA 4HQRA 4MVJM 4C4OA 1UKBA 3D2AA 4MVWA 4DUZB 4JP1A 3AR9A 3QX8A 2OGTA 5CDFE 1Z63A 2PRJA 1E3JA 4MA5A 1AGNA 1USWA 1W93A 2IEGA 4NYMQ 2VK2A 1JG1A 3ETHA 4XYEA 3VZQA 4KFSA 2WHRA 5H3CA 3RHZA 3N8KA 2C77A 4BKOA 1U6IA 1NI4A 1Q1EA 1I7NA 2ZUSA 4EFDA 3T5AA 1CETA 3SQNA 1U2DA 3R7AA 3EPHA 2HF9A 2O7VA 2CNDA 4EF4A 2UAGA 1S1CA 5FPKA 2O3QA 3BRCA 3OJWA 4URHA 5DX1A 2H18A 3HB4X 1OWNA 4XYGA 1EUCA 1CQXA 1TEHA 2IUTA 3K2BA 4ZCQA 3DFFA 2LXNA 3HZRA 1AKUA 1K8XB 1XN4A 4POOA 1XZFA 1A5ZA 1YQTA 1XMPA 2GEVA 1UODA 4FFWA 2ZP1A 3SJUA 2YRXA 5I7OA 3INNA 4P4SA 2GPBA 5TQ2B 1EXDA 3ESZA 1J2EA 1J7KA 3S1AB 3V4ZA 3LUAA 2EARA 3FFTA 2Y0BA 4M60A 1QP0A 1Q7RA 2ZBDA 1VB5A 4N0QA 3B3JA 1W36B 4YR9A 5LLSA 2H1OA 4KREA 4MKGA 3CA8A 3U4CA 4WOBA 1U9JA 4JI0B 1U8CB 3WWDA 1MQ9A 2X7XA 4PHGA 3GRZA 5SZJA 1ZGGA 4QUHA 3T5TA 2EDAA 2UZ0A 3HC7A 4GLOA 3X43A 4IVQA 2NNLD 5DM4A 3N2KB 4DQUA 2XCSB 3CV3A 2PBLA 3V4RA 4DB4A 3ROEA 3DP7A 1WMSA 2OSBA 1R16A 4HLDA 4NU0A 2R6DA 1ONOA 3L7JA 3DZKA 2RD2A 4QGHA 1STOA 3PXGA 2VYVD 2WOJA 1YU9A 4FGUA 1RIIA 4CG3A 3ETJA 1KAGA 2MSEB 1KXJA 4ZVOA 1FXWF 3I76A 4EDHA 2UXDB 2W2LA 4JQZA 3TI7A 2FNAA 2XNSA 1N8TA 5IU6A 4JT9A 3O8DA 4JASB 1Y1SA 3AUAA 1COWA 1Z8NA 4YC7A 3ZY6A 3C3BA 4IIGA 4K8OA 4QZVA 2EX1A 4ZODA 5ELMA 3F1LA 1A2BA 2JI8A 5CDFA 1RHMA 3KZKA 4EVSA 3F5SA 4KWTA 3Q8MA 3HFRA 1I51A 4DILA 4RTNA 4PWYA 3VR1A 1DKMA 2YBDA 1YOBA 4OPMA 2M6SA 4DCGA 1FDOA 4ZT4A 2I34A 3QI7A 3OP1A 3T34A 3TW6A 4IUDS 3KEOA 3HP4A 4BKMA 2XMGA 4KAAA 1Z26A 3RVSA 1PZHA 5BURA 4YA6A 1GIAA 3RU9A 4CLRB 1RWQA 1T6NA 2DXIA 1KO5A 4J1NA 2ERCA 5EZYF 4TSFD 1NFQA 4XGRA 5KX5F 3T61A 4PQGA 2V6MA 3ZWXA 2R0QC 4W63A 1L7NA 2HK9A 3BHNA 3NRJA 3QHQA 4CM8B 3BG5A 2LPMA 3CGWA 4CKZA 1CKEA 2YWEA 2I33A 2GFHA 2B92A 4LHXA 4LJKA 5GY7A 1RTKA 4I9GA 2YXBA 5SZKB 4YO8A 1KZ4A 1Z8FA 1RJFA 5EJFA 3ZV3A 1N2ZA 4ZO9A 2H5EA 4QUAA 5E7IA 2H52A 4D74A 1WUJS 2BTQB 1TXGA 1HDXA 2QORA 2YOHA 3GGGA 4JAVC 2XBUA 4LZAA 4D4KA 4UAJA 4P7BA 2WF8A 2ZAMA 3AEUB 1GSOA 4S3MA 4G25A 5JCJD 1A5BB 3LPMA 3IHKA 3AHJA 4FJ0A 3T1OA 1ZS9A 3I0ZA 3L18A 3ZKAA 1PEKE 2UUOA 1W1UA 5KOJA 3LDFA 3AU9A 1HETA 4LRSB 4EG8A 1JJVA 1WY7A 2IOYA 1QWSA 2VP2A 2WVJA 1O58A 2H59A 4Q1VA 1VXOA 1P33A 3H83A 4E15A 5GINE 1IH8A 5TX7A 2VBCA 3QRWA 5DTQA 5JEDA 5TVKA 1Y5NA 