1WMAA

Crystal structure of human cbr1 in complex with hydroxy-pp
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
275
structure length
275
Chain Sequence
SGIHVALVTGGNKGIGLAIVRDLCRLFSGDVVLTARDVTRGQAAVQQLQAEGLSPRFHQLDIDDLQSIRALRDFLRKEYGGLDVLVNNAGIAFKVADPTPFHIQAEVTMKTNFFGTRDVCTELLPLIKPQGRVVNVSSIMSVRALKSCSPELQQKFRSETITEEELVGLMNKFVEDTKKGVHQKEGWPSSAYGVTKIGVTVLSRIHARKLSEQRKGDKILLNACCPGWVRTDMAGPKATKSPEEGAETPVYLALLPPDAEGPHGQFVSEKRVEQW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title An unbiased cell morphology-based screen for new, biologically active small molecules
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords Carbonyl reductase [NADPH] 1
total genus 106
structure length 275
sequence length 275
ec nomenclature ec 1.1.1.184: Carbonyl reductase (NADPH).
pdb deposition date 2004-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1wmaA00
4YVFA 1T4DA 4BNZA 1VSVA 2EKLA 3HG7A 4MOWA 5A02A 4TKMA 2EGGA 4PRLA 5AQ1A 4MIYA 5B12A 4MO2A 4MP6A 3FTPA 2BFMA 3K30A 5AXDA 3WTBA 5L3ZA 4NR0A 3QWAA 5H81A 5A3VA 1XSEA 4I9HA 1KEUA 1B8PA 4FFOA 3RD5A 3ITKA 4M55A 2YDXA 2B4QA 1I2ZA 2PNFA 3UCEA 4B79A 3GZ4A 4PCVA 3O4RA 5F3RA 3PIIA 1EE2A 1U1IA 3SLGA 4JCOA 4CMHA 1DIGA 2UDPA 1YL5A 2RBEA 2B69A 2ZTUA 3JYQA 3C1AA 3FSRA 2C20A 4A03A 4D79A 4KTTE 3E9MA 4NIMA 1LLUA 2X9GA 1T24A 3ZV6A 1YOVB 3MZ0A 5KIAA 4U6QA 5EJ2A 4EUHA 1K5HA 4LW8A 2VTDA 2VUUA 4ND2A 4CM8A 4ZQFA 1GUFA 5ER6A 3DBHB 2G82A 1KYQA 3UVEA 1CIVA 1DBVO 4E3ZA 5JDCA 1X13A 1P77A 3H9QA 4NU5A 3W1VA 2W2LD 3K96A 3OICA 4HNGA 3M6IA 3EMKA 4LMRA 1N1EA 3GDGA 4RVDA 4W4TA 4GPD1 3BHJA 4JQCA 1VI2A 4YT8A 2X9NA 3JYLA 5IG2A 4D7AA 1G1AA 4C7KA 1P45A 4Q9NA 1M6HA 2FPPA 5EPOA 5BSEA 1ISHA 4YR9A 3I9OA 2VTEA 1P31A 1TB4A 5DZSA 1EUCA 2PZJA 1IY8A 4MKZA 3KM0A 1H9BA 3MWEB 4OAQA 3QRWA 4KDFA 2JHFA 2GN6A 2IEDA 3MJ4A 5DN9A 1AUPA 1Q0QA 5GZ1A 1QV7A 3ZW8A 4E13A 4YQZA 1TT5A 1DO8A 4MP3A 1D4FA 2YW9A 4J49A 1PX0A 5AXCA 1H5QA 1QSGA 4R68A 1B26A 2OBYA 4IJUA 1SO8A 3MJEA 5MDHA 4BKUA 4ZA2A 3M1LA 3H7AA 4CMGA 4CM4B 2AEMA 2QIOA 1DPGA 3GQVA 2B0JA 3KHUA 3H5NA 3HJAA 4XDZA 3TZQA 4Q3AA 2DM6A 2P2SA 2YY7A 2QHXA 4WNIA 2JFFA 2QG4A 1DFGA 1GPJA 2IDZA 3ITDA 2ZK7A 2VOJA 1HYEA 2C5AA 2D8AA 3H9JA 2Y93A 4MKXA 1JKIA 4J9UE 2TMGA 4JJIA 1C0IA 2YHIB 2C7VA 3JQEA 1PGNA 1C0KA 4GVXA 4FSHA 2FZEA 3DBLA 3N7UA 3PIDA 4D46A 4CLOA 1Y6JA 4BV9A 3U62A 4BO6A 2VQ3A 3UGKA 1LDYA 1E7SA 4BNJA 2GZ2A 1LJ8A 5JW6A 3U4DA 4DQVA 4K1LA 3D5QA 5H82A 4OYRA 4BMVA 1QYVA 3GK3A 5EL0A 1A27A 3B1FA 3BTVA 1XG5A 1SB9A 1F06A 1BXKA 1BSVA 1ENZA 1CJCA 5L40A 1ZSYA 3B20A 2NM0A 4MPDA 4NBVA 3LZ6A 2D4AA 4R9RA 1Y8RB 3G3EA 4XCVA 5JMWA 4RF4A 1FDTA 1W6UA 1JAXA 2J6IA 1WLYA 1R4NB 3JQ8B 2JCYA 5DCUA 3FF4A 1O8CA 3GGGA 3C3XA 4J1TA 3Q3CA 1IPFA 1BMDA 1DRUA 3ICCA 5I9MA 2O2YA 4KP7A 5ILOA 3AUUA 1M67A 1P3DA 3FBGA 3PDUA 3IUPA 3DFUA 5JYDA 5L9AA 4CMIA 1CQJA 3I4FA 3DO5A 1T1SA 2RH4A 4FFNA 4H16A 4AJKA 2V6MA 2I99A 1JA9A 1EE9A 4WCFA 4PN3A 3NYWA 1MFZA 2DUUA 3U9LA 2NQ8A 3JD4A 4J16A 4AJ1A 4PG4A 1HZJA 5C37A 3IS3A 1YJ8A 1T1RA 3D64A 1ZMOA 4R41A 4ALLA 2VZ9A 1MC5A 4CLRB 2OZPA 1XYGA 3RROA 3AOEC 3ZZNA 4BO8A 2ZKLA 2OBNA 4WLOA 2A4KA 3NEPX 1HSOA 1ENYA 1MG0A 3EDMA 3HZZA 3WQRA 1E3LA 2OOSA 3JQ8A 3KYBA 3MJSA 1Y9AA 1D1SA 1PWZA 1ZJYA 4Y67A 1SBYA 1T2CA 4DMLA 4WE3A 5G0VA 3FWNA 5F21A 4EBFA 2VYND 3D3WA 1PJQA 3PQEA 4I5FA 3AM3A 3ZU2A 1OBFO 4Z3KA 3WYCA 4E5PA 1PGPA 1NFQA 3CSDA 4E2XA 2CVZA 3HB4X 4NBRA 1UP7A 4L75A 4DYDA 1I10A 2I9PA 4AG3A 1NBOA 3PPIA 3CH6A 5U1PA 2V6BA 1ZNQO 2H5LA 3OMLA 4ZRNA 5B4VA 5K6AA 3QVTA 1N7HA 3OIFA 1WDMA 4DQUA 4NK4A 1IL0A 3EVNA 1PL8A 3I52A 5F1KA 3CMMA 5B4UA 1ZK4A 4ALNA 2EKPA 4YRBA 3WX0A 3QHAA 2E6UX 1IE3A 2NQTA 2Y1GA 2PGLA 1UXIA 1V0JA 4QEDA 3RVDA 5T67A 3L77A 1S6YA 4QTZA 4D3DA 1C3VA 3AUSA 3PWZA 2X9VA 4C4OA 2EJVA 2OFPA 5BNTA 3AK4A 4XB1A 2JJYA 5TSDA 4I5DA 1YOVA 1RWBA 1T4BA 5JPIA 2HQ1A 4GMGA 4FS3A 2RIRA 5JY6A 2J5QA 4CR7A 4J0FA 2EGHA 3QVOA 3LLSA 5G0TA 3HDYA 5TX7A 2RHRA 3O8QB 4R9SA 1XCBA 4OXKA 3PFWO 4QFCA 3H2SA 4I9NA 4Z6KA 2J3HA 3D4OA 3W4KA 4BL5A 5JYEA 2YYYA 4DLAA 1RKXA 4IY1A 4DGSA 2D5CA 3DFZA 2BF7A 1IHXA 1ZFNA 1Q0HA 4XDYA 3GVIA 3FHLA 1UP6A 3NJ4A 1E7WA 1ONPA 4OM8A 4TZKA 4NI5A 5L7WA 3H5RA 3IOYA 3RFVA 4J2HA 2VZ8A 4MVJP 4BVAA 4OKIA 3KBOA 1YL6A 2NTJA 1BW9A 3G0OA 3R6DA 4H15A 5DF1A 1GY8A 1K0UA 4DIFA 1WW8A 3GZNA 3JCZA 4U7WA 4FIZA 2Q49A 3ZV5A 4BGVA 5IDQA 2Y0DA 8LDHA 3TZCA 1I5RA 3DZJA 5HS6A 2Y0EA 4Q3BA 4PLVA 4CMCA 3KEQA 2DQ4A 2C07A 3D4NA 3JQBC 4CM4A 2HCTA 4ZU3A 1NQAO 3JQAD 4AJ2A 5FWNA 1DSSG 4WASA 1O0SA 2HDHA 2JL1A 3DBRB 3ZN2A 2X7HA 3RSHA 1ISJA 1WDLA 4B4VA 3EW7A 4A26A 2ZB7A 2X6TA 2Q4EA 2VRBA 3LT1A 4ILKA 5A1TA 1IZ9A 4F46A 1PGOA 3UOGA 3VZRA 1X7GA 2VHYA 1Q0LA 5IFLA 4FR5A 3V2HA 1D8AA 3RFXA 3P7MA 1NQTA 3BTSA 3JQFA 1UR5A 1ZEMA 4ITUA 4Z0PA 5A9TA 4CMAA 1MP0A 1LDGA 1H0KA 2C59A 3WGHA 3NGLA 2P5UA 4L4SA 1Y1PA 2PV7A 1AXEA 1MG5A 3DHNA 1JN0A 2CF6A 2PK3A 2NACA 5CPFA 5JO0A 2CVQA 3EZLA 4AJPA 3RC7A 3MJCA 4PRKA 5CPBA 5MGBA 2I65A 2ZYAA 4NBTA 3GLQA 3IUSA 3OJLA 1TVEA 4KDEA 2FWMX 5I8WA 5ICSA 4M1QA 3SBOA 4MVJF 4NH4A 3MWDB 2G5CA 3C1OA 4AFNA 4XWYA 3QVWA 1P1JA 3RUIA 3PQFA 3PWSA 3Q0EA 1NR1A 1HSZA 1I3MA 4NBUA 1ADGA 3L6DA 4XYEA 5EERA 