1WMHB

Crystal structure of a pb1 domain complex of protein kinase c iota and par6 alpha
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
82
structure length
82
Chain Sequence
b'SIVEVKSKFDAEFRRFALPRASVSGFQEFSRLLRAVHQIPGLDVLLGYTDAHGDLLPLTNDDSLHRALASGPPPLRLLVQKR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein kinase C, iota type
publication title Structure of a Cell Polarity Regulator, a Complex between Atypical PKC and Par6 PB1 Domains
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/cell cycle
total genus 17
structure length 82
sequence length 82
ec nomenclature
pdb deposition date 2004-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00564 PB1 PB1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1wmhB00
4K81A 1K8RB 1WMHA 1WXVA 2Z59B 4XZ4A 2JRIB 4AUQC 4B6WA 4EKUA 4EOYA 2LVPA 2JY6A 4HXDA 1L2NA 3L16A 3PTFC 3H7PA 2DZMA 2K1FA 5GMVA 1WJ4A 4DHZB 1L7YA 1WMHB 4FHJA 4A20A 2M8SA 2Z0EB 3H9DA 3QHTA 4WJPA 4EEWA 1I35A 1NBFC 2J0KA 3PGEA 1WJ6A 3H7PB 3PSEB 1LM8B 1J0GA 2JZZA 2M1MA 2HD5B 3L54A 2K6QA 4I6NB 4JGHB 2WDTB 3IFWB 4KSKC 2DYMA 3A9KA 2MA9B 3WAMA 3ZNHB 2K8BA 3N30A 2LGDA 2C7MB 1UELA 2CS4A 1KM7A 1UH6A 4YL8A 4E74A 1LQBA 1TTNA 2MBOA 5FR6A 2IZVB 2JT4B 2GBNA 3H6NA 4EFOA 2REXA 2LJ5A 4LJOB 2HJ8A 3ALBA 3GZNI 2L7RA 4TQ0A 3A9KB 1WGGA 2GBKA 2RR9A 1P98A 3APCA 4MELA 3U8ZA 3KYDD 3RZFA 2MBHA 1T0YA 1WR1A 3M95A 3UGBB 1I42A 3ZTDA 4HDQA 4HPMB 2LUEA 2NBUA 2HE7A 1V5OA 3CMMB 3CSFA 1QZEA 2LGYA 3ZRFA 1CMXB 1A5RA 2KFKB 4ANXA 4NJ6A 4BOZB 3UINB 1WJNA 3WAPA 2MQJA 2MSED 2RGFA 4DDID 3DBLI 2DZKA 3VTVA 4MM3A 4GXBA 2ASQA 1YX5B 2LWPA 2MBEA 5LLIA 1R4MI 1TBEA 3VHTC 2RSUA 3SD5A 4EZLA 4KDLB 4II2B 1C3TA 4CHKA 3RD2A 4ANUA 3L17A 4P7IA 3AU5A 3AULA 1EF5A 1Z2MA 3DVGY 5L95C 3HM3A 4W9GA 5D7GA 3LJ3A 3DBHI 3DBRI 3PS6A 3TMPB 2MP2A 4IWPA 2FNJB 5C23A 3S2AA 3MHSD 3ZRCA 3QAQA 3HIZA 2L05A 1E5WA 5J18A 4ANWA 5KHQA 4WAAA 4GDLB 3WANA 4CYEA 1E8ZA 3RCZA 2KWUB 4MGZE 4DHZE 2LVQA 2MLBA 3X0WA 3VVWB 3UQAA 4ICUA 3UIPB 4N9F4 1WGYA 2MP2B 3EHVA 3L08A 3JSVA 4TUUA 1EO6A 4W9JA 4B9KA 3A1QB 3EC8A 2J0MA 2M4NA 4HPLB 3HM6X 4HJKA 4HVBA 1YJ1A 4JL9A 1KJTA 2BGFA 4MJSB 1WXMA 2BWFA 1YIWA 5AZGA 4W9HA 1OGWA 4GDKA 2KJRA 1E7VA 4AJWA 1XQQA 3VH4B 5DPRA 3VTUA 2BPSA 2L8JA 2OOBB 1WGRA 4K7SA 2IO3B 2M0XA 2CKHB 3DBSA 3AU4A 4PYUA 2I1JA 3M3JA 3VAWA 3ML9A 3M63B 4W9KA 5BO4B 1Q1OA 2NBVB 1H4RA 5E6NA 2J7QB 1V86A 3P2BA 4GDKB 4TV3A 2ZPNA 1GC6A 1GG3A 1UBIA 2KDEB 2PE9A 2JRHA 4IM0A 1V80A 4FJVB 4W9LA 2MRPA 1WXSA 4HCPB 2LGXA 3V6CB 3OJ4B 2ZNVB 4I6PA 5HKHA 2UWQA 1WF9A 4JLCA 2OJRA 1ISNA 1E7UA 2KHWB 4WJNA 2L76A 4W9IA 3B08A 1P3QU 1R4NI 2D11A 2NBWB 2R2OA 3ECIA 4ANVA 5LXHA 2KDIA 4NQKE 2ZCCA 1SE9A 3N3KB 5LXIB 4RM8A 1AARA 3PLUA 2JVCA 2V4LA 2D2QA 1P9DU 2W9NA 1V6EA 4TQ1A 3PRPB 3KYCD 4WWOA 3QQ8B 4W9DA 3PLVA 3W1YA 2LXAA 2K39A 2KWCA 3ENEA 4IWQA 2QHOA 4BFRA 2RD0A 4ICVA 3K9OB 4AOFA 4A3PA 4MGIE 1UD7A 4FJYA 3ZNZB 5CHFA 2WWZA 2AYOB 3AI5A 1YQBA 5C1ZA 2GBJA 3AXCA 5KHOA 4KDIC 4W9FA 4EZJA 2LVOA 1WGHA 2N1VA 4PS8A 4FADA 4TKNA 1WR6E 2NPTB 2VRRB 4FHKA 3VFKA 1Y8RC 4HWIB 4JQWC 1NI2A 2MCNB 3TJPA 1ZW7A 2LRWA 3L0WB 1X1MA 1EF1A 2L0FA 2FCQA 1PQSA 2R2QA 2ZZPB 4W9EA 3ZKJC 2KVRA 2LZ6A 2BKFA 2MBBB 4G50A 3T8MA 4FLHA 2FAZA 1NDDA 1RLFA 2PE6B 3JVZX 2KTRA 4ZRJA 3VUWA 1SIFA 2G4DB 2K8CA 2N7EA 2ZVOA 5JH5C 2LI5A 1WYWB 4GIVA 4W9CA 2KFKA 4BVUC 3U7DA 2FIFA 2KN5A 4MH0E 4KZCA 3IG3A 3WA0A 1YX6B 2KTRB 5IAAC 2IY1B 4GU2A 4NNJB 2ZJDA 3VDZA 1P1AA 4BBNF 3RZWC 1UGMA 2DAJA 3T9LA 3K9PB 1H8CA 4IWOA 2WX0A 4ZRIA 3QA8A 2BYFA 2XK5B 2XBBC 3HHMA 1OEYA 4I6LB 2A5UA 2KANA 4GN1A 3A4RA 2FCNA 2O6VB 4WQOB 2D07B 4MSMB 2IO2B 1P0RA 2KMAA 4GGQA 1GC7A 3BY4B 3QCAA 4KVGB 4GDLA 3N32A 4DHJD 1WE6A 2CR5A 2L0TA 5L83A 5AEKB 4MGYE 2ZPYA 1Z5SB 1V81A 4GMVA 4LDTB 3I3TB 3ZNGC 4KZ0A 2O2VB 1V9JA 3A1QA 3Q3JA 5EDSA 4WJOA 2EKEC 4ZDVA 4RMAA 3WALA 1WX7A 3M62B 3PPAA 1WFYA 4MJSA 2N1WA 3PRMB 3R3MA 4EZKA 4AWJA 2KQSA 3A9JB 3JYUA 3NS8A 1OTRB 1ZKHA 3NZSA 3V62A 3LDZE 2C5LC 4PS3A 4G3XB 1LFDA 3QX1A 2J0JA 3EECA 2LASA 3QARA 2FUHB 4JIOU 2GOWA 3U30A 2IYDB 2B3AA 3RULA 1U4AA 3KUZA 2DZJA 3A33B 4M8NA 1MG8A 2AL3A 3ZDTA 3ZVVA 1WRDB 3DVNV 1WM3A 3W1SA 2N7DA 2KQ7A 1V49A 2MX2A 2I1KA 1VCBA 4IUMB 3ZLZA 3VUXA 4BBNC 1E90A 2O6VD 5D6JB 3Q3FA 3OJ3A 4RM9A 3ZNID 2AEHA 4GB9A 3A4SC 4G0NB 2C60A 4FULA 4MEMA 1WJUA 4NAWB 3PREA 5G55A 2Z0DB 5CX3A 3R7QA 3V61A 4LJPB 3W1SC 2LD9A 1IYFA 3SHQA 4LDTD 5JHBA 4BKSD 2KX3A 3GOEA 1G6JA 2CHXA 1JRUA 2KDBA 5E6PA 4E71A 1OEYJ 1WXAA 3RT3B 2ZNVC 2PEAA 2FCMA 2YLMA 2IY0B 3ZDMC 3UF8A 4DBGA 4HCNB 3VTWA 4MGKE 1WE7A 2KJ6A 4KV2A 3ZTCA 2GMIC 1FXTB 3R66C 2G4SA 2D3GA 3CSTA 2D10A 1E8YA 3VUYA 2KO3A 3OAWA 5CTRC 2MBQA 3VQIA 2NPTA 2G3QB 1XT9B 4HLEA 1OQYA 2LRUA 2C7HA 1XD3B 4K1RB 1WX9A 2NVUI 3DVNU 4A3OA 4DHJB 2NR2A 3R7RA 1D3ZA 1TZ1A 3L13A 1E8WA 2N9EB 3NHEB 3NOBA 4DXAB 2WYQA 1Q0WB 4NPNA 2BKRB 2JZ3B 4FN2A 5D2MB 1F9JA 2KWVB 4ZYNA 2YVCA 5J17A 3CF6E 2L00B 4WJQA 2KNBA 4BKTA 3DPDA 3APDA 3PV1A 1RRBA 4X57B 4PYZA 3UIOB 3IHPC 3WIMA 2NS5A 3D32A 1WM2A 2RPQA 3DCGA 1V5TA 4HK2A 3ONSA 4J6IA 2V3SA 3PHXB 3VH3B 2IO1B 2EMSA 2KLCA 3SU8X 1GJZA 1J8CA 1VD2A 2XK5A 1UBQA 2IBIB 4GSWA 2FCSA 4NJ7A 2KK8A 3TIXA 3QC8B 2DHZA 1YD8U 4AP4C 1C1YB 3RYTA 3ZUNA 2O6VA 2KOXA 4IC7B 3L10B 4LCDE 4ZRKA 1IP9A 1SGHA 2XEWA 