1WMHB

Crystal structure of a pb1 domain complex of protein kinase c iota and par6 alpha
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
82
structure length
82
Chain Sequence
SIVEVKSKFDAEFRRFALPRASVSGFQEFSRLLRAVHQIPGLDVLLGYTDAHGDLLPLTNDDSLHRALASGPPPLRLLVQKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a Cell Polarity Regulator, a Complex between Atypical PKC and Par6 PB1 Domains
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/cell cycle
molecule keywords Protein kinase C, iota type
total genus 17
structure length 82
sequence length 82
ec nomenclature
pdb deposition date 2004-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00564 PB1 PB1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1wmhB00
2DYBA 1QZEA 4A3OA 2OOBB 4KZCA 2Z59B 4K7WA 4YL8A 2MP2A 5DPRA 5DCNA 4W9EA 2KTFA 3U8ZA 4A3PA 1D3ZA 1AARA 1KLVA 1E8ZA 1WY8A 2L76A 3W1YA 2G4DB 1H4RA 2KLGA 3VQIA 4RM9A 2PJHA 3M63B 3NY5A 1WGDA 3V6CB 4CYEA 4PS8A 4FJYA 5IA7A 2GOWA 3QARA 2NBWB 2LGDA 2RSUA 1YIWA 3KW5B 2KTRB 2KZRA 1GNUA 4AJYB 2N1WA 1ZKHA 4TV3A 4DXAB 1OTRB 4I6LB 2KMCA 3H7SA 4DBGA 2JRHA 2CS4A 2KC1A 2ZCCA 3L10B 2MSED 4GU2A 2O2VB 2XK5B 2ZEQA 3OLMD 2WX0A 4ANVA 1S1QB 1WJ6A 2RR9A 3CSFA 5AZGA 5J18A 3Q3JA 3JSVB 1X1MA 2M8SA 4HCPB 4MJSB 1V5TA 4OVVA 2D3GA 4LDTB 1U4AA 2L3ZA 4E3CA 2KNBA 2LD9A 2W9NA 3DBHI 5J17A 2M1MA 1I35A 1UZXB 1SE9A 3QJZA 4GN1A 4P7IA 3TJPA 2ZCBA 2K8BA 3L17A 4W9JA 3W1SA 2KQSA 4AP4C 4X57B 1ISNA 1SIFA 4FULA 3UIPB 3KUZA 1RAXA 1WX8A 2MBHA 1E8WA 2N9PC 2K25A 3SHQA 5D2MB 2L00B 2GMIC 4W9KA 2BPSA 2DZKA 3VTUA 3WANA 4EEWA 4M0WB 1E7UA 3HHMA 1GC7A 4FHKA 2L0TA 3APDA 3DCGA 4WJPA 3VVWB 2BF8B 1WXMA 3ZW3A 4GDKB 2GBMA 4RMAA 2FAZA 2NPTB 2FCQA 2ZPNA 1M94A 3EECA 2KWUB 2N9EB 3VTVA 1TGZB 4IM0A 1WR6E 3PS6A 3O65B 4DHZB 2BWES 4ANUA 1Q1OA 3N32A 4KSLC 2LGYA 5J2RA 4OVUA 3KUDB 3PGEA 2M17A 2J7QB 3HIZA 3WIMA 4HCNB 2D11A 5L95C 2L8JA 4NAWA 2JVCA 1Y8RC 4KIKA 2O6VA 4LDTD 3RYTA 2NPTA 3QHTA 2KJHB 4MDKE 2IO3B 1NDDA 4FN2A 4MGZE 3QCAA 2G3QB 2K8HA 3QWZB 2IY0B 2ZZPB 4TQ0A 5JH5C 2LXAA 3H7PB 3NZSA 2L7RA 2PE6B 4FJZA 4GMVA 1V49A 2L0FA 2KFKB 1ZW7A 2DZMA 3GZNI 3B0AA 2N4FA 1K8RB 4HJKA 1PQSA 2MBQA 1Q0WB 2DZJA 3R66C 3NHEB 1WIAA 4NJ7A 4IM3A 2EKEC 3IHPC 2IZVB 4EZKA 2YLMA 1FXTB 1NI2A 3ZTCA 4F1SA 3Q3FA 4NQKE 4KZ0A 4TQ1A 3A1QA 4IW0A 5L83A 4ICUA 4J6IA 1E90A 5FR6A 3UIOB 1G6JA 2KLCA 4GIVA 2J0MA 3IFWB 3SU8X 4N9F4 3ENEA 1P1AA 3X23A 1OEYA 4NAWB 4W9DA 2KC2A 4DHJB 1IP9A 1WGGA 3H1UA 2NBVB 1WRDB 3PVLA 1WJ4A 2REXA 4NY0A 2ZJDA 2QHOA 4XC2A 3V62A 2JUOA 1WE7A 3SD5A 1SGHA 3DVGX 4JL9A 3WAOA 3ZNID 2JXXA 3QIJA 3AU4A 2MW5A 4JLCA 4FLHA 2LGXA 1J8CA 1CMXB 3N30A 4FHJA 3ZNHB 2AEHA 1UD7A 4K7SA 4URKA 4GOCA 2MQJA 3PTFC 2KJ6A 2FNJB 2O6VD 4XX5A 2BYVE 4CO7A 3PSEB 3TIXA 3L13A 4GB9A 1R4NI 4EOYA 4MEMA 1UGMA 4B95A 3MJWA 4EFOA 5AEKB 2HJ8A 2GBKA 2Z0DB 4GDLA 2R2QA 1V9JA 2BGFA 2LASA 1LM8B 3M3JA 4MGYE 1UBIA 2CR5A 4HLEA 2K6DB 3NZUA 1LFDA 3DQVA 3DBSA 4ZRJA 2CHXA 2KMAA 1TBEA 3GOEA 2KD0A 2IO0B 2ZPYA 2LVOA 3B08A 3ZDMC 2D10A 2KK8A 3QA8A 4IWOA 4JQWC 5DPSA 4BKGA 4BOZB 2AL6A 2LXCA 2C9WB 4FJVB 2MRPA 4WWOA 2G45B 3TL5A 2WX1A 1Z5SB 3ZDTA 1L2NA 2ZNVC 2WWZA 3A4RA 4W9IA 3TBLD 2OJRA 2Z0EB 3B1LX 2DYOA 4IWQA 3UQAA 4G0NB 4KSKC 3RUIB 2K8CA 2CHWA 3AI5A 4II3B 2GBJA 1E7VA 1V80A 4EKUA 4G3XB 4BKTA 4G50A 4WAAA 1TZ1A 1WJUA 1WZ0A 3H6NA 2M0XA 1V5OA 4MM3A 1EF1A 3QAQA 3DVGY 5CX3A 4XZ4A 4LCDE 3PRMB 3PZDA 2CKHB 2KDEB 2LI5A 4IUMB 4PYZA 2DENB 1WYWB 1UH6A 2KX0A 3TCAA 1Q5WB 4I6PA 4BKSD 2BKRB 2KVRA 4NJ6A 1XD3B 5TR5A 4G11A 2B3AA 4AOFA 1WXAA 5LXIB 3PRPB 5DPWA 2JRIB 2UWQA 3VH3B 1KOTA 2KTRA 3IBEA 5JHBA 1V2YA 2LRUA 3HM6X 3JVZX 1YD8U 1EUVB 3MHSD 4E74A 2LRWA 3ONSA 3VXWA 1V86A 2LWPA 4KIKB 1WJNA 2KFKA 2KOXA 1WI0A 2JT4B 2EMTA 2KO3A 2YVCA 1WMHB 3A33B 2FCNA 2JZ3B 3OJ3A 3V61A 2AL3A 2BYEA 2GBRA 2IBIB 2IO1B 3L0WB 2KXJA 3U30A 3ML9A 3BINA 3PPAA 2BWFA 3A1QB 4HPMB 2MX2A 3I3TB 3EC8A 1WGYA 2DAFA 5C23A 2NS5A 1P0RA 2MBOA 1WFYA 1RFAA 1OGWA 4BOSC 1EO6A 4NQLB 1J19A 3C0RB 3DVNU 4ZRKA 5CHVC 2KX3A 2MP2B 5GMVA 3SDLC 3S2AA 1WGHA 3PREA 3A9JA 3AXCA 1T0YA 3DDCB 5AZHA 2RGFA 1MG8A 3KYCD 3N3KB 1YJ1A 3ML8A 4GSWA 5KHOA 3LDZE 4FBJB 3OAWA 4B6WA 3VDZA 4HVBA 2JWZA 2DHZA 2FIDA 3DBRI 4MSQB 4BBNC 4NPNA 2KN5A 1WZ3A 5C1ZA 3AULA 3RZWC 3L16A 4GDKA 4KDIC 2A5UA 4MGIE 1GJZA 3OJ4B 4W9GA 5CTRC 4ICVA 4BFRA 5JHAA 2EMSA 2LJ5A 3U7DA 4ZDVA 1GG3A 1YX5B 4F8CB 2HE7A 2FCMA 1WE6A 2JY6A 2XBBC 1XQQA 2V4LA 4HDOA 2N9XA 1VD2A 2J0KA 2J0JA 3DOWA 2HTHA 3VTWA 3T8MA 4ZRIA 3D32A 3DVNV 3JSVA 4BKSA 2BKFA 2IY1B 1VCBA 1L7YA 3ECIA 5EDSA 2PPHA 4K81A 4A20A 3K9PB 3HM3A 2LZ6A 1YQBA 2MBBB 3ZRFA 3UGBB 4DDID 3IG3A 3M62B 4DHJD 4FA6A 3QQ8B 3ZO5B 2WDTB 4CHKA 2G4SA 1BT0A 1E5WA 1F9JA 3DPDA 4DWFA 2M4NA 1HE8A 2JPHA 2MA9B 3T9LA 4IM2A 1KJTA 1WM3A 2KHWB 2DYMA 4KVGB 1I42A 3R7RA 4IC7B 5CHWA 3VUYA 2IO2B 3EFUA 3QK0A 1WH3A 3ZLZA 2AWTA 1WF9A 4IG7B 2KANA 4BBNF 4NNJB 5HKHA 4TKNA 2PEAA 4ANXA 4M8MA 2ZNVB 1OEYJ 2AYOB 4K7UA 4HXDA 1J0GA 2BYFA 2KDFB 2GBNA 3LJ3A 3RULA 3AU5A 2A4ZA 3RZFA 4B9KA 5IAAC 1TTNA 4IWPA 4WJNA 2K39A 1ZGUB 3CF6E 2KJRA 4EZLA 3M95A 4BVUC 3JW0X 3A9KB 2ASQA 3ZNZB 3APCA 4ANWA 5E6NA 1LXDA 4GGQA 3ZTDA 1GC6A 1V6EA 2XEWA 2KDBA 4WWNA 2ZVOA 3EHVA 1XT9B 2LVQA 1RRBA 2CHZA 3L54A 2KWVB 3QC8B 4KV2A 1GUAB 1P9DU 2LVPA 3V60A 2N1VA 2JZZA 3RCZA 2RPQA 3VH4B 4JIOU 3L08A 2N7DA 2WYQA 4DDGD 3PT2B 4RM8A 2UYZB 2KQ7A 3W1SC 1UELA 4HWIB 1EF5A 1P98A 4WJQA 3R7QA 3ALBA 4MJSA 1S3SG 3CSTA 1V81A 3WALA 4KDLB 3NOBA 4WJOA 2N7EA 3JYUA 3KH0A 5BO4B 5D6JB 1C1YB 1WGRA 2C5LC 4JGHB 3A9JB 3UQBA 1LQBA 1WR1A 4F7ZA 1RLFA 5CHFA 2VRRB 2XK5A 3ZRCA 3UINB 3KYDD 2DAJA 3RD2A 1UBQA 2R2OA 4EZJA 2PE9A 3WAMA 2L05A 1WX7A 2ZVNA 3A9KA 5DPTA 4HDQA 4LJOB 4AJWA 4HK2A 1WXVA 3ZVVA 3NS8A 3TMPB 3X0WA 2KKCA 4E71A 5KHQA 2CU1A 3KVFB 3VAWA 4WQOB 2LUEA 3R3MA 2NVUI 2RD0A 5E6OA 1WX9A 2C7HA 3CMMB 2I1KA 2KDIA 2V3SA 4MGKE 4W9FA 1C3TA 4GXBA 2D07B 4TUUA 2HD5B 2MLBA 4HPLB 2DZIA 4M8NA 4ASWC 3IVFA 3V6EB 1P3QU 4MSMB 2MWSB 2DX5B 3KUCB 2IYDB 2C7NB 3RT3B 1A5RA 3VHTC 5D94A 5JZEB 2KFJA 3MTNB 3WA0A 3DBLI 5G2NA 4PYUA 3QX1A 3A4SC 3UF8A 2FIFA 2NBUA 4W9HA 2MBEA 5LXHA 4PS7A 2NR2A 4MELA 5LLIA 1WMHA 3VFKA 2O6VB 3VUXA 4W9LA 4FADA 1OQYA 3PV1A 2FUHB 4W9CA 5G55A 4I6NB 4WWPA 1Z2MA 4AWJA 1WXSA 5E6PA 3ZKJC 3PHXB 1JRUA 3ZUNA 3APFA 3HK0A 4MH0E 4ZYNA 2KWCA 4DHZE 3P2BA 3PLVA 3PHWB 4PS3A 3PRZA 3ZNGC 2V1YA 3VUWA 1KM7A 2D2QA 3WAPA 2JF5A 4K1RB 4II2B 1H8CA 5D7GA 3H9DA 3K9OB 2I1JA 4AUQC 3BY4B 4GDLB 2NCNA 2O2VA 1IPGA 5AZFA 1WM2A 1IYFA 1E8YA 1E8XA 4DK5A 4EUTA 2MCNB 2K6QA 2C7MB 2Y5BB 4LJPB 1YX6B 2K1FA 2FCSA 3H7PA 3ZIMA 2C60A 1NBFC 3PLUA 1R4MI
chains in the Genus database with same CATH superfamily