4BB6A 2PZKA 1P1KA 1HYHA 1H6AA 4N5MA 2C2YA 2VRCA 3JQ9C 2NTVA 2WYVA 4CMEA 4CM9A 2GDZA 4FOOA 1EQ2A 4R1TA 3DBRA 2D5AA 4XRGA 4YJHA 1LC3A 1PR9A 3ANMA 4UEJA 3UN1A 4HBGA 4G65A 4JK3A 5A05A 4PLCA 4B3IA 2YHUA 1PZHA 1V3UA 4CQMA 2CDBA 1PSDA 2Q4BA 2UUPA 1DIBA 3FD8A 4PG8A 5EN4A 3H3JA 1NWCA 4RDHA 4P38A 4RPGA 4LCJA 1BGVA 1F14A 3DMTA 1HLDA 1QYXA 4MIOA 3WWZA 4BO9A 1LQTA 1J0XO 1QORA 1SZJG 3MCVA 1A7KA 1XEAA 2R00C 2EWMA 1VLLA 5HBRA 1KEPA 3PYMA 4WUVA 3BAZA 3I9NA 1XDWA 4DL9A 3BMNB 3WMWA 1PEDA 3AFMA 3WMXA 3KETA 4CLOB 3CZMA 4GX2A 1PJ2A 3NDRA 3Q2KA 1IB6A 4D41A 5TT0A 5KOIA 2X5KO 1XKQA 1Y5RA 5J23A 1ZSNA 4QX6A 4NZ9A 1VL0A 4JN6B 4UUPA 3I9JA 4DPKA 4N5NA 5HWSA 5TNXA 1AXGA 2E49A 1DIHA 2I76A 4FFRA 4Q3EA 3ANNA 4U0JA 4CV3A 4BQRA 1F8GA 1I3LA 1QV6A 2BELA 3DBLB 1FDUA 3VPFA 1XLTA 4CQMD 2CFCA 2IE0A 3GDOA 1S7CA 4TKLA 3GUYA 4NJMA 1RYDA 3BMQA 1ZUD1 3NV9A 4D44A 3Q9UA 1YDWA 1KVSA 4PG6A 5JMPA 3DDNA 3MJTA 3H5AA 4RF5A 3WGZA 4BGEA 3BIOA 4HP8A 5ILGA 4RPJA 2ZTLA 5DDIP 3LC2O 2C7GA 1U7HA 1T2EA 5KJ6A 2EKQA 2PD6A 3QLJA 3LYLA 4J43A 3UW3A 5A5FA 1KVUA 1V35A 2GZ3A 2FRDA 5FF9A 5L95A 2X22A 2O3UA 4O0LA 3I6IA 1IPEA 2Q2WA 2I67A 3EK2A 3AI2A 5DBIA 1HE3A 4FCCA 2FZWA 3OEYA 2ZATA 4EDFA 1DXYA 3ONEA 3ZWYA 3WLEA 4AJOA 3INTA 1SB8A 3ZHBA 2P9EA 1R0KA 3ZWCA 1N7GA 4HX5A 3GN1A 3WJAA 4RORA 5TC4A 2O50A 4QECA 4A2CA 2AEFA 4GSKA 5KCZA 3BZUA 1P1HA 5G0UA 4ZD6A 1RYEA 3K5PA 1YXMA 1ADBA 3UH1A 5HTOA 5TGDA 3F47A 4IDAA 5LDGA 2B36A 1Y81A 3TFQA 2PZLA 5ENVA 4B8ZA 3DHYA 4YAKA 3BTOA 2AHRA 4Z0HO 1EVZA 3MOIA 3GFBA 1ZIDA 4NK5A 3GG2A 1KY4A 1YBMA 2WYWA 3JD1A 5ADHA 3ZGYA 2Q1TA 3SJ7A 5L7TA 1YQGA 2J5KA 4UVDA 4E2ZA 1BDBA 1XGKA 3ZWOA 3ENNA 3ONFA 4CL3A 1T2DA 1R12A 4DIBA 5EIOA 2HK9A 2HJSA 3KEOA 5L4NA 3W8EA 3QWHA 3TZHA 3ZNQA 3K2EA 3PRJA 1CRWG 1EDOA 3DZKA 1NR7A 2VUSA 3FR7A 3LC7O 4P4GA 3RC2A 3ZWPA 4DQXA 1XIVA 4CR8A 4YJHB 2OXIA 4BOYA 3DONA 3E5MA 1JU9A 2UVDA 4FW8A 3P5SA 4NHEA 4R3WA 3VOSA 4AJ4A 4CM1A 5KJFA 4CJXA 1E1LA 2BGMA 1T2AA 2E48A 1HE5A 2VHZA 1EK5A 1CWUA 2HLPA 3T4EA 3EVTA 2ZB4A 4D3SA 4UAGA 4A73A 4GLLA 3RUHA 2EW2A 2EEZA 3GHYA 4Q39A 4UUNA 1AHHA 5THQA 1ENPA 4EI2A 3DXFA 3KV3O 3I5MA 1NWHA 3GEGA 1GTMA 1I0ZA 2EV9A 2OGUA 2PGJA 1VL6A 1GDHA 3GAFA 3KTDA 2Y0CA 2J3JA 4NNJA 4LSWA 3QWBA 3AFNA 1C1XB 4HKTA 3KVOA 1BVUA 3V1YA 4W7HA 1L1FA 3DZHA 1P74A 3SXPA 3ZWNA 1HE2A 1NVTA 1WVGA 1GEEA 3F46A 2YJZA 4W9NC 2GRAA 5JAIA 2Z95A 3EHEA 4QT0A 2WE7A 4ROSA 1EMDA 3UFXA 1NM5A 2EJWA 5AXBA 1MV8A 1P33A 4KUEA 5AOVA 4IINA 4OQZA 4RVGA 3TZ6A 3K9QO 3AI3A 1F0YA 3E1KA 5C7IO 3RQSA 1KVTA 2EERA 1SAYA 4RLSA 1MX3A 2YHIA 3WR5A 1PQPA 4BV8A 2GNAA 4NJMB 2IEBA 3WQSB 5B1YA 2Q1WA 4KUHA 3ZNPA 5FEUA 1PZEA 4P8RA 1Z74A 3TRIA 2GZ1A 2ET6A 4A7PA 3WIDA 3WYBA 2WTBA 3AY7A 3AY6A 1U28A 5ENDA 1PJ4A 4CUZA 3IP3A 3WSVA 7ADHA 3RUEA 2CNBA 2PKRA 3OJOA 4BGUA 1MXFA 1BG6A 4MVJA 2Z1NA 4CUJA 4CLDA 4KWHA 3EUWA 2CZCA 2Y05A 4YT4A 1BW9B 5DP1A 1BWSA 3V2GA 4YPOA 2VYNA 3VZQA 2VWGA 1MC4A 3K92A 2VRCD 4ZGWA 1JWBB 3OHSX 2CF5A 4M89A 4JBIA 1DHTA 4E5KA 1EBUA 2JAPA 1NP3A 4RO0A 1VL8A 2Q2QA 4OOFA 4D0RA 2DAPA 1KOLA 4P22A 4DBVO 3IAHA 4DLBA 1LX6A 3RWBA 2Y1DA 5GZ6A 5TF4A 3S1LA 4XR4A 2VN8A 4D0SA 3KYDB 3O26A 2JKVA 4FFLA 1XU9A 4WLNA 1P9LA 3ADPA 3ETEA 3FNHA 3V1TC 1UUFA 4XJSA 3FPCA 4WECA 3WGTA 1GFSA 4E6PA 3QJ5A 1IULA 2WD7A 1VKNA 3DZFA 2DTEA 1QKIA 3ORFA 4MVJH 4BNIA 1PS9A 4JX8A 4L0QA 4GSLA 4Y9DA 4W7IA 9LDTA 5A04A 4I08A 4J4BA 4JJFA 4DRYA 5TLSA 2ZJ0A 5A5EA 1UDBA 5T8KC 4IS2A 4CM3A 4JBHA 3ZCXA 4YT2A 3QWFA 5DCYA 3PJGA 5A9SA 3DC2A 1QLJA 2BFPA 3E8XA 1WZEA 1I2CA 4TMFA 1ONOA 3RBVA 2WD7B 1YQXA 2CVOA 2XF8A 3E18A 5A9SB 1X1EA 1K6IA 3WS7A 3FPLA 2HKIA 4GX5A 2BI8A 3B70A 1HDRA 3CINA 3UICA 3RCBA 4HFNA 4J1QA 2E82A 2UUOA 5DNAA 3KYDA 4DPLA 2WSBA 2AQ8A 3NT4A 3I83A 4J6FA 2OHXA 3V1UA 5LDHA 3FRJA 1KETA 1TXGA 3KYCB 2P5YA 4TRJA 4WK6A 3NX4A 1YO6A 3KRTA 3EYWA 4ZVVA 4E32A 1XWFA 2EG9A 1D3AA 3ASUA 1ZK2A 4WLFA 4C7JA 1KY5A 4GMFA 1LDMA 1PL6A 3FNGA 3C7DB 1WXDA 3CIFA 2Q1SA 3NDJA 1Y8QB 3GNTA 4ND4A 2VYVA 4PLZA 4CM9D 3ZNNA 4FFMA 4ND5A 3DEYX 3SC4A 4X54A 5FYDA 5T64A 2GR9A 3F1LA 3I9KA 4QFDA 1LUAA 3RAJA 5JY1A 1UH5A 3W4JA 4NFHA 3GPDG 1J5PA 2X86A 2RH8A 4J4TA 2DUWA 4GWGA 4YA6A 4CL8A 2HAEA 1EFKA 3R3SA 5H83A 1VJ1A 4K28A 3DQPA 4PG5A 5G0WA 3ZHYA 4EYEA 1T25A 1HYGA 1C0LA 3F1KA 1OFGA 3ZHXA 5F5NA 5G2OA 3AWDA 1DIRA 2FY8A 3CEAA 1LSSA 5T8KA 3SC6A 4B7UA 4KWIA 4NQZA 4Y6SA 4BQPA 1GZ3A 4BHTA 4KZPA 5IN5A 3ZV4A 1N92A 4PZDA 2YFHA 4RV9A 4Z0TA 1YKFA 3TWOA 3T7EA 3RUFA 3JQAB 1E1KA 1VM6A 3B6ZA 4LISA 1IUKA 1KBZA 4UVGA 2VYVD 2D3TA 2O3TA 1PJSA 3VTZA 4L4RA 2ZYDA 3I1JA 3KYCA 3QWIA 4XJTA 3S2EA 1U3VA 1HKUA 4NMHA 1R4NA 2CMDA 2DT5A 5JDIC 4ALJA 1OAAA 2YDYA 1JVSA 4DMMA 5A3JA 1W0CA 3VC7A 3B1JA 4WEQA 3SEFA 1E1NA 2BD0A 4IDDA 3ONDA 1H6DA 1LXCA 1WDKA 3EGOA 3OA0A 2Y66A 4FGWA 4IQ8A 2HMSA 1B3BA 3K31A 1XQ1A 3DOOA 4U8GA 3WG9A 2G0TA 1U9JA 2P9GA 5TIIA 1DC3A 2RHCA 2X0NA 3D0OA 3E5RA 3GRPA 4WCFB 4DTIA 1P1RA 3K2BA 2B5VA 3CTMA 4I9UA 1BRMA 1EVJA 4AJLA 4ZHSA 2AG5A 2WEKA 1AN9A 3UUWA 2O3SA 2Q45A 3FNEA 3GVCA 1HE4A 4Y8VA 3O03A 4CM8B 4OO3A 5CFZA 3LF2A 4HFJA 3S2FA 5I7VA 2HK8A 1HRDA 5CEFA 3CZRA 1YB5A 5L53A 1H9AA 1ZZEA 4Q3CA 1LLQA 4CODB 4RVUA 1I3KA 2DTXA 2ILTA 1LNQA 3IJRA 4XIJA 5AXAA 3CUKA 