4BKGA 4F1SA 2JF5A 4II3B 5AZFA 4DDGD 3OLMD 4K7UA 4BOSC 2KDFB 5E6OA 2JUOA 1ZGUB 2KD0A 1E8XA 2DENB 2HTHA 4PS7A 2DAFA 4OVUA 4BKSA 2O2VA 1J19A 4IW0A 2A4ZA 3QJZA 2NCNA 5AZHA 5CHWA 3KUCB 1V2YA 2PPHA 3QIJA 1IPGA 4F7ZA 4XX5A 5TR5A 4GOCA 5IA7A 5G2NA 3A9JA 2KC1A 2DYBA 2KZRA 3DQVA 2Y5BB 3DDCB 5CHVC 3QWZB 1S3SG 1WX8A 3H7SA 3PZDA 3PRZA 4XC2A 1WZ0A 1WIAA 2CHWA 1GUAB 4G11A 1WGDA 4MDKE 4NY0A 2KLGA 1KLVA 2IO0B 4DWFA 3TBLD 3PVLA 4KSLC 2KX0A 3IVFA 2CHZA 3KH0A 2JXXA 2AWTA 2K25A 4IG7B 3MJWA 3DOWA 5D94A 5DPTA 4FBJB 2LXCA 3WAOA 2AL6A 2GBMA 2M17A 4ASWC 3VXWA 4FA6A 2BF8B 3DVGX 3IBEA 3NZUA 4FJZA 2FIDA 1KOTA 2KXJA 3C0RB 4NAWA 2DZIA 2CU1A 3RUIB 3ZW3A 5DCNA 3O65B 1GNUA 2KKCA 2JPHA 1Q5WB 3APFA 4HDOA 3B1LX 4EUTA 3UQBA 2ZVNA 2WX1A 2KFJA 2ZCBA 2KC2A 1TGZB 2KMCA 2C7NB 3JSVB 1LXDA 4WWNA 1M94A 2BYEA 5JZEB 3JW0X 4OVVA 4DK5A 4F8CB 2ZEQA 1RAXA 1WY8A 3EFUA 1WI0A 4URKA 2G45B 3SDLC 1UZXB 1S1QB 1BT0A 3PT2B 3V60A 2C9WB 3B0AA 4WWPA 4MSQB 4E3CA 4KIKA 2K6DB 2V1YA 4M8MA 4CO7A 5DPSA 3ZIMA 2BYVE 4M0WB 3TCAA 5DPWA 3V6EB 4B95A 3TL5A 2L3ZA 2K8HA 2MW5A 2N9PC 4NQLB 3H1UA 5J2RA 2GBRA 2KTFA 2JWZA 2DYOA 4K7WA 5JHAA 4IM3A 3ZO5B 4KIKB 3HK0A 3PHWB 2BWES 2MWSB 2PJHA 3NY5A 1HE8A 3KVFB 4AJYB 4IM2A 3BINA 2DX5B 3MTNB 2EMTA 3KW5B 3X23A 2N9XA 3QK0A 2UYZB 2KJHB 3ML8A 1WZ3A 1EUVB 2N4FA 3KUDB 1RFAA 1WH3A
chains in the Genus database with same CATH superfamily
1K8RB 4AUQC 2D3AA 3ABVB 2LVPA 4LNKA 2WDQB 3L16A 1KF6B 2JX5A 1SF0A 4JWUC 1WMHB 2XNAC 4WJPA 1VRAB 1NBFC 4P1BC 1FCLA 1EU4A 5IP4D 1LM8B 2JZZA 2M1MA 1WWTA 1SEBD 2WDTB 1R4MB 2LHEA 2INPE 4XWTA 3WAMA 4XDDA 4A90A 2LJ5A 2HJ8A 3GZNI 2L7RA 3APCA 3U8ZA 3RMKC 3AEGB 2M0AA 4YXDB 3UGBB 5IO9A 4HPMB 2VZKD 2HE7A 3CSFA 4HKZE 3AB5A 3WCQA 1KRHA 1CMXB 4ANXA 4NJ6A 3OWEB 2MQJA 2RGFA 4DDID 1FXAA 1TJEA 2DZKA 2MBEA 2WXKA 5LLIA 2MJDA 4TSSA 3VHTC 3RD2A 4RF1A 2BVCA 4P7IA 1EF5A 3DVGY 5L95C 3HM3A 4NZLB 3PS6A 1F2RI 3FAHA 5C23A 3MHSD 1KTKA 1QOBA 1ZUD2 4WAAA 1QQRA 3WANA 4MGZE 4DQOC 1WGYA 2MP2B 3L08A 4YTMB 4A55A 3EC8A 2M4NA 4HPLB 4LNIA 4JL9A 1STEA 1WXQA 2K0PA 5HHDG 1ZP0B 5DPRA 2IO3B 2G1EA 2HTME 2M0XA 3DBSA 3AEAB 5BO4B 1Q1OA 5E6NA 4GDKB 2TSSA 4LNFA 4TV3A 2WU2B 3BYYB 4S0RA 2KDEB 1KLGD 3KQ4A 2JRHA 2ZNVB 4I6PA 2KHWB 5G5HA 4WJNA 2L76A 1XEEA 1P3QU 5LXHA 3SEBA 1E6EB 3AH7A 1N62A 1TY0A 1L4ZB 3PLUA 4M01A 2JVCA 2V4LA 4WWOA 1P9DU 5EE1A 2FE8A 5LNK1 2K39A 4KX6B 4ICVA 4AOFA 2WXFA 1UD7A 4ARIA 3AE8B 4W9FA 3LB8C 1JWAD 1TKGA 3BIID 4HWIB 1ZW7A 5BYSA 1X1MA 2R2QA 2BKFA 2IJ0A 3T8MA 2Q5WD 2FAZA 1RLFA 1GB4A 2N7EA 1E10A 1WYWB 1L6VA 2FIFA 1SJED 4MH0E 4KZCA 2KTRB 2OEDA 3BZDB 1DOYA 3EA6A 4WAFA 3RNBC 4BBNF 3SFEB 1UGMA 2KT7A 3K9PB 4KKJA 4IWOA 2KACA 2XK5B 1Q10A 4I6LB 1ACCA 2OJWA 2KANA 4GN1A 3IT4B 2FCNA 4WQOB 3TSSA 1CK1A 3QCAA 3AE5B 5BMIA 2ZPYA 4LDTB 4KZ0A 2D3CA 1E7PB 1DOXA 3A1QA 2QSDA 5EDSA 4OVZA 4N58A 4ZYSA 4RGOS 3WALA 1WX7A 4WWMA 2N1WA 3PRMB 3R3MA 3NS8A 1OTRB 3NZSA 2C5LC 4P6VF 4PS3A 1TT5B 1QKZA 2LASA 1XF5L 4C4VB 1U4AA 3KUZA 2DZJA 5MPOA 2K5PA 3W1SA 3NRZA 1VCBA 4IUMB 1JWSD 2H89B 5D6JB 4GB9A 1J7BA 3NVVA 1V1PA 1IYFA 2LD9A 5JHBA 1JRPA 2CHXA 2KDBA 3ZYYX 1N5XA 3RT3B 2ZNVC 4XYCA 1T0RC 2ICIA 3C19A 2X38A 3VTWA 1WE7A 1P7FA 1FO4A 2WXNA 3R66C 3VRBB 1AWDA 5FKAC 1SE4A 3CIRB 3KLSX 4BAXA 3OAWA 5CTRC 1SSNA 2Y5CA 4LTUA 2C7HA 1XD3B 4D2KA 1ZDXA 5BMGA 5AUKA 4A3OA 1JWUD 2Z8LA 3NOBA 2W82A 1UWXA 1TKYA 2YVCA 5J17A 3DPDA 3APDA 4PYZA 3IHPC 2NS5A 3DCGA 2K9XA 2N0SB 3I5JC 3AEDB 2EMSA 1J8CA 1VD2A 2IBIB 2QJLA 3I9V1 2FBWB 3QC8B 2DHZA 3RYTA 1K50A 1TY2A 2O6VA 3DWMA 3FKYA 3LXFA 3OLMD 4BOSC 2DWQA 1ZGUB 4PS7A 1J19A 4B0MA 2WXJA 1C77A 1HZ5A 4QAYA 3KUCB 1V2YA 2PPHA 1YJIA 4F7ZA 4GOCA 5G2NA 4YTPB 3QWZB 3O13A 2W54A 1YQ4B 3PRZA 2ON8A 1WIAA 1GUAB 1HZ6A 2KMMA 4MDKE 1AW7A 4AQ7A 1L0XB 1GPXA 2KX0A 3IVFA 3GP7A 3MJWA 4FBJB 2LXCA 3WAOA 4J3OD 2AL6A 1SJHD 1JCKB 2FIDA 3ZGZA 2CU1A 3ZW3A 5DCNA 3V3XA 3O65B 3N1XC 1XLNA 2JPHA 1Q5WB 3Q3NC 4IDIA 3UQBA 2HDEA 3P4QB 2WU5B 3DHGC 3ZJVA 2BYEA 5JZEB 4DK5A 1T0QC 2INDC 1RAXA 1WY8A 3EFUA 4URKA 1UZXB 3R2TA 1BT0A 1IBXB 4CO7A 4M8MA 4JE3B 1TS5A 4A9AA 4B95A 2B76B 2MW5A 2N9PC 5J2RA 2KTFA 3V05A 4IM3A 4OHJA 3ZO5B 4KIKB 2BWES 2CJOA 2WXQA 3BINA 2EMTA 3X23A 3QK0A 3ML8A 3ZQ4A 1WMHA 4XZ4A 1ZXIA 4B6WA 2DBYA 3UI3A 4DXFA 1L2NA 4YWGG 1WJ4A 1FCCC 1JQ4A 2K3UA 4FHJA 2AQ1B 4EEWA 1I35A 4MACA 3OG5A 3PSEB 3BVGA 1J0GA 4ACFA 2K6QA 4JGHB 2DYMA 3ZXVA 2K8BA 3N30A 1UH6A 4E74A 1TTNA 2MBOA 5FR6A 4EFOA 3ALBA 3RFZB 3A9KB 1T0YA 1WR1A 3M95A 2CU3A 2NBUA 3CMMB 5E6JA 2LFIA 3ZRFA 3PZ8A 3UINB 3MHZA 1WJNA 3WAPA 2RDBC 3VTVA 4MM3A 2ASQA 1YX5B 1CZPA 1C3TA 4CHKA 4ANUA 3AULA 4US9A 4W9GA 1JWMD 2MP2A 1E9MA 3ZRCA 4O1NA 3HIZA 1E5WA 5EE9A 4YSZB 5KHQA 4GDLB 4IOIE 3RCZA 1ZXHA 4DHZE 2MLBA 3X0WA 3VVWB 1QOAA 2J4XA 4W9JA 4B9KA 1C9FA 3FILB 2BGFA 2QC8A 4MJSB 2PVGC 2BWFA 1OGWA 1BXTA 2GB1A 4GDKA 4M0WA 4LNNA 4AJWA 3VH4B 3VTUA 1R7SA 1WGRA 2I1JA 1FEHA 3KWLA 2JWUA 3ML9A 2NBVB 1TS3A 2W55A 2J7QB 1QT9A 2ZPNA 1GC6A 4OZBA 1UBIA 2M19A 4IM0A 1V80A 2MRPA 4HCPB 2LGXA 3OJ4B 5HKHA 1E7UA 4W9IA 4LK0M 1R4NI 3ECIA 4JPSA 2KDIA 5IKCM 1V6EA 3PRPB 4RGTA 4W9DA 1NYRA 2RDGA 2NMQA 4IWQA 2RD0A 3AEEB 3MC9A 1F1HA 4A3PA 3ZNZB 4R3DA 2AYOB 1SE3A 3AI5A 4L1BA 3AE3B 5C1ZA 2GBJA 4KDIC 4IKGA 2LVOA 4EZJA 2NPTB 4FHKA 3N1YC 4ZRPA 1PQSA 2LZ6A 2MBBB 3DWGC 