4ZHOA 4KZCA 2Z59B 4K7WA 2ON8A 3Q14C 2CJNA 2G4DB 2VZKD 3M63B 3NY5A 1WGDA 4PS8A 3RNBC 1IBXB 2LGDA 2RSUA 3MC9A 3KW5B 2L1AA 2MEKA 2H89B 3AECB 3DWGC 1JMLA 2N1WA 4DXAB 3TEYA 2I38A 2JRHA 2CS4A 4JX1C 3ZGZA 1K50A 3BYTB 3B2FA 3HRDD 2WX0A 1D4BA 1S1QB 3CSFA 5LNK1 5AZGA 3JSVB 2WDQB 1HZ6A 1SE4A 2M8SA 2JXTA 2N7JA 2XNAC 4A6QA 2WXOA 4LDTB 1DOXA 1ZOYB 2L3ZA 4IKGA 2LD9A 3DBHI 3PZ8A 2M1MA 5J17A 2K22A 2ZCBA 3L17A 4AP4C 4X57B 1Y56A 3UIPB 1RAXA 1WX8A 4YXDB 2N9PC 3SHQA 5D2MB 2GMIC 1FNWA 3UI3A 3HVDA 1FRRA 1NI3A 3O13A 4XGAB 4EEWA 2BQQA 2SAKA 2KQ4X 2L0TA 2WXNA 3BIID 1SE2A 3ZW3A 2FAZA 1IGDA 2ZPNA 1M94A 2WHIA 1TGZB 1WR6E 3CWIA 4DHZB 1I4GA 3MFGA 1Q1OA 3N32A 5IN7A 2LGYA 1T3QA 3KUDB 5T8IA 4L1BA 2VH1A 4HCNB 2D11A 1PGBA 2JVCA 3P4PB 1PYWD 2AQ1B 4FN2A 2FE8A 1F2RC 2G3QB 2K8HA 2IY0B 2OJWA 4TQ0A 1B9RA 2X8XX 4FJZA 1V49A 4RGNA 2KFKB 2DZMA 3B0AA 1C4PA 1PQSA 1Q0WB 3R66C 3NHEB 1C78A 1ZPSA 3N1ZC 1CZPA 1NI2A 5EE9A 3Q3FA 4KZ0A 4YTPB 4IW0A 4J6IA 1XLPA 4ZOHC 3UIOB 1G6JA 2J53A 4GIVA 1KLGD 1J7BA 3IFWB 3SU8X 4YWGG 2Z8LA 1XLQA 1P1AA 5FKAC 1WRDB 3PVLA 3LB8C 4LLGM 2ZJDA 2QHOA 3AE7B 3QIJA 2MW5A 3KLSX 1KF6B 1CK1A 4FHJA 4K7SA 2KJ6A 1I4QA 4C56C 4KGSA 4CO7A 2BYVE 3BZDB 2PTLA 3E56A 5AEKB 1SJED 4GDLA 4LK0M 4C00A 1TS4A 2R2QA 1V9JA 4JPSA 2LASA 1XEEA 1TT5B 5G5HA 2CHXA 2KMAA 2IO0B 4J3OD 4ARCA 1XLNA 3FAHA 3ZDMC 2D10A 3R2TA 4BOZB 4FJVB 1ZP0B 3IAM1 2WX1A 2ZNVC 4W9IA 2INDC 3TBLD 1R4NB 2OJRA 2Z0EB 2DYOA 1T0SC 4KSKC 2CHWA 4II3B 3DHGC 1LO5D 1V80A 1L4ZB 4BKTA 4WAAA 1JWBD 1EF1A 5BMIA 2CKHB 2KDEB 2LI5A 2DENB 2WXGA 3DWMA 3EA6A 2WXLA 4LTUA 2X38A 5TR5A 4NJ6A 4NJCA 4AOFA 4A55A 2JRIB 2QILA 2KTRA 2LRUA 1JRPA 1VLBA 4MM3B 2LWPA 1WJNA 1CJEA 3GP7A 2INCC 2KO3A 1VZ6A 1WMHB 3OJ3A 3V61A 1EWCA 2Q5WD 3I3TB 4WIPA 1ESFA 1I7HA 1L6VA 1WFYA 1OGWA 1GOZA 3DVNU 2W3SA 5CHVC 2KX3A 3KWLA 3PREA 1N61A 3DDCB 3N3KB 4GSWA 4FBJB 1SB3C 4S0RA 2PW9A 4BBNC 3DBRI 5C1ZA 4ICVA 4BFRA 2EMSA 3U7DA 4F8CB 2J0KA 2J0JA 4ZRIA 4NAMA 4BKSA 3C19A 1L7YA 4AQ7A 5EDSA 4K81A 1YQBA 2K9XA 3M62B 1WSPA 2XN9C 3DPDA 1E5WA 1F9JA 2INPE 2M4NA 3BWUD 2MA9B 1WM3A 1F77A 4IC7B 3I5JC 3VUYA 2BS4B 3EFUA 4L23A 3BVGA 2AWTA 4BBNF 1RYJA 4TKNA 4ANXA 2EKIA 1MI0A 1YJIA 1QF6A 3I9V1 3LJ3A 4C4VA 2A4ZA 4B9KA 2MJDA 1A70A 2WXJA 3SFDB 4RH6A 2ACZB 3A9KB 5E6NA 3ZTDA 2XEWA 4IOIE 2ZVOA 3EHVA 2LVQA 4OHJA 3ETRA 3L54A 4LNIA 2LMCA 3QC8B 2JZZA 2N1VA 3R2IA 5AUIA 3VH4B 3RNCC 2IDYA 3GE3C 1UELA 1P98A 4WJQA 1PFDA 1S3SG 1V81A 2N7EA 2Y3AA 5BO4B 5BYRA 3VRBB 2V9HA 1LQBA 3UINB 1SJHD 2PE9A 4RCOA 1NYQA 4LJOB 4HDQA 3TMPB 2QIEB 3KVFB 2LUEA 1V1OA 3R3MA 2RD0A 2C7HA 3CMMB 4GXBA 4TUUA 5MPOA 2KVZA 2NTSA 2MWSB 2DX5B 1DGJA 2C7NB 2SEBD 5D94A 1GB4A 2QC8A 3HVZA 1QT9A 4M0WA 1TS5A 4PYUA 3A4SC 4OZBA 1M4VA 2MBEA 3BVMA 4MELA 5LLIA 3W2DA 3PV1A 2PKOA 4MACA 5G55A 2RDGA 1UGJA 3ZKJC 3ZUNA 3W5UB 3APFA 4MH0E 4ZYNA 3ABVB 4LNFA 4PS3A 5D3DA 3VUWA 4P1CC 2JYEA 3TEWA 4II2B 4AUQC 2I1JA 4XYCA 2LGSA 2O2VA 1E8YA 1E8XA 2J42A 3AE6B 2MJEA 2MCNB 5BYQA 1MG4A 1N60A 1FRDA 2K1FA 3RPFC 3H7PA 3ZIMA 2BVCA 3RCZA 1JWAD 1ZUD2 1QZEA 4RF0A 2OOBB 1D5XC 1TJEA 2MP2A 4YL8A 5DCNA 4W9EA 4A3PA 3GE8C 1YQ3B 2GRIA 3W1YA 1H4RA 1UUPA 1P7FA 4CYEA 1XF5L 1VDVA 1SXTA 4AJYB 4A9AA 4TV3A 1ZKHA 4HJGE 1OTRB 4I6LB 3H7SA 4NZLB 1YN4A 2O2VB 5D3IB 1AN8A 4ANVA 1WJ6A 1C9FA 5HI1A 1K51A 2D3GA 4US8A 1SE9A 3QJZA 3V3XA 4W9JA 3W1SA 4MT5A 2YEPB 1SIFA 4DXGA 4FULA 3U4EG 2K25A 3VR8B 4W9KA 2WXMA 4B0EA 4M0WB 1E7UA 1WGKA 4C80A 4FHKA 3VVWB 4WJPA 4GDKB 2GBMA 2RDBC 1HZ5A 2QMTA 2FCQA 3EECA 3VTVA 1WXQA 4REZA 1J7AA 3PS6A 2BWES 3Q3OC 3P42A 1TZOA 5IO9A 2D5GA 5J2RA 2WXFA 4OVUA 3PGEA 3HIZA 3WIMA 1TYGB 2J52A 4WQMA 5L95C 3NS1A 4NAWA 1Y8RC 2O6VA 2HTME 3RYTA 3QHTA 2KJHB 2WXPA 4MDKE 3P4RB 1NDDA 4MGZE 1FMAD 3AV8A 2BS2B 3TEZA 5FR3A 3NZSA 3P63A 1E10A 2L0FA 1LGRA 4XWTA 5I4DA 1ZXIA 4NJ7A 2EKEC 2IZVB 2YLMA 3ZTCA 4NQKE 3T3OA 3A1QA 4M02A 3OG5A 5HHDG 2J0MA 4N9F4 1N5XA 3X23A 1OEYA 4DHJB 2KC2A 1IP9A 4XC2A 2W3RA 3ZJTA 3U2SC 2JUOA 3L4PA 1SE3A 1SGHA 4JL9A 3ZNID 1D5MC 2JX5A 4FLHA 4JLCA 2LGXA 3ZNHB 3N30A 2IPKD 1UD7A 4URKA 4XX5A 2O6VD 3PSEB 1QOAA 4GB9A 4EOYA 4MEMA 1UGMA 3AM9A 2HJ8A 2GBKA 1RWSA 2JWUA 2PVOD 2VH2A 1LM8B 3M3JA 4MGYE 4TMAB 2JYTA 1F0ZA 3DQVA 4ZRJA 3GOEA 1N5WA 2KD0A 2KK8A 3N20C 5DPSA 2LXCA 2C9WB 2MRPA 3NJTA 3TL5A 1L2NA 3A4RA 1SF0A 3UQAA 3RUIB 3NUHB 3ZYYX 4G3XB 4G50A 1WJUA 2M0XA 1QKZA 5CX3A 4IUMB 1L5PA 2V3NA 2RPVA 1IUEA 1UH6A 5JXVA 3C8YA 2KDMA 1TS2A 4YSXB 3Q8FA 5LXIB 5EE0A 2L32A 3NRZA 3VH3B 2Y5CA 1V2YA 3JVZX 3H8HA 3V05A 4JE3B 1WI0A 1YN3A 3KQ4A 2YVCA 4F1SA 2AL3A 3U30A 3ML9A 2M0AA 3BINA 2BWFA 4HPMB 1WGYA 1P0RA 2PIAA 1J19A 3C0RB 3R8BA 5GMVA 1IGCA 2MP2B 3SDLC 3A9JA 1T0YA 3TSSA 1MG8A 2E3TA 3ML8A 1YJ1A 4B6WA 2FUG1 2FIDA 4MSQB 1F2RI 2KN5A 1WZ3A 1L0YB 3AULA 3L16A 1F52A 2AQ3B 4GDKA 1N6ZA 3OJ4B 4W9GA 5CTRC 5JHAA 2LJ5A 1GG3A 1YX5B 2XBBC 1XQQA 4HDOA 2H88B 2KAJA 3SEBA 1ZXHA 2HTHA 2W82A 2UU7A 3T8MA 3D32A 2W55A 3JSVA 2IY1B 1VCBA 1GPXA 4LNOA 3K9PB 1FNVA 2NTTA 3ZRFA 3UGBB 4DHJD 4HKQA 2OEDA 4FA6A 3QQ8B 4AS1A 1HE8A 2JPHA 1I42A 3QK0A 4S17A 1BMLC 2KWDA 1XO3A 5HKHA 4M8MA 1ROEA 3AEGB 4BZAA 2BYFA 2KDFB 2GBNA 5HG2A 3N1YC 4PK1A 5IAAC 3RNAC 4WJNA 4IWPA 2K39A 1ZGUB 3CF6E 3M95A 1YOVB 3JW0X 3GZNB 2INNE 3ZNZB 1GC6A 4WWNA 1RRBA 2CHZA 5IP4D 4KV2A 3WCQA 1GUAB 3V60A 4JIOU 3Q8CA 2WYQA 4R3DA 5FK9C 4DDGD 3W1SC 4KGTA 1EF5A 4L2YA 3ALBA 4WJOA 3KH0A 3JYUA 1WRIA 3B9JA 1TS3A 2C5LC 1WR1A 5CHFA 2XK5A 2KACA 3KYDD 2DAJA 4C7ZA 2R2OA 3WAMA 2L05A 1WX7A 3A9KA 1WXVA 1JCKB 1ZDXA 2CU1A 1WYGA 2NVUI 3AE8B 5E6OA 3LYYA 2V3SA 2D07B 1EU3A 4ASWC 1PDXA 3IVFA 3KUCB 3RT3B 1A5RA 4YTNB 1WWTA 3MTNB 1VZ7A 1E0ZA 2NBUA 2WXIA 2QJLA 4YSYB 2NR2A 4FADA 4W9LA 1OQYA 2FUHB 4LNKA 4W9CA 4I6NB 5E6PA 3PHXB 1JRUA 1SSNA 3HK0A 2KWCA 3PHWB 1TKYA 2V1YA 1MPEA 1JW9D 2QCZA 4P16A 3WAPA 3W9CB 1H8CA 3K9OB 4GDLB 4ACFA 1IPGA 1IYFA 4OVZA 4ITKA 2K6QA 3NZ3A 2C7MB 2WXKA 1YX6B 1DOIA 2C60A 3PLUA 2DYBA 4A3OA 4KKJA 1N63A 3RNGC 5DPRA 1D3ZA 1AARA 1KLVA 1WY8A 2L76A 2KLGA 3VQIA 1NVID 4RM9A 3ZXRA 3V6CB 1T0QC 5IA7A 4FJYA 2GOWA 3QARA 3RNFC 2WP9B 3FILB 4D2KA 1D5ZC 3Q2AC 4DBGA 3L10B 2KC1A 2AX5A 2ZEQA 3I63C 2DLBA 3EGRA 4HROA 2RR9A 1I4XA 5J18A 3Q3JA 1X1MA 1MFWA 3GB1A 4N6EB 4DXFA 4HCPB 4MJSB 5BMGA 4P6VF 2KNBA 2WXRA 2W9NA 1I35A 1UZXB 3AE3B 4P7IA 2KQSA 4XDCA 1ISNA 3P1MA 2MBHA 1FXIA 1E8WA 2L00B 4USAA 2OHFA 4EE2A 3VTUA 3WANA 1F1HA 1GC7A 4RF1A 3DBRB 1V97A 3URYA 4UDUC 4RMAA 1FIQA 2NPTB 4O1NA 2D3BA 2N9EB 2JZPA 1MVKA 3NVYA 1TY0A 3KWVA 4OZAA 3O65B 1MHXA 1T6BX 1Q10A 4KSLC 4BAXA 4KIKA 3EUB2 2LUMA 2NPTA 4CQNA 4JWSC 3AE5B 5JH5C 4ARIA 2LXAA 3H7PB 2PE6B 1HXYD 4GLSC 1ZW7A 3GZNI 4TSSA 2N4FA 1K8RB 1JWUD 2MBQA 1D6EC 1WIAA 4IM3A 3IHPC 4EZKA 1FNUA 4ZRPA 2GLSA 5L83A 5FR6A 1T0RC 2K5PA 4XDDA 3ENEA 1I4HA 3ZQ4A 1FEHA 3H1UA 5IOIA 4NY0A 2REXA 3E9SA 1FCLA 2HDEA 1UNSA 2WXHA 3DBHB 3SD5A 2BW2A 1J8CA 1CMXB 1QOFA 3AEDB 2MQJA 2FNJB 4B0MA 4OW0A 2M56B 3TIXA 3L13A 1R4NI 3ZJVA 1QOBA 2Z0DB 2IGDA 2V0GA 2JU6X 1YQ4B 2N9LA 1DOYA 1AWDA 4WWMA 1UBIA 4RGOS 2K6DB 3NZUA 1TBEA 1E7PB 2ZPYA 3B08A 1J7CA 3N9YC 3QA8A 4IWOA 2G1EA 5BYSA 2AL6A 2G45B 1Z5SB 3ZDTA 3Q8BA 2WWZA 4A90A 1HTOA 4IWQA 1FD6A 2K8CA 3AI5A 1E7VA 1TZ1A 1WZ0A 3H6NA 1V5OA 3OWEB 2CU3A 4MM3A 3DVGY 4LCDE 2KX0A 5EE3A 4BKSD 3DHHC 2BKRB 2KVRA 1VZ8A 2B3AA 1WXAA 3PRPB 3Q3MC 5DPWA 1OQQA 2LFIA 1KOTA 3N1XC 2L52A 3IBEA 3HM6X 3RN9C 3RFZB 3MHSD 4E74A 2BS3B 3AN1A 3AE9B 1V86A 4IDIA 2KFKA 2JT4B 2EMTA 2IGGA 2FCNA 4KKIA 2IO1B 2BYEA 3SFEB 2JSVX 1ET9A 2KXJA 1XCQL 5IKCM 2DAFA 2NS5A 3BVZA 2MH7A 2MBOA 1RFAA 3RNEC 1EO6A 4NQLB 4ZRKA 1WGHA 3AXCA 2WDRB 4ZRQA 5KHOA 3VDZA 1QQRA 2DHZA 1R4MB 1V1PB 1K53A 3NVWA 3Q8EA 4KDIC 2MJ3A 5TSSA 3MC8A 2FCMA 1WE6A 2JY6A 2N9XA 3DOWA 1CQVA 2K3UA 3VTWA 1AW7A 3DVNV 2BKFA 2PLPA 2LZ6A 2MBBB 4DDID 3IG3A 3ZO5B 1FFUA 2WDTB 4CHKA 4RFBA 4C4VB 4DWFA 1KJTA 4KVGB 4HEA1 3R7RA 2MHJA 3BK2A 2IO2B 1WH3A 3ZLZA 1WF9A 2FBWB 4IG7B 2WS3B 4NNJB 1YJJA 4PT5A 1OEYJ 4HXDA 1UWMA 1J0GA 1JQ4A 1BXTA 3RI7C 