5JDIA 3L4SO 4E31A 5JC8A 1GEGA 1Y8RA 3ZV3A 4BNXA 3QV1A 4OOEA 1RM4A 1E3WB 1N9GB 2Y67A 2J5RA 2VOEA 3PEFA 3HFGA 1E77A 3ENKA 4MP8A 2GF2A 3AY3A 2IXBA 2QW8A 1RM0A 1RM5A 1LBEA 5BR7A 3BXXA 1WNTA 1UXHA 2B35A 1I30A 2GLXA 2EXXA 2RAFA 5U4QA 1HT0A 2C82A 2AE2A 3OQ1A 1ZXLA 4IBOA 4TVOA 3CMCO 1PZFA 3G1UA 3WLFA 3IKTA 1TA4A 2HRBA 3L07A 4YJFB 4WLEA 3UCFA 5B4TA 1C14A 1KIFA 4FDAA 3KB6A 4CMEC 5JCJA 4W99A 1WMAA 1FK8A 2PZMA 3RKUA 4EITA 3JD2A 3HDQA 3I9MA 3FWZA 2OORA 2DPHA 4CMJA 1QP8A 2QYSA 1ZEJA 3WGOA 2ZYGA 2VNAA 4FJ1A 1C0PA 3JQ7A 3A9WA 1I01A 1ULUA 1M76A 3KXDA 3RASA 1MA0A 1PWXA 2DFVA 1MGOA 2YQ5A 3PHIA 3PHHA 4RPHA 3VH2A 1AHIA 4CQMB 3HSKA 1B15A 4PZEA 4ZN6A 3D1LA 2C2XA 5IDXA 4YDRA 3QSGA 4IPTA 4DVJA 4F6CA 1A4UA 4FJ0A 4YTEA 2YV3A 3C8MA 4J2OA 2PH5A 3X2FA 4EEXA 5G4LA 1YJQA 4MVJE 1UAGA 2JHGA 3BMQB 3F4LA 5K6AC 4E0BA 4FC6A 3NGXA 4RPKA 4IDGA 4QQRA 4XQCA 1Z75A 4DA9A 3F3SA 1H93A 3KSZO 5A06A 2NVWA 1D1TA 1Y7TA 2GASA 2NSDA 2YV1A 4IGEA 3BHMA 3JQGA 4RCVA 4BNNA 1CEQA 1K3TA 3ZU3A 2P4HX 1WMBA 3QA9A 1RM3A 2WD8A 1KERA 1WP4A 3PFFA 3JQCA 4AJNA 4W82A 4IJWA 3Q1LA 2Y68A 3I23A 4GX0A 3L4BC 2NADA 4CM6A 1H2HA 2F1KA 5TRTA 1YVEI 1ZCJA 1DHRA 4DUPA 4UUMA 4U5QA 1V3VA 3UAGA 1PS8A 3C1TA 4J3FA 2R6JA 1JKFA 2GERA 1CERA 1WPQA 1Y9EA 3BMNA 4Y6RA 4YT5A 3O9ZA 2IZZA 4ID9A 2C0CA 1Q7GA 1UXGA 3MJVA 3U4HA 3B1KA 4LN1A 2D59A 3SX2A 4P4NA 1UZMA 2BGKA 2JCVA 1YE3A 3SLKA 4BKPA 4BUCA 1P44A 1B0AA 5IDYA 3VVCA 3FNFA 1HDGO 3TN7A 1WAMA 2E37A 4IXWA 3VPHA 2VT2A 3EY4A 1EUDA 3PK0A 4MIEA 4ESOA 4L4XA 3HB5X 4YJGA 3WXBA 4LRSB 3PXXA 4XIYA 3ZWBA 4BNUA 3WOHA 3OEWA 1GU7A 4BO4A 4ALMA 1ORRA 1PJBA 1UDCA 3ZWMA 3GNSA 5B37A 4OQYA 1NHWA 1PJ3A 1AE1A 1NAIA 3U5TA 1DFIA 3TOZA 4BIIA 1NYTA 3M2TA 2YUTA 3IP1A 3I6QA 3DB2A 1DB3A 3HE3A 3HNPA 3NUGA 3PZBA 4WKGA 7MDHA 1L7EA 1I36A 1PQWA 1TT5B 3ABIA 5KWEA 4OJNA 2ZB3A 3WQQA 1V3TA 4FFPA 2NU7A 3GG9A 1A5ZA 1O6ZA 5IAAA 1ZW1A 4LCEA 5L45A 2W8ZA 3DR3A 1GL3A 4B4WA 1G0OA 3JD0A 2D1YA 1WWKA 3PJDA 1KEWA 1HDXA 4OXYA 1I24A 1P0FA 2PR2A 4EJ0A 4H3VA 3C85A 4PLWA 4U0KA 1E6WA 3QP9A 5C7OO 2IRWA 4J7XA 3JQ9A 1DAPA 3OBBA 1NQ5A 3BYZA 3LLVA 2PFGA 4G81A 3KZVA 1E3JA 4HV4A 3HFSA 4R01A 2VHWA 2W2KB 5F5LA 1K2WA 3EZYA 3OJFA 2BRUA 4RQUA 3ZW9A 3UXYA 3DBHA 1YS4A 3L6EA 3KLMX 5JAQA 3SJUA 2X5JO 3ETGA 1Q7BA 4XQGA 3RBZA 4CLXA 4ALIA 1UDAA 5ITVA 5IXSA 1QYDA 1GYPA 4IDFA 4R51A 3AU9A 4RVHA 2NWQA 1DJQA 1HDCA 1NNUA 1ZK3A 2RCYA 4YCAA 5DT9A 4PLTA 5C7LO 4DC0A 2DBZA 1VKOA 1P1FA 3WJ7A 4RL6A 1LDNA 2J8ZA 5I7EA 1GADO 3BMCB 1UZLA 2YQ4A 1LDEA 1ZJZA 1GCUA 3C24A 4XGNA 1EVYA 3MTJA 2TMDA 1EK6A 3DAPA 3LC1O 1GPDG 4CV1A 2NV6A 1XR3A 1I2BA 1A7AA 1BXGB 1QXSA 1YGYA 5A03A 5CDTA 1LI4A 3H8VA 5KVCA 3TJRA 2NLOA 4OMUA 1RJWA 4GX1A 1HTBA 5KJEA 3DL2A 3S55A 2HUNA 4WCDA 4CLRA 2W2LA 2V65A 1X7DA 3LK7A 3COSA 3PZRA 4JBGA 3VH3A 4B3JA 2FPGA 3WB9A 2XXJA 3X2EA 4A5OA 3NDIA 4NDNE 3JQBA 3JQAA 4AJJA 9LDBA 2AXQA 3RJ9A 4R16A 3WFIA 3VDQA 4XB2A 5I9NA 3C7AA 3ZDFA 1LSUA 3PJFA 1Q1NA 3WNQA 2GD1O 4FGSA 3IKVA 4I5EA 3VZPA 1FMCA 2VWPA 5I7SA 1IOLA 4CR6A 4CPDA 2GYYA 3AJRA 4IXTA 4K26A 2H9IA 5C5IA 4TQGA 1GUZA 2HO5A 3FBTA 4L8VA 1I32A 4XD2A 2EP7A 2PH3A 1NVGA 1U8FO 4JP2A 1U8XX 1X1TA 3JTMA 4A0SA 1NX6A 1LLDA 2POQX 3LSYA 3WGIA 4S1VA 4UVHA 1F8FA 4F3YA 1FF9A 4LVUA 1E5LA 4RPLA 3LF1A 5KVVA 3RUDA 1OMOA 2A94A 4MDHA 5IZCC 2FR1A 1YRLA 1DEHA 2B4TO 4DREA 1B7GO 4XGKA 1R4MB 3M2PA 1Z7EA 3TOXA 1BDMA 2O7QA 3FN4A 5JE8A 1E6EA 4IIUA 1EBFA 2VUTA 1PGJA 1ZBQA 1KEVA 4D42A 5HM8A 4IMRA 3A1NA 1XHLA 1ARZA 1BTOA 3WBFA 5IN4A 2J3IA 3FTNA 4G2NA 3VPSA 1Y8QA 4IDBA 1SEVA 3ANLA 4I8XA 1O5IA 5JAMA 2QYTA 3ZWVA 3D4PA 2OO5A 1O9BA 1DOHA 3A06A 1VJ0A 4BNGA 4GL4A 3VKVA 2GPTA 3WNVA 4BKOA 1DIAA 1U7TA 2BFOA 3NRCA 4ONEA 1ZMTA 1E7RA 4O6VA 1YONA 2X1HA 1GUYA 1HXHA 2YZ7A 4QXMA 3W8FA 3E03A 2JFGA 2JFHA 1XU7A 4O1MA 2G76A 4Z9YA 2E4AA 1UJMA 4TWRA 2BKAA 4ZQGA 3I3OA 4GKVA 4EJMA 4GH5A 5COQA 4IDEA 4J4HA 3DAFA 3GAZA 3AU8A 1DC4A 2DPGA 2I66A 5CG1A 4NBWA 1FJHA 3WBBA 4TZTA 2PD4A 3WGGA 3W6ZA 2LDBA 5A4DA 3ZWXA 4HFRA 1EDZA 2XAAA 3GUCA 5JBIA 3QVXA 4KQXA 1HETA 3ETDA 4ZRMA 4Z3DA 3RI3A 1Z45A 1BVRA 2O23A 2GN8A 3W8DA 3BTUA 3PI7A 4YBZA 4YQYA 4RQTA 4B3HA 1E6UA 3TL3A 1XQ6A 4PLHA 3VH4A 4CV0A 3F4BA 4MVJG 1LSJA 3OIDA 2Q46A 3KOUA 3GDFA 4Q3DA 2V6GA 2VNSA 4OHUA 4B7XA 1K6XA 1ID1A 2Q50A 3JQ7B 4B8WA 3WICA 4GGOA 1M2WA 3HADA 3KSUA 4IQ0A 4BS9A 2OL4A 4CV2A 5JXWA 4FOSA 1X14A 1JDJA 3JYPA 1YDEA 3F5SA 4J7CA 1H2BA 1JWAB 1NHGA 4II3A 5IZCA 4DYVA 2NNLD 1H6CA 3DTTA 3O38A 4WOKA 4WOJA 1XELA 1TT7A 1KC1A 4W6ZA 1BXGA 5BSHA 4IZHA 1FXSA 3W6UA 5ER9A 4OKNA 2X0JA 1PJLA 1U4OA 1LRLA 1OC4A 5BQFA 4JXKA 1W8DA 2HMVA 3ADOA 4AJHA 3IL2A 2DBQA 4YWJA 3JQGB 1PGQA 1GAEO 3OP4A 4ZICA 1NVMB 4GQAA 4PGFA 1GQQA 4JGBA 4NJOA 5L4SA 2IXAA 3K73O 3R1IA 3ROKA 2QRKA 2FP4A 2OMEA 4TVBA 4D43A 3GH3A 1DAOA 4RF2A 1HZZA 1T26A 4BKRA 3LQFA 5HA5A 1SCUA 5JDCC 3PJEA 3F6YA 4R54A 1GV1A 3KLPX 4R5MA 5DBGA 4HXYA 5I8ZA 4ND3A 3EC7A 3WDSA 3BHIA 3D3EA 4BNLA 5IZ4A 3QE3A 2Q1UA 3OJEA 3P19A 4QUKA 4YAGA 2ZIZA 4E21A 4YXFA 3VKUA 2A92A 4QO7A 3LDHA 5TS3A 2I6TA 4CMIB 1LEHA 3GNQA 1F12A 5ICMA 2JAHA 5KJ1A 3ON5A 1OOEA 1Z7BA 1R37A 1V9LA 2WYUA 3Q11A 1B8VA 1PZGA 3TPCA 4QO8A 4R69A 4YAJA 3BMOB 1JKJA 4TSKA 4RVSA 2WE8A 4NFYA 1EEHA 