4FLHA 2PE6B 3VUWA 2KTRA 2MEKA 2G4DB 1N60A 5JH5C 4GIVA 4ZHOA 2KFKA 4BVUC 4N59A 2KN5A 4RF0A 3U7ZA 3IG3A 2IY1B 4GU2A 4C7ZA 5IN7A 3IAM1 2RDHA 2DAJA 5C3JB 3T9LA 3NZ3A 4ZRIA 3QA8A 2BYFA 2JQRB 2XBBC 1OEYA 2A5UA 1D5MC 1EWYC 4KVGB 4DHJD 5JXVA 1T0SC 3W5VB 3U4EG 4LLGM 2O2VB 1V9JA 1XLPA 3Q3JA 1EU3A 3Q8EA 5HI1A 2EKEC 4OZCA 3M62B 1L5PA 4AWJA 2KQSA 3A9JB 3Q6BA 4G3XB 1LFDA 2J0JA 3EECA 4MH8A 2PTLA 3U30A 2GLSA 3A33B 3Q8CA 3N1ZC 1RYJA 2KQ7A 1V49A 2WDRB 2ZW0A 2KYWA 4US8A 4RM9A 2AEHA 3Q8FA 1HXYD 4MEMA 1WJUA 3R7QA 3V61A 3SHQA 4LDTD 1MJDA 4S17A 2PEAA 1JALA 3UF8A 3N20C 2PW9A 1FXTB 2D3GA 2J52A 3Q69A 3VUYA 3HRDD 3Q14C 2CJNA 2LGSA 3VQIA 3EFCA 4HLEA 1OQYA 3TEYA 1MI0A 3MJ5A 4YT0B 2JYEA 4DHJB 1VDVA 3L13A 1E8WA 3NHEB 2JYTA 4NPNA 4FN2A 3NJTA 2KWVB 4ZYNA 3CF6E 1E0ZA 2L00B 4P16A 4CQNA 4X57B 3PV1A 3WIMA 3D32A 2Y5PA 4NAMA 1WM2A 1ROEA 4HK2A 3ONSA 4KGRA 3PHXB 4WIPA 2IO1B 3LYYA 2W3SA 2KLCA 1FFVA 3AE6B 2L1AA 4PK1A 4IC7B 3L10B 4LCDE 1DOIA 1SGHA 1XCQL 2XEWA 4F1SA 1PGBA 5H92C 1WSPA 1GOZA 2R61A 5E6OA 2JUOA 3VRAB 2HTHA 3AECB 2DAFA 2WDVB 4IW0A 2JXTA 1UGJA 1YOVB 2NCNA 4N6EB 1RFKA 5CHWA 4ZOHC 1K51A 3HVZA 2DYBA 2KZRA 5CHVC 1S3SG 3H7SA 3PZDA 3NVYA 1NI3A 2CHWA 4G11A 4NY0A 1KLVA 2KLGA 3GE3C 4KSLC 1M4VA 5D94A 3DOWA 2WXGA 1OFFA 3PZ7A 4ASWC 4FA6A 3NZUA 3Q3OC 4Q2JA 4NAWA 4REZA 2V9HA 3RUIB 4MT5A 2ZW1A 3W9CB 4HDOA 3B1LX 2ZVNA 2WX1A 3N9YC 1I4XA 1R4NB 2WXPA 1V8CA 5BYQA 1M94A 4OVVA 2HJ1A 1UF0A 1MHHE 3V60A 3B0AA 1IGCA 4KIKA 2BTEA 5DPSA 5DPWA 1V1OA 3TL5A 3AM9A 2IGHA 2K8HA 4NQLB 2JWZA 2PLPA 3MTNB 2WLBA 2KJHB 2V3NA 3GZNB 1EUVB 2N4FA 1EWCA 1RFAA 1WH3A 1WXVA 2JRIB 3BVMA 1VR9A 5EE3A 1EM7A 4EKUA 4EOYA 4HXDA 2BBCA 2K1FA 3GE8C 2G9HD 1L6UA 5GMVA 1D5ZC 1L7YA 2M8SA 2D5GA 3AE9B 2Z0EB 2J0KA 3PGEA 1WJ6A 1AYFA 3H7PB 4KGSA 3L54A 3GS2A 4I6NB 3IFWB 3MC0B 3A9KA 2LGDA 2C7MB 1KM7A 4YL8A 2IZVB 2JT4B 3H6NA 2REXA 3ZJTA 4TQ0A 2BB5A 1LGRA 2AQ3B 1WGGA 2RR9A 4HRSA 1ZDVA 4P1CC 3RZFA 2MBHA 1PDXA 2H88B 2WP9B 3ZTDA 1YMHE 2LUEA 1I4RA 1FNWA 1QZEA 2LGYA 4BOZB 5D3IB 2MSED 2LWPA 1R4MI 2RSUA 2LHDA 4EZLA 3B2FA 1FIQA 1GB1A 1Z2MA 3DBHI 3DBRI 3TMPB 4IWPA 4RGMA 2UU7A 3BK2A 3QAQA 2L05A 5J18A 4CYEA 1E8ZA 2LVQA 3UQAA 4ICUA 2MJEA 3UIPB 4N9F4 3EHVA 3JSVA 1EO6A 1DYQA 3R8BA 1I7HA 2N7JA 1VZ8A 3A1QB 2NTSA 2J0MA 2KVZA 4HJKA 4HVBA 1BMLC 1SXTA 1KJTA 3IXSA 3TUOA 4EE2A 2L83A 3E9SA 4W9HA 1K52A 2KJRA 1E7VA 1VZ6A 2JZPA 1XQQA 2IGDA 2OOBB 2L8JA 3AU4A 2KN4A 4XDCA 3M63B 1TZOA 1H4RA 1WXSA 3HVDA 1XXGA 1T6BX 1N6ZA 1WF9A 4JLCA 2IPKD 3B08A 2NBWB 1ZOYB 2D11A 3MC8A 4ANVA 4DXGA 2ZCCA 5LXIB 4RM8A 1AARA 4L23A 3URYA 2D2QA 4TQ1A 3KYCD 2IDYA 3PLVA 3W1YA 2LXAA 1TKEA 2X8XX 2KWCA 3ENEA 1OQRA 2QHOA 4BFRA 1NEKB 2RMMA 4C7YA 5CHFA 2WWZA 3AE1B 5KHOA 1TS2A 4HEA1 1WGHA 4PS8A 4TKNA 1WR6E 3VFKA 1Y8RC 3TJPA 3TEZA 2L0FA 2FCQA 2ZZPB 3ZKJC 4G50A 1CJEA 1NDDA 2AX5A 3JVZX 2ZVOA 2V3PA 3B9JA 3EUB2 1FMAD 2KAJA 1F2RC 3U7DA 2BS2B 3WA0A 1ESFA 4NNJB 3VDZA 3RZWC 4LNOA 2DLBA 2N9LA 5H8YE 2WX0A 3HHMA 1FPYA 3A4RA 2O6VB 2D07B 1RM6C 2IO2B 1P0RA 1GC7A 5L83A 1WE6A 2CR5A 2L0TA 1QF6A 4MGYE 1C78A 5BMHA 2GRIA 4GMVA 3I3TB 3ZNGC 3AEBB 3GB1A 1L4DB 2J53A 1N63A 1MPEA 3RNGC 4ZDVA 1MFWA 2PKOA 4EZKA 3P4PB 2WXHA 1HTQA 1UNSA 1ZKHA 2BS4B 3LDZE 3MP9A 2MH7A 3RI7C 3QARA 2FUHB 4JIOU 2GOWA 3RULA 1XLOA 1MG8A 4RH6A 3ZDTA 1L0YB 3DVNV 2BT6A 2N7DA 2I1KA 2WXIA 3NS1A 3ZLZA 2JU6X 3MFGA 3ZXRA 4BBNC 4UDUC 5GXGB 3A4SC 2PVOD 2Z0DB 2L52A 3W1SC 4KKIA 4BKSD 3GOEA 1FFUA 3IAS1 1G6JA 3SR6A 5E6PA 4E71A 3VR8B 3B2GA 1OEYJ 1FRDA 1MG4A 2IY0B 2E3TA 1K53A 2LEKA 4DBGA 4HCNB 2KJ6A 2G4SA 4WURA 3NG0A 1E8YA 1QOGA 4OW0A 1HQRD 2KO3A 1C76A 3AMZA 5FR3A 1C4AA 1XT9B 1T3QA 1T5XD 4K1RB 1VZ7A 3SFDB 1MVKA 2D3BA 3DVNU 2NR2A 1FNVA 3R7RA 1TZ1A 2N9EB 4RFBA 1YN3A 2WYQA 2JZ3B 1JMLA 1ZE3D 5D2MB 5BYRA 1C4PA 2KNBA 4BKTA 3UIOB 2KQ4X 2RPQA 1B9RA 1V5TA 2V3SA 3VH3B 2KWDA 1GJZA 3C8YA 3RN9C 2XK5A 1WRIA 4GSWA 2FCSA 3RNEC 4NJ7A 2KK8A 3TIXA 1VJKA 3AV8A 4AP4C 1YD8U 2BYTA 1C1YB 3ZJUA 4RGNA 1UWMA 3ZUNA 1SIJA 4ZRKA 4K3BA 1AN8A 1IP9A 4BKGA 2JF5A 3DBHB 3DBRB 4II3B 5AZFA 1QLBB 5T8IA 4K7UA 2ACZB 2KD0A 2DENB 4OVUA 2A4ZA 3E56A 5AZHA 3U52E 4B0EA 3QIJA 1IPGA 4XX5A 2VH1A 2AQ2B 4ZHPA 3HUIA 3DQVA 2Y5BB 3DDCB 1WX8A 2WNMA 4NJCA 4XC2A 1WZ0A 2L32A 4ITKA 4XE0A 1WGDA 4C4VA 3PVLA 3CWIA 2CHZA 2EELA 3KH0A 2JXXA 2AWTA 2K25A 1A70A 1SB3C 4MM3B 2QMTA 2M17A 3U2SC 2QIEB 3VXWA 2BF8B 3DVGX 1KOTA 2KXJA 3C0RB 4C56C 1XLQA 5HG2A 4RCOA 1GNUA 2KKCA 2JSVX 3APFA 4EUTA 2KFJA 2ZCBA 1TGZB 2C7NB 4A6QA 1LXDA 4WWNA 3JW0X 1I4HA 2G45B 4M02A 3AEFB 3SDLC 2BW2A 3PT2B 2C9WB 3I57A 2LMCA 1DGJA 4AS1A 4WWPA 4MSQB 4E3CA 1LO5D 2V1YA 3EGRA 3ZIMA 2BB6A 2BYVE 4M0WB 3TCAA 1WYGA 2SEBD 3FC4A 4RNAA 3H1UA 2GBRA 1OQQA 2DYOA 5JHAA 1ZPSA 2MWSB 1HE8A 4AJYB 4IM2A 4H2AA 3KW5B 1D5XC 2N9XA 1B1ZA 1I4QA 1WZ3A 2WS3B 4K81A 2Z59B 2VZKB 2YEPF 4ZRQA 2JY6A 1XCTL 3PTFC 3H7PA 2DZMA 1P7EA 4DHZB 4A20A 1HTOA 4C80A 3H9DA 3L4PA 3IT6B 3QHTA 3BYTB 4KGTA 3RPFC 1L0VB 3P4RB 2HD5B 2WXRA 4KSKC 4M00A 2MA9B 3ZNHB 1FNUA 1UELA 2CS4A 2QCZA 1LQBA 2GBNA 4LJOB 2OHFA 2GBKA 1P98A 1YQ3B 4MELA 3KYDD 1F52A 2V4IB 4YSXB 3I63C 1I42A 4HDQA 2QDFA 2WXOA 1V5OA 4ARCA 1A5RA 2KFKB 1JROA 2MJ3A 1FRRA 3DBLI 4GXBA 5AUIA 4YTNB 1PFDA 1TBEA 2W3RA 3SD5A 4KDLB 4II2B 3L17A 3AU5A 1UUPA 4JX1C 5D7GA 3LJ3A 1TS4A 5C2TB 2FNJB 3S2AA 