3B2GA 3RULA 3AU5A 3RZFA 1ACCA 2KJRA 4US9A 2ASQA 3Q8AA 4ANWA 1XCTL 4OZCA 2BT6A 1V6EA 1C79A 1FPYA 2KWVB 1P9DU 2RPQA 1FFVA 4N58A 4JWUC 2N7DA 3TUOA 1NEKB 2UYZB 2KQ7A 5C2TB 1TKEA 2EELA 4MJSA 3CSTA 5D6JB 1WGRA 3A9JB 3MHZA 3UQBA 4F7ZA 2DNFA 2VRRB 2W54A 1UBQA 1L4DB 5DPTA 3BYYB 4HK2A 2CJOA 3DBLB 2KKCA 1N62A 4E71A 3VAWA 2D3AA 1NYRA 2RDHA 2KDIA 4MGKE 4K3BA 2HD5B 2MLBA 1JALA 1VJKA 2DZIA 4MSMB 1V1PA 2PVGC 1STEA 5JZEB 2KFJA 3WA0A 5G2NA 3QX1A 2FIFA 2QSDA 5LXHA 4PS7A 2BTEA 3VUXA 1FCCC 1L0XB 2ZW0A 1WXSA 1TY2A 3FKYA 4DHZE 3PLVA 1KLUD 1I4PA 2LHDA 3ZXVA 4K1RB 5D7GA 1C4CA 3H9DA 5AZFA 1PGAA 1OFFA 2WU5B 1KRHA 1B1ZA 3HUIA 1BUIC 1HQRD 1KH0A 2KTFA 3U8ZA 3MP9A 1E8ZA 2Y5PA 2LGIA 2PJHA 1VR9A 2NBWB 1YIWA 2KTRB 3NVVA 2KZRA 3U52E 1GNUA 1VRAB 1JWMD 2KMCA 2ZCCA 4YSZB 2MSED 4GU2A 2ONQA 2VZKB 2XK5B 3OLMD 4WAFA 1V5TA 4OVVA 1ZE3D 3LXFA 1U4AA 1C4AA 2YEPF 4E3CA 3CIRB 3TJPA 4GN1A 2K8BA 5BMHA 3KUZA 2PMVA 1SBBB 2WNMA 2J4XA 2BPSA 2DZKA 1ET6A 3HHMA 4P1BC 3APDA 3DCGA 5AUKA 2BF8B 1WXMA 2NMQA 3Q3NC 1MHHE 1K52A 3Q69A 2KWUB 2TSSA 2KT7A 4IM0A 1C77A 4ANUA 4ZHPA 2M19A 2M17A 2J7QB 3AMZA 2L8JA 1YMHE 4LDTD 2ZW1A 2IO3B 5GXGB 4RGTA 2GB1A 1QOGA 3QCAA 3QWZB 2ZZPB 2GI9A 3IXSA 4M00A 1XXGA 2L7RA 5HFYA 4GMVA 4HJKA 2DZJA 1FXTB 4TQ1A 4MH8A 4ICUA 1E90A 1IBXA 2KLCA 3VR9B 1JWSD 2V3PA 2QDFA 4N59A 3FC4A 4NAWB 4W9DA 1WGGA 2NBVB 1WJ4A 3V62A 1WE7A 3DVGX 3WAOA 2JXXA 2KMMA 3AU4A 2KN4A 5H92C 3AEEB 1GAQB 2AEHA 4GOCA 3PTFC 3T3NA 3AEBB 1YN5A 4B95A 3MJWA 4EFOA 2HJ1A 2RMMA 5G5GA 3NG0A 4WURA 2BGFA 4HKZE 2CR5A 2V4IB 3P4SB 3AE4B 4HLEA 1LFDA 3DBSA 2WLBA 3AB5A 4H2AA 3RMKC 2LVOA 2WU2B 4JQWC 4Q2JA 4BKGA 2LJIA 3IAS1 4WWOA 1PGXA 2E6XA 3B1LX 4M01A 4RNAA 4G0NB 2GBJA 4EKUA 4YT0B 2IJ0A 3QAQA 4K3CA 4XZ4A 3PRMB 4YTMB 3PZDA 4PYZA 1GB1A 1WYWB 1XLOA 3TCAA 1Q5WB 1FO4A 4I6PA 3DHIC 1XD3B 4G11A 3VRAB 1HEZE 3IT4B 2UWQA 5JHBA 4A8XC 1YD8U 1EUVB 1ENFA 2LRWA 3ONSA 3VXWA 4KIKB 2KOXA 1EWYC 2IGHA 3A33B 4QAYA 2JZ3B 2GBRA 2IBIB 3L0WB 3ZJUA 3PPAA 2K0PA 3A1QB 2MX2A 2LEKA 2JQRB 1YNTE 3EFCA 3SR6A 3EC8A 5C23A 2BBCA 2WDVB 4BOSC 4DQOC 1E6EB 1OQRA 1TIFA 4HRSA 3S2AA 1V8CA 2I2YA 5AZHA 2RGFA 3KYCD 3LDZE 3OAWA 4HVBA 1QILA 2ICIA 2JWZA 5E6JA 4NPNA 4XWWA 3AE2B 3AE1B 3I57A 3RZWC 1HTQA 1GJZA 2A5UA 4MGIE 3PZ7A 4FXCA 2BYTA 3AEAB 4ZDVA 2HE7A 2V4LA 1VD2A 4HPPA 1QLBB 1FXAA 3ECIA 2PPHA 4A20A 3HM3A 1UWXA 2L83A 2G4SA 1BT0A 1DYQA 3T9LA 4IM2A 2KHWB 2BB5A 2DYMA 1L0VB 5CHWA 1ZDVA 1L6UA 2KANA 1KFYB 3MC0B 2PEAA 3U7ZA 2ZNVB 2DWQA 2AYOB 4K7UA 2B76B 3AEFB 1SIJA 1P7EA 1T5XD 1TTNA 2WXQA 1JROA 1NENB 2WGSA 3NVZA 4EZLA 3W5VB 3P4QB 1I4RA 3Q6BA 3IT6B 4BVUC 3APCA 1LXDA 4GGQA 2KDBA 4C7YA 1EU4A 1XT9B 1C76A 2D3CA 2WQYB 2LVPA 1FM0D 2R61A 3L08A 2KYWA 3PT2B 4RM8A 4WH4A 4HWIB 4ZYSA 2LHEA 2N9KA 3R7QA 4KX6B 3WALA 4KDLB 3NOBA 1C1YB 4JGHB 5EE1A 2DBYA 1RLFA 3ZRCA 4LNNA 2AQ2B 3RD2A 4EZJA 2ZVNA 2QEJC 1E9MA 4AJWA 3ZVVA 5H8YE 3NS8A 1RFKA 3X0WA 1SEBD 5KHQA 4WQOB 1MJDA 1WX9A 2I1KA 2BB6A 4W9FA 1C3TA 4HPLB 4M8NA 1TKGA 3V6EB 1P3QU 1UF0A 1KTKA 1EM7A 2IYDB 3MJ5A 3VHTC 3DBLI 3AH7A 1AYFA 4KGRA 3UF8A 4W9HA 1HA5A 3BK1A 1WMHA 3VFKA 2O6VB 1RM6C 3GS2A 4WWPA 1Z2MA 4AWJA 3PO0A 2N0SB 3TEXA 5C3JB 3P2BA 3PRZA 3ZNGC 1KM7A 2D2QA 2JF5A 3BY4B 1PUTA 2NCNA 1WM2A 2G9HD 4DK5A 4RGMA 4EUTA 2Y5BB 4LJPB 3J9CA 1R7SA 2FCSA 4XE0A 3FILA 1NBFC 1R4MI
chains in the Genus database with same CATH topology
2DYBA 1QZEA 4A3OA 2OOBB 4KZCA 2Z59B 4K7WA 4YL8A 2MP2A 5DPRA 5DCNA 4W9EA 2KTFA 3U8ZA 4A3PA 1D3ZA 1AARA 1KLVA 1E8ZA 1WY8A 2L76A 3W1YA 2G4DB 1H4RA 2KLGA 3VQIA 4RM9A 2PJHA 3M63B 3NY5A 1WGDA 3V6CB 4CYEA 4PS8A 4FJYA 5IA7A 2GOWA 3QARA 2NBWB 2LGDA 2RSUA 1YIWA 3KW5B 2KTRB 2KZRA 1GNUA 4AJYB 2N1WA 1ZKHA 4TV3A 4DXAB 1OTRB 4I6LB 2KMCA 3H7SA 4DBGA 2JRHA 2CS4A 2KC1A 2ZCCA 3L10B 2MSED 4GU2A 2O2VB 2XK5B 2ZEQA 3OLMD 2WX0A 4ANVA 1S1QB 1WJ6A 2RR9A 3CSFA 5AZGA 5J18A 3Q3JA 3JSVB 1X1MA 2M8SA 4HCPB 4MJSB 1V5TA 4OVVA 2D3GA 4LDTB 1U4AA 2L3ZA 4E3CA 2KNBA 2LD9A 2W9NA 3DBHI 5J17A 2M1MA 1I35A 1UZXB 1SE9A 3QJZA 4GN1A 4P7IA 3TJPA 2ZCBA 2K8BA 3L17A 4W9JA 3W1SA 2KQSA 4AP4C 4X57B 1ISNA 1SIFA 4FULA 3UIPB 3KUZA 1RAXA 1WX8A 2MBHA 1E8WA 2N9PC 2K25A 3SHQA 5D2MB 2L00B 2GMIC 4W9KA 2BPSA 2DZKA 3VTUA 3WANA 4EEWA 4M0WB 1E7UA 3HHMA 1GC7A 4FHKA 2L0TA 3APDA 3DCGA 4WJPA 3VVWB 2BF8B 1WXMA 3ZW3A 4GDKB 2GBMA 4RMAA 2FAZA 2NPTB 2FCQA 2ZPNA 1M94A 3EECA 2KWUB 2N9EB 3VTVA 1TGZB 4IM0A 1WR6E 3PS6A 3O65B 4DHZB 2BWES 4ANUA 1Q1OA 3N32A 4KSLC 2LGYA 5J2RA 4OVUA 3KUDB 3PGEA 2M17A 2J7QB 3HIZA 3WIMA 4HCNB 2D11A 5L95C 2L8JA 4NAWA 2JVCA 1Y8RC 4KIKA 2O6VA 4LDTD 3RYTA 2NPTA 3QHTA 2KJHB 4MDKE 2IO3B 1NDDA 4FN2A 4MGZE 3QCAA 2G3QB 2K8HA 3QWZB 2IY0B 2ZZPB 4TQ0A 5JH5C 2LXAA 3H7PB 3NZSA 2L7RA 2PE6B 4FJZA 4GMVA 1V49A 2L0FA 2KFKB 1ZW7A 2DZMA 3GZNI 3B0AA 2N4FA 1K8RB 4HJKA 1PQSA 2MBQA 1Q0WB 2DZJA 3R66C 3NHEB 1WIAA 4NJ7A 4IM3A 2EKEC 3IHPC 2IZVB 4EZKA 2YLMA 1FXTB 1NI2A 3ZTCA 4F1SA 3Q3FA 4NQKE 4KZ0A 4TQ1A 3A1QA 4IW0A 5L83A 4ICUA 4J6IA 1E90A 5FR6A 3UIOB 1G6JA 2KLCA 4GIVA 2J0MA 3IFWB 3SU8X 4N9F4 3ENEA 1P1AA 3X23A 1OEYA 4NAWB 4W9DA 2KC2A 4DHJB 1IP9A 1WGGA 3H1UA 2NBVB 1WRDB 3PVLA 1WJ4A 2REXA 4NY0A 2ZJDA 2QHOA 4XC2A 3V62A 2JUOA 1WE7A 3SD5A 1SGHA 3DVGX 4JL9A 3WAOA 3ZNID 2JXXA 3QIJA 3AU4A 2MW5A 4JLCA 4FLHA 2LGXA 1J8CA 1CMXB 3N30A 4FHJA 3ZNHB 2AEHA 1UD7A 4K7SA 4URKA 4GOCA 2MQJA 3PTFC 2KJ6A 2FNJB 2O6VD 4XX5A 2BYVE 4CO7A 3PSEB 3TIXA 3L13A 4GB9A 1R4NI 4EOYA 4MEMA 1UGMA 4B95A 3MJWA 4EFOA 5AEKB 2HJ8A 2GBKA 2Z0DB 4GDLA 2R2QA 1V9JA 2BGFA 2LASA 1LM8B 3M3JA 4MGYE 1UBIA 2CR5A 4HLEA 2K6DB 3NZUA 1LFDA 3DQVA 3DBSA 4ZRJA 2CHXA 2KMAA 1TBEA 3GOEA 2KD0A 2IO0B 2ZPYA 2LVOA 3B08A 3ZDMC 2D10A 2KK8A 3QA8A 4IWOA 4JQWC 5DPSA 4BKGA 4BOZB 2AL6A 2LXCA 2C9WB 4FJVB 2MRPA 4WWOA 2G45B 3TL5A 2WX1A 1Z5SB 3ZDTA 1L2NA 2ZNVC 2WWZA 3A4RA 4W9IA 3TBLD 2OJRA 2Z0EB 3B1LX 2DYOA 4IWQA 3UQAA 4G0NB 4KSKC 3RUIB 2K8CA 2CHWA 3AI5A 4II3B 2GBJA 1E7VA 1V80A 4EKUA 4G3XB 4BKTA 4G50A 4WAAA 1TZ1A 1WJUA 1WZ0A 3H6NA 2M0XA 1V5OA 4MM3A 1EF1A 3QAQA 3DVGY 5CX3A 4XZ4A 4LCDE 3PRMB 3PZDA 2CKHB 2KDEB 2LI5A 4IUMB 4PYZA 2DENB 1WYWB 1UH6A 2KX0A 3TCAA 1Q5WB 4I6PA 4BKSD 2BKRB 2KVRA 4NJ6A 1XD3B 5TR5A 4G11A 2B3AA 4AOFA 1WXAA 5LXIB 3PRPB 5DPWA 2JRIB 2UWQA 3VH3B 1KOTA 2KTRA 3IBEA 5JHBA 1V2YA 2LRUA 3HM6X 3JVZX 1YD8U 1EUVB 3MHSD 4E74A 2LRWA 3ONSA 3VXWA 1V86A 2LWPA 4KIKB 1WJNA 2KFKA 2KOXA 1WI0A 2JT4B 2EMTA 2KO3A 2YVCA 1WMHB 3A33B 2FCNA 2JZ3B 3OJ3A 3V61A 2AL3A 2BYEA 2GBRA 2IBIB 2IO1B 3L0WB 2KXJA 3U30A 3ML9A 3BINA 3PPAA 2BWFA 3A1QB 4HPMB 2MX2A 3I3TB 3EC8A 1WGYA 2DAFA 5C23A 2NS5A 1P0RA 2MBOA 1WFYA 1RFAA 1OGWA 4BOSC 1EO6A 4NQLB 1J19A 3C0RB 3DVNU 4ZRKA 5CHVC 2KX3A 2MP2B 5GMVA 3SDLC 3S2AA 1WGHA 3PREA 3A9JA 3AXCA 1T0YA 3DDCB 5AZHA 2RGFA 1MG8A 3KYCD 3N3KB 1YJ1A 3ML8A 4GSWA 5KHOA 3LDZE 4FBJB 3OAWA 4B6WA 3VDZA 4HVBA 2JWZA 2DHZA 2FIDA 3DBRI 4MSQB 4BBNC 4NPNA 2KN5A 1WZ3A 5C1ZA 3AULA 3RZWC 3L16A 4GDKA 4KDIC 2A5UA 4MGIE 1GJZA 3OJ4B 4W9GA 5CTRC 4ICVA 4BFRA 5JHAA 2EMSA 2LJ5A 3U7DA 4ZDVA 1GG3A 1YX5B 4F8CB 2HE7A 2FCMA 1WE6A 2JY6A 2XBBC 1XQQA 2V4LA 4HDOA 2N9XA 1VD2A 2J0KA 2J0JA 3DOWA 2HTHA 3VTWA 3T8MA 4ZRIA 3D32A 3DVNV 3JSVA 4BKSA 2BKFA 2IY1B 1VCBA 1L7YA 3ECIA 5EDSA 2PPHA 4K81A 4A20A 3K9PB 3HM3A 2LZ6A 1YQBA 2MBBB 3ZRFA 3UGBB 4DDID 3IG3A 3M62B 4DHJD 4FA6A 3QQ8B 3ZO5B 2WDTB 4CHKA 2G4SA 1BT0A 1E5WA 