1P2VA 3SE7A 1J2JA 2J30A 2FSVA 3BC1A 3H7IA 4KDRA 1BTOA 4LUCA 2WNHA 3OY7A 4D57A 2SKDA 1AKNA 3PZBA 3T5GA 1WPRA 4G97A 3U13A 3FOAA 3IRUA 4R1MA 1WSDA 5C80A 2FE4A 4P7KA 4W4TA 3GLHB 1NY5A 3S1AA 1N6HA 4X64B 3DHEA 3U44B 2R4TA 2I1LA 3FPJA 3HABA 4OP1A 2DHRA 2EFEB 2JCSA 4WN9A 5EIAA 2DR3A 3A31A 4OH7A 4OMFG 2BGUA 3EW9A 2QSUA 5F2KA 5JFOA 4IHAA 4JV5B 1T4DA 4MRPA 4DJDC 2D0IA 3GNLA 3BUSA 4YHHB 3T1VA 1Y6GA 3N53A 3AL0C 2IV3A 2XUQA 4DW8A 3VISA 3GWGA 4QC2A 5DCUA 2IYFA 4HB3A 1XJCA 3DVLA 1F9AA 3CN9A 2I29A 4KU4A 5ABPA 3ZWWA 2HBZA 4L07A 3WLTA 4V0NA 4MPRA 5DNEA 2JFFA 1TEVA 5C5CA 3AEQB 4B7AA 1DQNA 4EW2A 5FOQA 2EIHA 4M7PA 1TQDA 2Y1CA 2HF2A 4GT1A 1E1CB 2TMDA 1G2IA 3PUWA 4TMYA 5LZ4A 1MPTA 1P73A 1SU6A 2D4HA 3C6XA 3FHTA 3TTTA 4P31A 1B0ZA 3U7FB 4GR5A 1CVLA 2VP9A 2WIFA 1WJGA 1XX6A 3SIWA 4TUYA 3UJ3X 4CUZA 1G3MA 3QMVA 3KE8A 1ODIA 3WDKA 1YULA 1Z16A 4IJ6A 4MVJI 1X8JA 4RV9A 3P7MA 3OPQA 1ZONA 3NKVA 3N2NA 3AILA 3GUVA 4L8YA 3ER6A 1IG0A 4OBEA 2VJBA 4RQBA 4PR3A 4Q82A 4IOJA 4JYPA 4DJEC 2WAYA 4YX9A 1Y4DE 5T5QA 1YB4A 3EDRA 3O6VA 3ZZ0A 3RANA 4OXXA 4EI9A 4OOEA 1XG5A 2EYQA 1TJ5A 1EXVA 3L01A 2GH1A 1WKVA 4YO7A 4CQMB 1RXVA 3IBTA 5HA5A 3ZCQA 3CX6A 1KS9A 1JDBC 1II0A 5IJ9A 1P4RA 3G8AA 2I4RA 1ABFA 4I1UA 3ZI7A 2R87A 4JOQA 4EJSA 1J1UA 2V7QA 5F7JA 3V8QA 1L7XA 4W1SA 2OZEA 1YK0A 1TZ2A 3EMVA 1SOWA 1QGDA 2O3RA 1IJFA 3JQ8B 4TOIA 2ONCA 4KGZA 3BJEA 3BXZA 2GRAA 3K0CC 4XWKA 2A5GA 1QMGA 2CUKA 2V8OA 2QQ0A 1CC1S 3B6KA 1L5MA 3I09A 3R74A 3RS0A 1LX7A 3GCGA 3ZZNA 1AKWA 2C9OA 3K96A 3JARA 4H7HA 4NV3A 1NVUQ 2ACKA 2R86A 2W93A 1J8FA 1QIMA 2CY0A 1YA6A 1W5FA 1ZHHA 4F85A 4LXGA 2WLTA 1VL2A 1HOXA 3HH8A 4GPAA 3BKWA 1VG0B 1MGPA 4LXUA 3QNWA 5IJWA 1YI1A 2XB6A 3GLIA 3OQVA 2ONJA 1T9CA 3EZYA 4AS3A 1NYRA 5J58A 2Q99A 4MZXA 4RK7A 4IDCA 4ZAGA 3VTKA 3KAQA 2L18A 2P0EA 4YUZA 4GBMA 1SUEA 2CKDA 3W4JA 2DQSA 1C9YA 1IE3A 3DVRX 1V7ZA 3UFBA 4IM7A 1YJQA 4N7JA 4ZXFA 3RU7A 3ZLUA 4PLCA 2YKGA 4IEIA 3U4HA 2EKBA 3OLZA 5L3VA 1WP4A 2F1HA 3AWIA 3I34X 3NM4A 4WASA 5LL6P 1KEEB 1E9AA 5F12A 1AU9A 1FJGB 1M83A 3WO0A 1LH0A 3D8RA 4PPFA 3CCBA 3RHSA 2VEDA 5ALPA 1QRTA 3HNOA 4RELA 1RAGA 2I62A 3UGKA 1M1NA 4ZMRA 1QHXA 3COWA 1A8IA 3C8DA 4M83A 4WZAB 2XZTA 1UOQA 1H5QA 1X9IA 5ICGA 3P9RA 3SQMA 5KTOA 5KYYB 3P2KA 