2WQYB 3TEWA 4ANWA 4WQMA 2KWUB 3BWUD 1V97A 4TUUA 1RWSA 1D4BA 1PGAA 2LJIA 4HJGE 3W2DA 3HM6X 1YJ1A 1TIFA 1JWBD 1IBXA 1WXMA 1YIWA 5AZGA 1F0ZA 3R2IA 1ET6A 2BPSA 4K7SA 4PYUA 3Q8BA 2CKHB 3M3JA 4FXCA 3VAWA 1YN4A 4W9KA 1V86A 3P2BA 3ETRA 1GG3A 5HFYA 2PE9A 4W9LA 4FJVB 1J7CA 3V6CB 2Y3AA 2NTTA 2UWQA 2VH2A 2OJRA 3AN1A 1ISNA 4JWSC 1PUTA 2R2OA 4NQKE 1VLBA 1SE9A 3N3KB 2W9NA 3H8HA 3QQ8B 1WGKA 3TEXA 2LUMA 3K9OB 4MGIE 4FJYA 1YQBA 3AXCA 1YNTE 2N1VA 4FADA 2VRRB 1D6EC 3P4SB 3AE2B 2GI9A 4JQWC 1NI2A 1I4PA 2MCNB 2LRWA 3L0WB 1EF1A 4W9EA 2KVRA 2PMVA 1ENFA 1NVID 4ZRJA 2FUG1 1SIFA 2K8CA 2WXMA 2LI5A 4W9CA 2QILA 1TYGB 1YJJA 2QEJC 1J7AA 2SAKA 5I4DA 1YX6B 1HEZE 5IAAC 3PO0A 2ZJDA 1P1AA 1H8CA 1I4GA 4WH4A 3DHIC 4HKQA 3P1MA 4MSMB 1F77A 2KMAA 4GGQA 3BY4B 3J9CA 4GDLA 3N32A 4K3CA 5AEKB 1Z5SB 1V81A 3Q3MC 1KLUD 2YEPB 4WJOA 4RMAA 3FILA 3PPAA 1WFYA 4MJSA 3JYUA 5TSSA 3V62A 3QX1A 2WXLA 3RNAC 4BZAA 2IYDB 2B3AA 3P63A 4M8NA 2AL3A 3ZVVA 1QILA 1WRDB 1WM3A 1JW9D 1PYWD 2MX2A 2XN9C 3VUXA 1E90A 2O6VD 3Q3FA 3OJ3A 3ZNID 1GAQB 4G0NB 1HA5A 2C60A 4FULA 4NAWB 3DHHC 3PREA 5G55A 5CX3A 2LGIA 4LJPB 2KX3A 3NUHB 2KDMA 1JRUA 3Q8AA 4TMAB 1WXAA 1V1PB 1SBBB 2FCMA 2YLMA 3ZDMC 4MGKE 4KV2A 3ZTCA 2GMIC 4OZAA 3CSTA 2D10A 3W5UB 2MBQA 2NPTA 2M56B 2RPVA 2G3QB 3KWVA 1C4CA 1YN5A 2LRUA 3RNFC 3VR9B 1NYQA 2I2YA 1WX9A 4L2YA 2NVUI 1FD6A 1D3ZA 4DXAB 1Q0WB 1MHXA 2BKRB 2INNE 2INCC 5FK9C 1F9JA 4GLSC 4WJQA 1RRBA 3RNCC 4J6IA 1C79A 3SU8X 3DBLB 5D3DA 1UBQA 1SE2A 2I38A 4A8XC 1FXIA 4YSYB 2KOXA 4DDGD 2KDFB 4BKSA 1E8XA 4HPPA 2O2VA 2J42A 2MHJA 3QJZA 3BK1A 2DNFA 1BUIC 2PIAA 3AE4B 5TR5A 5IA7A 1KH0A 1KFYB 3A9JA 4HROA 2KC1A 2E6XA 3Q2AC 1IUEA 5EE0A 5IOIA 2IO0B 1ET9A 4DWFA 3TBLD 1CQVA 4IG7B 5DPTA 4XGAB 2N9KA 1N61A 2GBMA 1FM0D 1IGDA 3IBEA 4FJZA 2DZIA 3NVWA 4XWWA 2K22A 1XO3A 1NENB 5G5GA 1QOFA 2KC2A 2KMCA 3JSVB 3P42A 4F8CB 2ZEQA 1WI0A 1PGXA 4PT5A 1S1QB 3AE7B 2K6DB 3BVZA 2V0GA 3V6EB 2L3ZA 2BQQA 2IGGA 4K7WA 1Y56A 2BS3B 4USAA 3HK0A 3NVZA 3PHWB 2PJHA 3NY5A 3KVFB 1N5WA 2DX5B 2WGSA 3T3OA 2WHIA 2UYZB 3T3NA 2EKIA 3KUDB 4C00A 2ONQA
chains in the Genus database with same CATH topology
4K81A 1K8RB 1WMHA 1WXVA 2Z59B 4XZ4A 2JRIB 4AUQC 4B6WA 4EKUA 4EOYA 2LVPA 2JY6A 4HXDA 1L2NA 3L16A 3PTFC 3H7PA 2DZMA 2K1FA 5GMVA 1WJ4A 4DHZB 1L7YA 1WMHB 4FHJA 4A20A 2M8SA 2Z0EB 3H9DA 3QHTA 4WJPA 4EEWA 1I35A 1NBFC 2J0KA 3PGEA 1WJ6A 3H7PB 3PSEB 1LM8B 1J0GA 2JZZA 2M1MA 2HD5B 3L54A 2K6QA 4I6NB 4JGHB 2WDTB 3IFWB 4KSKC 2DYMA 3A9KA 2MA9B 3WAMA 3ZNHB 2K8BA 3N30A 2LGDA 2C7MB 1UELA 2CS4A 1KM7A 1UH6A 4YL8A 4E74A 1LQBA 1TTNA 2MBOA 5FR6A 2IZVB 2JT4B 2GBNA 3H6NA 4EFOA 2REXA 2LJ5A 4LJOB 2HJ8A 3ALBA 3GZNI 2L7RA 4TQ0A 3A9KB 1WGGA 2GBKA 2RR9A 1P98A 3APCA 4MELA 3U8ZA 3KYDD 3RZFA 2MBHA 1T0YA 1WR1A 3M95A 3UGBB 1I42A 3ZTDA 4HDQA 4HPMB 2LUEA 2NBUA 2HE7A 1V5OA 3CMMB 3CSFA 1QZEA 2LGYA 3ZRFA 1CMXB 1A5RA 2KFKB 4ANXA 4NJ6A 4BOZB 3UINB 1WJNA 3WAPA 2MQJA 2MSED 2RGFA 4DDID 3DBLI 2DZKA 3VTVA 4MM3A 4GXBA 2ASQA 1YX5B 2LWPA 2MBEA 5LLIA 1R4MI 1TBEA 3VHTC 2RSUA 3SD5A 4EZLA 4KDLB 4II2B 1C3TA 4CHKA 3RD2A 4ANUA 3L17A 4P7IA 3AU5A 3AULA 1EF5A 1Z2MA 3DVGY 5L95C 3HM3A 4W9GA 5D7GA 3LJ3A 3DBHI 3DBRI 3PS6A 3TMPB 2MP2A 4IWPA 2FNJB 5C23A 3S2AA 3MHSD 3ZRCA 3QAQA 3HIZA 2L05A 1E5WA 5J18A 4ANWA 5KHQA 4WAAA 4GDLB 3WANA 4CYEA 1E8ZA 3RCZA 2KWUB 4MGZE 4DHZE 2LVQA 2MLBA 3X0WA 3VVWB 3UQAA 4ICUA 3UIPB 4N9F4 1WGYA 2MP2B 3EHVA 3L08A 3JSVA 4TUUA 1EO6A 4W9JA 4B9KA 3A1QB 3EC8A 2J0MA 2M4NA 4HPLB 3HM6X 4HJKA 4HVBA 1YJ1A 4JL9A 1KJTA 2BGFA 4MJSB 1WXMA 2BWFA 1YIWA 5AZGA 4W9HA 1OGWA 4GDKA 2KJRA 1E7VA 4AJWA 1XQQA 3VH4B 5DPRA 3VTUA 2BPSA 2L8JA 2OOBB 1WGRA 4K7SA 2IO3B 2M0XA 2CKHB 3DBSA 3AU4A 4PYUA 2I1JA 3M3JA 3VAWA 3ML9A 3M63B 4W9KA 5BO4B 1Q1OA 2NBVB 1H4RA 5E6NA 2J7QB 1V86A 3P2BA 4GDKB 4TV3A 2ZPNA 1GC6A 1GG3A 1UBIA 2KDEB 2PE9A 2JRHA 4IM0A 1V80A 4FJVB 4W9LA 2MRPA 1WXSA 4HCPB 2LGXA 3V6CB 3OJ4B 2ZNVB 4I6PA 5HKHA 2UWQA 1WF9A 4JLCA 2OJRA 1ISNA 1E7UA 2KHWB 4WJNA 2L76A 4W9IA 3B08A 1P3QU 1R4NI 2D11A 2NBWB 2R2OA 3ECIA 4ANVA 5LXHA 2KDIA 4NQKE 2ZCCA 1SE9A 3N3KB 5LXIB 4RM8A 1AARA 3PLUA 2JVCA 2V4LA 2D2QA 1P9DU 2W9NA 1V6EA 4TQ1A 3PRPB 3KYCD 4WWOA 3QQ8B 4W9DA 3PLVA 3W1YA 2LXAA 2K39A 2KWCA 3ENEA 4IWQA 2QHOA 4BFRA 2RD0A 4ICVA 3K9OB 4AOFA 4A3PA 4MGIE 1UD7A 4FJYA 3ZNZB 5CHFA 2WWZA 2AYOB 3AI5A 1YQBA 5C1ZA 2GBJA 3AXCA 5KHOA 4KDIC 4W9FA 4EZJA 2LVOA 1WGHA 2N1VA 4PS8A 4FADA 4TKNA 1WR6E 2NPTB 2VRRB 4FHKA 3VFKA 1Y8RC 4HWIB 4JQWC 1NI2A 2MCNB 3TJPA 1ZW7A 2LRWA 3L0WB 1X1MA 1EF1A 2L0FA 2FCQA 1PQSA 2R2QA 2ZZPB 4W9EA 3ZKJC 2KVRA 2LZ6A 2BKFA 2MBBB 4G50A 3T8MA 4FLHA 2FAZA 1NDDA 1RLFA 2PE6B 3JVZX 2KTRA 4ZRJA 3VUWA 1SIFA 2G4DB 2K8CA 2N7EA 2ZVOA 5JH5C 2LI5A 1WYWB 4GIVA 4W9CA 2KFKA 4BVUC 3U7DA 2FIFA 2KN5A 4MH0E 4KZCA 3IG3A 3WA0A 1YX6B 2KTRB 5IAAC 2IY1B 4GU2A 4NNJB 2ZJDA 3VDZA 1P1AA 4BBNF 3RZWC 1UGMA 2DAJA 3T9LA 3K9PB 1H8CA 4IWOA 2WX0A 4ZRIA 3QA8A 2BYFA 2XK5B 2XBBC 3HHMA 1OEYA 4I6LB 2A5UA 2KANA 4GN1A 3A4RA 2FCNA 2O6VB 4WQOB 2D07B 4MSMB 2IO2B 1P0RA 2KMAA 4GGQA 1GC7A 3BY4B 3QCAA 4KVGB 4GDLA 3N32A 4DHJD 1WE6A 2CR5A 2L0TA 5L83A 5AEKB 4MGYE 2ZPYA 1Z5SB 1V81A 4GMVA 4LDTB 3I3TB 3ZNGC 4KZ0A 2O2VB 1V9JA 3A1QA 3Q3JA 5EDSA 4WJOA 2EKEC 4ZDVA 4RMAA 3WALA 1WX7A 3M62B 3PPAA 1WFYA 4MJSA 2N1WA 3PRMB 3R3MA 4EZKA 4AWJA 