1F9JA 3DPDA 4DWFA 2M4NA 1HE8A 2JPHA 2MA9B 3T9LA 4IM2A 1KJTA 1WM3A 2KHWB 2DYMA 4KVGB 1I42A 3R7RA 4IC7B 5CHWA 3VUYA 2IO2B 3EFUA 3QK0A 1WH3A 3ZLZA 2AWTA 1WF9A 4IG7B 2KANA 4BBNF 4NNJB 5HKHA 4TKNA 2PEAA 4ANXA 4M8MA 2ZNVB 1OEYJ 2AYOB 4K7UA 4HXDA 1J0GA 2BYFA 2KDFB 2GBNA 3LJ3A 3RULA 3AU5A 2A4ZA 3RZFA 4B9KA 5IAAC 1TTNA 4IWPA 4WJNA 2K39A 1ZGUB 3CF6E 2KJRA 4EZLA 3M95A 4BVUC 3JW0X 3A9KB 2ASQA 3ZNZB 3APCA 4ANWA 5E6NA 1LXDA 4GGQA 3ZTDA 1GC6A 1V6EA 2XEWA 2KDBA 4WWNA 2ZVOA 3EHVA 1XT9B 2LVQA 1RRBA 2CHZA 3L54A 2KWVB 3QC8B 4KV2A 1GUAB 1P9DU 2LVPA 3V60A 2N1VA 2JZZA 3RCZA 2RPQA 3VH4B 4JIOU 3L08A 2N7DA 2WYQA 4DDGD 3PT2B 4RM8A 2UYZB 2KQ7A 3W1SC 1UELA 4HWIB 1EF5A 1P98A 4WJQA 3R7QA 3ALBA 4MJSA 1S3SG 3CSTA 1V81A 3WALA 4KDLB 3NOBA 4WJOA 2N7EA 3JYUA 3KH0A 5BO4B 5D6JB 1C1YB 1WGRA 2C5LC 4JGHB 3A9JB 3UQBA 1LQBA 1WR1A 4F7ZA 1RLFA 5CHFA 2VRRB 2XK5A 3ZRCA 3UINB 3KYDD 2DAJA 3RD2A 1UBQA 2R2OA 4EZJA 2PE9A 3WAMA 2L05A 1WX7A 2ZVNA 3A9KA 5DPTA 4HDQA 4LJOB 4AJWA 4HK2A 1WXVA 3ZVVA 3NS8A 3TMPB 3X0WA 2KKCA 4E71A 5KHQA 2CU1A 3KVFB 3VAWA 4WQOB 2LUEA 3R3MA 2NVUI 2RD0A 5E6OA 1WX9A 2C7HA 3CMMB 2I1KA 2KDIA 2V3SA 4MGKE 4W9FA 1C3TA 4GXBA 2D07B 4TUUA 2HD5B 2MLBA 4HPLB 2DZIA 4M8NA 4ASWC 3IVFA 3V6EB 1P3QU 4MSMB 2MWSB 2DX5B 3KUCB 2IYDB 2C7NB 3RT3B 1A5RA 3VHTC 5D94A 5JZEB 2KFJA 3MTNB 3WA0A 3DBLI 5G2NA 4PYUA 3QX1A 3A4SC 3UF8A 2FIFA 2NBUA 4W9HA 2MBEA 5LXHA 4PS7A 2NR2A 4MELA 5LLIA 1WMHA 3VFKA 2O6VB 3VUXA 4W9LA 4FADA 1OQYA 3PV1A 2FUHB 4W9CA 5G55A 4I6NB 4WWPA 1Z2MA 4AWJA 1WXSA 5E6PA 3ZKJC 3PHXB 1JRUA 3ZUNA 3APFA 3HK0A 4MH0E 4ZYNA 2KWCA 4DHZE 3P2BA 3PLVA 3PHWB 4PS3A 3PRZA 3ZNGC 2V1YA 3VUWA 1KM7A 2D2QA 3WAPA 2JF5A 4K1RB 4II2B 1H8CA 5D7GA 3H9DA 3K9OB 2I1JA 4AUQC 3BY4B 4GDLB 2NCNA 2O2VA 1IPGA 5AZFA 1WM2A 1IYFA 1E8YA 1E8XA 4DK5A 4EUTA 2MCNB 2K6QA 2C7MB 2Y5BB 4LJPB 1YX6B 2K1FA 2FCSA 3H7PA 3ZIMA 2C60A 1NBFC 3PLUA 1R4MI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DYB A;  1QZE A;  4A3O A;  2OOB B;  4KZC A;  2Z59 B;  4K7W A;  4YL8 A;  2MP2 A;  5DPR A;  5DCN A;  4W9E A;  2KTF A;  3U8Z A;  4A3P A;  1D3Z A;  1AAR A;  1KLV A;  1E8Z A;  1WY8 A;  2L76 A;  3W1Y A;  2G4D B;  1H4R A;  2KLG A;  3VQI A;  4RM9 A;  2PJH A;  3M63 B;  3NY5 A;  1WGD A;  3V6C B;  4CYE A;  4PS8 A;  4FJY A;  5IA7 A;  2GOW A;  3QAR A;  2NBW B;  2LGD A;  2RSU A;  1YIW A;  3KW5 B;  2KTR B;  2KZR A;  1GNU A;  4AJY B;  2N1W A;  1ZKH A;  4TV3 A;  4DXA B;  1OTR B;  4I6L B;  2KMC A;  3H7S A;  4DBG A;  2JRH A;  2CS4 A;  2KC1 A;  2ZCC A;  3L10 B;  2MSE D;  4GU2 A;  2O2V B;  2XK5 B;  2ZEQ A;  3OLM D;  2WX0 A;  4ANV A;  1S1Q B;  1WJ6 A;  2RR9 A;  3CSF A;  5AZG A;  5J18 A;  3Q3J A;  3JSV B;  1X1M A;  2M8S A;  4HCP B;  4MJS B;  1V5T A;  4OVV A;  2D3G A;  4LDT B;  1U4A A;  2L3Z A;  4E3C A;  2KNB A;  2LD9 A;  2W9N A;  3DBH I;  5J17 A;  2M1M A;  1I35 A;  1UZX B;  1SE9 A;  3QJZ A;  4GN1 A;  4P7I A;  3TJP A;  2ZCB A;  2K8B A;  3L17 A;  4W9J A;  3W1S A;  2KQS A;  4AP4 C;  4X57 B;  1ISN A;  1SIF A;  4FUL A;  3UIP B;  3KUZ A;  1RAX A;  1WX8 A;  2MBH A;  1E8W A;  2N9P C;  2K25 A;  3SHQ A;  5D2M B;  2L00 B;  2GMI C;  4W9K A;  2BPS A;  2DZK A;  3VTU A;  3WAN A;  4EEW A;  4M0W B;  1E7U A;  3HHM A;  1GC7 A;  4FHK A;  2L0T A;  3APD A;  3DCG A;  4WJP A;  3VVW B;  2BF8 B;  1WXM A;  3ZW3 A;  4GDK B;  2GBM A;  4RMA A;  2FAZ A;  2NPT B;  2FCQ A;  2ZPN A;  1M94 A;  3EEC A;  2KWU B;  2N9E B;  3VTV A;  1TGZ B;  4IM0 A;  1WR6 E;  3PS6 A;  3O65 B;  4DHZ B;  2BWE S;  4ANU A;  1Q1O A;  3N32 A;  4KSL C;  2LGY A;  5J2R A;  4OVU A;  3KUD B;  3PGE A;  2M17 A;  2J7Q B;  3HIZ A;  3WIM A;  4HCN B;  2D11 A;  5L95 C;  2L8J A;  4NAW A;  2JVC A;  1Y8R C;  4KIK A;  2O6V A;  4LDT D;  3RYT A;  2NPT A;  3QHT A;  2KJH B;  4MDK E;  2IO3 B;  1NDD A;  4FN2 A;  4MGZ E;  3QCA A;  2G3Q B;  2K8H A;  3QWZ B;  2IY0 B;  2ZZP B;  4TQ0 A;  5JH5 C;  2LXA A;  3H7P B;  3NZS A;  2L7R A;  2PE6 B;  4FJZ A;  4GMV A;  1V49 A;  2L0F A;  2KFK B;  1ZW7 A;  2DZM A;  3GZN I;  3B0A A;  2N4F A;  1K8R B;  4HJK A;  1PQS A;  2MBQ A;  1Q0W B;  2DZJ A;  3R66 C;  3NHE B;  1WIA A;  4NJ7 A;  4IM3 A;  2EKE C;  3IHP C;  2IZV B;  4EZK A;  2YLM A;  1FXT B;  1NI2 A;  3ZTC A;  4F1S A;  3Q3F A;  4NQK E;  4KZ0 A;  4TQ1 A;  3A1Q A;  4IW0 A;  5L83 A;  4ICU A;  4J6I A;  1E90 A;  5FR6 A;  3UIO B;  1G6J A;  2KLC A;  4GIV A;  2J0M A;  3IFW B;  3SU8 X;  4N9F 4;  3ENE A;  1P1A A;  3X23 A;  1OEY A;  4NAW B;  4W9D A;  2KC2 A;  4DHJ B;  1IP9 A;  1WGG A;  3H1U A;  2NBV B;  1WRD B;  3PVL A;  1WJ4 A;  2REX A;  4NY0 A;  2ZJD A;  2QHO A;  4XC2 A;  3V62 A;  2JUO A;  1WE7 A;  3SD5 A;  1SGH A;  3DVG X;  4JL9 A;  3WAO A;  3ZNI D;  2JXX A;  3QIJ A;  3AU4 A;  2MW5 A;  4JLC A;  4FLH A;  2LGX A;  1J8C A;  1CMX B;  3N30 A;  4FHJ A;  3ZNH B;  2AEH A;  1UD7 A;  4K7S A;  4URK A;  4GOC A;  2MQJ A;  3PTF C;  2KJ6 A;  2FNJ B;  2O6V D;  4XX5 A;  2BYV E;  4CO7 A;  3PSE B;  3TIX A;  3L13 A;  4GB9 A;  1R4N I;  4EOY A;  4MEM A;  1UGM A;  4B95 A;  3MJW A;  4EFO A;  5AEK B;  2HJ8 A;  2GBK A;  2Z0D B;  4GDL A;  2R2Q A;  1V9J A;  2BGF A;  2LAS A;  1LM8 B;  3M3J A;  4MGY E;  1UBI A;  2CR5 A;  4HLE A;  2K6D B;  3NZU A;  1LFD A;  3DQV A;  3DBS A;  4ZRJ A;  2CHX A;  2KMA A;  1TBE A;  3GOE A;  2KD0 A;  2IO0 B;  2ZPY A;  2LVO A;  3B08 A;  3ZDM C;  2D10 A;  2KK8 A;  3QA8 A;  4IWO A;  4JQW C;  5DPS A;  4BKG A;  4BOZ B;  2AL6 A;  2LXC A;  2C9W B;  4FJV B;  2MRP A;  4WWO A;  2G45 B;  3TL5 A;  2WX1 A;  1Z5S B;  3ZDT A;  1L2N A;  2ZNV C;  2WWZ A;  3A4R A;  4W9I A;  3TBL D;  2OJR A;  2Z0E B;  3B1L X;  2DYO A;  4IWQ A;  3UQA A;  4G0N B;  4KSK C;  3RUI B;  2K8C A;  2CHW A;  3AI5 A;  4II3 B;  2GBJ A;  1E7V A;  1V80 A;  4EKU A;  4G3X B;  4BKT A;  4G50 A;  4WAA A;  1TZ1 A;  1WJU A;  1WZ0 A;  3H6N A;  2M0X A;  1V5O A;  4MM3 A;  1EF1 A;  3QAQ A;  3DVG Y;  5CX3 A;  4XZ4 A;  4LCD E;  3PRM B;  3PZD A;  2CKH B;  2KDE B;  2LI5 A;  4IUM B;  4PYZ A;  2DEN B;  1WYW B;  1UH6 A;  2KX0 A;  3TCA A;  1Q5W B;  4I6P A;  4BKS D;  2BKR B;  2KVR A;  4NJ6 A;  1XD3 B;  5TR5 A;  4G11 A;  2B3A A;  4AOF A;  1WXA A;  5LXI B;  3PRP B;  5DPW A;  2JRI B;  2UWQ A;  3VH3 B;  1KOT A;  2KTR A;  3IBE A;  5JHB A;  1V2Y A;  2LRU A;  3HM6 X;  3JVZ X;  1YD8 U;  1EUV B;  3MHS D;  4E74 A;  2LRW A;  3ONS A;  3VXW A;  1V86 A;  2LWP A;  4KIK B;  1WJN A;  2KFK A;  2KOX A;  1WI0 A;  2JT4 B;  2EMT A;  2KO3 A;  2YVC A;  1WMH B;  3A33 B;  2FCN A;  2JZ3 B;  3OJ3 A;  3V61 A;  2AL3 A;  2BYE A;  2GBR A;  2IBI B;  2IO1 B;  3L0W B;  2KXJ A;  3U30 A;  3ML9 A;  3BIN A;  3PPA A;  2BWF A;  3A1Q B;  4HPM B;  2MX2 A;  3I3T B;  3EC8 A;  1WGY A;  2DAF A;  5C23 A;  2NS5 A;  1P0R A;  2MBO A;  1WFY A;  1RFA A;  1OGW A;  4BOS C;  1EO6 A;  4NQL B;  1J19 A;  3C0R B;  3DVN U;  4ZRK A;  5CHV C;  2KX3 A;  2MP2 B;  5GMV A;  3SDL C;  3S2A A;  1WGH A;  3PRE A;  3A9J A;  3AXC A;  1T0Y A;  3DDC B;  5AZH A;  2RGF A;  1MG8 A;  3KYC D;  3N3K B;  1YJ1 A;  3ML8 A;  4GSW A;  5KHO A;  3LDZ E;  4FBJ B;  3OAW A;  4B6W A;  3VDZ A;  4HVB A;  2JWZ A;  2DHZ A;  2FID A;  3DBR I;  4MSQ B;  4BBN C;  4NPN A;  2KN5 A;  1WZ3 A;  5C1Z A;  3AUL A;  3RZW C;  3L16 A;  4GDK A;  4KDI C;  2A5U A;  4MGI E;  1GJZ A;  3OJ4 B;  4W9G A;  5CTR C;  4ICV A;  4BFR