3OM9A 1ISIA 3F9IA 2AW5A 5TT1A 2FN7A 2PA3A 4A10A 3VHRA 1P1IA 3HDHA 4YRAA 2AA3A 1LLCA 3ASVA 5JNLA 3H9GA 3JYOA 1JAYA 3FCOA 2EF1A 2Y1OA 3INRA 3STHA 2P68A 4N18A 1N5DA 1T2FA 3A14A 1VRWA 2ZQZA 1LQUA 3GY0A 3GVHA 3BMOA 1ULSA 3JSAA 4KMSA 1Q2XA 5BSGA 4HY3A 2OUIA 2Q99A 1A72A 3E48A 1SOVA 3PTZA 1B8UA 4IGFA 1GYRA 1G0NA 2ZQYA 3KUXA 1B16A 3MOGA 4PLYA 4F6LA 4N5LA 5JO9A 1ISFA 4RF3A 1ZH8A 4AL4A 1NPTO 4TROA 1R0SA 4IUYA 3GGOA 5FI3A 3INGA 4RLHA 4KTVE 4KOAA 4EZBA 1C1DA 5CDSA 4TRNA 1MXHA 3FI9A 3HN7A 3EAGA 4OGWA 4IZIA 4U6SA 4BNWA 1ADCA 4MVJI 1GQYA 2IODA 5IF3A 5KVSA 4LRTB 3Q9NA 3RBXA 4BO7A 2FR0A 2D0IA 2HSDA 3NKLA 1R0LA 3QW2A 1FDSA 3GGPA 4IIVA 3UF0A 5CDGA 4XYGA 2W2KA 5KVQA 5CEJA 4E5MA 2AQHA 1GV0A 2QRJA 1K89A 3TZKA 4OH1A 1K6JA 3ULKA 3HWRA 1UP4A 4L74A 2NU9A 5BSFA 1E3EA 1ZXBA 5LCXA 3TSCA 1E0DA 4BNFA 4ZQEA 2O4CA 2PGDA 4N54A 2G1UA 4IM7A 4BMSA 4LK3A 1MUUA 4K6CA 1RPNA 1WZIA 3OIGA 4RGBA 4XGIA 4E5YA 2P9CA 5G4KA 5JFOA 2DFDA 1QYWA 3R3JA 4F45A 3BMCA 3TF5A 1E1MA 3VTFA 3W4IA 1PR3A 2C54A 5JCXA 2CDCA 1HDOA 3IDSA 1A71A 1HWYA 4GI2A 1PJTA 4E12A 4WEOA 4MVJM 5T6BA 4YYZA 4JJGA 3LT0A 5FFFA 4LVCA 1ONNA 2EW8A 3ZH2A 1UXKA 1EUZA 3AOEA 4BKQA 2CDAA 1W4ZA 3K6JA 4OL9A 3OETA 2QZ9A 2O4UX 3ZNOA 2VCYA 4IQGA 3F5QA 2PWZA 4GKBA 2Y1EA 4BNHA 5F1OA 4WNCA 1R66A 2OP1A 1ENOA 1DRVA 5IXYA 4MJLA 4BO0A 1DC6A 2Z5LA 3P2OA 3TDKA 3GMDA 3RKRA 4GWKA 3G17A 1DDOA 1DLJA 2Y1CA 3JQDA 4HWKA 1PS0A 2O48X 4L9RA 3L4BA 4HUJA 1PIWA 4NG5A 5DOVA 3SVTA 1GD1O 4UEKA 4BO2A 3HHPA 3JV7A 1E92A 4RZHA 4ZQBA 4E2WA 1J4AA 2VWQA 3PDJA 4UVEA 2ZTMA 4XEHA 1QLHA 1X7HA 3ROMA 4CQLB 1ZK0A 1GQ2A 5CDYA 3RJ5A 4CUKA 4J1NA 3L0DA 4JNKA 3T4XA 1Z6ZA 2JD1A 5G4KB 1P0CA 1VJTA 1JQBA 2I3AA 2O2SA 4JROA 4E5NA 5CG2A 1O89A 2P4QA 3MEQA 1ISGA 1V8BA 2CSUA 4RJTA 4MKRA 4JIGA 2BFAA 3DMYA 5GMOA 4IJVA 4A27A 4FPXA 1NQOA 4ND1A 4PZCA 5A9RA 3D7LA 2CY0A 3IIEA 4M54A 4HFMA 4LSMA 1U4SA 2NU6A 1E3WA 5COAA 2D2IA 4YJDA 2X4GA 2DC1A 3U09A 3RIHA 2W90A 3H65A 5JS6A 2EIHA 1VC2A 1JTVA 3ROPA 3PHLA 4OSOA 2FR8A 4IDCA 3O8QA 1HDYA 2XXBA 3IQDB 3H9UA 1R4MA 3PHJA 4CM5A 5U9CA 4RVFA 1NFFA 2YV2A 2CD9A 4CLHA 1U3UA 4D45A 1LC0A 2HK7A 3DZGA 1N9GA 1HL3A 2BH9A 4XRRA 2A9FA 2Y99A 2NUAA 1YQDA 1NTOA 2HMUA 5EINA 3I4CA 4KUGA 1A9ZA 3S2GA 1R16A 2BHLA 4R5HA 1YBVA 3ZHZA 1H94A 3WGYA 4M87A 5T57A 2C29D 3ZWAA 4J0EA 1OI7A 4R1NA 2H1SA 5C3MA 1M6WA 1SOWA 3CKYA 5HS4A 2QZZA 3VPXA 2GN9A 1C1XA 1VPDA 4R4JA 3UHAA 1DRWA 4XYBA 5DCWA 3RFTA 1BHSA 3MTGA 5IDWA 1DC5A 1TI7A 3DZIA 4XYMA 4BO5A 1N2SA 3GA0A 3TFOA 2X0RA 3ZU4A 4OSPA 3NTOA 1Q7CA 3H6KA 3NTRA 5TJ9A 3WFJA 2R00A 5IJZA 3KSDO 2F00A 1DFHA 3V2UA 5LC1A 2EP5A 5KJCA 1A4IA 3AUAA 3P2YA 3PGJA 1B3RA 3RUCA 2IYPA 3GHHA 3E9QA 1X0VA 1VSUA 3PLRA 3AM5A 4YRDA 4PLGA 4BNMA 3D5TA 4I5GA 4XQEA 4JLWA 4TRMA 3NJ8A 3VVBA 4AICA 4I1IA 4K9DA 5ITWA 1OC2A 4N7RA 5TJHA 1E7MA 1PU2A 2NVBA 4EW6A 4B4UA 2HMTA 5CAEA 1J49A 1N1GA 1F17A 2JD0A 1IZ0A 3V5NA 4Z9FA 2EHDA 5JAZA 4EUEA 1LA2A 1QR6A 4PVCA 3GZNB 2VZ0A 1H6BA 3ZI0A 3GT0A 5ES3A 2FPIA 3L6OO 4PLPA 5JCJD 4J9VA 3GVPA 4BNTA 4E2YA 3LT2A 3JD3A 4QSMA 5GZ3A 1QRRA 3OSUA 2AG8A 2O3QA 2ZJ1A 4Z9XA 3ICPA 2AE1A 4YJFA 1E3IA 1TLTA 2H6EA 1DLIA 3TQHA 2P91A 3TNLA 3U4IA 4LGVA 1X0XA 2Q2VA 3PLNA 1JVBA 3AUTA 4B4OA 4BO3A 1CDOA 3A28A 1KVQA 3U0BA 4XZ3A 5DULA 4XA8A 3S2IA 4DIOA 2Z1MA 1U2GA 3G79A 2X58A 5F1PA 1LRJA 4XQ9A 2ZCUA 2XPCA 1U2DA 5CDUA 1PQUA 1JW9B 1B2LA 5I9LA 2HMWA 2WWRA 4WLVA 5DBFA 3L9WA 5KTKA 1PTJA 1UZNA 5DOZA 1FDVA 2B83A 3OH8A 4BGIA 3QQPA 5L4LA 1I3NA 3HUDA 2PKQO 2GCGA 1O94A 3DBVO 1YH3A 2JD2A 4G5HA 4L76A 4WLUA 3UKOA 1PL7A 2DVMA 1NPYA 4Y98A 1U5CA 3OECA 3QIVA 1GCOA 1LTHR 2B37A 1DJNA 3ST7A 4J91A 1CQIA 4FN4A 2I3GA 1MFPA 4AJIA 2VT3A 3GOHA 5DP2A 1EVIA 3WWYA 2W4QA 3PYLA 2FSVA 2VWHA 1KC3A 3U49A 4CM7A 3GFGA 1NAHA 4Y6PA 1NXQA 3CXRA 4O5OA 1YL7A 2NVUA 4S3MA 3M1AA 2GO1A 4FD3A 2PKQP 3HQ4O 4PIVA 3UCXA 3DWFA 3HDJA 4PVDA 4YAIA 4DLLA 4BNVA 1UXJA 4WGGA 6LDHA 4YACA 5G0SA 2BLLA 5L51A 1FDWA 3PYXA 4W9NA 4IMPA 4TRRA 1CF2O 1X15A 2PY6A 2QQ5A 1W73A 1L7DA 1QG6A 3VDRA 3OA2A 3LVFO 4XX0A 3LT4A 4YB8A 1ZO8A 2FMUA 2PTGA 5CP8A 5THKA 3ZU5A 1ML3A 3PGXA 1KVRA 1SPXA 3IC5A 4FBGA 4M49A 1HLPA 1O95A 2X0IA 3GEDA 3N58A 3QY9A 4II2A 4IS3A 3FR8A 3H2ZA 3OFSA 4K6FA 4XYLA 5K9ZA 3S8MA 3L9XA 2HRZA 4CLEA 4FB5A 1YWGO 1E7YA 1ZKMA 2C5EA 2HU2A 3AM4A 3GN2A 1NFRA 4YJGB 3DMTC 8ADHA 1SEPA 1VE9A 3U3XA 4H7PA 2AQKA 1G6KA 4BB5A 1U3TA 4PFJA 4CMBA 4BNYA 2XOXA 4E4YA 2FSSA 1M66A 1NASA 1U3WA 3DOJA 2DBVO 3V8BA 1GZ6A 1ZSVA 4JP3A 3JQ6A 4RDIA 2UYYA 3T7CA 1SNYA 4O59O 3GMSA 3NT2A 3GPIA 3I9LA 3PP8A 4WPGA 1ISMA 2WDZA 3DAGA 3E9NA 2BGLA 2ZB8A 1E7QA 4PLFA 3RUAA 5JLAA 4M86A 1LRKA 3WSWA 3NTQA 3GC6A 3G1TA 4GGPA 4UUOA 3RC1A 3Q6IA 4OXNA 2AEJA 4GAEA 3GEMA 1EFLA 3GF4A 5BNIA 3GR6A 1JLLA 2FHSA 4IJKA 1OZAA 1Y5MA 2LDXA 4NPCA 5AYVA 4MVJD 2B4RO 3WGQA 1R6DA 3VAZA 2PD3A 2V7PA 1YB1A 5K0ZA 2I5PO 3E82A 1ADFA 1MB4A 4R1UA 3WYEA 2WMDA 4BO1A 5T5QA 4Q3NA 4WCFC 3PHGA 3AW9A 1YB4A 1UAYA 4KQWA 4INAA 3VZSA 5I7FA 1ZK1A 5EMHA 3WTCA 4MINA 4M8SA 1KS9A 1QMGA 3Q2IA 5TQVA 5GY7A 2GSDA 1HF3A 1HEUA 5EESA 5BT9A 3AI1A 3JQFC 2DU8A 5L7YA 3RU9A 4UULA 4CQLA 3DTYA 2ZCVA 4DXHA 1GZ4A 1GR0A 3IMFA 4FJ2A 2SCUA 4O63O 4UEOA 2H63A 4L73A 1LSOA 4BNKA 3R0IA 1AGNA 