3VDMA 4YI3A 2FFHA 2XGGA 2ZJ5A 1SVOA 2PGDA 2CB9A 4UBNA 4HWRA 1ZJ5A 2OXEA 4RETA 4X65B 5HF6A 3ZGYA 1X38A 3QWIA 2Z2ZA 3SM3A 3LY7A 1OYYA 1NSFA 1KO8A 4RZXA 4M9RA 1LQTA 2OBMA 3K0FA 3OCCA 3RTEA 1EK6A 3ZIDA 1E9EA 2MYTA 2G5PA 2WUWE 4WZBA 3N58A 2WJ6A 3ZDBA 1U98A 1D2MA 1TQ6A 2Y1KA 5KWIA 3ZJ4A 5DCLA 3L0CA 2P5UA 4QPPA 4KFUA 2CVZA 3P9PA 4QOHA 1HM5A 1NURA 4EB6B 1RLJA 2EHJA 4GVLA 2CLOB 2GTHA 1OOEA 3FYCA 3IO5A 3SJ7A 2YWHA 4M0FA 2JFZA 5KZMB 1DJPA 3ZWMA 2ZJ2A 4HLQB 4LY0A 5LXTF 4LE0A 1NOJA 5IF9A 4IIHA 1EB9A 3CUWA 3PQ2A 4AC9A 1RE1A 3K0CA 1KVQA 1PTKA 4MIOA 4KXUA 1NSYA 2FEKA 4UM9B 1SVIA 5EWJA 4NCHA 1RXEA 1Q12A 2J3LA 3SKVA 3H3FA 3C3JA 1T9HA 2WFLB 1OXBB 3LVBA 4REMA 2JAWA 4Q1FA 4MPDA 4Y7DA 4S1VA 4YRCA 2GR9A 3OIVA 3NRCA 4G4GA 1KORA 5ESWA 1OX6A 2H00A 2R68A 1Q6ZA 3UMRA 3L7YA 1VBKA 4C2TA 1P0IA 3GFRA 1TD1A 3EC2A 3ZVMA 1Y37A 3BGWA 1VBFA 3WGQA 3W7VA 5K01A 4MVJG 1V2GA 4EK9A 3CKKA 1LNQA 2ZJ3A 3JZDA 4PONA 3MWYW 1RQNA 2ZRQA 1Y6ZA 2FVYA 1W4BA 3KK0A 2ZYHA 2XMDA 2G70A 5EFOA 4YQEA 2C2OA 1T1EA 3IFSA 3WV4A 3BAZA 4FHEA 2JB9A 4L3WA 4I4NA 4JYCA 3L0BA 1I32A 2CYBA 2OZPA 3ZHXA 4CDRA 1NYLA 3ADPA 4FT4A 2C7RA 1OZ0A 3Q8KA 3OJFA 4MGKR 3UK2A 2YZMA 3B8HA 1UXKA 3CZ5A 1IY0A 3V1YA 3HCEA 1H8HD 3CCCA 1YB2A 3PP8A 3Q98A 4NTZA 3RD5A 3EYAA 4DIOA 3QH4A 1NM5A 3OIDA 4ZVVA 3ILYA 3V6MA 3O0DA 4U0JA 4V1CB 4IIJA 4YCBA 2F17A 3ICEA 4F97A 1EE1A 1NXSA 3C45A 3TLYA 2RGGA 2HMUA 4PICA 3GYBA 4AYXA 3DXFA 1AE1A 4ZI2A 3HJFA 2O8EB 1HZZA 4WESB 1GUAA 5HRUA 3PJRA 4LJRA 1PJTA 2XZLA 4JVOA 2GQ0A 5G2OA 3UAOA 4QFDA 4DUYB 4W5NA 1B00A 2DERA 3SGLA 1U80A 4ISCA 5A02A 5CDUA 1ILEA 4OI0A 2B34A 1RAHA 1EFRD 2ZYDA 3P2OA 3N8HA 4J43A 4OGLA 5T67A 1YQXA 2YTZA 5AUNB 1LS1A 2BZSA 3KFXA 5C31A 1V39A 3I6IA 3V8NA 2OCPA 1QH0A 2PV0A 5HFNA 5EZYB 4HJRA 5K0ZA 3WHIA 2HIMA 2BVNA 1GRVA 3GMIA 3SHFA 2JLWA 3HN2A 4BMSA 1OX4A 4C7MA 5H83A 2RGYA 4FZRA 1DAIA 1RMQA 3Q9UA 5K8TA 4PBSA 3DTVD 4LYHA 2FZKA 2X3FA 2B2CA 1EFKA 1X87A 1NVAA 4MRRA 2P0AA 2JCXA 5HWSA 3CGGA 3KZMA 1LBHA 3ZXUB 3R44A 1MW9X 2PTGA 3AUYA 3GJ5A 3LM8A 1UKAA 2IP2A 1AM4D 1XK6A 2IYUA 2VCHA 2AC4A 2BGIA 2YNMC 3H17A 3WIVA 1OV6A 1R8JA 1KTIA 1U2QA 2PMFA 4WMLA 2B8TA 1M2VA 5FRDA 4JGIA 4U1RA 2CXUA 2Q8QA 3AXSA 5HIMA 3G59A 3OLYA 4P3XA 3I1YA 3KOZA 2OV3A 