2KQSA 3A9JB 3JYUA 3NS8A 1OTRB 1ZKHA 3NZSA 3V62A 3LDZE 2C5LC 4PS3A 4G3XB 1LFDA 3QX1A 2J0JA 3EECA 2LASA 3QARA 2FUHB 4JIOU 2GOWA 3U30A 2IYDB 2B3AA 3RULA 1U4AA 3KUZA 2DZJA 3A33B 4M8NA 1MG8A 2AL3A 3ZDTA 3ZVVA 1WRDB 3DVNV 1WM3A 3W1SA 2N7DA 2KQ7A 1V49A 2MX2A 2I1KA 1VCBA 4IUMB 3ZLZA 3VUXA 4BBNC 1E90A 2O6VD 5D6JB 3Q3FA 3OJ3A 4RM9A 3ZNID 2AEHA 4GB9A 3A4SC 4G0NB 2C60A 4FULA 4MEMA 1WJUA 4NAWB 3PREA 5G55A 2Z0DB 5CX3A 3R7QA 3V61A 4LJPB 3W1SC 2LD9A 1IYFA 3SHQA 4LDTD 5JHBA 4BKSD 2KX3A 3GOEA 1G6JA 2CHXA 1JRUA 2KDBA 5E6PA 4E71A 1OEYJ 1WXAA 3RT3B 2ZNVC 2PEAA 2FCMA 2YLMA 2IY0B 3ZDMC 3UF8A 4DBGA 4HCNB 3VTWA 4MGKE 1WE7A 2KJ6A 4KV2A 3ZTCA 2GMIC 1FXTB 3R66C 2G4SA 2D3GA 3CSTA 2D10A 1E8YA 3VUYA 2KO3A 3OAWA 5CTRC 2MBQA 3VQIA 2NPTA 2G3QB 1XT9B 4HLEA 1OQYA 2LRUA 2C7HA 1XD3B 4K1RB 1WX9A 2NVUI 3DVNU 4A3OA 4DHJB 2NR2A 3R7RA 1D3ZA 1TZ1A 3L13A 1E8WA 2N9EB 3NHEB 3NOBA 4DXAB 2WYQA 1Q0WB 4NPNA 2BKRB 2JZ3B 4FN2A 5D2MB 1F9JA 2KWVB 4ZYNA 2YVCA 5J17A 3CF6E 2L00B 4WJQA 2KNBA 4BKTA 3DPDA 3APDA 3PV1A 1RRBA 4X57B 4PYZA 3UIOB 3IHPC 3WIMA 2NS5A 3D32A 1WM2A 2RPQA 3DCGA 1V5TA 4HK2A 3ONSA 4J6IA 2V3SA 3PHXB 3VH3B 2IO1B 2EMSA 2KLCA 3SU8X 1GJZA 1J8CA 1VD2A 2XK5A 1UBQA 2IBIB 4GSWA 2FCSA 4NJ7A 2KK8A 3TIXA 3QC8B 2DHZA 1YD8U 4AP4C 1C1YB 3RYTA 3ZUNA 2O6VA 2KOXA 4IC7B 3L10B 4LCDE 4ZRKA 1IP9A 1SGHA 2XEWA 4BKGA 4F1SA 2JF5A 4II3B 5AZFA 4DDGD 3OLMD 4K7UA 4BOSC 2KDFB 5E6OA 2JUOA 1ZGUB 2KD0A 1E8XA 2DENB 2HTHA 4PS7A 2DAFA 4OVUA 4BKSA 2O2VA 1J19A 4IW0A 2A4ZA 3QJZA 2NCNA 5AZHA 5CHWA 3KUCB 1V2YA 2PPHA 3QIJA 1IPGA 4F7ZA 4XX5A 5TR5A 4GOCA 5IA7A 5G2NA 3A9JA 2KC1A 2DYBA 2KZRA 3DQVA 2Y5BB 3DDCB 5CHVC 3QWZB 1S3SG 1WX8A 3H7SA 3PZDA 3PRZA 4XC2A 1WZ0A 1WIAA 2CHWA 1GUAB 4G11A 1WGDA 4MDKE 4NY0A 2KLGA 1KLVA 2IO0B 4DWFA 3TBLD 3PVLA 4KSLC 2KX0A 3IVFA 2CHZA 3KH0A 2JXXA 2AWTA 2K25A 4IG7B 3MJWA 3DOWA 5D94A 5DPTA 4FBJB 2LXCA 3WAOA 2AL6A 2GBMA 2M17A 4ASWC 3VXWA 4FA6A 2BF8B 3DVGX 3IBEA 3NZUA 4FJZA 2FIDA 1KOTA 2KXJA 3C0RB 4NAWA 2DZIA 2CU1A 3RUIB 3ZW3A 5DCNA 3O65B 1GNUA 2KKCA 2JPHA 1Q5WB 3APFA 4HDOA 3B1LX 4EUTA 3UQBA 2ZVNA 2WX1A 2KFJA 2ZCBA 2KC2A 1TGZB 2KMCA 2C7NB 3JSVB 1LXDA 4WWNA 1M94A 2BYEA 5JZEB 3JW0X 4OVVA 4DK5A 4F8CB 2ZEQA 1RAXA 1WY8A 3EFUA 1WI0A 4URKA 2G45B 3SDLC 1UZXB 1S1QB 1BT0A 3PT2B 3V60A 2C9WB 3B0AA 4WWPA 4MSQB 4E3CA 4KIKA 2K6DB 2V1YA 4M8MA 4CO7A 5DPSA 3ZIMA 2BYVE 4M0WB 3TCAA 5DPWA 3V6EB 4B95A 3TL5A 2L3ZA 2K8HA 2MW5A 2N9PC 4NQLB 3H1UA 5J2RA 2GBRA 2KTFA 2JWZA 2DYOA 4K7WA 5JHAA 4IM3A 3ZO5B 4KIKB 3HK0A 3PHWB 2BWES 2MWSB 2PJHA 3NY5A 1HE8A 3KVFB 4AJYB 4IM2A 3BINA 2DX5B 3MTNB 2EMTA 3KW5B 3X23A 2N9XA 3QK0A 2UYZB 2KJHB 3ML8A 1WZ3A 1EUVB 2N4FA 3KUDB 1RFAA 1WH3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4K81 A;  1K8R B;  1WMH A;  1WXV A;  2Z59 B;  4XZ4 A;  2JRI B;  4AUQ C;  4B6W A;  4EKU A;  4EOY A;  2LVP A;  2JY6 A;  4HXD A;  1L2N A;  3L16 A;  3PTF C;  3H7P A;  2DZM A;  2K1F A;  5GMV A;  1WJ4 A;  4DHZ B;  1L7Y A;  1WMH B;  4FHJ A;  4A20 A;  2M8S A;  2Z0E B;  3H9D A;  3QHT A;  4WJP A;  4EEW A;  1I35 A;  1NBF C;  2J0K A;  3PGE A;  1WJ6 A;  3H7P B;  3PSE B;  1LM8 B;  1J0G A;  2JZZ A;  2M1M A;  2HD5 B;  3L54 A;  2K6Q A;  4I6N B;  4JGH B;  2WDT B;  3IFW B;  4KSK C;  2DYM A;  3A9K A;  2MA9 B;  3WAM A;  3ZNH B;  2K8B A;  3N30 A;  2LGD A;  2C7M B;  1UEL A;  2CS4 A;  1KM7 A;  1UH6 A;  4YL8 A;  4E74 A;  1LQB A;  1TTN A;  2MBO A;  5FR6 A;  2IZV B;  2JT4 B;  2GBN A;  3H6N A;  4EFO A;  2REX A;  2LJ5 A;  4LJO B;  2HJ8 A;  3ALB A;  3GZN I;  2L7R A;  4TQ0 A;  3A9K B;  1WGG A;  2GBK A;  2RR9 A;  1P98 A;  3APC A;  4MEL A;  3U8Z A;  3KYD D;  3RZF A;  2MBH A;  1T0Y A;  1WR1 A;  3M95 A;  3UGB B;  1I42 A;  3ZTD A;  4HDQ A;  4HPM B;  2LUE A;  2NBU A;  2HE7 A;  1V5O A;  3CMM B;  3CSF A;  1QZE A;  2LGY A;  3ZRF A;  1CMX B;  1A5R A;  2KFK B;  4ANX A;  4NJ6 A;  4BOZ B;  3UIN B;  1WJN A;  3WAP A;  2MQJ A;  2MSE D;  2RGF A;  4DDI D;  3DBL I;  2DZK A;  3VTV A;  4MM3 A;  4GXB A;  2ASQ A;  1YX5 B;  2LWP A;  2MBE A;  5LLI A;  1R4M I;  1TBE A;  3VHT C;  2RSU A;  3SD5 A;  4EZL A;  4KDL B;  4II2 B;  1C3T A;  4CHK A;  3RD2 A;  4ANU A;  3L17 A;  4P7I A;  3AU5 A;  3AUL A;  1EF5 A;  1Z2M A;  3DVG Y;  5L95 C;  3HM3 A;  4W9G A;  5D7G A;  3LJ3 A;  3DBH I;  3DBR I;  3PS6 A;  3TMP B;  2MP2 A;  4IWP A;  2FNJ B;  5C23 A;  3S2A A;  3MHS D;  3ZRC A;  3QAQ A;  3HIZ A;  2L05 A;  1E5W A;  5J18 A;  4ANW A;  5KHQ A;  4WAA A;  4GDL B;  3WAN A;  4CYE A;  1E8Z A;  3RCZ A;  2KWU B;  4MGZ E;  4DHZ E;  2LVQ A;  2MLB A;  3X0W A;  3VVW B;  3UQA A;  4ICU A;  3UIP B;  4N9F 4;  1WGY A;  2MP2 B;  3EHV A;  3L08 A;  3JSV A;  4TUU A;  1EO6 A;  4W9J A;  4B9K A;  3A1Q B;  3EC8 A;  2J0M A;  2M4N A;  4HPL B;  3HM6 X;  4HJK A;  4HVB A;  1YJ1 A;  4JL9 A;  1KJT A;  2BGF A;  4MJS B;  1WXM A;  2BWF A;  1YIW A;  5AZG A;  4W9H A;  1OGW A;  4GDK A;  2KJR A;  1E7V A;  4AJW A;  1XQQ A;  3VH4 B;  5DPR A;  3VTU A;  2BPS A;  2L8J A;  2OOB B;  1WGR A;  4K7S A;  2IO3 B;  2M0X A;  2CKH B;  3DBS A;  3AU4 A;  4PYU A;  2I1J A;  3M3J A;  3VAW A;  3ML9 A;  3M63 B;  4W9K A;  5BO4 B;  1Q1O A;  2NBV B;  1H4R A;  5E6N A;  2J7Q B;  1V86 A;  3P2B A;  4GDK B;  4TV3 A;  2ZPN A;  1GC6 A;  1GG3 A;  1UBI A;  2KDE B;  2PE9 A;  2JRH