4R3NA 2VHXA 1R15A 3BA1A 4CMKA 3DHEA 1MLDA 5JC1A 3NT5A 2WM3A 5AVOA 1D7OA 1ZVMA 3CPSA 1NPDA 4HADA 1Z73A 5KNLA 2OP0A 1SC6A 4E33A 2JCXA 2DLDA 1LU9A 4WJZA 3H3FA 2NVUB 2UV8A 3PQDA 4EEZA 3IJPA 3VH1A 2NTNA 5EQDA 4B7CA 4DBZA 3GRKA 1U5AA 4D3FA 5FI5A 5CEEA 2UAGA 2GN4A 2W98A 4GLOA 3K8ZA 1TEHA 4XKJA 4PG7A 5BNFA 3C7CB 4YEDA 4EUFA 3A4VA 2DKNA 4FC7A 1EZ4A 2AQIA 2X5OA 1Z82A 2J3KA 4ZQHA 2IZ0A 4NU6A 5EQFA 3OF2A 1A9YA 3PVZA 1GYQA 4P4LA 1XA0A 4GVLA 3RU7A 4J7UA 1SMKA 3GVXA 1PJCA 4J90A 4R1SA 4BMNA 3QVSA 4AVYA 1QYCA 2CUKA 3G49A 3U4CA 5JSFA 4DC1A 4XR9A 3KO8A 1N8KA 4GBJA 4FQ8A 3VPGA 4LMPA 5HRUA 2X8LA 4UVIA 2PLAA 1E5QA 4HNHA 3RC9A 2Q3EA 4URFA 3HN2A 5COBA 5KKCA 2YFQA 2WJPA 3ROQA 3OJ0A 2QX7A 2A35A 2B5WA 2X23A 3WIEA 3AOGA 2BMAA 1E3SA 3TL2A 2G17A 4RZIA 4OIMA 2O3JA 5KKAA 2AMFA 1IHYA 1M75A 2GUGA 3NAQA 4UREA 3H4VA 2HJRA 3PWKA 1B14A 3N74A 4NFSA 1HDZA 1LDBA 1J6UA 2VHVA 3DZBA 4DWVA 2ZTVA 2O3RA 1I8TA 2O7SA 1YBAA 4EJ6A 4YAEA 1EQUA 2IYOA 1V6AA 2BI7A 2GGSA 2NU8A 3E6AA 4EGFA 6ADHA 3ZWWA 4J1SA 1BXZA 1IYZA 4ALKA 4ZJUA 2DTDA 2IZ1A 2R2GA 1CYDA 2DBRA 3H9EO 2QRLA 3OQBA 5CHEA 2FOIA 1CETA 4AJEA 2Y1FA 1C1DB 3DOCA 2V6FA 3JYNA 3D3WB 1I33A 4E30A 4DPMA 3CE6A 3OQ6A 3LU1A
chains in the Genus database with same CATH superfamily
1JJ7A 3B3FA 2ZAYA 2VYFA 4XTCS 5DNEA 1T2UA 4TKMA 1BE1A 1I4EB 1Q91A 4PRLA 5B12A 2ZSUA 4MP6A 3OPVA 4DNPA 4X3OA 1XNHA 5AXDA 3WTBA 5KTRA 1OW3B 3DL0A 4O3MA 4PAGA 4NR0A 3QWAA 1S4QA 3DXZA 2Z6UA 2QAJA 3ZU6A 1VP9A 2B2NA 1XSEA 3OPYI 1DWQA 5LBIA 4XUGB 5DHPA 1QX3A 3ZXYA 1YC2A 4BVFA 4GM4A 1I2ZA 3ET4A 5SYAA 4N0EA 4P83A 2VPQA 3NOVA 2B1IA 5LXTA 4OJQA 4M9CA 5DLDA 1E1QA 5HM6A 1EE2A 1RQGA 2GK3A 5JXGA 4PQRA 5KDDA 3QBTA 1RWXA 1AOXA 1NW4A 2GBLA 4MA0A 5E2AA 3DVQX 2A5DA 3X1DA 4CMHA 1MEOA 1FSGA 2Q3BA 2RBEA 2YXPX 5CCEA 2B69A 1T5SA 2ZTUA 4JODA 3C1AA 3TAXA 4UXIA 5EZQA 1W5SA 2R1TA 4KTTE 2XRFA 4NIMA 3U16A 2UYOA 1T24A 4B34A 1F4VA 4DIMA 3QGMA 5KIAA 2OV4A 5DRYA 5DWDA 3PD7A 5CJ2A 4O1HA 1HTWA 3MCAA 1VDMA 3KOOA 5IRCD 3ZJTA 3TW6A 1C7ZA 1VJCA 4YI5A 3GLIB 1U2EA 2VTDA 2BFCA 2WTEA 1T3GA 1GT91 2AD1A 2FP3A 4CN9A 3HKBA 5JS2A 3DBHB 1I3CA 2C92A 2O0HA 2OKCA 4WGFA 3ZK8A 4B46A 5CT4A 1KYQA 2OZVA 4HDKB 3ESDA 5JDCA 1X13A 4DV6B 3NC4A 4U3JA 2W2LD 4QNMA 1XTUA 3W8NA 5F98A 2EZUA 3N2EA 4LMRA 1IQUA 1RLJA 3M4YA 4LRUA 3EEIA 4GR4A 1UFVA 1A82A 3BHJA 5JR3A 4JQCA 5EXEA 1ORDA 1OU0A 1SJ9A 3H42B 4IXMA 4MUAA 2UZ1B 5F51A 3STWA 2X9NA 5D5QA 3NXSA 5BY2A 1TM5E 2PIDA 3SKXA 1KBOA 2R7NA 1TYCA 2ATIA 2WJ3A 2SBTA 1ISHA 5F2EA 1XQXA 4DY6A 4P08A 1TB4A 4F38A 2PZJA 2ZYVX 1WLSA 1H9BA 1KO1A 1DX4A 4R3UC 1L8QA 3L7IA 3E2MA 3MWEB 4OAQA 1IZYA 3S28A 3UIEA 4DHWA 5ALVA 3IOMA 1VG8A 1DQSA 1NNI1 2GN6A 1DAIA 3QM1A 4MLDA 5DYIA 2R25B 3RGWS 4LQ4A 5K51A 1AUPA 1Q0QA 3T0IA 5ES4B 3ZW8A 4IWNA 4BU0A 3KTFA 1FTWA 3QBJA 1CDEA 3WLTA 1D4FA 2AFIB 4RL4A 3HMKA 5AXCA 2FF5A 2Q6KA 1QSGA 2IYQA 4N03A 4R68A 4IIGA 3MLBA 4IJUA 2COUA 1ODJA 3KKMA 3MBOA 1LBSA 3UAVA 1VLVA 2IU0A 1C8LA 1EGAA 2XOKD 3DM5A 4LZNA 3V34A 5MDHA 1WXEA 4MRSA 2MYPA 3EFEA 4F9EA 2ECOA 3GRFA 3M6WA 2BFCB 2HRRA 2VDVE 1TCCA 2AX4A 3UPTA 1V6SA 2B0JA 3NDPA 4CKXA 3PUWA 4UJ3A 2V7UA 3HCCA 4MGEA 1FDIA 1KY2A 4Q82A 1YNSA 5HG0A 1BHJA 2P2SA 3EDQA 1Q3HA 2QHXA 3GLFB 1QG0A 3VDNB 4CW7A 4U2EA 2V74B 1HYEA 2VPPA 3QHQA 4IKPA 4MUMA 5BQ3A 4JJIA 2DMRA 4TZ6A 3GRAA 3OCCA 3FDZB 3VVLA 3F3YA 1FZTA 1TJYA 3D7MA 3ZK7A 1OBOA 1R18A 4ZI5A 4CCSA 3DTVA 1C0KA 1L6RA 4GVXA 2H48A 1COWD 2VUHB 3DBLA 3N7UA 3PIDA 4G63A 4MWZA 4O4JA 4JLSA 3V00A 3U62A 4FFBA 2ZE6A 3Q3HA 3RAFC 4BO6A 2BZ0A 5K3OA 2G7MC 2PUFA 1Y7LA 2XDAA 1E7SA 4UMEA 1PBTA 3UGKA 3PGMA 4ARZA 4DA8A 5CFLA 2ON6A 5JW6A 1G18A 1RI5A 2NO1A 3DOHA 3LV8A 1P62B 4X3PA 1QHIA 4K1LA 4R9NA 1RZRA 1SG0A 3NIWA 3G8AA 3GK3A 3VO9A 1A27A 4K2HA 3BTVA 1YFJA 1VLJA 3EQ8A 2AJCA 2QP9X 2EJUA 2A1UA 2V59A 3K9CA 2Z08A 2XA9A 1XJQA 1Z13A 3DE1X 3KUCA 4JI3B 1J42A 1IBKB 5F4ZA 1J0AA 1J8YF 4DR6B 3ZS9A 4AF6A 4DCNA 3WLIA 3RSQA 3O8RA 3HA2A 1D1PA 3W79A 2GHIA 3CJQA 4R9RA 1Y8RB 5KX5B 2ERCA 4ZVMA 2IH4A 3BWYA 1QRSA 4FUTA 2R8YA 5CX1A 1GL9B 4QQ8A 3V48A 1FDTA 4TS9A 3WYGA 2QUJA 1NVXQ 1FL9A 1PWEA 5EVJA 3W9BA 3PF9A 4H7DA 3JQ8B 1TAUA 3VQTA 3VYSB 3GFTA 3IEPA 4IFTA 1O8CA 3JALB 1W59A 5E4YA 5IC5A 3RRBA 4C6SA 1T6ZA 3E9EA 1XZIA 3W90A 4CT4B 3Q3CA 3LPLA 4XSVA 1DO0A 1IPFA 1BMDA 3ICCA 1RKVA 1K8YB 2G04A 3EFOB 3AUUA 4PS0A 1M67A 1P2BA 3VX3A 2QYHA 4KFSA 5F73A 1SCUB 2GT1A 4UW9A 3Q7QA 5TQ2B 3KU4A 2PS9A 2HXGA 1HG1A 3A7EA 1U7UA 1SD1A 1BNCA 3CEMA 3DO5A 1QH9A 3I4FA 3LZCA 3OIUA 1X74A 3UAYA 3VPDA 4ER5A 4QFMA 5BSTA 1FNCA 2W71A 1Y1SA 4AJKA 4JDUA 7AT1A 3WA7A 1JA9A 1EE9A 3MBIA 2ZR7A 4FR0A 4PGHA 3IAM1 2I6QA 1L5OA 4QDZA 4HYEA 2W2VA 4E03A 1AD2A 4I50A 2PX8A 5HQTA 5C37A 4XUDA 1YJ8A 3D64A 1C7QA 4WCVA 3CSUA 4DCOA 1ZMOA 2C5BA 3G2KA 2NUTB 1CDDA 3T0GA 2OQVA 1ZONA 4GPZA 3IP5A 3QPBA 3DXYA 4JI6B 2V3WA 3ZZNA 3QTTA 2GH1A 2XE7A 3L7LA 4H31A 4WLOA 2J9FB 4AULA 5EMMA 2C58A 3PQ6A 1VHQA 3S70A 4ZZ1A 5CT9A 2JJMA 4LC9A 1JDSA 4WESB 4I4IA 3SICE 1YAJA 3OQ6A 3MJSA 5FWDA 1D1SA 2GN1A 1RI1A 2V8OA 4JQZA 2AF4C 2WF8A 3V8PA 4DMLA 4WE3A 4QJIA 2DPLA 4Q00A 4EBFA 4EG4A 2VTBA 1PDWA 2R62A 2F1HA 2MIIA 3M83A 2FG7C 4FQ7A 3QMWA 1V8FA 3D3WA 4I5FA 1CQPA 4DRXA 1WHTB 2RI0A 