4DJJA 5JCXA 1LK0A 2C92A 1TZKA 4GS5A 4N7BA 4NRDA 4CFZA 1ESCA 1UDXA 1DFGA 2D54A 4CFSA 5HK8A 1U0LA 1X6VA 5DCYA 1NR7A 1B8NA 2O7SA 1OBCA 4DA9A 4NATA 5LBUA 5LYYA 2EP5A 2GNAA 2H4FA 3K9CA 4O33A 3RYTC 1O5TA 2I2CA 3IOBA 4Y2QA 1W36C 3AIKA 3FPFA 3CLSC 3WYGA 1DKNA 1VIVA 4YP0A 4D8UA 3KL2A 2BF4A 4JLBA 3QVKA 3TRDA 2QJRA 3NEJA 5T64A 4RZ2A 3TEFA 4LDPA 3EUFA 3S2YA 1S8AA 4DBLC 1SIOA 5B1EA 3HBNA 2DRIA 3TIGA 4DR3B 4YXWD 1YQGA 4EYGA 1C7JA 4WLUA 2IOQA 4HH0A 4UOEA 1IMJA 1FK8A 1Y6RA 2AOUB 3DT9A 4LJYA 3KJGA 4DQ0A 2B82A 5B3LA 3WKBA 3INYA 4QYWA 1ZNWA 4AKTA 3RT1A 1J21A 3OZFA 3HWWA 1AGYA 1DINA 4RJKA 2FEXA 5E6RB 5KNCD 1J24A 1M6VA 1VKRA 5ALHA 3JQ6A 2RMKA 3UK1A 3QOWA 3JW8A 2PXXA 1JTEA 4OXRA 3ZHBA 1LX6A 4KR9A 4AJNA 4ZZIA 1KIFA 1F20A 3QUAA 2L2QA 4IILA 3KP1A 1EK0A 3RF7A 3R09A 3UMCA 3DS8A 1KY5A 3GDHA 3O0TA 2DWQA 5DX8A 1W46A 2D1YA 1K8RA 2H4JA 4BX0A 3C3MA 1IQPA 5D3MB 3NXKA 4EJ6A 2VSOA 3TLXA 1HDCA 1EWQA 3IP6A 1L5RA 4O02B 4EL0A 5LMUB 1EK1A 1B23P 2JKYA 3OF3A 1AQJA 4M9SA 2CNWD 4BBZA 3PD7A 4J4BA 4IDFA 2PFSA 4V1CA 5CFPA 1QZZA 4OFWA 1VFNA 1KPIA 2I8AA 3AF2A 5BW4A 3UMYA 1AGXA 1PGOA 2IHTA 4DJ5X 5JDCA 1YR2A 2PO7A 2IBSA 1YGPA 4KO2S 5BQ5A 4AZ0A 1KYTA 2PH1A 4ND5A 2E1PA 4IINA 3V48A 5ARBA 4ARBA 1I6WA 2GKGA 4JX9A 1U8XX 2JIQA 3TTSA 4CDGA 4CUKA 1D0VA 4IL5A 1JL3A 3GVPA 4B6PA 1JG3A 3H5LA 4DC0A 5BSFA 1V8BA 2Z5VA 1PQWA 5DSXA 1YOVA 1JTFA 5KNCH 3PDUA 4Y7CA 3P32A 1VE1A 4E46A 3II6X 4LIPD 4C07A 2F8LA 5FWDA 1P8JA 4CM4A 2B94A 1UP6A 5GONA 1OZAA 1PHRA 2YXLA 5AXBA 1M74A 1L8QA 5EWLB 4P5DA 5AI5A 4ZI7F 2C98A 2EFCB 3AEYA 4TT8A 1S1MA 3CT6A 2AX4A 3ICVA 5PGMA 4F7WA 2E4UA 4CNQA 4YCNA 2O1XA 4HOYA 1NP6A 5LOVF 3OQ6A 4LYDA 1SXJA 3BH7A 4KODA 2E5LB 4CMHA 2VHWA 4KUEA 4DCPA 1GDDA 2L42A 2MINB 1T1JA 7REQA 3S2IA 1CS0A 4TLLB 2VVTA 4MS3A 3SS9X 4IDQA 1TAHA 5DHFA 3R0QA 4ZAFA 2YHSA 2EKLA 4PR0A 4P84A 5T4HA 1L4GA 5DWVA 3UXYA 2AEMA 3EEFA 1NW5A 2BSAA 4R1NA 3CSUA 4BBAA 3UYKA 3U16A 2PH3A 2QVGA 1DJNA 4QSMA 1F9EA 4TYQA 2RBGA 2P40A 5LIPA 2OCDA 1RI4A 2PQMA 4MK4A 1P4HA 4P2GA 2PUGA 2VLBA 2EEZA 1M73E 3L8CA 3W8RA 2GDZA 4LWQA 2WHYA 4BB0A 4EPXA 4K0KB 3WWYA 4WRRA 4XUEA 5EEGA 2WKRA 4LF8B 2HWWA 2FYTA 1PFWA 1NA5A 1T6YA 2OD7A 4PWZA 3ESRA 4PYOA 5B4TA 2DB3A 1KNQA 3VGJA 3LVQE 4MS4A 3ZU5A 2K5UA 