A;  4IM0 A;  1V80 A;  4FJV B;  4W9L A;  2MRP A;  1WXS A;  4HCP B;  2LGX A;  3V6C B;  3OJ4 B;  2ZNV B;  4I6P A;  5HKH A;  2UWQ A;  1WF9 A;  4JLC A;  2OJR A;  1ISN A;  1E7U A;  2KHW B;  4WJN A;  2L76 A;  4W9I A;  3B08 A;  1P3Q U;  1R4N I;  2D11 A;  2NBW B;  2R2O A;  3ECI A;  4ANV A;  5LXH A;  2KDI A;  4NQK E;  2ZCC A;  1SE9 A;  3N3K B;  5LXI B;  4RM8 A;  1AAR A;  3PLU A;  2JVC A;  2V4L A;  2D2Q A;  1P9D U;  2W9N A;  1V6E A;  4TQ1 A;  3PRP B;  3KYC D;  4WWO A;  3QQ8 B;  4W9D A;  3PLV A;  3W1Y A;  2LXA A;  2K39 A;  2KWC A;  3ENE A;  4IWQ A;  2QHO A;  4BFR A;  2RD0 A;  4ICV A;  3K9O B;  4AOF A;  4A3P A;  4MGI E;  1UD7 A;  4FJY A;  3ZNZ B;  5CHF A;  2WWZ A;  2AYO B;  3AI5 A;  1YQB A;  5C1Z A;  2GBJ A;  3AXC A;  5KHO A;  4KDI C;  4W9F A;  4EZJ A;  2LVO A;  1WGH A;  2N1V A;  4PS8 A;  4FAD A;  4TKN A;  1WR6 E;  2NPT B;  2VRR B;  4FHK A;  3VFK A;  1Y8R C;  4HWI B;  4JQW C;  1NI2 A;  2MCN B;  3TJP A;  1ZW7 A;  2LRW A;  3L0W B;  1X1M A;  1EF1 A;  2L0F A;  2FCQ A;  1PQS A;  2R2Q A;  2ZZP B;  4W9E A;  3ZKJ C;  2KVR A;  2LZ6 A;  2BKF A;  2MBB B;  4G50 A;  3T8M A;  4FLH A;  2FAZ A;  1NDD A;  1RLF A;  2PE6 B;  3JVZ X;  2KTR A;  4ZRJ A;  3VUW A;  1SIF A;  2G4D B;  2K8C A;  2N7E A;  2ZVO A;  5JH5 C;  2LI5 A;  1WYW B;  4GIV A;  4W9C A;  2KFK A;  4BVU C;  3U7D A;  2FIF A;  2KN5 A;  4MH0 E;  4KZC A;  3IG3 A;  3WA0 A;  1YX6 B;  2KTR B;  5IAA C;  2IY1 B;  4GU2 A;  4NNJ B;  2ZJD A;  3VDZ A;  1P1A A;  4BBN F;  3RZW C;  1UGM A;  2DAJ A;  3T9L A;  3K9P B;  1H8C A;  4IWO A;  2WX0 A;  4ZRI A;  3QA8 A;  2BYF A;  2XK5 B;  2XBB C;  3HHM A;  1OEY A;  4I6L B;  2A5U A;  2KAN A;  4GN1 A;  3A4R A;  2FCN A;  2O6V B;  4WQO B;  2D07 B;  4MSM B;  2IO2 B;  1P0R A;  2KMA A;  4GGQ A;  1GC7 A;  3BY4 B;  3QCA A;  4KVG B;  4GDL A;  3N32 A;  4DHJ D;  1WE6 A;  2CR5 A;  2L0T A;  5L83 A;  5AEK B;  4MGY E;  2ZPY A;  1Z5S B;  1V81 A;  4GMV A;  4LDT B;  3I3T B;  3ZNG C;  4KZ0 A;  2O2V B;  1V9J A;  3A1Q A;  3Q3J A;  5EDS A;  4WJO A;  2EKE C;  4ZDV A;  4RMA A;  3WAL A;  1WX7 A;  3M62 B;  3PPA A;  1WFY A;  4MJS A;  2N1W A;  3PRM B;  3R3M A;  4EZK A;  4AWJ A;  2KQS A;  3A9J B;  3JYU A;  3NS8 A;  1OTR B;  1ZKH A;  3NZS A;  3V62 A;  3LDZ E;  2C5L C;  4PS3 A;  4G3X B;  1LFD A;  3QX1 A;  2J0J A;  3EEC A;  2LAS A;  3QAR A;  2FUH B;  4JIO U;  2GOW A;  3U30 A;  2IYD B;  2B3A A;  3RUL A;  1U4A A;  3KUZ A;  2DZJ A;  3A33 B;  4M8N A;  1MG8 A;  2AL3 A;  3ZDT A;  3ZVV A;  1WRD B;  3DVN V;  1WM3 A;  3W1S A;  2N7D A;  2KQ7 A;  1V49 A;  2MX2 A;  2I1K A;  1VCB A;  4IUM B;  3ZLZ A;  3VUX A;  4BBN C;  1E90 A;  2O6V D;  5D6J B;  3Q3F A;  3OJ3 A;  4RM9 A;  3ZNI D;  2AEH A;  4GB9 A;  3A4S C;  4G0N B;  2C60 A;  4FUL A;  4MEM A;  1WJU A;  4NAW B;  3PRE A;  5G55 A;  2Z0D B;  5CX3 A;  3R7Q A;  3V61 A;  4LJP B;  3W1S C;  2LD9 A;  1IYF A;  3SHQ A;  4LDT D;  5JHB A;  4BKS D;  2KX3 A;  3GOE A;  1G6J A;  2CHX A;  1JRU A;  2KDB A;  5E6P A;  4E71 A;  1OEY J;  1WXA A;  3RT3 B;  2ZNV C;  2PEA A;  2FCM A;  2YLM A;  2IY0 B;  3ZDM C;  3UF8 A;  4DBG A;  4HCN B;  3VTW A;  4MGK E;  1WE7 A;  2KJ6 A;  4KV2 A;  3ZTC A;  2GMI C;  1FXT B;  3R66 C;  2G4S A;  2D3G A;  3CST A;  2D10 A;  1E8Y A;  3VUY A;  2KO3 A;  3OAW A;  5CTR C;  2MBQ A;  3VQI A;  2NPT A;  2G3Q B;  1XT9 B;  4HLE A;  1OQY A;  2LRU A;  2C7H A;  1XD3 B;  4K1R B;  1WX9 A;  2NVU I;  3DVN U;  4A3O A;  4DHJ B;  2NR2 A;  3R7R A;  1D3Z A;  1TZ1 A;  3L13 A;  1E8W A;  2N9E B;  3NHE B;  3NOB A;  4DXA B;  2WYQ A;  1Q0W B;  4NPN A;  2BKR B;  2JZ3 B;  4FN2 A;  5D2M B;  1F9J A;  2KWV B;  4ZYN A;  2YVC A;  5J17 A;  3CF6 E;  2L00 B;  4WJQ A;  2KNB A;  4BKT A;  3DPD A;  3APD A;  3PV1 A;  1RRB A;  4X57 B;  4PYZ A;  3UIO B;  3IHP C;  3WIM A;  2NS5 A;  3D32 A;  1WM2 A;  2RPQ A;  3DCG A;  1V5T A;  4HK2 A;  3ONS A;  4J6I A;  2V3S A;  3PHX B;  3VH3 B;  2IO1 B;  2EMS A;  2KLC A;  3SU8 X;  1GJZ A;  1J8C A;  1VD2 A;  2XK5 A;  1UBQ A;  2IBI B;  4GSW A;  2FCS A;  4NJ7 A;  2KK8 A;  3TIX A;  3QC8 B;  2DHZ A;  1YD8 U;  4AP4 C;  1C1Y B;  3RYT A;  3ZUN A;  2O6V A;  2KOX A;  4IC7 B;  3L10 B;  4LCD E;  4ZRK A;  1IP9 A;  1SGH A;  2XEW A;  4BKG A;  4F1S A;  2JF5 A;  4II3 B;  5AZF A;  4DDG D;  3OLM D;  4K7U A;  4BOS C;  2KDF B;  5E6O A;  2JUO A;  1ZGU B;  2KD0 A;  1E8X A;  2DEN B;  2HTH A;  4PS7 A;  2DAF A;  4OVU A;  4BKS A;  2O2V A;  1J19 A;  4IW0 A;  2A4Z A;  3QJZ A;  2NCN A;  5AZH A;  5CHW A;  3KUC B;  1V2Y A;  2PPH A;  3QIJ A;  1IPG A;  4F7Z A;  4XX5 A;  5TR5 A;  4GOC A;  5IA7 A;  5G2N A;  3A9J A;  2KC1 A;  2DYB A;  2KZR A;  3DQV A;  2Y5B B;  3DDC B;  5CHV C;  3QWZ B;  1S3S G;  1WX8 A;  3H7S A;  3PZD A;  3PRZ A;  4XC2 A;  1WZ0 A;  1WIA A;  2CHW A;  1GUA B;  4G11 A;  1WGD A;  4MDK E;  4NY0 A;  2KLG A;  1KLV A;  2IO0 B;  4DWF A;  3TBL D;  3PVL A;  4KSL C;  2KX0 A;  3IVF A;  2CHZ A;  3KH0 A;  2JXX A;  2AWT A;  2K25 A;  4IG7 B;  3MJW A;  3DOW A;  5D94 A;  5DPT A;  4FBJ B;  2LXC A;  3WAO A;  2AL6 A;  2GBM A;  2M17 A;  4ASW C;  3VXW A;  4FA6 A;  2BF8 B;  3DVG X;  3IBE A;  3NZU A;  4FJZ A;  2FID A;  1KOT A;  2KXJ A;  3C0R B;  4NAW A;  2DZI A;  2CU1 A;  3RUI B;  3ZW3 A;  5DCN A;  3O65 B;  1GNU A;  2KKC A;  2JPH A;  1Q5W B;  3APF A;  