A;  5JHA A;  2EMS A;  2LJ5 A;  3U7D A;  4ZDV A;  1GG3 A;  1YX5 B;  4F8C B;  2HE7 A;  2FCM A;  1WE6 A;  2JY6 A;  2XBB C;  1XQQ A;  2V4L A;  4HDO A;  2N9X A;  1VD2 A;  2J0K A;  2J0J A;  3DOW A;  2HTH A;  3VTW A;  3T8M A;  4ZRI A;  3D32 A;  3DVN V;  3JSV A;  4BKS A;  2BKF A;  2IY1 B;  1VCB A;  1L7Y A;  3ECI A;  5EDS A;  2PPH A;  4K81 A;  4A20 A;  3K9P B;  3HM3 A;  2LZ6 A;  1YQB A;  2MBB B;  3ZRF A;  3UGB B;  4DDI D;  3IG3 A;  3M62 B;  4DHJ D;  4FA6 A;  3QQ8 B;  3ZO5 B;  2WDT B;  4CHK A;  2G4S A;  1BT0 A;  1E5W A;  1F9J A;  3DPD A;  4DWF A;  2M4N A;  1HE8 A;  2JPH A;  2MA9 B;  3T9L A;  4IM2 A;  1KJT A;  1WM3 A;  2KHW B;  2DYM A;  4KVG B;  1I42 A;  3R7R A;  4IC7 B;  5CHW A;  3VUY A;  2IO2 B;  3EFU A;  3QK0 A;  1WH3 A;  3ZLZ A;  2AWT A;  1WF9 A;  4IG7 B;  2KAN A;  4BBN F;  4NNJ B;  5HKH A;  4TKN A;  2PEA A;  4ANX A;  4M8M A;  2ZNV B;  1OEY J;  2AYO B;  4K7U A;  4HXD A;  1J0G A;  2BYF A;  2KDF B;  2GBN A;  3LJ3 A;  3RUL A;  3AU5 A;  2A4Z A;  3RZF A;  4B9K A;  5IAA C;  1TTN A;  4IWP A;  4WJN A;  2K39 A;  1ZGU B;  3CF6 E;  2KJR A;  4EZL A;  3M95 A;  4BVU C;  3JW0 X;  3A9K B;  2ASQ A;  3ZNZ B;  3APC A;  4ANW A;  5E6N A;  1LXD A;  4GGQ A;  3ZTD A;  1GC6 A;  1V6E A;  2XEW A;  2KDB A;  4WWN A;  2ZVO A;  3EHV A;  1XT9 B;  2LVQ A;  1RRB A;  2CHZ A;  3L54 A;  2KWV B;  3QC8 B;  4KV2 A;  1GUA B;  1P9D U;  2LVP A;  3V60 A;  2N1V A;  2JZZ A;  3RCZ A;  2RPQ A;  3VH4 B;  4JIO U;  3L08 A;  2N7D A;  2WYQ A;  4DDG D;  3PT2 B;  4RM8 A;  2UYZ B;  2KQ7 A;  3W1S C;  1UEL A;  4HWI B;  1EF5 A;  1P98 A;  4WJQ A;  3R7Q A;  3ALB A;  4MJS A;  1S3S G;  3CST A;  1V81 A;  3WAL A;  4KDL B;  3NOB A;  4WJO A;  2N7E A;  3JYU A;  3KH0 A;  5BO4 B;  5D6J B;  1C1Y B;  1WGR A;  2C5L C;  4JGH B;  3A9J B;  3UQB A;  1LQB A;  1WR1 A;  4F7Z A;  1RLF A;  5CHF A;  2VRR B;  2XK5 A;  3ZRC A;  3UIN B;  3KYD D;  2DAJ A;  3RD2 A;  1UBQ A;  2R2O A;  4EZJ A;  2PE9 A;  3WAM A;  2L05 A;  1WX7 A;  2ZVN A;  3A9K A;  5DPT A;  4HDQ A;  4LJO B;  4AJW A;  4HK2 A;  1WXV A;  3ZVV A;  3NS8 A;  3TMP B;  3X0W A;  2KKC A;  4E71 A;  5KHQ A;  2CU1 A;  3KVF B;  3VAW A;  4WQO B;  2LUE A;  3R3M A;  2NVU I;  2RD0 A;  5E6O A;  1WX9 A;  2C7H A;  3CMM B;  2I1K A;  2KDI A;  2V3S A;  4MGK E;  4W9F A;  1C3T A;  4GXB A;  2D07 B;  4TUU A;  2HD5 B;  2MLB A;  4HPL B;  2DZI A;  4M8N A;  4ASW C;  3IVF A;  3V6E B;  1P3Q U;  4MSM B;  2MWS B;  2DX5 B;  3KUC B;  2IYD B;  2C7N B;  3RT3 B;  1A5R A;  3VHT C;  5D94 A;  5JZE B;  2KFJ A;  3MTN B;  3WA0 A;  3DBL I;  5G2N A;  4PYU A;  3QX1 A;  3A4S C;  3UF8 A;  2FIF A;  2NBU A;  4W9H A;  2MBE A;  5LXH A;  4PS7 A;  2NR2 A;  4MEL A;  5LLI A;  1WMH A;  3VFK A;  2O6V B;  3VUX A;  4W9L A;  4FAD A;  1OQY A;  3PV1 A;  2FUH B;  4W9C A;  5G55 A;  4I6N B;  4WWP A;  1Z2M A;  4AWJ A;  1WXS A;  5E6P A;  3ZKJ C;  3PHX B;  1JRU A;  3ZUN A;  3APF A;  3HK0 A;  4MH0 E;  4ZYN A;  2KWC A;  4DHZ E;  3P2B A;  3PLV A;  3PHW B;  4PS3 A;  3PRZ A;  3ZNG C;  2V1Y A;  3VUW A;  1KM7 A;  2D2Q A;  3WAP A;  2JF5 A;  4K1R B;  4II2 B;  1H8C A;  5D7G A;  3H9D A;  3K9O B;  2I1J A;  4AUQ C;  3BY4 B;  4GDL B;  2NCN A;  2O2V A;  1IPG A;  5AZF A;  1WM2 A;  1IYF A;  1E8Y A;  1E8X A;  4DK5 A;  4EUT A;  2MCN B;  2K6Q A;  2C7M B;  2Y5B B;  4LJP B;  1YX6 B;  2K1F A;  2FCS A;  3H7P A;  3ZIM A;  2C60 A;  1NBF C;  3PLU A;  1R4M I; 
#chains in the Genus database with same CATH topology
 4ZHO A;  4KZC A;  2Z59 B;  4K7W A;  2ON8 A;  3Q14 C;  2CJN A;  2G4D B;  2VZK D;  3M63 B;  3NY5 A;  1WGD A;  4PS8 A;  3RNB C;  1IBX B;  2LGD A;  2RSU A;  3MC9 A;  3KW5 B;  2L1A A;  2MEK A;  2H89 B;  3AEC B;  3DWG C;  1JML A;  2N1W A;  4DXA B;  3TEY A;  2I38 A;  2JRH A;  2CS4 A;  4JX1 C;  3ZGZ A;  1K50 A;  3BYT B;  3B2F A;  3HRD D;  2WX0 A;  1D4B A;  1S1Q B;  3CSF A;  5LNK 1;  5AZG A;  3JSV B;  2WDQ B;  1HZ6 A;  1SE4 A;  2M8S A;  2JXT A;  2N7J A;  2XNA C;  4A6Q A;  2WXO A;  4LDT B;  1DOX A;  1ZOY B;  2L3Z A;  4IKG A;  2LD9 A;  3DBH I;  3PZ8 A;  2M1M A;  5J17 A;  2K22 A;  2ZCB A;  3L17 A;  4AP4 C;  4X57 B;  1Y56 A;  3UIP B;  1RAX A;  1WX8 A;  4YXD B;  2N9P C;  3SHQ A;  5D2M B;  2GMI C;  1FNW A;  3UI3 A;  3HVD A;  1FRR A;  1NI3 A;  3O13 A;  4XGA B;  4EEW A;  2BQQ A;  2SAK A;  2KQ4 X;  2L0T A;  2WXN A;  3BII D;  1SE2 A;  3ZW3 A;  2FAZ A;  1IGD A;  2ZPN A;  1M94 A;  2WHI A;  1TGZ B;  1WR6 E;  3CWI A;  4DHZ B;  1I4G A;  3MFG A;  1Q1O A;  3N32 A;  5IN7 A;  2LGY A;  1T3Q A;  3KUD B;  5T8I A;  4L1B A;  2VH1 A;  4HCN B;  2D11 A;  1PGB A;  2JVC A;  3P4P B;  1PYW D;  2AQ1 B;  4FN2 A;  2FE8 A;  1F2R C;  2G3Q B;  2K8H A;  2IY0 B;  2OJW A;  4TQ0 A;  1B9R A;  2X8X X;  4FJZ A;  1V49 A;  4RGN A;  2KFK B;  2DZM A;  3B0A A;  1C4P A;  1PQS A;  1Q0W B;  3R66 C;  3NHE B;  1C78 A;  1ZPS A;  3N1Z C;  1CZP A;  1NI2 A;  5EE9 A;  3Q3F A;  4KZ0 A;  4YTP B;  4IW0 A;  4J6I A;  1XLP A;  4ZOH C;  3UIO B;  1G6J A;  2J53 A;  4GIV A;  1KLG D;  1J7B A;  3IFW B;  3SU8 X;  4YWG G;  2Z8L A;  1XLQ A;  1P1A A;  5FKA C;  1WRD B;  3PVL A;  3LB8 C;  4LLG M;  2ZJD A;  2QHO A;  3AE7 B;  3QIJ A;  2MW5 A;  3KLS X;  1KF6 B;  1CK1 A;  4FHJ A;  4K7S A;  2KJ6 A;  1I4Q A;  4C56 C;  4KGS A;  4CO7 A;  2BYV E;  3BZD B;  2PTL A;  3E56 A;  5AEK B;  1SJE D;  4GDL A;  4LK0 M;  4C00 A;  1TS4 A;  2R2Q A;  1V9J A;  4JPS A;  2LAS A;  1XEE A;  1TT5 B;  5G5H A;  2CHX A;  2KMA A;  2IO0 B;  4J3O D;  4ARC A;  1XLN A;  3FAH A;  3ZDM C;  2D10 A;  3R2T A;  4BOZ B;  4FJV B;  1ZP0 B;  3IAM 1;  2WX1 A;  2ZNV C;  4W9I A;  2IND C;  3TBL D;  1R4N B;  2OJR A;  2Z0E B;  2DYO A;  1T0S C;  4KSK C;  2CHW A;  4II3 B;  3DHG C;  1LO5 D;  1V80 A;  1L4Z B;  4BKT A;  4WAA A;  1JWB D;  1EF1 A;  5BMI A;  2CKH B;  2KDE B;  2LI5 A;  2DEN B;  2WXG A;  3DWM A;  3EA6 A;  2WXL A;  4LTU A;  2X38 A;  5TR5 A;  4NJ6 A;  4NJC A;  4AOF A;  4A55 A;  2JRI B;  2QIL A;  2KTR A;  2LRU A;  1JRP A;  1VLB A;  4MM3 B;  2LWP A;  1WJN A;  1CJE A;  3GP7 A;  2INC C;  2KO3 A;  1VZ6 A;  1WMH B;  3OJ3 A;  3V61 A;  1EWC A;  2Q5W D;  3I3T B;  4WIP A;  1ESF A;  1I7H A;  1L6V A;  1WFY A;  1OGW A;  1GOZ A;  3DVN U;  2W3S A;  5CHV C;  2KX3 A;  3KWL A;  3PRE A;  1N61 A;  3DDC B;  3N3K B;  4GSW A;  4FBJ B;  1SB3 C;  4S0R A;  2PW9 A;  4BBN C;  3DBR I;  5C1Z A;  4ICV A;  4BFR A;  2EMS A;  3U7D A;  4F8C B;  2J0K A;  2J0J A;  4ZRI A;  4NAM A;  4BKS A;  3C19 A;  1L7Y A;  4AQ7 A;  5EDS A;  4K81 A;  1YQB A;  2K9X A;  3M62 B;  1WSP A;  2XN9 C;  3DPD A;  1E5W A;  1F9J A;  2INP E;  2M4N A;  3BWU D;  2MA9 B;  1WM3 A;  1F77 A;  4IC7 B;  3I5J C;  3VUY A;  2BS4 B;  3EFU A;  4L23 A;  3BVG A;  2AWT A;  4BBN F;  1RYJ A;  4TKN A;  4ANX A;  2EKI A;  1MI0 A;  1YJI A;  1QF6 A;  3I9V 1;  3LJ3 A;  4C4V A;  2A4Z A;  4B9K A;  2MJD A;  1A70 A;  2WXJ A;  3SFD B;  4RH6 A;  2ACZ B;  3A9K B;  5E6N A;  3ZTD A;  2XEW A;  4IOI E;  2ZVO A;  3EHV A;  2LVQ A;  4OHJ A;  3ETR A;  3L54 A;  4LNI A;  2LMC A;  3QC8 B;  2JZZ A;  2N1V A;  3R2I A;  5AUI A;  3VH4 B;  3RNC C;  2IDY A;  3GE3 C;  1UEL A;  1P98 A;  4WJQ A;  1PFD A;  1S3S G;  1V81 A;  2N7E A;  2Y3A A;  5BO4 B;  5BYR A;  3VRB B;  2V9H A;  1LQB A;  3UIN B;  1SJH D;  2PE9 A;  4RCO A;  1NYQ A;  4LJO B;  4HDQ A;  3TMP B;  2QIE B;  3KVF