5HIKA 3R76A 3PVSA 2P2LA 5CBKA 4CEJB 4HVTA 3AGQA 5D1NA 3GUZA 2M32A 1ONNA 2GYVA 4HFRA 4FMDF 3NV7A 2AOUA 2HEIA 1BG6A 4HTFB 2ZRFA 1VZ2A 1NBMD 4Z9YA 2PEZA 1E2HA 1O0CA 3HUTA 1LBTA 2O8BB 3O3CA 3F4BA 4XCVA 4HWPA 3GA5A 3MLEA 2QP9X 1YS1X 2DKNA 1CBUA 4KACA 4G56A 4C03A 2C03A 4R7TA 3THYB 4FDLA 1C30B 2AG0A 5FL7A 3VH3A 2OAGA 3RVDA 1P31A 4HEA1 2H1WA 1VE3A 3HWSA 4B6RA 5IH7A 5AIBA 3LOPA 4EABA 3LX5A 1DEXA 3SQWA 4EF6A 3IA2A 1BX0A 2HSEA 4G5FA 4RXUA 2AZ4A 2HT6A 3BWCA 3RAGA 4MRSA 4ARVA 4F4HA 2POQX 5CFQA 4D6PA 3UWPA 2JGEA 3ZCVA 1NF8A 2VQFB 2EKZA 1N5KA 4YBRA 1JHYA 3V4PB 3WK7A 4P5PA 4O6VA 1FDTA 2PMWB 3X1DA 3A4TA 4CBVA 4UPEA 1KFKB 1OILA 3CJRA 1GTZA 3NCHA 1RPNA 2X5KO 2VBIA 3K30A 2C61A 3I83A 2IHUA 4N3BA 3AI1A 3GNSA 2MCFA 2E6KA 4A5OA 1NDHA 1U0TA 1XTZA 2H54A 5EHZA 3SD7A 1EYZA 1EAMA 4AN0A 1OLUB 1OZFA 1NXWA 2NZJA 3SN6A 1M6HA 1GSIA 1UFKA 1Z0JA 2BFBA 1GZHB 5P8WA 1XU7A 2WM9B 4W7HA 4E7PA 2UZ4A 5IZ4A 4Y0VA 1U0SY 3JTEA 5KDOA 1RBZA 4CM4B 4YJ2B 5REQA 3C7TA 3FCCA 2PYDA 2PJZA 3Q7TA 4HEQA 4NIMA 2O06A 3LCVB 3K9QO 1UP7A 1LRKA 3IELA 5TVGA 3FVTA 5EWLA 2IOFK 1GNQA 2ZG6A 1ZRNA 3R9KA 4MI9A 4NX2A 4PFJA 4ZVRA 4MEAA 3H0CA 4TKLA 5DTJA 4P4UA 4QLOA 5DVZA 3UTCA 3WR5A 3FTFA 3U7IA 2ZW9A 4BJ6A 2FUEA 1FNDA 1GZVA 5ENZA 5K2MA 5BW8A 4TYNA 1WETA 2GVNA 4DEXA 1Z33A 2I9PA 4YT4A 2E49A 1SBYA 2NTEA 4L57A 1TT5A 2C7GA 5YASA 4NNJA 5BRNA 3E61A 5CXQA 3G17A 2QJTA 1SA0B 1FFXA 1O9HA 1I3MA 1P4GA 2HBRA 1BW9B 3GAZA 4KPUA 3OTIA 1H8EA 5CCXA 4QODA 5P21A 3I5AA 2FSHA 1LEHA 3IAFA 4R8LA 4X20B 4EHJA 3ZY4A 3HVRA 1DSSG 1MOPA 2XZPA 2F3RA 4JROA 3R5XA 1OH7A 1AHNA 4QDKA 4UE3S 4C6TA 1S02A 2HX1A 2WPDA 4JK3A 4FR2A 3RIMA 1IHDA 2XUZA 4AUMA 3M6VA 1QJ4A 5HPYB 2XQVA 1O89A 1EUDB 4NP6A 4G5YA 5L53A 3IOYA 1ODSA 1WIWA 2HMYB 2IRWA 3JQ7A 4MXDA 4OJMX 4Z4IA 4RVDA 4EWLA 1JE1A 2WT8A 3FTCA 3EAQA 3OFKA 4KHPB 2NSDA 2YYAA 3DUWA 3DV9A 3GT4A 3RASA 4BBJA 1Q2UA 1J09A 1DG1G 2VO1A 2DBVO 1DAKA 3LLCA 1TGYA 4DSNA 1M1UA 1UFOA 2PUDA 4DSAA 3FIJA 1Z82A 2WHQA 1XKXA 3SCZA 1NXVA 2A1TS 3V8RA 1C4KA 2QD1A 4QYXA 3LQ4A 4YPVA 3DEKA 4FYYA 3A6FA 2GAOA 3HJUA 3R3UA 3GG9A 4MQEA 3GLHA 4QT0A 1IXKA 3U44A 1EFAA 3BAFA 4BQFA 3I1JA 1KZ9A 4LHZA 5TF0A 3JQBA 3IE2A 3O4VA 1LJLA 4W6ZA 3SF0A 3AERB 2R47A 4U5XA 3DMRA 3FD8A 1SAYA 