4HDO A;  3B1L X;  4EUT A;  3UQB A;  2ZVN A;  2WX1 A;  2KFJ A;  2ZCB A;  2KC2 A;  1TGZ B;  2KMC A;  2C7N B;  3JSV B;  1LXD A;  4WWN A;  1M94 A;  2BYE A;  5JZE B;  3JW0 X;  4OVV A;  4DK5 A;  4F8C B;  2ZEQ A;  1RAX A;  1WY8 A;  3EFU A;  1WI0 A;  4URK A;  2G45 B;  3SDL C;  1UZX B;  1S1Q B;  1BT0 A;  3PT2 B;  3V60 A;  2C9W B;  3B0A A;  4WWP A;  4MSQ B;  4E3C A;  4KIK A;  2K6D B;  2V1Y A;  4M8M A;  4CO7 A;  5DPS A;  3ZIM A;  2BYV E;  4M0W B;  3TCA A;  5DPW A;  3V6E B;  4B95 A;  3TL5 A;  2L3Z A;  2K8H A;  2MW5 A;  2N9P C;  4NQL B;  3H1U A;  5J2R A;  2GBR A;  2KTF A;  2JWZ A;  2DYO A;  4K7W A;  5JHA A;  4IM3 A;  3ZO5 B;  4KIK B;  3HK0 A;  3PHW B;  2BWE S;  2MWS B;  2PJH A;  3NY5 A;  1HE8 A;  3KVF B;  4AJY B;  4IM2 A;  3BIN A;  2DX5 B;  3MTN B;  2EMT A;  3KW5 B;  3X23 A;  2N9X A;  3QK0 A;  2UYZ B;  2KJH B;  3ML8 A;  1WZ3 A;  1EUV B;  2N4F A;  3KUD B;  1RFA A;  1WH3 A; 
#chains in the Genus database with same CATH topology
 1K8R B;  4AUQ C;  2D3A A;  3ABV B;  2LVP A;  4LNK A;  2WDQ B;  3L16 A;  1KF6 B;  2JX5 A;  1SF0 A;  4JWU C;  1WMH B;  2XNA C;  4WJP A;  1VRA B;  1NBF C;  4P1B C;  1FCL A;  1EU4 A;  5IP4 D;  1LM8 B;  2JZZ A;  2M1M A;  1WWT A;  1SEB D;  2WDT B;  1R4M B;  2LHE A;  2INP E;  4XWT A;  3WAM A;  4XDD A;  4A90 A;  2LJ5 A;  2HJ8 A;  3GZN I;  2L7R A;  3APC A;  3U8Z A;  3RMK C;  3AEG B;  2M0A A;  4YXD B;  3UGB B;  5IO9 A;  4HPM B;  2VZK D;  2HE7 A;  3CSF A;  4HKZ E;  3AB5 A;  3WCQ A;  1KRH A;  1CMX B;  4ANX A;  4NJ6 A;  3OWE B;  2MQJ A;  2RGF A;  4DDI D;  1FXA A;  1TJE A;  2DZK A;  2MBE A;  2WXK A;  5LLI A;  2MJD A;  4TSS A;  3VHT C;  3RD2 A;  4RF1 A;  2BVC A;  4P7I A;  1EF5 A;  3DVG Y;  5L95 C;  3HM3 A;  4NZL B;  3PS6 A;  1F2R I;  3FAH A;  5C23 A;  3MHS D;  1KTK A;  1QOB A;  1ZUD 2;  4WAA A;  1QQR A;  3WAN A;  4MGZ E;  4DQO C;  1WGY A;  2MP2 B;  3L08 A;  4YTM B;  4A55 A;  3EC8 A;  2M4N A;  4HPL B;  4LNI A;  4JL9 A;  1STE A;  1WXQ A;  2K0P A;  5HHD G;  1ZP0 B;  5DPR A;  2IO3 B;  2G1E A;  2HTM E;  2M0X A;  3DBS A;  3AEA B;  5BO4 B;  1Q1O A;  5E6N A;  4GDK B;  2TSS A;  4LNF A;  4TV3 A;  2WU2 B;  3BYY B;  4S0R A;  2KDE B;  1KLG D;  3KQ4 A;  2JRH A;  2ZNV B;  4I6P A;  2KHW B;  5G5H A;  4WJN A;  2L76 A;  1XEE A;  1P3Q U;  5LXH A;  3SEB A;  1E6E B;  3AH7 A;  1N62 A;  1TY0 A;  1L4Z B;  3PLU A;  4M01 A;  2JVC A;  2V4L A;  4WWO A;  1P9D U;  5EE1 A;  2FE8 A;  5LNK 1;  2K39 A;  4KX6 B;  4ICV A;  4AOF A;  2WXF A;  1UD7 A;  4ARI A;  3AE8 B;  4W9F A;  3LB8 C;  1JWA D;  1TKG A;  3BII D;  4HWI B;  1ZW7 A;  5BYS A;  1X1M A;  2R2Q A;  2BKF A;  2IJ0 A;  3T8M A;  2Q5W D;  2FAZ A;  1RLF A;  1GB4 A;  2N7E A;  1E10 A;  1WYW B;  1L6V A;  2FIF A;  1SJE D;  4MH0 E;  4KZC A;  2KTR B;  2OED A;  3BZD B;  1DOY A;  3EA6 A;  4WAF A;  3RNB C;  4BBN F;  3SFE B;  1UGM A;  2KT7 A;  3K9P B;  4KKJ A;  4IWO A;  2KAC A;  2XK5 B;  1Q10 A;  4I6L B;  1ACC A;  2OJW A;  2KAN A;  4GN1 A;  3IT4 B;  2FCN A;  4WQO B;  3TSS A;  1CK1 A;  3QCA A;  3AE5 B;  5BMI A;  2ZPY A;  4LDT B;  4KZ0 A;  2D3C A;  1E7P B;  1DOX A;  3A1Q A;  2QSD A;  5EDS A;  4OVZ A;  4N58 A;  4ZYS A;  4RGO S;  3WAL A;  1WX7 A;  4WWM A;  2N1W A;  3PRM B;  3R3M A;  3NS8 A;  1OTR B;  3NZS A;  2C5L C;  4P6V F;  4PS3 A;  1TT5 B;  1QKZ A;  2LAS A;  1XF5 L;  4C4V B;  1U4A A;  3KUZ A;  2DZJ A;  5MPO A;  2K5P A;  3W1S A;  3NRZ A;  1VCB A;  4IUM B;  1JWS D;  2H89 B;  5D6J B;  4GB9 A;  1J7B A;  3NVV A;  1V1P A;  1IYF A;  2LD9 A;  5JHB A;  1JRP A;  2CHX A;  2KDB A;  3ZYY X;  1N5X A;  3RT3 B;  2ZNV C;  4XYC A;  1T0R C;  2ICI A;  3C19 A;  2X38 A;  3VTW A;  1WE7 A;  1P7F A;  1FO4 A;  2WXN A;  3R66 C;  3VRB B;  1AWD A;  5FKA C;  1SE4 A;  3CIR B;  3KLS X;  4BAX A;  3OAW A;  5CTR C;  1SSN A;  2Y5C A;  4LTU A;  2C7H A;  1XD3 B;  4D2K A;  1ZDX A;  5BMG A;  5AUK A;  4A3O A;  1JWU D;  2Z8L A;  3NOB A;  2W82 A;  1UWX A;  1TKY A;  2YVC A;  5J17 A;  3DPD A;  3APD A;  4PYZ A;  3IHP C;  2NS5 A;  3DCG A;  2K9X A;  2N0S B;  3I5J C;  3AED B;  2EMS A;  1J8C A;  1VD2 A;  2IBI B;  2QJL A;  3I9V 1;  2FBW B;  3QC8 B;  2DHZ A;  3RYT A;  1K50 A;  1TY2 A;  2O6V A;  3DWM A;  3FKY A;  3LXF A;  3OLM D;  4BOS C;  2DWQ A;  1ZGU B;  4PS7 A;  1J19 A;  4B0M A;  2WXJ A;  1C77 A;  1HZ5 A;  4QAY A;  3KUC B;  1V2Y A;  2PPH A;  1YJI A;  4F7Z A;  4GOC A;  5G2N A;  4YTP B;  3QWZ B;  3O13 A;  2W54 A;  1YQ4 B;  3PRZ A;  2ON8 A;  1WIA A;  1GUA B;  1HZ6 A;  2KMM A;  4MDK E;  1AW7 A;  4AQ7 A;  1L0X B;  1GPX A;  2KX0 A;  3IVF A;  3GP7 A;  3MJW A;  4FBJ B;  2LXC A;  3WAO A;  4J3O D;  2AL6 A;  1SJH D;  1JCK B;  2FID A;  3ZGZ A;  2CU1 A;  3ZW3 A;  5DCN A;  3V3X A;  3O65 B;  3N1X C;  1XLN A;  2JPH A;  1Q5W B;  3Q3N C;  4IDI A;  3UQB A;  2HDE A;  3P4Q B;  2WU5 B;  3DHG C;  3ZJV A;  2BYE A;  5JZE B;  4DK5 A;  1T0Q C;  2IND C;  1RAX A;  1WY8 A;  3EFU A;  4URK A;  1UZX B;  3R2T A;  1BT0 A;  1IBX B;  4CO7 A;  4M8M A;  4JE3 B;  1TS5 A;  4A9A A;  4B95 A;  2B76 B;  2MW5 A;  2N9P C;  5J2R A;  2KTF A;  3V05 A;  4IM3 A;  4OHJ A;  3ZO5 B;  4KIK B;  2BWE S;  2CJO A;  2WXQ A;  3BIN A;  2EMT A;  3X23 A;  3QK0 A;  3ML8 A;  3ZQ4 A;  1WMH A;  4XZ4 A;  1ZXI A;  4B6W A;  2DBY A;  3UI3 A;  4DXF A;  1L2N A;  4YWG G;  