B;  2LUE A;  1V1O A;  3R3M A;  2RD0 A;  2C7H A;  3CMM B;  4GXB A;  4TUU A;  5MPO A;  2KVZ A;  2NTS A;  2MWS B;  2DX5 B;  1DGJ A;  2C7N B;  2SEB D;  5D94 A;  1GB4 A;  2QC8 A;  3HVZ A;  1QT9 A;  4M0W A;  1TS5 A;  4PYU A;  3A4S C;  4OZB A;  1M4V A;  2MBE A;  3BVM A;  4MEL A;  5LLI A;  3W2D A;  3PV1 A;  2PKO A;  4MAC A;  5G55 A;  2RDG A;  1UGJ A;  3ZKJ C;  3ZUN A;  3W5U B;  3APF A;  4MH0 E;  4ZYN A;  3ABV B;  4LNF A;  4PS3 A;  5D3D A;  3VUW A;  4P1C C;  2JYE A;  3TEW A;  4II2 B;  4AUQ C;  2I1J A;  4XYC A;  2LGS A;  2O2V A;  1E8Y A;  1E8X A;  2J42 A;  3AE6 B;  2MJE A;  2MCN B;  5BYQ A;  1MG4 A;  1N60 A;  1FRD A;  2K1F A;  3RPF C;  3H7P A;  3ZIM A;  2BVC A;  3RCZ A;  1JWA D;  1ZUD 2;  1QZE A;  4RF0 A;  2OOB B;  1D5X C;  1TJE A;  2MP2 A;  4YL8 A;  5DCN A;  4W9E A;  4A3P A;  3GE8 C;  1YQ3 B;  2GRI A;  3W1Y A;  1H4R A;  1UUP A;  1P7F A;  4CYE A;  1XF5 L;  1VDV A;  1SXT A;  4AJY B;  4A9A A;  4TV3 A;  1ZKH A;  4HJG E;  1OTR B;  4I6L B;  3H7S A;  4NZL B;  1YN4 A;  2O2V B;  5D3I B;  1AN8 A;  4ANV A;  1WJ6 A;  1C9F A;  5HI1 A;  1K51 A;  2D3G A;  4US8 A;  1SE9 A;  3QJZ A;  3V3X A;  4W9J A;  3W1S A;  4MT5 A;  2YEP B;  1SIF A;  4DXG A;  4FUL A;  3U4E G;  2K25 A;  3VR8 B;  4W9K A;  2WXM A;  4B0E A;  4M0W B;  1E7U A;  1WGK A;  4C80 A;  4FHK A;  3VVW B;  4WJP A;  4GDK B;  2GBM A;  2RDB C;  1HZ5 A;  2QMT A;  2FCQ A;  3EEC A;  3VTV A;  1WXQ A;  4REZ A;  1J7A A;  3PS6 A;  2BWE S;  3Q3O C;  3P42 A;  1TZO A;  5IO9 A;  2D5G A;  5J2R A;  2WXF A;  4OVU A;  3PGE A;  3HIZ A;  3WIM A;  1TYG B;  2J52 A;  4WQM A;  5L95 C;  3NS1 A;  4NAW A;  1Y8R C;  2O6V A;  2HTM E;  3RYT A;  3QHT A;  2KJH B;  2WXP A;  4MDK E;  3P4R B;  1NDD A;  4MGZ E;  1FMA D;  3AV8 A;  2BS2 B;  3TEZ A;  5FR3 A;  3NZS A;  3P63 A;  1E10 A;  2L0F A;  1LGR A;  4XWT A;  5I4D A;  1ZXI A;  4NJ7 A;  2EKE C;  2IZV B;  2YLM A;  3ZTC A;  4NQK E;  3T3O A;  3A1Q A;  4M02 A;  3OG5 A;  5HHD G;  2J0M A;  4N9F 4;  1N5X A;  3X23 A;  1OEY A;  4DHJ B;  2KC2 A;  1IP9 A;  4XC2 A;  2W3R A;  3ZJT A;  3U2S C;  2JUO A;  3L4P A;  1SE3 A;  1SGH A;  4JL9 A;  3ZNI D;  1D5M C;  2JX5 A;  4FLH A;  4JLC A;  2LGX A;  3ZNH B;  3N30 A;  2IPK D;  1UD7 A;  4URK A;  4XX5 A;  2O6V D;  3PSE B;  1QOA A;  4GB9 A;  4EOY A;  4MEM A;  1UGM A;  3AM9 A;  2HJ8 A;  2GBK A;  1RWS A;  2JWU A;  2PVO D;  2VH2 A;  1LM8 B;  3M3J A;  4MGY E;  4TMA B;  2JYT A;  1F0Z A;  3DQV A;  4ZRJ A;  3GOE A;  1N5W A;  2KD0 A;  2KK8 A;  3N20 C;  5DPS A;  2LXC A;  2C9W B;  2MRP A;  3NJT A;  3TL5 A;  1L2N A;  3A4R A;  1SF0 A;  3UQA A;  3RUI B;  3NUH B;  3ZYY X;  4G3X B;  4G50 A;  1WJU A;  2M0X A;  1QKZ A;  5CX3 A;  4IUM B;  1L5P A;  2V3N A;  2RPV A;  1IUE A;  1UH6 A;  5JXV A;  3C8Y A;  2KDM A;  1TS2 A;  4YSX B;  3Q8F A;  5LXI B;  5EE0 A;  2L32 A;  3NRZ A;  3VH3 B;  2Y5C A;  1V2Y A;  3JVZ X;  3H8H A;  3V05 A;  4JE3 B;  1WI0 A;  1YN3 A;  3KQ4 A;  2YVC A;  4F1S A;  2AL3 A;  3U30 A;  3ML9 A;  2M0A A;  3BIN A;  2BWF A;  4HPM B;  1WGY A;  1P0R A;  2PIA A;  1J19 A;  3C0R B;  3R8B A;  5GMV A;  1IGC A;  2MP2 B;  3SDL C;  3A9J A;  1T0Y A;  3TSS A;  1MG8 A;  2E3T A;  3ML8 A;  1YJ1 A;  4B6W A;  2FUG 1;  2FID A;  4MSQ B;  1F2R I;  2KN5 A;  1WZ3 A;  1L0Y B;  3AUL A;  3L16 A;  1F52 A;  2AQ3 B;  4GDK A;  1N6Z A;  3OJ4 B;  4W9G A;  5CTR C;  5JHA A;  2LJ5 A;  1GG3 A;  1YX5 B;  2XBB C;  1XQQ A;  4HDO A;  2H88 B;  2KAJ A;  3SEB A;  1ZXH A;  2HTH A;  2W82 A;  2UU7 A;  3T8M A;  3D32 A;  2W55 A;  3JSV A;  2IY1 B;  1VCB A;  1GPX A;  4LNO A;  3K9P B;  1FNV A;  2NTT A;  3ZRF A;  3UGB B;  4DHJ D;  4HKQ A;  2OED A;  4FA6 A;  3QQ8 B;  4AS1 A;  1HE8 A;  2JPH A;  1I42 A;  3QK0 A;  4S17 A;  1BML C;  2KWD A;  1XO3 A;  5HKH A;  4M8M A;  1ROE A;  3AEG B;  4BZA A;  2BYF A;  2KDF B;  2GBN A;  5HG2 A;  3N1Y C;  4PK1 A;  5IAA C;  3RNA C;  4WJN A;  4IWP A;  2K39 A;  1ZGU B;  3CF6 E;  3M95 A;  1YOV B;  3JW0 X;  3GZN B;  2INN E;  3ZNZ B;  1GC6 A;  4WWN A;  1RRB A;  2CHZ A;  5IP4 D;  4KV2 A;  3WCQ A;  1GUA B;  3V60 A;  4JIO U;  3Q8C A;  2WYQ A;  4R3D A;  5FK9 C;  4DDG D;  3W1S C;  4KGT A;  1EF5 A;  4L2Y A;  3ALB A;  4WJO A;  3KH0 A;  3JYU A;  1WRI A;  3B9J A;  1TS3 A;  2C5L C;  1WR1 A;  5CHF A;  2XK5 A;  2KAC A;  3KYD D;  2DAJ A;  4C7Z A;  2R2O A;  3WAM A;  2L05 A;  1WX7 A;  3A9K A;  1WXV A;  1JCK B;  1ZDX A;  2CU1 A;  1WYG A;  2NVU I;  3AE8 B;  5E6O A;  3LYY A;  2V3S A;  2D07 B;  1EU3 A;  4ASW C;  1PDX A;  3IVF A;  3KUC B;  3RT3 B;  1A5R A;  4YTN B;  1WWT A;  3MTN B;  1VZ7 A;  1E0Z A;  2NBU A;  2WXI A;  2QJL A;  4YSY B;  2NR2 A;  4FAD A;  4W9L A;  1OQY A;  2FUH B;  4LNK A;  4W9C A;  4I6N B;  5E6P A;  3PHX B;  1JRU A;  1SSN A;  3HK0 A;  2KWC A;  3PHW B;  1TKY A;  2V1Y A;  1MPE A;  1JW9 D;  2QCZ A;  4P16 A;  3WAP A;  3W9C B;  1H8C A;  3K9O B;  4GDL B;  4ACF A;  1IPG A;  1IYF A;  4OVZ A;  4ITK A;  2K6Q A;  3NZ3 A;  2C7M B;  2WXK A;  1YX6 B;  1DOI A;  2C60 A;  3PLU A;  2DYB A;  4A3O A;  4KKJ A;  1N63 A;  3RNG C;  5DPR A;  1D3Z A;  1AAR A;  1KLV A;  1WY8 A;  2L76 A;  2KLG A;  3VQI A;  1NVI D;  4RM9 A;  3ZXR A;  3V6C B;  1T0Q C;  5IA7 A;  4FJY A;  2GOW A;  3QAR A;  3RNF C;  2WP9 B;  3FIL B;  4D2K A;  1D5Z C;  3Q2A C;  4DBG A;  3L10 B;  2KC1 A;  2AX5 A;  2ZEQ A;  3I63 C;  2DLB A;  3EGR A;  4HRO A;  2RR9 A;  1I4X A;  5J18 A;  3Q3J A;  1X1M A;  1MFW A;  3GB1 A;  4N6E B;  4DXF A;  4HCP B;  4MJS B;  5BMG A;  4P6V F;  2KNB A;  2WXR A;  2W9N A;  1I35 A;  1UZX B;  3AE3 B;  4P7I A;  2KQS A;  4XDC A;  1ISN A;  3P1M A;  2MBH A;  1FXI A;  1E8W A;  2L00 B;  4USA A;  2OHF A;  4EE2 A;  3VTU A;  3WAN A;  1F1H A;  1GC7 A;  4RF1 A;  3DBR B;  1V97 A;  3URY A;  4UDU C;  4RMA A;  1FIQ A;  2NPT B;  4O1N A;  2D3B A;  2N9E B;  2JZP A;  1MVK A;  3NVY A;  1TY0 A;  3KWV A;  4OZA A;  3O65 B;  1MHX A;  1T6B X;  1Q10 A;  4KSL C;  4BAX A;  4KIK A;  3EUB 2;  2LUM A;  2NPT A;  4CQN A;  4JWS C;  3AE5 B;  5JH5 C;  4ARI A;  2LXA A;  3H7P B;  2PE6 B;  1HXY D;  4GLS C;  1ZW7 A;  3GZN I;  4TSS A;  2N4F A;  1K8R B;  1JWU D;  2MBQ A;  1D6E C;  1WIA A;  4IM3 A;  3IHP C;  4EZK A;  1FNU A;  4ZRP A;  2GLS A;  5L83 A;  5FR6 A;  1T0R C;  2K5P A;  4XDD A;  3ENE A;  1I4H A;  3ZQ4 A;  1FEH A;  3H1U A;  5IOI A;  4NY0 A;  2REX A;  3E9S A;  1FCL A;  2HDE A;  1UNS A;  2WXH A;  3DBH B;  3SD5 A;  2BW2 A;  1J8C A;  1CMX B;  1QOF A;  3AED B;  2MQJ A;  2FNJ B;  4B0M A;  4OW0 A;  2M56 B;  3TIX A;  3L13 A;  1R4N I;  3ZJV A;  1QOB A;  2Z0D B;  2IGD A;  2V0G A;  2JU6 X;  1YQ4 B;  2N9L A;  1DOY A;  1AWD A;  4WWM A;  1UBI A;  4RGO S;  2K6D B;  3NZU A;  1TBE A;  1E7P B;  2ZPY A;  3B08 A;  1J7C A;  3N9Y C;  3QA8 A;  4IWO A;  2G1E A;  5BYS A;  2AL6 A;  2G45 B;  1Z5S B;  3ZDT A;  3Q8B A;  2WWZ A;  4A90 A;  1HTO A;  4IWQ A;  1FD6 A;  2K8C A;  3AI5 A;  1E7V A;  1TZ1 A;  1WZ0 A;  3H6N A;  1V5O A;  3OWE B;  2CU3 A;  4MM3 A;  3DVG Y;  4LCD E;  2KX0 A;  5EE3 A;  4BKS D;  3DHH C;  2BKR B;  2KVR A;  1VZ8 A;  2B3A A;  1WXA A;  3PRP B;  3Q3M C;  5DPW A;  1OQQ A;  2LFI A;  1KOT A;  3N1X C;  2L52 A;  3IBE A;  3HM6 X;  3RN9 C;  3RFZ B;  3MHS D;  4E74 A;  2BS3 B;  3AN1 A;  3AE9 B;  1V86 A;  4IDI A;  2KFK A;  2JT4 B;  2EMT A;  2IGG A;  2FCN A;  4KKI A;  2IO1 B;  2BYE