8ABPA 2ZJ4A 4N65A 4DADA 2KPOA 5IT5A 3FYHA 2OORC 1OE0A 2Y68A 4INPA 3ZWVA 3HA2A 2FR8A 4OKNA 1VM6A 4F46A 1T2UA 5KVAA 3PGA1 4QVGA 2PXAA 3ZBTA 2I1VB 3VBCA 4AJEA 4YUVA 2WP0A 3KB1A 4OHXA 1UWVA 1RHRA 3C4VA 2O8FB 4NI5A 2BEWB 3GD7A 1QDEA 1PJ2A 1UC4B 2RKWA 1ZVMA 2FZEA 3BMNB 4YRFA 3V7NA 2YZGA 3ZXXA 2EW2A 5IYZA 3RIXA 1L3IA 1HWYA 1N3BA 2PKYX 4H08A 4J8PA 4X8HA 1ORDA 2YVAA 3ZJYA 3PI6A 5T8KA 1L4UA 2FY8A 3D6AA 3CVJA 5L7YA 2IHZA 5EWJB 4JI7B 3BB1A 3KKQA 1WMEA 4OQEA 2B21A 1CZNA 1QAMA 4ITVA 1ZGZA 5GMOA 1FRQA 4RHTA 3A1VA 4WBNA 2AJ8A 2O8DB 1KDZA 5IKMA 3ZTYA 1QOPB 4CEHA 1R8XA 3PNKA 1PEAA 1FUKA 1GTMA 1UF9A 5AVQA 3QVUA 1QZ3A 4M46A 5EERA 3NC1C 5C2JB 1L4KA 3EOZA 1C4OA 3N59A 2WF9A 1E99A 1OTYA 2Z0MA 2O7QA 2NO0A 2QTZA 3AH8A 3N2EA 3UWSA 4QFCA 3MS4A 2UZAA 4FK8A 3BFJA 2OFOA 3O4JA 3E84A 4I4LA 3CRZA 4XX0B 5BWOA 4DAOA 2RI1A 4DV0B 2WWVD 2JCVA 2Q3DA 1QH8B 3DB1A 3K6KA 4B75A 5JNTA 2H8KA 2W42A 4M87A 1Y3IA 3FBWA 1XQ1A 2OG1A 3L41A 1K86A 1NMSA 1O6CA 4I6JA 5HX7A 5MF6A 5U9CA 4KYIB 2ZYSA 1HX7A 4Q1BA 1P9NA 4B7CA 2X4DA 3C5CA 4DR5B 4O4JA 1WW2A 4M8NE 5HJ7A 4MCIA 1EFUA 3AV3A 1XRRA 2JH9A 2X77A 1L5SA 3TOVA 5BT8A 1PNRA 4B3FX 1VLZA 3Q3GE 3VR5A 4BUZA 4ZZ0A 4FOOA 3KJIA 5J5AA 3FLMA 3DDZX 4FLEA 3CLVA 4J3JA 4YRQA 1YB7A 3CMCO 4ZGWA 1C3XA 2NO1A 2PZFA 2GILA 3PHHA 4BCCA 1Q1BA 1SVUA 4U7DA 4JBNA 3HMKA 4E2XA 5JQGB 1TT7A 4DDMA 3IP7A 1K3UB 1JQKA 1QE0A 5GQSA 2ST1A 1BXRA 3FCYA 5B1IA 1I13A 3F9IA 3Q7PA 4RIFA 4U2DA 5LA6A 4BLOA 3TQRA 4DNXA 2PAAA 2XJ4A 2VUHB 1EUDA 2FFAA 2G40A 2YRWA 3CH5A 4Y98A 4WEOA 4LQ4A 3SZUA 1E6UA 2Y67A 5EIXA 1RYHA 1D4OA 4XD2A 3Q8LA 2R85A 1KVTA 1A27A 3KLOA 4HQ0A 1WXFA 4FHCA 1YB5A 4FOPA 4KWIA 4NE2A 4JDUA 4RIEA 3PFNA 1AZTA 4DLSA 3OX1A 1J8YF 1KYVA 4PPNA 4EO7A 2ZUFA 1L7BA 4LJ6A 1WABA 3BZBA 3RO7A 4E3ZA 1M2HA 1WBJB 3BMOB 1QHHA 1VJ5A 2H2AA 2W8ZA 5KVQA 1GPBA 3V1KA 2VK8A 4BP3A 1BN7A 4NBLA 3LT5A 5DIZA 5BV7A 1RYEA 5CA0B 1W30A 3C4QA 3E1SA 2ZS9A 3WVNA 3KQPA 4RLFA 3ETLA 5FUQA 4IVPA 3JALA 4O2AA 2P90A 3F5DA 3JSAA 4JELA 5DYTA 2DGDA 2XYRA 1REQA 1VE9A 3P2MA 4LECA 4GX5A 7MDHA 1HQCA 4E5VA 2BHNA 2WIAA 3NOOA 1O87A 1VKOA 3LT4A 4ZTZB 3ROFA 4TWAA 2J85A 2O2ZA 4G8CA 4AJ9A 2BJHA 2OEPA 1A9XA 4BEBA 3OQHA 3KZVA 1K0UA 1CERA 4PS0A 4YS6A 4C4ZA 4GR4A 4QOGA 5ILQA 1IUKA 