3CEJA 4QDUA 3QITA 1B8NA 1G4HA 2C2OA 3D8HA 3KZOA 1KDOA 1CX9B 5EUMA 1HNWB 1SUSA 3WYCA 4F2DA 1PGPA 1FSZA 4P7KA 4HPJB 4E2XA 1RWMA 4NBRA 4D4KA 1GRNA 4OCZA 3G2JA 3DV2A 3T1HB 2GN0A 4X1IA 4HDQB 2EIXA 3AIMA 2IHKA 5IJWA 1J99A 1ZICA 5FFNA 5JD5A 2ZBRA 1N7HA 2TRSB 4CKEB 1RXVA 2Q41A 4KXVA 3REOA 4Q6BA 5E0KB 1GPLA 1WPGA 2OG2A 4LOKA 2J7PA 5AI5A 1Z25A 4HXGA 2P75A 2V45A 3T5DA 5F7JA 3QTBA 1JX6A 1A8SA 4HLNA 4YIHA 1UEIA 4G0VA 4JU8A 2ZS8A 3WMFA 3HJBA 3CPEA 3WX0A 4HK4A 1A8PA 4J6EA 3PG5A 4IVRA 3IIKA 1G19A 1H2FA 1ZHHA 5K0BA 3AEKA 2JLRA 5EWMB 1OV6A 1UXIA 4QEDA 1NLYA 1E66A 5JS7A 3LUDA 1OH8A 2BGGA 1XUOA 4ZIRB 2X9VA 5L8VA 2GJSA 1SUEA 4HN4B 1NSFA 1ZGHA 4I5DA 5TSDA 3SF8B 3P32A 2XY4A 5JPIA 1T4BA 1FJGB 2CLFB 1T8SA 5A7FA 1Q15A 2XNDD 1VYVA 3G0BA 3KZXA 4CR7A 4EHIA 5JY6A 1O94D 1XZNA 2HPAA 2ST1A 3BGOS 3QVOA 4EG3A 3PUHA 3R7FA 4LG1A 3HDYA 2PRSA 3HJGA 5TX7A 4R9SA 1VMIA 2IA5A 3NHAA 3PFWO 2WAMA 3DP7A 1GARA 5ALHA 1XWWA 3H2SA 1TMGE 4ZDIA 4CHTA 4GPEA 3B6MA 3T06B 2Z1DA 3W4KA 2HTEA 2PLRA 2JDID 1GXSA 2YYYA 3K0AA 2OB2A 1SIOA 4B83A 2CYCA 3GFQA 2WG2A 3DFZA 1IHXA 1SFRA 1ZBDA 1M1YA 2R6HA 1UP6A 2IPOA 3NJ4A 4WA8A 6NULA 2FSUA 1OAKA 4U7PB 2R96A 4GXNA 4NI5A 1PSZA 2WU8A 4DWWA 3L0BA 3T3NA 1GUDA 4RMJA 2XDWA 5JH7F 4EP1A 1WV0A 1YK1A 3KBOA 4NE2A 2OXEA 4ZXPA 3TOSA 1N5MA 3DGEC 3RH0A 1BW9A 3IQXA 3R6DA 4MWTA 3ZY4A 3GLHE 3N6VA 1BOOA 1U3CA 2O2XA 1PQYA 1WW8A 2ZJBA 3EEYA 3JCZA 4ZIRA 3QFTA 2CN1A 5JI2E 3U44A 5IDQA 1JIUA 4QHYA 8LDHA 3L8DA 4RFSB 1QQAA 4P32A 1GN9A 1PJZA 3DEKA 3IUJA 1P72A 4ZYZA 5HBGA 1VCHA 1EDBA 3W2IA 4CMCA 4RACA 1JUDA 5DBEX 3R5TA 3TXAA 1Y1TA 1YA4A 2HCTA 4ZU3A 1N2CA 3UATA 1NQAO 4AJ2A 3E8MA 5FWNA 2HT1A 4WASA 3RABA 5FR1A 4MIKA 2HXSA 3QNWA 3NHFA 1WO8A 4WOBA 4ZHQB 2PUCA 1C1YA 5GQSA 2X7HA 2IU6A 5K3AA 4BAZA 2JHCA 3EEQA 1WDLA 3R09A 4GIBA 3CZ5A 3TGWA 4LYEA 3EW7A 3MRVA 4JLOA 4LJSA 4YRRA 1RRVA 4MSUA 4KVGA 2OFFA 2GS9A 3SEQA 5LXTB 1BQ4A 3EVGA 2OD9A 5FFMA 3E9CA 3W1WA 4FR5A 1JHXA 2EFDB 3MSCA 1K4YA 4TN1A 5EXSA 1NQTA 1Z4IA 3MWDA 3L6RA 4S1PA 4UNPA 1MP0A 2WW8A 1XP8A 2BZ1A 2WJ6A 1LDGA 2JZCA 3HBJA 4G5GA 3O82A 1H0KA 1GFWA 1LW7A 5K3FA 3UY4A 5DMXA 1II0A 2P5UA 1KIMA 3DHNA 3EPPA 4L6AA 1Z9BA 2CF6A 2JIBA 1RWKA 2ZJ3A 1C3XA 1K27A 2NACA 4NLLA 3VJMA 1U0GA 5K0JA 3CBGA 3A26A 3EZLA 4AJPA 1J20A 3RC7A 1FW8A 3OWHA 1UOPA 3P2IA 1W4LA 3N5KA 1WSWA 3WGLA 3WKDA 3VYRB 4EA6A 1K3UB 3GLQA 5GVRA 3D02A 4WK0B 2QXYA 4KDEA 1GZDA 5DXJA 2Y2VA 4CTKA 5ICSA 3SBOA 4EMTA 4MVJF 1VIDA 3OZDA 4HLUA 4JZKA 4AZVA 1SVWA 3W2EA 1U81A 2QNBA 2W11A 4Y2JA 4AFNA 5AP9A 3KDSE 2HSGA 4RX1A 4U3JB 5HXAA 3Q0EA 1PE0A 3C6BA 5FYQA 4C4TA 4CYMA 4BY9E 2P27A 3NIFB 3U48A 4E07A 1XZFA 4NBUA 4Q4AA 1AF7A 1CP2A 4MQMA 5K0FA 2AXEA 3ZCRA 5J9FA 1B23P 1P1KA 1HYHA 3D6NB 1Z0ZA 3F5FA 3L1HA 4FGJA 4N5MA 5CH8A 3SIPA 5K8JB 2YV5A 4Q7QA 4YS6A 3R2JA 1JT9A 3H2JA 3ZLBA 4DARA 3VNVA 1P2SA 1K86A 1UPBA 4DJJA 1EQ2A 1ZX1A 3IKLA 4ODIA 3PNPA 2IDKA 5E4FA 1OXUA 1W5EA 3QLUC 5ALQA 2H4YA 1GP2A 4RKYA 2VP4A 4A8HA 2BH2A 1X2BA 1W2WB 1II8A 3MWFA 1NW7A 4PLCA 2CDBA 4R7GA 2H1HA 3T3GA 2ZM6B 1PSDA 1DIBA 3EVBA 3FD8A 4B6FA 1Z47A 3B5EA 3SF0A 2I91A 4PHCA 4H7KA 1A2OA 4RDHA 2L69A 1G5RA 4P38A 1G17A 2AR7A 4RPGA 4TYMA 1HLFA 4Q9IA 1VECA 1BGVA 3WA6A 1CY7A 3PXBA 4L22A 1MEEA 1DGQA 3AEQB 1J23A 4LE0A 1J0XO 2H0QA 1SZJG 2CCJA 1TYZA 3MCVA 3PNLA 3WLRA 3FIJA 1A7KA 2NG1A 5JXIA 2BI4A 3PDHA 1VLLA 2V4ZA 3E9DA 5HBRA 1KEPA 4B9EA 2W93A 1ECBA 2ZYWX 1RRPA 3C6ZA 3I9NA 1XDWA 1ZC3A 1B1AA 2VSQA 1AQJA 2WSIA 3WMXA 3ISVA 3RHTA 2X13A 4CLOB 1BGWA 4GX2A 5DE3A 4A4DA 3NDRA 1IB6A 5KOIA 4JOQA 3HH8A 1MX5A 5CMLA 1P5RA 1VL0A 4JN6B 3Q7TA 4N5NA 5HWSA 4S2EA 1LI7A 3SC2B 1KAEA 1QGUB 1DIHA 3FIUA 1Y5IA 1ISSA 2I76A 3KOZA 1F6DA 3ANNA 3NATA 3ORRA 4M9XA 1R0ZA 2HH9A 3VNQA 1RACA 3DR5A 2I3DA 1I3LA 1QOZA 2XVMA 3SHTA 1XMIA 2FDXA 1RS0A 3DBLB 4MVWA 3VPFA 4Z3OA 4JC5A 2CFCA 1XD8A 3GDOA 4HB4A 1S7CA 5TQ0A 2PANA 2GBIA 5BV1A 4MR7B 2E9SA 5HJ7A 3LUBA 1RYDA 2NOAA 3V2IA 2AGVA 2Z04A 3TE6A 4D44A 4H4DA 3UYLA 1KVSA 1E9RA 2C3PA 2FPMA 4RK5A 1T8YA 2L42A 5JMPA 1MQSA 4G67A 4X1KA 2ZUDA 4RF5A 3KUDA 1L5RA 3RTAA 4F21A 3TQCA 4BGEA 3LJKA 3AWIA 3B9PA 4U02A 5C31A 3V7NA 1XMXA 2C7GA 3HABA 4KQMA 2EKQA 1U0HC 1Y6RA 2QLFA 2YY5A 3CUUA 3JALA 3LYLA 2PUTA 3QLJA 1H3NA 4LXYA 3UW3A 5A5FA 1ZH6A 5KTYA 1V35A 2FEAA 2K2QB 4OV6B 3AVXA 4O2BB 2FRDA 2X8BA 3MT0A 1CW2B 5FF9A 2BONA 5LFAA 1OPXA 4LZLA 3I6IA 5HEKA 1RRCA 4CL0A 3I76A 4B6RA 1EWYA 1R4AA 2PVPA 4L28A 5DBIA 3UKJA 4DUGD 2XDYA 5KSWB 1JTEA 3ND5A 1OBHA 3DMDA 4FCCA 1VHJA 2ZATA 3E15A 4EDFA 4NU0A 2OAQ1 1BX0A 2ZYRA 3COVA 3VR1A 4LJAA 4FZVA 3ZWYA 1KFJB 4AJOA 5JZOA 4WHMA 3K2QA 2DWCA 2HA5A 3HLYA 4PAMA 5DEIA 5HCIA 3WJAA 4YP1A 2BSQA 5KYUA 1NJSA 4QECA 1E20A 4GSKA 4BFXA 4GF5A 5AO9A 4YRSA 5KCZA 1I7QB 3R7NA 5GTDA 4HH1A 1RYEA 2WT4A 3ND7A 3K5PA 1ADBA 1FMFA 3UT5A 1XD2B 1GXSB 1CVLA 2Q1YA 4NZNA 3EGEA 2P4UA 4PAQA 5TGDA 1A50B 1M1NA 1USGA 2QV7A 2B36A 4L9WA 4OQ4A 4GYJA 5GONA 2PZLA 3AW8A 5ENVA 5IT4A 3GP3A 3I2KA 5LLSA 2FRDC 2WPDD 5IUKC 1J8DA 1SN7A 1GSIA 3DT8A 3MOIA 2AN4A 2ZU0C 4BEWA 5KOHA 3QBVA 5BUQA 1CZLA 3R3XA 3WGVA 1W9MA 2BV3A 4RPCA 4A2WA 2C4NA 3CX4A 4KEAA 4WJLA 2WB2A 4YRQA 2Q1TA 4M88A 1Z62A 5CW2A 5UKDA 3RRXA 3NHPA 2C3YA 2J5KA 2XX3A 5CT6A 1BDBA 