A;  3SFE B;  2JSV X;  1ET9 A;  2KXJ A;  1XCQ L;  5IKC M;  2DAF A;  2NS5 A;  3BVZ A;  2MH7 A;  2MBO A;  1RFA A;  3RNE C;  1EO6 A;  4NQL B;  4ZRK A;  1WGH A;  3AXC A;  2WDR B;  4ZRQ A;  5KHO A;  3VDZ A;  1QQR A;  2DHZ A;  1R4M B;  1V1P B;  1K53 A;  3NVW A;  3Q8E A;  4KDI C;  2MJ3 A;  5TSS A;  3MC8 A;  2FCM A;  1WE6 A;  2JY6 A;  2N9X A;  3DOW A;  1CQV A;  2K3U A;  3VTW A;  1AW7 A;  3DVN V;  2BKF A;  2PLP A;  2LZ6 A;  2MBB B;  4DDI D;  3IG3 A;  3ZO5 B;  1FFU A;  2WDT B;  4CHK A;  4RFB A;  4C4V B;  4DWF A;  1KJT A;  4KVG B;  4HEA 1;  3R7R A;  2MHJ A;  3BK2 A;  2IO2 B;  1WH3 A;  3ZLZ A;  1WF9 A;  2FBW B;  4IG7 B;  2WS3 B;  4NNJ B;  1YJJ A;  4PT5 A;  1OEY J;  4HXD A;  1UWM A;  1J0G A;  1JQ4 A;  1BXT A;  3RI7 C;  3B2G A;  3RUL A;  3AU5 A;  3RZF A;  1ACC A;  2KJR A;  4US9 A;  2ASQ A;  3Q8A A;  4ANW A;  1XCT L;  4OZC A;  2BT6 A;  1V6E A;  1C79 A;  1FPY A;  2KWV B;  1P9D U;  2RPQ A;  1FFV A;  4N58 A;  4JWU C;  2N7D A;  3TUO A;  1NEK B;  2UYZ B;  2KQ7 A;  5C2T B;  1TKE A;  2EEL A;  4MJS A;  3CST A;  5D6J B;  1WGR A;  3A9J B;  3MHZ A;  3UQB A;  4F7Z A;  2DNF A;  2VRR B;  2W54 A;  1UBQ A;  1L4D B;  5DPT A;  3BYY B;  4HK2 A;  2CJO A;  3DBL B;  2KKC A;  1N62 A;  4E71 A;  3VAW A;  2D3A A;  1NYR A;  2RDH A;  2KDI A;  4MGK E;  4K3B A;  2HD5 B;  2MLB A;  1JAL A;  1VJK A;  2DZI A;  4MSM B;  1V1P A;  2PVG C;  1STE A;  5JZE B;  2KFJ A;  3WA0 A;  5G2N A;  3QX1 A;  2FIF A;  2QSD A;  5LXH A;  4PS7 A;  2BTE A;  3VUX A;  1FCC C;  1L0X B;  2ZW0 A;  1WXS A;  1TY2 A;  3FKY A;  4DHZ E;  3PLV A;  1KLU D;  1I4P A;  2LHD A;  3ZXV A;  4K1R B;  5D7G A;  1C4C A;  3H9D A;  5AZF A;  1PGA A;  1OFF A;  2WU5 B;  1KRH A;  1B1Z A;  3HUI A;  1BUI C;  1HQR D;  1KH0 A;  2KTF A;  3U8Z A;  3MP9 A;  1E8Z A;  2Y5P A;  2LGI A;  2PJH A;  1VR9 A;  2NBW B;  1YIW A;  2KTR B;  3NVV A;  2KZR A;  3U52 E;  1GNU A;  1VRA B;  1JWM D;  2KMC A;  2ZCC A;  4YSZ B;  2MSE D;  4GU2 A;  2ONQ A;  2VZK B;  2XK5 B;  3OLM D;  4WAF A;  1V5T A;  4OVV A;  1ZE3 D;  3LXF A;  1U4A A;  1C4A A;  2YEP F;  4E3C A;  3CIR B;  3TJP A;  4GN1 A;  2K8B A;  5BMH A;  3KUZ A;  2PMV A;  1SBB B;  2WNM A;  2J4X A;  2BPS A;  2DZK A;  1ET6 A;  3HHM A;  4P1B C;  3APD A;  3DCG A;  5AUK A;  2BF8 B;  1WXM A;  2NMQ A;  3Q3N C;  1MHH E;  1K52 A;  3Q69 A;  2KWU B;  2TSS A;  2KT7 A;  4IM0 A;  1C77 A;  4ANU A;  4ZHP A;  2M19 A;  2M17 A;  2J7Q B;  3AMZ A;  2L8J A;  1YMH E;  4LDT D;  2ZW1 A;  2IO3 B;  5GXG B;  4RGT A;  2GB1 A;  1QOG A;  3QCA A;  3QWZ B;  2ZZP B;  2GI9 A;  3IXS A;  4M00 A;  1XXG A;  2L7R A;  5HFY A;  4GMV A;  4HJK A;  2DZJ A;  1FXT B;  4TQ1 A;  4MH8 A;  4ICU A;  1E90 A;  1IBX A;  2KLC A;  3VR9 B;  1JWS D;  2V3P A;  2QDF A;  4N59 A;  3FC4 A;  4NAW B;  4W9D A;  1WGG A;  2NBV B;  1WJ4 A;  3V62 A;  1WE7 A;  3DVG X;  3WAO A;  2JXX A;  2KMM A;  3AU4 A;  2KN4 A;  5H92 C;  3AEE B;  1GAQ B;  2AEH A;  4GOC A;  3PTF C;  3T3N A;  3AEB B;  1YN5 A;  4B95 A;  3MJW A;  4EFO A;  2HJ1 A;  2RMM A;  5G5G A;  3NG0 A;  4WUR A;  2BGF A;  4HKZ E;  2CR5 A;  2V4I B;  3P4S B;  3AE4 B;  4HLE A;  1LFD A;  3DBS A;  2WLB A;  3AB5 A;  4H2A A;  3RMK C;  2LVO A;  2WU2 B;  4JQW C;  4Q2J A;  4BKG A;  2LJI A;  3IAS 1;  4WWO A;  1PGX A;  2E6X A;  3B1L X;  4M01 A;  4RNA A;  4G0N B;  2GBJ A;  4EKU A;  4YT0 B;  2IJ0 A;  3QAQ A;  4K3C A;  4XZ4 A;  3PRM B;  4YTM B;  3PZD A;  4PYZ A;  1GB1 A;  1WYW B;  1XLO A;  3TCA A;  1Q5W B;  1FO4 A;  4I6P A;  3DHI C;  1XD3 B;  4G11 A;  3VRA B;  1HEZ E;  3IT4 B;  2UWQ A;  5JHB A;  4A8X C;  1YD8 U;  1EUV B;  1ENF A;  2LRW A;  3ONS A;  3VXW A;  4KIK B;  2KOX A;  1EWY C;  2IGH A;  3A33 B;  4QAY A;  2JZ3 B;  2GBR A;  2IBI B;  3L0W B;  3ZJU A;  3PPA A;  2K0P A;  3A1Q B;  2MX2 A;  2LEK A;  2JQR B;  1YNT E;  3EFC A;  3SR6 A;  3EC8 A;  5C23 A;  2BBC A;  2WDV B;  4BOS C;  4DQO C;  1E6E B;  1OQR A;  1TIF A;  4HRS A;  3S2A A;  1V8C A;  2I2Y A;  5AZH A;  2RGF A;  3KYC D;  3LDZ E;  3OAW A;  4HVB A;  1QIL A;  2ICI A;  2JWZ A;  5E6J A;  4NPN A;  4XWW A;  3AE2 B;  3AE1 B;  3I57 A;  3RZW C;  1HTQ A;  1GJZ A;  2A5U A;  4MGI E;  3PZ7 A;  4FXC A;  2BYT A;  3AEA B;  4ZDV A;  2HE7 A;  2V4L A;  1VD2 A;  4HPP A;  1QLB B;  1FXA A;  3ECI A;  2PPH A;  4A20 A;  3HM3 A;  1UWX A;  2L83 A;  2G4S A;  1BT0 A;  1DYQ A;  3T9L A;  4IM2 A;  2KHW B;  2BB5 A;  2DYM A;  1L0V B;  5CHW A;  1ZDV A;  1L6U A;  2KAN A;  1KFY B;  3MC0 B;  2PEA A;  3U7Z A;  2ZNV B;  2DWQ A;  2AYO B;  4K7U A;  2B76 B;  3AEF B;  1SIJ A;  1P7E A;  1T5X D;  1TTN A;  2WXQ A;  1JRO A;  1NEN B;  2WGS A;  3NVZ A;  4EZL A;  3W5V B;  3P4Q B;  1I4R A;  3Q6B A;  3IT6 B;  4BVU C;  3APC A;  1LXD A;  4GGQ A;  2KDB A;  4C7Y A;  1EU4 A;  1XT9 B;  1C76 A;  2D3C A;  2WQY B;  2LVP A;  1FM0 D;  2R61 A;  3L08 A;  2KYW A;  3PT2 B;  4RM8 A;  4WH4 A;  4HWI B;  4ZYS A;  2LHE A;  2N9K A;  3R7Q A;  4KX6 B;  3WAL A;  4KDL B;  3NOB A;  1C1Y B;  4JGH B;  5EE1 A;  2DBY A;  1RLF A;  3ZRC A;  4LNN A;  2AQ2 B;  3RD2 A;  4EZJ A;  2ZVN A;  2QEJ C;  1E9M A;  4AJW A;  3ZVV A;  5H8Y E;  3NS8 A;  1RFK A;  3X0W A;  1SEB D;  5KHQ A;  4WQO B;  1MJD A;  1WX9 A;  2I1K A;  2BB6 A;  4W9F A;  1C3T A;  4HPL B;  4M8N A;  1TKG A;  3V6E B;  1P3Q U;  1UF0 A;  1KTK A;  1EM7 A;  2IYD B;  3MJ5 A;  3VHT C;  3DBL I;  3AH7 A;  1AYF A;  4KGR A;  3UF8 A;  4W9H A;  1HA5 A;  3BK1 A;  1WMH A;  3VFK A;  2O6V B;  1RM6 C;  3GS2 A;  4WWP A;  1Z2M A;  4AWJ A;  3PO0 A;  2N0S B;  3TEX A;  5C3J B;  3P2B A;  3PRZ A;  3ZNG C;  1KM7 A;  2D2Q A;  2JF5 A;  3BY4 B;  1PUT A;  2NCN A;  1WM2 A;  2G9H D;  4DK5 A;  4RGM A;  4EUT A;  2Y5B B;  4LJP B;  3J9C A;  1R7S A;  2FCS A;  4XE0 A;  3FIL A;  1NBF C;  1R4M I; 
#chains in the Genus database with same CATH homology
 2DYB A;  1QZE A;  4A3O A;  2OOB B;  4KZC A;  2Z59 B;  4K7W A;  4YL8 A;  2MP2 A;  5DPR A;  5DCN A;  4W9E A;  2KTF A;  3U8Z A;  4A3P A;  1D3Z A;  1AAR A;  1KLV A;  1E8Z A;  1WY8 A;  2L76 A;  3W1Y A;  2G4D B;  1H4R A;  2KLG A;  3VQI A;  4RM9 A;  2PJH A;  3M63 B;  3NY5 A;  1WGD A;  3V6C B;  4CYE A;  4PS8 A;  4FJY A;  5IA7 A;  2GOW A;  3QAR A;  2NBW B;  2LGD A;  2RSU A;  1YIW A;  3KW5 B;  2KTR B;  2KZR A;  1GNU A;  4AJY B;  2N1W A;  1ZKH A;  4TV3 A;  4DXA B;  1OTR B;  4I6L B;  2KMC A;  3H7S A;  4DBG A;  2JRH A;  2CS4 A;  2KC1 A;  2ZCC A;  3L10 B;  2MSE D;  4GU2 A;  2O2V B;  2XK5 B;  2ZEQ A;  3OLM D;  2WX0 A;  4ANV A;  1S1Q B;  1WJ6 A;  2RR9 A;  3CSF A;  5AZG A;  5J18 A;  3Q3J A;  3JSV B;  1X1M A;  2M8S A;  4HCP B;  4MJS B;  1V5T A;  4OVV A;  2D3G A;  4LDT B;  1U4A A;  2L3Z A;  4E3C A;  2KNB A;  2LD9 A;  2W9N A;  3DBH I;  5J17 A;  2M1M A;  1I35 A;  1UZX B;  1SE9 A;  3QJZ A;  4GN1 A;  4P7I A;  3TJP A;  2ZCB A;  2K8B A;  3L17 A;  4W9J A;  3W1S A;  2KQS A;  4AP4 C;  4X57 B;  1ISN A;  1SIF A;  4FUL A;  3UIP B;  3KUZ A;  1RAX A;  1WX8 A;  2MBH A;  1E8W A;  2N9P C;  2K25 A;  3SHQ A;  5D2M B;  2L00 B;  2GMI C;  4W9K A;  2BPS A;  2DZK A;  3VTU A;  3WAN A;  4EEW A;  4M0W B;  1E7U A;  3HHM A;  1GC7 A;  4FHK A;  2L0T A;  3APD A;  3DCG A;  4WJP A;  3VVW B;  2BF8 B;  1WXM A;  3ZW3 A;  4GDK B;  2GBM A;  4RMA A;  2FAZ A;  2NPT B;  2FCQ A;  2ZPN A;  1M94 A;  3EEC A;  2KWU B;  2N9E B;  3VTV A;  1TGZ B;  4IM0 