2BEWA 3D0KA 1DAEA 2M2IA 3DYVA 4CV1A 1NN1A 4KL8S 4BNJA 5MN5A 2ERXA 3PEVA 1Q20A 3DVSX 5DOVA 2C78A 2LVBA 1F2UA 4Z9AA 1UDAA 3H9JA 3QKIA 1FDUA 2FZCA 1DC7A 1N8NA 2ZJBA 3BTSA 3IBFA 3K92A 4MVJA 5I7HA 4AVYA 2VHEA 3HMQA 4J0KA 3AF6A 4BLQA 1N6OA 3NFRA 4QQFA 3UH0A 4JHXA 3NVDA 3QKTA 5GJWC 3TIIA 1GPJA 1YNSA 1QG0A 4ID3A 3WGYA 5GJVC 1FYXA 1YUMA 3G0DA 1XPUA 3NPAA 3F4LA 4MCHA 4IZ6A 4DCOA 4RKEA 3VDQA 5IKOA 3QVVA 4CV3A 4C0QC 1HC7A 3HLTA 3A4MA 4ALKA 4O3MA 3QFTA 4TRJA 4YJGB 5BQOA 2D5IA 1V3QE 1UZNA 5CJ2A 1EVYA 4XWOA 2DZDA 1T8YA 2R4UA 3VTFA 3GLFE 4GL2A 2OK7A 3ET5A 2V7EA 4B7XA 3ICWA 1T10A 5LP6C 1LLFA 2BI4A 2FK8A 3FRIA 4RIIA 2OHIA 5A9RA 1C4XA 3NTUA 3NT5A 3PS9A 5FD8A 1ZI6A 4GI2A 1PZXA 1DWOA 1ZC3A 5KQPA 2OORA 4XKJA 2AVDA 3MXTA 1DXOA 4Q1CA 1ANKA 3SDZA 1A4XA 1E6CA 3ZGOA 2BYTA 5CB0A 1KH1A 2B69A 2QVZX 4GRAA 4IIXA 1H2YA 1YL7A 1VPTA 4Z4EA 3H16A 3IOMA 2JKZA 1WDTA 3WMFA 4MW2A 1VCOA 5B55A 1JWLA 1UBMS 3G0OA 4GQAA 4IXNA 5K6TA 3NBZC 1II8A 2AN3A 3EA4A 4NC9A 1EDEA 2X5JO 4RYDA 3JQPA 1AMOA 1WB9A 1YGYA 3MRXA 5DBGA 3ZDQA 4FDTA 1T4MA 1RYZA 1P7WA 3DKRA 4MLZA 4TLDA 4P81A 5CURA 1E1QA 1M75A 1XCOA 2XHEA 3SS8A 2PX0A 2YY6A 1O6GA 3TX6A 5LWHA 1SXGA 4BVLA 5ARCA 2PL5A 4HGRA 2R79A 5EYPB 3K70D 2X1LA 4BO0A 3PKZA 3R3ZA 3EIEA 3LA8A 4JJ7A 1WVMA 2VN8A 1TQ8A 3SNHA 1YBFA 2J9XB 2REQB 4NV0A 4O4JF 3RSHA 3HK2A 2NUTA 1MV8A 3F7MA 2GPWA 4N0DA 4DNOA 3D81A 1XT6A 2BFEB 1N6KA 3BDAA 5D87A 4XUDA 4LQCA 4M0EA 1FSGA 1N0WA 2R7NA 2A0FA 3DEJA 4E51A 3OJOA 3W8FA 3LQRA 4BGUA 5AD1A 3IESA 3BULA 4FQ7A 3KQSA 3DC2A 1K92A 4R1LA 3MTGA 2AW3A 1M8JA 3TAXA 3DAFA 3LQQA 3U5TA 3CLSD 3QMWA 3B2NA 1T8TA 3LIIA 3LPNA 3GFQA 2C42A 3MD9A 4U7FA 5E2IA 2G88A 4GKBA 3A28A 5TT0A 4DMUB 1WTCA 1JALA 1JF8A 3GCDA 3F90A 3GUHA 2JHFA 3M4YA 2BY4A 2XA2A 3ABRB 3MOGA 4OK6A 4WKCA 4Y30A 4B2YA 2NOAA 2YHUA 3KJFA 3P4UA 3UJPA 3KDSE 2P3SA 4MKIA 2OCAA 3PEYA 4NYIR 5B3AA 4UXJA 3AHGA 4R16A 3JVVA 1E2QA 5IXSA 4E12A 2ZUEA 2PMDA 4MAMA 4TKZA 2C2HA 2O52A 3LNCA 1JA9A 4RVSA 4NZZA 1VYTA 1GU7A 4HQ6A 3IJRA 4QPJC 1F60A 1L2TA 4CM7A 2IW3A 1X2BA 4G23A 1YD7A 1YRLA 3D54D 1G20A 1QQ6A 3RF6A 2H85A 2O8BA 2QHXA 1XZGA 3UJ6A 5L4NA 5EY5B 3W3AH 4I4CA 4B3RB 3O4RA 2PYZA 4OQXA 3CIFA 2FPPB 1K68A 4Q7MB 2VTBB 4C01A 3TLCA 4LRUA 5JATA 4H0NA 