1MN6A 2NYUA 4MRMB 4PC2A 5JMOA 5EEGA 2P9HA 1R12A 3NB0A 4DIBA 1QRUA 3RTCA 1E58A 4IYJA 1UC8A 3GH1A 1U3FA 2FSFA 5HZHA 3TZHA 1M2EA 2GTHA 3ZNQA 3PRJA 3A6PC 1CRWG 1MTZA 3TB6A 5IP5A 4P4GA 2NSYA 3LC7O 4QOHA 3RS5A 3SM9A 1A5TA 2ZIAA 3HJUA 3ZWPA 3WC4A 2OT3B 3M1YA 4YJHB 1EFTA 1MAUA 3DONA 5LQSA 4A8PA 2FE4A 3EVCA 1TIPA 4AJ4A 3P5SA 3VOSA 4CM1A 4DT1B 3KEGA 4KX3A 2BGMA 3I5UA 5AKGA 3IBFA 1XD9A 3K1YA 4II7A 1QH8B 1YZKA 1SD5A 4AZ3A 4B3RB 1EK5A 2HLPA 4LNUB 1QIIA 4Y2SA 1E2BA 2PMBA 3BBLA 4D3SA 3EXFB 4UAGA 4A73A 4GLLA 4ZVUA 4AP9A 2DUMA 2BKVA 2EW2A 2QL7A 3E0QA 3GHYA 3HCNA 5EKUA 1AHHA 2Q3MA 1ENPA 3K70B 1F5NA 1MJHA 3BIXA 4C0WA 1L7AA 2DQKA 1GTMA 2GZRA 3GUHA 1MO5A 3JWEA 1PVDA 4Y6QA 4L6IA 2JLVA 1H69A 3KTDA 2Y0CA 1ECGA 1NW9B 2J3JA 3CVJA 3QWBA 3H13A 2ZUVA 2G88A 4BWYA 1WXXA 1UXOA 4LXXA 2O14A 1P74A 4KWCA 2ECQA 1HE2A 1FC0A 3F7MA 4W9NC 1OLXB 5JAIA 1MC8A 3ZVKA 3ZGNA 3L8EA 1K8QA 4F4JA 3QEKA 1P4AA 2EJWA 3E3NA 3RSZA 1MV8A 4L95C 1Y1RA 1RRKA 4F4HA 5C7YA 1B76A 1P9WA 2YN0A 4M83A 1HY3A 2IIQA 1E2UA 2F3TA 2OAEA 3AI3A 5FA8A 4AK9A 1DCTA 5BSMA 4KIWA 1RAFA 5C7IO 2XUQA 4JT2A 3RQSA 2FWNA 5CRIA 3WLHA 1BAPA 2BKEA 2JEYA 5JZVA 1HR0B 2QTNA 1NSTA 3RT7A 3T3IA 5EKDA 1N34B 3G5TA 2FPRA 2R8ZA 4Y7DA 3ROFA 5CYGA 4ZTBA 1PQPA 2FZVA 1KEZA 2GNAA 2J87A 2QAGB 5B1YA 5HPYB 4BAUA 2YS7A 1Y7PA 3ZNPA 5FEUA 3TECE 4P8RA 1Y4UA 1IY2A 1QGED 1SCAA 2GZ1A 3K8OE 1H2RS 5DHTA 1O2DA 3WIDA 1P60A 3I73A 2P6UA 3AF5A 4UM7A 3WVNA 5H3LA 1JG7A 5CDFE 4DB2A 4IJ6A 4CUZA 2HO4A 2XNKA 3FPJA 4IXNA 2GAIA 4GGMX 5FL3A 1ZXXA 2CNBA 2Q2NA 1UCFA 4YT4A 2JAWA 4YV7A 3OJOA 1BG6A 1N32B 1EINA 1E5TA 1N2BA 1Z5PA 2WYOA 4MVJA 4QYIB 4CLDA 4GU5A 4JUCA 4LIPD 3DMFA 4HYYA 1ZQ1A 4JUIA 4RENA 4HS9A 2QGNA 1BWSA 5M29A 4MDFA 1ZR2A 2IZ5A 1QFYA 1ZM2A 3K92A 4RESA 2GFQA 4BBAA 2JBWA 4I4TF 2J1LA 3DQQA 3GQBB 3OHSX 3QX9A 5EKSA 3DKPA 4M89A 2HF9A 3TLMA 2DWOA 1DHTA 1JSRA 1L4HA 3OCVA 5CNMA 2Q9AA 2JAPA 4RO0A 3UQZA 2OWDA 2Q2QA 4D0RA 1SA0B 4I3FA 3H1FA 1XEWY 5AI0A 5KREA 4PWZA 4V03A 5EIFA 2JIPA 5BN5B 4DLBA 4JLJA 3AEQA 4X7RA 3L4JA 4HB0A 4DMKA 2DPMA 1MAVA 1G21A 3OEHD 1PWYE 3E7DA 4Q1BA 3S1LA 4XR4A 2FPGB 3KZCA 1DX9A 2VN8A 3VZBA 1KI9A 2M1ZA 2Q3HA 2ZJAA 1G2QA 3O26A 1UBMS 3ASZA 4S35A 2NUPA 5YASA 1K4KA 1XU9A 2QSUA 3QVMA 1XMSA 1V5GA 5HKAA 1KYZA 1U98A 1NJ5A 4BE4A 1QZ3A 3HXOA 4WECA 3OX3A 1GFSA 4E6PA 4TT3D 4U9UA 4WUTA 4ISBA 1GNVA 4MVJH 3GJ3A 4A2QA 1ZL0A 5EE1A 2DFKB 3G13A 1L5GB 2BTQB 4L0QA 4GSLA 3GCZA 5IWCA 4UHKA 5AVWA 5JIBA 4G85A 2PQMA 3OKFA 3E4CA 2JLBA 5T8KC 4YT2A 1T36B 4D02A 5IKPA 1H9CA 2VR1A 3IULA 4MO9A 3T61A 1G20B 3TR0A 3L0OA 1AGRA 2IV3A 5IC6A 3ZOKA 2MOKA 1WZEA 1I2CA 2ES4A 2ZFUA 2ZWVA 2ZUTA 2ZT8A 5SYMA 4EGQA 3ZJVA 4JR0A 1CUDA 4QUAA 2CVOA 3ZY2A 4GPBA 3RLIA 5H1YA 3FPLA 2HKIA 1VIAA 2BI8A 3B70A 5IARA 1OJ7A 2ETVA 5FPTA 3CINA 3UICA 3GPBA 3KWMA 4KN5A 4ENQA 3ED1A 1TJPB 4DYHA 3FRIA 3HUFA 2AZTA 2E82A 1V3QE 4PHHA 4YRMA 5DNAA 4DPLA 2WSBA 3VJKA 5I47A 2C1ZA 5D01A 4J6FA 1QBKC 2OHXA 1VPTA 3V1UA 5LDHA 1Q0UA 2CCGA 4LQCA 4YYEA 1TUEA 4FZJA 2P5YA 3R6WA 4TRJA 1QH8A 4TL7A 4E32A 3G23A 3C5HA 2PT9A 3K32A 3GA5A 3KRTA 1XWFA 3ND9A 1D3AA 1SIBE 1XCLA 1ZK2A 2R1UA 2WSYB 3HA7A 3QY0A 4PGAA 5EGSA 5FQNA 5I9TA 4PV7A 1GG5A 1LDMA 3DL7A 2MR6A 3CONA 4UBNA 4H2DA 10MHA 2Q1SA 3IR7A 1KQ3A 3I2IA 2Z2XA 1UOQA 2D2FA 2VXYA 3FKQA 3L0SA 3O6VA 3ZNNA 1SBHA 4ZQCB 1FTNA 3GX1A 1Q3KA 3EA4A 4JSYA 1YF3A 3QXSA 5C5DA 3FTEA 3FKSD 3I9KA 3V4FA 3B82A 2VSYA 1N6OA 4FEEA 3RAPR 1DI0A 2AFIE 4O4HF 1IJKA 1VBKA 2CC2A 2E2WA 2DFTA 2AKEA 2B8WA 2WOJA 1RC1A 3L7YA 4GOJA 4W8HA 4WOCA 3OM1A 4QTUB 4GWGA 3T9AA 1PX2A 3VU9A 1W1IA 4FYIA 4R8LA 2VJQA 1VJ1A 1U2ZA 1C9EA 2P41A 3OOYA 4ITVA 3ZHYA 4EYEA 3A05A 1L7QA 3E58A 4G23A 2R8XA 1HYGA 2XQGA 1BD4A 3TLCA 4M7WA 4QRIA 5G2OA 4ASUD 4MB2A 4BQPA 4PW0A 4NQZA 2FUCA 4TLCA 4BHTA 2WMOB 1I1NA 2ID7A 3C3YA 4M9SA 2RKBA 5IEBA 5EJ9A 4NMWA 4RV9A 4UU8A 4TT8A 2IYYA 1YKFA 3N2GB 3TWOA 3ZZTA 3JATA 1WXHA 4BVKA 1CQWA 1XTVA 3RIXA 4FN5A 2BFNA 1VM6A 1BYUA 2GM9A 1IUKA 1SRRA 1KDYA 3VR3D 5FD8A 2BGIA 2FZGA 2D3TA 2C96A 2O3TA 2YXBA 2BIFA 3KTAB 3AQ4A 4KJXA 3TBFA 2SHKA 4OB8A 4Y2TA 4PC6A 4ETNA 5ITZA 4OIFA 1D5CA 1IUOA 3LS2A 1EYZA 1ZN9A 3S2EA 1HKUA 4XJXA 3LOUA 2DT5A 2ADFA 2XRYA 3MRTA 2OO5C 1B73A 4KI0A 4UMFA 4ALJA 1ESNA 3AHDA 4E1AA 4WKBA 4XW2A 4HQKA 1GM5A 1CRZA 2MINB 2YR0A 3NWOA 2XT6A 4BZZA 4C21A 3AJ9A 3JSXA 6REQB 1E1NA 2P11A 2ZRMA 4JEUA 1AGXA 2A8YA 3TKYA 2IS4A 4C7OB 4Q21A 3AB3A 1ZJ6A 1NMEA 2CXXA 2VKQA 3I92A 4IDDA 4O4LA 3R24A 1H6DA 3EGOA 4O1IA 2GAAA 4QGSA 3PA8A 4ZVKA 2VSOA 4Q7KA 3NV7A 3ZDZB 3T1YB 3TG8A 1XQ1A 2SNIE 3DOOA 3EDRA 4BMCA 3DJYA 3NBKA 3TFWA 4ZRDA 4ZAWA 4FX5A 4F1JA 4IHJB 1UPCA 3GRPA 4Y9RA 3L8YA 3GLHB 3NRBA 5DGCA 4C4XA 4DG8A 4P3XA 1UMDB 1RZRD 1Q6YA 1GL7A 3I2FA 5E7IA 4EGAA 4G9GA 4AJLA 3H16A 2AG5A 2WEKA 1MBZA 4Y30A 1J9ZA 4MTLA 2CHFA 3O03A 3ZIAD 4GMHA 3A1CA 2BAGA 5CFZA 4XSGA 5EMNA 1X94A 1IM2A 3DKKA 3KHKA 1JAZA 3NORA 1W581 3RF7A 1X8XA 3G89A 3BGWA 1YB5A 3NH9A 4LYHA 1AQ6A 1X7YA 4G3XA 3VHXA 3EG5A 4Q3CA 3EA5A 3JRXA 5EKTA 4AX8A 4IQ4A 2IBSA 4CEHB 1GGEA 1I3KA 3B12A 4YBRA 1CJMA 4WX2B 3PFBA 4HNUA 4X91A 3U4AA 3F7TA 4UPDA 5ECWA 3TSWA 3VC3A 2E4VA 1DKUA 4EJ2A 3PUVA 2G6TA 2A0UA 4WFIA 5E38A 2PKYX 1KYTA 3QV1A 3FCCA 3ODGA 