A;  1WR6 E;  3PS6 A;  3O65 B;  4DHZ B;  2BWE S;  4ANU A;  1Q1O A;  3N32 A;  4KSL C;  2LGY A;  5J2R A;  4OVU A;  3KUD B;  3PGE A;  2M17 A;  2J7Q B;  3HIZ A;  3WIM A;  4HCN B;  2D11 A;  5L95 C;  2L8J A;  4NAW A;  2JVC A;  1Y8R C;  4KIK A;  2O6V A;  4LDT D;  3RYT A;  2NPT A;  3QHT A;  2KJH B;  4MDK E;  2IO3 B;  1NDD A;  4FN2 A;  4MGZ E;  3QCA A;  2G3Q B;  2K8H A;  3QWZ B;  2IY0 B;  2ZZP B;  4TQ0 A;  5JH5 C;  2LXA A;  3H7P B;  3NZS A;  2L7R A;  2PE6 B;  4FJZ A;  4GMV A;  1V49 A;  2L0F A;  2KFK B;  1ZW7 A;  2DZM A;  3GZN I;  3B0A A;  2N4F A;  1K8R B;  4HJK A;  1PQS A;  2MBQ A;  1Q0W B;  2DZJ A;  3R66 C;  3NHE B;  1WIA A;  4NJ7 A;  4IM3 A;  2EKE C;  3IHP C;  2IZV B;  4EZK A;  2YLM A;  1FXT B;  1NI2 A;  3ZTC A;  4F1S A;  3Q3F A;  4NQK E;  4KZ0 A;  4TQ1 A;  3A1Q A;  4IW0 A;  5L83 A;  4ICU A;  4J6I A;  1E90 A;  5FR6 A;  3UIO B;  1G6J A;  2KLC A;  4GIV A;  2J0M A;  3IFW B;  3SU8 X;  4N9F 4;  3ENE A;  1P1A A;  3X23 A;  1OEY A;  4NAW B;  4W9D A;  2KC2 A;  4DHJ B;  1IP9 A;  1WGG A;  3H1U A;  2NBV B;  1WRD B;  3PVL A;  1WJ4 A;  2REX A;  4NY0 A;  2ZJD A;  2QHO A;  4XC2 A;  3V62 A;  2JUO A;  1WE7 A;  3SD5 A;  1SGH A;  3DVG X;  4JL9 A;  3WAO A;  3ZNI D;  2JXX A;  3QIJ A;  3AU4 A;  2MW5 A;  4JLC A;  4FLH A;  2LGX A;  1J8C A;  1CMX B;  3N30 A;  4FHJ A;  3ZNH B;  2AEH A;  1UD7 A;  4K7S A;  4URK A;  4GOC A;  2MQJ A;  3PTF C;  2KJ6 A;  2FNJ B;  2O6V D;  4XX5 A;  2BYV E;  4CO7 A;  3PSE B;  3TIX A;  3L13 A;  4GB9 A;  1R4N I;  4EOY A;  4MEM A;  1UGM A;  4B95 A;  3MJW A;  4EFO A;  5AEK B;  2HJ8 A;  2GBK A;  2Z0D B;  4GDL A;  2R2Q A;  1V9J A;  2BGF A;  2LAS A;  1LM8 B;  3M3J A;  4MGY E;  1UBI A;  2CR5 A;  4HLE A;  2K6D B;  3NZU A;  1LFD A;  3DQV A;  3DBS A;  4ZRJ A;  2CHX A;  2KMA A;  1TBE A;  3GOE A;  2KD0 A;  2IO0 B;  2ZPY A;  2LVO A;  3B08 A;  3ZDM C;  2D10 A;  2KK8 A;  3QA8 A;  4IWO A;  4JQW C;  5DPS A;  4BKG A;  4BOZ B;  2AL6 A;  2LXC A;  2C9W B;  4FJV B;  2MRP A;  4WWO A;  2G45 B;  3TL5 A;  2WX1 A;  1Z5S B;  3ZDT A;  1L2N A;  2ZNV C;  2WWZ A;  3A4R A;  4W9I A;  3TBL D;  2OJR A;  2Z0E B;  3B1L X;  2DYO A;  4IWQ A;  3UQA A;  4G0N B;  4KSK C;  3RUI B;  2K8C A;  2CHW A;  3AI5 A;  4II3 B;  2GBJ A;  1E7V A;  1V80 A;  4EKU A;  4G3X B;  4BKT A;  4G50 A;  4WAA A;  1TZ1 A;  1WJU A;  1WZ0 A;  3H6N A;  2M0X A;  1V5O A;  4MM3 A;  1EF1 A;  3QAQ A;  3DVG Y;  5CX3 A;  4XZ4 A;  4LCD E;  3PRM B;  3PZD A;  2CKH B;  2KDE B;  2LI5 A;  4IUM B;  4PYZ A;  2DEN B;  1WYW B;  1UH6 A;  2KX0 A;  3TCA A;  1Q5W B;  4I6P A;  4BKS D;  2BKR B;  2KVR A;  4NJ6 A;  1XD3 B;  5TR5 A;  4G11 A;  2B3A A;  4AOF A;  1WXA A;  5LXI B;  3PRP B;  5DPW A;  2JRI B;  2UWQ A;  3VH3 B;  1KOT A;  2KTR A;  3IBE A;  5JHB A;  1V2Y A;  2LRU A;  3HM6 X;  3JVZ X;  1YD8 U;  1EUV B;  3MHS D;  4E74 A;  2LRW A;  3ONS A;  3VXW A;  1V86 A;  2LWP A;  4KIK B;  1WJN A;  2KFK A;  2KOX A;  1WI0 A;  2JT4 B;  2EMT A;  2KO3 A;  2YVC A;  1WMH B;  3A33 B;  2FCN A;  2JZ3 B;  3OJ3 A;  3V61 A;  2AL3 A;  2BYE A;  2GBR A;  2IBI B;  2IO1 B;  3L0W B;  2KXJ A;  3U30 A;  3ML9 A;  3BIN A;  3PPA A;  2BWF A;  3A1Q B;  4HPM B;  2MX2 A;  3I3T B;  3EC8 A;  1WGY A;  2DAF A;  5C23 A;  2NS5 A;  1P0R A;  2MBO A;  1WFY A;  1RFA A;  1OGW A;  4BOS C;  1EO6 A;  4NQL B;  1J19 A;  3C0R B;  3DVN U;  4ZRK A;  5CHV C;  2KX3 A;  2MP2 B;  5GMV A;  3SDL C;  3S2A A;  1WGH A;  3PRE A;  3A9J A;  3AXC A;  1T0Y A;  3DDC B;  5AZH A;  2RGF A;  1MG8 A;  3KYC D;  3N3K B;  1YJ1 A;  3ML8 A;  4GSW A;  5KHO A;  3LDZ E;  4FBJ B;  3OAW A;  4B6W A;  3VDZ A;  4HVB A;  2JWZ A;  2DHZ A;  2FID A;  3DBR I;  4MSQ B;  4BBN C;  4NPN A;  2KN5 A;  1WZ3 A;  5C1Z A;  3AUL A;  3RZW C;  3L16 A;  4GDK A;  4KDI C;  2A5U A;  4MGI E;  1GJZ A;  3OJ4 B;  4W9G A;  5CTR C;  4ICV A;  4BFR A;  5JHA A;  2EMS A;  2LJ5 A;  3U7D A;  4ZDV A;  1GG3 A;  1YX5 B;  4F8C B;  2HE7 A;  2FCM A;  1WE6 A;  2JY6 A;  2XBB C;  1XQQ A;  2V4L A;  4HDO A;  2N9X A;  1VD2 A;  2J0K A;  2J0J A;  3DOW A;  2HTH A;  3VTW A;  3T8M A;  4ZRI A;  3D32 A;  3DVN V;  3JSV A;  4BKS A;  2BKF A;  2IY1 B;  1VCB A;  1L7Y A;  3ECI A;  5EDS A;  2PPH A;  4K81 A;  4A20 A;  3K9P B;  3HM3 A;  2LZ6 A;  1YQB A;  2MBB B;  3ZRF A;  3UGB B;  4DDI D;  3IG3 A;  3M62 B;  4DHJ D;  4FA6 A;  3QQ8 B;  3ZO5 B;  2WDT B;  4CHK A;  2G4S A;  1BT0 A;  1E5W A;  1F9J A;  3DPD A;  4DWF A;  2M4N A;  1HE8 A;  2JPH A;  2MA9 B;  3T9L A;  4IM2 A;  1KJT A;  1WM3 A;  2KHW B;  2DYM A;  4KVG B;  1I42 A;  3R7R A;  4IC7 B;  5CHW A;  3VUY A;  2IO2 B;  3EFU A;  3QK0 A;  1WH3 A;  3ZLZ A;  2AWT A;  1WF9 A;  4IG7 B;  2KAN A;  4BBN F;  4NNJ B;  5HKH A;  4TKN A;  2PEA A;  4ANX A;  4M8M A;  2ZNV B;  1OEY J;  2AYO B;  4K7U A;  4HXD A;  1J0G A;  2BYF A;  2KDF B;  2GBN A;  3LJ3 A;  3RUL A;  3AU5 A;  2A4Z A;  3RZF A;  4B9K A;  5IAA C;  1TTN A;  4IWP A;  4WJN A;  2K39 A;  1ZGU B;  3CF6 E;  2KJR A;  4EZL A;  3M95 A;  4BVU C;  3JW0 X;  3A9K B;  2ASQ A;  3ZNZ B;  3APC A;  4ANW A;  5E6N A;  1LXD A;  4GGQ A;  3ZTD A;  1GC6 A;  1V6E A;  2XEW A;  2KDB A;  4WWN A;  2ZVO A;  3EHV A;  1XT9 B;  2LVQ A;  1RRB A;  2CHZ A;  3L54 A;  2KWV B;  3QC8 B;  4KV2 A;  1GUA B;  1P9D U;  2LVP A;  3V60 A;  2N1V A;  2JZZ A;  3RCZ A;  2RPQ A;  3VH4 B;  4JIO U;  3L08 A;  2N7D A;  2WYQ A;  4DDG D;  3PT2 B;  4RM8 A;  2UYZ B;  2KQ7 A;  3W1S C;  1UEL A;  4HWI B;  1EF5 A;  1P98 A;  4WJQ A;  3R7Q A;  3ALB A;  4MJS A;  1S3S G;  3CST A;  1V81 A;  3WAL A;  4KDL B;  3NOB A;  4WJO A;  2N7E A;  3JYU A;  3KH0 A;  5BO4 B;  5D6J B;  1C1Y B;  1WGR A;  2C5L C;  4JGH B;  3A9J B;  3UQB A;  1LQB A;  1WR1 A;  4F7Z A;  1RLF A;  5CHF A;  2VRR B;  2XK5 A;  3ZRC A;  3UIN B;  3KYD D;  2DAJ A;  3RD2 A;  1UBQ A;  2R2O A;  4EZJ A;  2PE9 A;  3WAM A;  2L05 A;  1WX7 A;  2ZVN A;  3A9K A;  5DPT A;  4HDQ A;  4LJO B;  4AJW A;  4HK2 A;  1WXV A;  3ZVV A;  3NS8 A;  3TMP B;  3X0W A;  2KKC A;  4E71 A;  5KHQ A;  2CU1 A;  3KVF B;  3VAW A;  4WQO B;  2LUE A;  3R3M A;  2NVU I;  2RD0 A;  5E6O A;  1WX9 A;  2C7H A;  3CMM B;  2I1K A;  2KDI A;  2V3S A;  4MGK E;  4W9F A;  1C3T A;  4GXB A;  2D07 B;  4TUU A;  2HD5 B;  2MLB A;  4HPL B;  2DZI A;  4M8N A;  4ASW C;  3IVF A;  3V6E B;  1P3Q U;  4MSM B;  2MWS B;  2DX5 B;  3KUC B;  2IYD B;  2C7N B;  3RT3 B;  1A5R A;  3VHT C;  5D94 A;  5JZE B;  2KFJ A;  3MTN B;  3WA0 A;  3DBL I;  5G2N A;  4PYU A;  3QX1 A;  3A4S C;  3UF8 A;  2FIF A;  2NBU A;  4W9H A;  2MBE A;  5LXH A;  4PS7 A;  2NR2 A;  4MEL A;  5LLI A;  1WMH A;  3VFK A;  2O6V B;  3VUX A;  4W9L A;  4FAD A;  1OQY A;  3PV1 A;  2FUH B;  4W9C A;  5G55 A;  4I6N B;  4WWP A;  1Z2M A;  4AWJ A;  1WXS A;  5E6P A;  3ZKJ C;  3PHX B;  1JRU A;  3ZUN A;  3APF A;  3HK0 A;  4MH0 E;  4ZYN A;  2KWC A;  4DHZ E;  3P2B A;  3PLV A;  3PHW B;  4PS3 A;  3PRZ A;  3ZNG C;  2V1Y A;  3VUW A;  1KM7 A;  2D2Q A;  3WAP A;  2JF5 A;  4K1R B;  4II2 B;  1H8C A;  5D7G A;  3H9D A;  3K9O B;  2I1J A;  4AUQ C;  3BY4 B;  4GDL B;  2NCN A;  2O2V A;  1IPG A;  5AZF A;  1WM2 A;  1IYF A;  1E8Y A;  1E8X A;  4DK5 A;  4EUT A;  2MCN B;  2K6Q A;  2C7M B;  2Y5B B;  4LJP B;  1YX6 B;  2K1F A;  2FCS A;  3H7P A;  3ZIM A;  2C60 A;  1NBF C;  3PLU A;  1R4M I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...