4QG3A 1RPJA 4H9GA 4Z2YA 3MBIA 2ID4A 1OX5A 1RWXA 4PZDA 2GCEA 5DWDA 1PR4A 2VF8A 2JATA 3MXOA 4MWBA 1RKBA 1FVXA 1XZMA 1IZ8A 3ACCA 4KRFA 3VYUB 1TFUA 3H1PA 4RL6A 4N3GA 4ZYLA 1CS0B 1GFZA 4MUEA 2HR1A 1ZU4A 4F72A 4FX2A 4AKIA 1Z4PX 1A71A 1FIUA 1M6VB 3E22A 4PTZA 4RA9A 4D8WA 1AVTA 2CMHA 3CRVA 4E6EA 5KYWA 1O2DA 3PQ5A 4IRMA 1SOVA 1XROA 3DKVA 4PSAA 3RTCA 1UBRS 3LP6A 5DNVA 3VV3A 1RAIA 4BO9A 4BNKA 3MOIA 2A84A 1V8FA 1X7HA 3WJ1A 2CXOA 2UYYA 3USES 5IZCC 1TYZA 5KJ6A 3H7AA 3H5NA 3G2KA 2BUBA 1JKJB 3LYLA 2PRZA 3FWHA 4DWVA 2QD4A 3OU7A 2EERA 2J9FA 4TRRA 4EFNA 4TVSA 1QKIA 4L4ZA 1EFPA 2GNPA 3FMOB 4NOLA 1A8QA 1RWOA 2N47A 3EEIA 1LPBB 3HL4A 3ITNA 2QW0X 5FR1A 2HSWA 3U40A 2NX2A 1ESMA 2WU0A 4FFMA 3FWPA 2YVLA 4OU4A 4QEZA 4Q9IA 3WK8A 3H2HA 2BLLA 3BRSA 4Q4AB 2IKSA 3QJYA 3V7WA 1UAGA 3OEEA 4TLMB 2Y93A 5H4GA 4CKWA 3HUEA 4C6SA 1Q1NA 4G24A 4F8YA 4D99A 5EPEA 3FGNA 3SHVA 1CB0A 1DPFA 4HFMA 3ZV5A 1ZD5A 4X6XA 3WLHA 4B4WA 1R0RE 2HSDA 3MT0A 4BGDA 2I6XA 4BFYA 2RIRA 1KFBB 3N1UA 2RAUA 3N0TA 4Z51A 2VRCD 3HYNA 3S1SA 1LPSA 4CLOB 1YJ5A 4JU8A 4B7UA 1WF3A 3GRRA 3HDQA 2NYUA 3KD3A 4HQNA 4PLHA 3L4BC 3TZQA 2O1SA 4ZCRA 2QRZA 3OTHA 3W3ZB 1JEYB 3IEUA 4K9RA 4ZI7A 1AQ6A 1GVHA 1KRHA 1NAIA 2YS6A 4CKEA 5DI3B 4RKQA 1QV9A 1URPA 2EG5A 3KJQA 3KQYA 5JADA 4BGVA 2P75A 2QZ4A 3NNDA 1ZR4A 1VA4A 3GN1A 4IHJA 4W9NA 5DNWA 3VJRA 5AQEA 3IIMA 2MINA 4CTMA 1RQGA 2QQ5A 3DZJA 2RHGB 2PKQP 3SC6A 1RCUA 3VRHA 1PYOA 4BTLA 1Z3IX 2XUDA 3KB8A 1QWOA 2YDYA 2VTDA 1H3NA 2GRUA 1FDWA 2DUNA 3S2FA 1CEQA 3JD4A 1DIAA 4EUFA 2Y1LA 4C9BA 3OQIA 2X0IA 3MS7A 4RULA 2Z2KA 1C7IA 4QXOA 1PQYA 2C5BA 2UZ3A 3EWIA 3H2SA 2GJSA 4KVZA 3UJ8A 4YCSA 5JAMA 2WWTA 2Q1TA 1RPAA 3I0NA 3DXZA 4EG0A 3DUFB 3TQQA 1BEZA 3EC1A 3K73O 1RBQA 3TKAA 2QLBA 2DBZA 3PJEA 2A6PA 3B1XA 3C5WP 1JQBA 5LNK6 4RAOA 4AP9A 4BNYA 4PG5A 1ZIOA 2H1CA 3RRYA 4KR2A 1V41E 2AOTB 1BZYA 3WRWA 3BVPA 3V2IA 5B4UA 2ERYA 1G8MA 5JDCC 1TM4E 3O1JC 2XWJI 2CT8A 3QQPA 2HQ1A 3ZR4B 1NKVA 2XQFA 3I8XA 3CKYA 4DZRA 2MSDB 1XTSA 2Y9PB 3ORHA 5F76A 4CR7A 2OCIA 1BHQ1 1G4AE 4HADA 4BNIA 1DX6A 1GKYA 5JG7A 1QLHA 3TG8A 4V0SA 1M7BA 2Z5GA 4ZREA 2P8JA 5K8LA 2FRVA 1CUZA 4GXRA 3TD6A 5EE9A 1NBAA 3ZHQA 1Q91A 3DB2A 1LPPA 1RWBA 1JT2A 1L1EA 3GZ4A 1L8LA 2PKWA 3AF3A 2D4AA 2GN1A 2I66A