2H08A 3QKSA 1LPPA 2IUTA 2BFDA 5E2BA 2J5RA 3PEFA 1Z22A 3HFGA 1GRQA 4KE9A 3M6AA 5THXA 2QUIA 4ZKDA 4MP8A 5K99A 3KQLA 4XWAA 1C9KA 3C5WP 2IXBA 2QW8A 2W6ZA 2I4OA 1WNTA 1RC0A 3NKVA 4BQOA 4O25A 2BF4A 4UJ5A 4HZIA 4BX0A 3FJYA 4WXEA 3T5CA 2NV0A 4CVNA 4HQNA 4TVOA 5EZ6B 3PFGA 1PZFA 5BWBA 4CZ2A 3IKTA 1TA4A 3DW3X 2V54A 4DLVA 5AW7A 1EDDA 3C14C 1FTGA 1V71A 3I12A 3UCFA 5B4TA 2R79A 1P5HA 3JQQA 2HT6A 2J0UB 4V2IA 5AUNB 3OZCA 3GQBA 4DLPA 1RE1A 1PKEA 3L0CA 1F1BA 4MGIR 1SUAA 3CLSD 4EUNA 1J56A 4EITA 1Z36A 2Y2UA 3I9MA 2GHRA 3FWZA 3VVMA 4JC0A 2GCEA 2CLLB 4OXIA 2DB3A 4DE5A 3J80A 4XDYA 3ACCA 3W1EA 2QYSA 4MYCA 5GJCA 1ZEJA 3ZS8A 2VNAA 4BP3A 4BFCA 3KXDA 4FILA 3PC2A 1M76A 4MPPA 1J2YA 5FR2A 3ZVLA 3Q72A 2G8NA 1PWXA 2IEGA 2DFVA 5TQ2A 1MGOA 2YQ5A 5CLJA 1AHIA 4H9GA 1J0DA 2RARA 4Q4AB 2WAAA 4DVJA 4K7JA 1QPBA 4AMVA 2NZYA 1Q95A 4J2OA 4QHTA 1HLGA 1E2PA 2IT1A 3GROA 5DYWA 1YJQA 1M7GA 5JOQA 1UAGA 1IONA 2OV1A 2WSLA 2PS3A 3BMQB 2V9ZA 3F4LA 5K6AC 3INNA 1KDVA 3NAMA 4FC6A 1ZIPA 3DNMA 4XQCA 2G71A 2O0KA 2G77B 4L50A 1KAQA 4TN5A 2XQKA 1D1TA 3ESCA 5NLLA 2GASA 3SS8A 4KNWA 4NTZA 2A0XA 2IZ7A 3FMIA 5LNK6 2C0PA 2ID9A 4RCVA 1KI6A 4FR2A 2P4HX 1JA0A 3C6MA 4HDOB 4F2GA 2UVQA 3TEJA 1KERA 1CUUA 1CE8B 1P61B 1WP4A 1OI3A 3ENWA 1E62A 2I7TA 4JZYA 5IVDA 5K0LA 3ZHSA 2B8NA 3LH5A 5FBVB 1A4XA 4TM7A 3JZAA 1IVNA 3L4BC 4JI0B 2GBGA 2ZREA 4IIEA 1H2HA 4M38A 5PGMA 5ICEA 3IT3A 1XNRB 3C3PA 4YC7A 4GBGA 1CUXA 1UFRA 3RNOA 1GZ7A 4NS1A 1TKBA 2V58A 1Z4MA 1S8AA 4GICA 2GOYA 3C1TA 1I4OA 1JKJB 1SKYB 1D0IA 3LX4A 3T6KA 4GZMA 4O4LB 1RAAA 4WERA 5KYUB 5CFQA 3PQ3A 1EUYA 1UXGA 1OWPA 3MJVA 4LWPA 1TM4E 1UODA 2GYVA 2WV9A 3LYUA 1EUCB 4P4NA 2W4IA 4QGAA 1JIQA 1WBDA 3OY2A 3KXKA 4XH9B 1WETA 3EW9A 1RBMA 2CJPA 3KVVA 5IDYA 4MGZR 2HCRA 5EI5A 4Y2HA 4TWIA 2A14A 1Z07A 3GYGA 4I2VA 5A5VA 2VT2A 1T5BA 1SVIA 4AN1A 1O87A 4MIEA 3WLSA 4URYR 2VO1A 3SDSA 2BE9A 4AIRA 1EXWA 4RTLA 4EPTA 3DEZA 3WXBA 3DE0X 1D6MA 3HN6A 1KDRA 2FN4A 3PXXA 4RV5A 3RS4A 2KS6A 6PFKA 4EJSB 3RVMA 4BO4A 2QI9C 2Y1LA 3N59A 3KR9A 4H1TA 4PZYA 5B37A 2G9NA 3OQJA 2OHGA 4PNZA 1PJ3A 1KQGA 3U5TA 4CEIB 1DFIA 2CYAA 4J0CA 4F7DA 3SEZA 2QN7A 4QPDA 3F3KA 3I6QA 4N3GA 16PKA 5GIOE 3EDCA 2GF9A 3HE3A 2GBPA 4JEHA 4WKGA 2OLEA 7MDHA 5KWEA 5LQJA 3RC8A 2D1RA 1FFCA 3LP6A 3UJ3X 3EQ7A 4B7UA 2I62A 1V3TA 3PICA 4R1PA 3SQNA 3WQQA 2F3QA 5B7PA 5HF9A 2B4AA 1O6ZA 3GG9A 5BWCA 5L45A 1ZI8A 3DR3A 5IASA 4EF5A 1E2MA 4Y2GA 1EVLA 2QAIA 3EGVA 4YPVA 2DCUA 5FWYB 1M1NB 1XTTA 5T4FA 3T12A 5LOVF 2I7DA 3H5TA 1AIPA 1VLQA 1WWKA 2NT3A 3BEDA 1NKVA 1U8YA 3BRWA 3W7VA 1TYDE 1WCV1 4GNRA 5MN4A 4OXYA 2GHQA 2PR2A 4QBHA 4LGYA 2QZSA 4B0OA 2ZBEA 4PGGA 1AB6A 2OHOA 1E6CA 4U0KA 4FI3F 1E6WA 3AHGA 2O6HA 2IRWA 4BDSA 2OK8A 1AT1A 4J7XA 4YLGA 3JQ9A 3TIFA 4JYMA 2C7OA 2L82A 3M82A 5IKMA 2A3RA 2XUGA 3KJZA 5ESDA 2XZTA 4B6EA 3DCYA 2CFOA 2VPXA 5BVGA 3RWOA 3G2OA 4HNAA 5ELLA 4BWGA 5BSKA 1VTKA 1Z2DA 3EZYA 1NP6A 4RZSA 2BPOA 2OFOA 3F8SA 4KFUA 3KSAC 3DBHA 1ZMBA 1MZPA 3L6EA 1JYSA 2G3YA 1UJCA 1YQEA 2JCGA 4QYIA 4B3GA 2HQSA 2WU3A 3HVUA 3ETGA 1Q7BA 3M5PA 4LKOA 5AKYA 3RBZA 4ALIA 1UDAA 3PEEA 5ISMA 1ZGZA 3LGAA 1V47A 1FXWA 1KH3A 1SVNA 4X41A 4R51A 5J4KA 2RI6A 3AU9A 3L1IA 3DA8A 4RVHA 1DJQA 4LJ9A 4YCAA 1VSQA 2G5GX 1F2VA 4YAWA 1Q1GA 1T9ZA 3B52X 1E6KA 1PR4A 2ZRPA 2DBZA 2EFHB 1DOAA 5JNWA 1P1FA 1OHHA 3WJ7A 4RL6A 2J8ZA 4D81A 4O4HA 1OE0A 4L3OA 3LNTA 1EVYA 2BM8A 3MTJA 2PEYA 3KAKA 4R2XA 3K0CC 4Q34A 1ATIA 1YIDA 2JJ2D 1FP4A 2IEYA 1TQDA 4XVRA 4JJ8A 5TEVA 5KOYA 1XR3A 4FXOA 3M4ZA 1QXSA 4X92A 4J8PA 2W6IA 3PQ5A 2TS1A 4RXMA 1RJEA 2XDQA 3CN7A 3DL2A 3EG9A 1SBIA 3R9WA 1YZHA 1LZLA 4KBYA 5JADA 2PXHA 2RI1A 1X7DA 2V65A 3LK7A 3NEAA 4JBGA 3STYA 3VH3A 1FFSA 1N6PA 4D9IA 4F2HA 2FPGA 1Z16A 3DMGA 4I5IA 1UKCA 4OHXA 1KZ9A 1DKPA 5K3CA 3OTWA 3UAOA 3L49A 4AJJA 3W6NA 3KAQA 1Y6GA 5I9SA 4R16A 1E1RD 2G67A 3SMVA 1L7XA 3VR4A 5KYNA 1PVVA 1V5WA 4RFLA 1QGYA 2Q6TA 1QCCA 4JSTA 2I8LA 1N8NA 4RW0A 4UCWA 4XUEA 5I9NA 1N0IA 2LUOA 1G5IA 4OHOA 4LF9B 2ZRNA 3VYWA 4L7QA 2IIPA 3M3DA 3UT6A 2V96A 3WK5A 4PX2A 5HNKA 2WWXA 2XUAA 3AR4A 1G3QA 3EB9A 3IKVA 4I5EA 1II8B 5EIBC 1WE2A 2C7PA 2R8RA 5A6SB 1R3DA 2PE5A 4KSYA 3U7FB 4WBNA 3FH0A 2H0RA 4IIYA 5C35A 1CS4C 3DVAA 4CTNA 4OJYA 2H9IA 2X6RA 4YRCA 5ESWA 4GKAA 1XCMA 1L4UA 3FBTA 4DWJA 4UZSA 2GEKA 4X1IB 3D2BA 3DAHA 5FTLA 1NVGA 1XQWA 4ED9A 3M6VA 1M34E 1J0CA 1K6MA 1Q20A 1PFQA 1U8XX 5HE9A 4RSRA 5CLFA 4LXGA 3C6KA 4A0SA 1LLDA 2XZLA 3B78A 4FWIB 3BK2A 1GWNA 4EW3A 1TYBE 1A4RA 3GJ4A 4GR9A 4L9AA 1Y89A 4S1VA 4U8HA 4GYKA 4U4AA 2FWRA 4F3YA 4CTJA 3PXEA 5HMMA 4LVUA 3Q3VA 1FQJA 1YR9A 2HY7A 3TI9A 4NENB 4F0JA 3RUDA 1JDTA 2OQ2A 4FOTA 1E5XA 1YRLA 1DEHA 4L27A 4M1YA 3UW1A 4FMDB 4DREA 1MO6A 1MRNA 3ONVA 4RZUA 4U7FA 5KQGA 5KWJA 3VFDA 4GW3A 4UNQA 2ZLBA 3UA3A 2FMHA 1CUAA 5CA0A 4F6RA 1BDMA 2ZSBA 2NXJA 3HB1A 4DMRA 2XOEA 1NATA 2ODQA 3FN4A 2REQA 1D5WA 3HU5A 5JE8A 4IIUA 3TDMA 4KVZA 3U13A 2ZIFA 1LJUA 4D42A 1Z5ZA 3T5GA 4C2TA 4HS4A 2BFWA 4U9IS 3AIOA 1XHLA 5CR9A 1BTOA 2GI4A 3M6XA 2J3IA 3A3OA 3CW9A 4UCXA 3FTNA 5HKBA 3VI4B 3ANLA 4MUEA 1FJ2A 4FLFA 8AT1A 1SKBA 2O05A 1K0FA 3S1SA 3D4PA 4ZPJA 2OO5A 5DGXA 1JNXX 3DLIA 1JIIA 1DARA 1LY1A 2RIPA 1C5KA 1DIAA 1TJ4A 2HDOA 4ONEA 1PFYA 2LP4Y 3FZYA 4YGXB