1WJ4 A;  1FCC C;  1JQ4 A;  2K3U A;  4FHJ A;  2AQ1 B;  4EEW A;  1I35 A;  4MAC A;  3OG5 A;  3PSE B;  3BVG A;  1J0G A;  4ACF A;  2K6Q A;  4JGH B;  2DYM A;  3ZXV A;  2K8B A;  3N30 A;  1UH6 A;  4E74 A;  1TTN A;  2MBO A;  5FR6 A;  4EFO A;  3ALB A;  3RFZ B;  3A9K B;  1T0Y A;  1WR1 A;  3M95 A;  2CU3 A;  2NBU A;  3CMM B;  5E6J A;  2LFI A;  3ZRF A;  3PZ8 A;  3UIN B;  3MHZ A;  1WJN A;  3WAP A;  2RDB C;  3VTV A;  4MM3 A;  2ASQ A;  1YX5 B;  1CZP A;  1C3T A;  4CHK A;  4ANU A;  3AUL A;  4US9 A;  4W9G A;  1JWM D;  2MP2 A;  1E9M A;  3ZRC A;  4O1N A;  3HIZ A;  1E5W A;  5EE9 A;  4YSZ B;  5KHQ A;  4GDL B;  4IOI E;  3RCZ A;  1ZXH A;  4DHZ E;  2MLB A;  3X0W A;  3VVW B;  1QOA A;  2J4X A;  4W9J A;  4B9K A;  1C9F A;  3FIL B;  2BGF A;  2QC8 A;  4MJS B;  2PVG C;  2BWF A;  1OGW A;  1BXT A;  2GB1 A;  4GDK A;  4M0W A;  4LNN A;  4AJW A;  3VH4 B;  3VTU A;  1R7S A;  1WGR A;  2I1J A;  1FEH A;  3KWL A;  2JWU A;  3ML9 A;  2NBV B;  1TS3 A;  2W55 A;  2J7Q B;  1QT9 A;  2ZPN A;  1GC6 A;  4OZB A;  1UBI A;  2M19 A;  4IM0 A;  1V80 A;  2MRP A;  4HCP B;  2LGX A;  3OJ4 B;  5HKH A;  1E7U A;  4W9I A;  4LK0 M;  1R4N I;  3ECI A;  4JPS A;  2KDI A;  5IKC M;  1V6E A;  3PRP B;  4RGT A;  4W9D A;  1NYR A;  2RDG A;  2NMQ A;  4IWQ A;  2RD0 A;  3AEE B;  3MC9 A;  1F1H A;  4A3P A;  3ZNZ B;  4R3D A;  2AYO B;  1SE3 A;  3AI5 A;  4L1B A;  3AE3 B;  5C1Z A;  2GBJ A;  4KDI C;  4IKG A;  2LVO A;  4EZJ A;  2NPT B;  4FHK A;  3N1Y C;  4ZRP A;  1PQS A;  2LZ6 A;  2MBB B;  3DWG C;  4FLH A;  2PE6 B;  3VUW A;  2KTR A;  2MEK A;  2G4D B;  1N60 A;  5JH5 C;  4GIV A;  4ZHO A;  2KFK A;  4BVU C;  4N59 A;  2KN5 A;  4RF0 A;  3U7Z A;  3IG3 A;  2IY1 B;  4GU2 A;  4C7Z A;  5IN7 A;  3IAM 1;  2RDH A;  2DAJ A;  5C3J B;  3T9L A;  3NZ3 A;  4ZRI A;  3QA8 A;  2BYF A;  2JQR B;  2XBB C;  1OEY A;  2A5U A;  1D5M C;  1EWY C;  4KVG B;  4DHJ D;  5JXV A;  1T0S C;  3W5V B;  3U4E G;  4LLG M;  2O2V B;  1V9J A;  1XLP A;  3Q3J A;  1EU3 A;  3Q8E A;  5HI1 A;  2EKE C;  4OZC A;  3M62 B;  1L5P A;  4AWJ A;  2KQS A;  3A9J B;  3Q6B A;  4G3X B;  1LFD A;  2J0J A;  3EEC A;  4MH8 A;  2PTL A;  3U30 A;  2GLS A;  3A33 B;  3Q8C A;  3N1Z C;  1RYJ A;  2KQ7 A;  1V49 A;  2WDR B;  2ZW0 A;  2KYW A;  4US8 A;  4RM9 A;  2AEH A;  3Q8F A;  1HXY D;  4MEM A;  1WJU A;  3R7Q A;  3V61 A;  3SHQ A;  4LDT D;  1MJD A;  4S17 A;  2PEA A;  1JAL A;  3UF8 A;  3N20 C;  2PW9 A;  1FXT B;  2D3G A;  2J52 A;  3Q69 A;  3VUY A;  3HRD D;  3Q14 C;  2CJN A;  2LGS A;  3VQI A;  3EFC A;  4HLE A;  1OQY A;  3TEY A;  1MI0 A;  3MJ5 A;  4YT0 B;  2JYE A;  4DHJ B;  1VDV A;  3L13 A;  1E8W A;  3NHE B;  2JYT A;  4NPN A;  4FN2 A;  3NJT A;  2KWV B;  4ZYN A;  3CF6 E;  1E0Z A;  2L00 B;  4P16 A;  4CQN A;  4X57 B;  3PV1 A;  3WIM A;  3D32 A;  2Y5P A;  4NAM A;  1WM2 A;  1ROE A;  4HK2 A;  3ONS A;  4KGR A;  3PHX B;  4WIP A;  2IO1 B;  3LYY A;  2W3S A;  2KLC A;  1FFV A;  3AE6 B;  2L1A A;  4PK1 A;  4IC7 B;  3L10 B;  4LCD E;  1DOI A;  1SGH A;  1XCQ L;  2XEW A;  4F1S A;  1PGB A;  5H92 C;  1WSP A;  1GOZ A;  2R61 A;  5E6O A;  2JUO A;  3VRA B;  2HTH A;  3AEC B;  2DAF A;  2WDV B;  4IW0 A;  2JXT A;  1UGJ A;  1YOV B;  2NCN A;  4N6E B;  1RFK A;  5CHW A;  4ZOH C;  1K51 A;  3HVZ A;  2DYB A;  2KZR A;  5CHV C;  1S3S G;  3H7S A;  3PZD A;  3NVY A;  1NI3 A;  2CHW A;  4G11 A;  4NY0 A;  1KLV A;  2KLG A;  3GE3 C;  4KSL C;  1M4V A;  5D94 A;  3DOW A;  2WXG A;  1OFF A;  3PZ7 A;  4ASW C;  4FA6 A;  3NZU A;  3Q3O C;  4Q2J A;  4NAW A;  4REZ A;  2V9H A;  3RUI B;  4MT5 A;  2ZW1 A;  3W9C B;  4HDO A;  3B1L X;  2ZVN A;  2WX1 A;  3N9Y C;  1I4X A;  1R4N B;  2WXP A;  1V8C A;  5BYQ A;  1M94 A;  4OVV A;  2HJ1 A;  1UF0 A;  1MHH E;  3V60 A;  3B0A A;  1IGC A;  4KIK A;  2BTE A;  5DPS A;  5DPW A;  1V1O A;  3TL5 A;  3AM9 A;  2IGH A;  2K8H A;  4NQL B;  2JWZ A;  2PLP A;  3MTN B;  2WLB A;  2KJH B;  2V3N A;  3GZN B;  1EUV B;  2N4F A;  1EWC A;  1RFA A;  1WH3 A;  1WXV A;  2JRI B;  3BVM A;  1VR9 A;  5EE3 A;  1EM7 A;  4EKU A;  4EOY A;  4HXD A;  2BBC A;  2K1F A;  3GE8 C;  2G9H D;  1L6U A;  5GMV A;  1D5Z C;  1L7Y A;  2M8S A;  2D5G A;  3AE9 B;  2Z0E B;  2J0K A;  3PGE A;  1WJ6 A;  1AYF A;  3H7P B;  4KGS A;  3L54 A;  3GS2 A;  4I6N B;  3IFW B;  3MC0 B;  3A9K A;  2LGD A;  2C7M B;  1KM7 A;  4YL8 A;  2IZV B;  2JT4 B;  3H6N A;  2REX A;  3ZJT A;  4TQ0 A;  2BB5 A;  1LGR A;  2AQ3 B;  1WGG A;  2RR9 A;  4HRS A;  1ZDV A;  4P1C C;  3RZF A;  2MBH A;  1PDX A;  2H88 B;  2WP9 B;  3ZTD A;  1YMH E;  2LUE A;  1I4R A;  1FNW A;  1QZE A;  2LGY A;  4BOZ B;  5D3I B;  2MSE D;  2LWP A;  1R4M I;  2RSU A;  2LHD A;  4EZL A;  3B2F A;  1FIQ A;  1GB1 A;  1Z2M A;  3DBH I;  3DBR I;  3TMP B;  4IWP A;  4RGM A;  2UU7 A;  3BK2 A;  3QAQ A;  2L05 A;  5J18 A;  4CYE A;  1E8Z A;  2LVQ A;  3UQA A;  4ICU A;  2MJE A;  3UIP B;  4N9F 4;  3EHV A;  3JSV A;  1EO6 A;  1DYQ A;  3R8B A;  1I7H A;  2N7J A;  1VZ8 A;  3A1Q B;  2NTS A;  2J0M A;  2KVZ A;  4HJK A;  4HVB A;  1BML C;  1SXT A;  1KJT A;  3IXS A;  3TUO A;  4EE2 A;  2L83 A;  3E9S A;  4W9H A;  1K52 A;  2KJR A;  1E7V A;  1VZ6 A;  2JZP A;  1XQQ A;  2IGD A;  2OOB B;  2L8J A;  3AU4 A;  2KN4 A;  4XDC A;  3M63 B;  1TZO A;  1H4R A;  1WXS A;  3HVD A;  1XXG A;  1T6B X;  1N6Z A;  1WF9 A;  4JLC A;  2IPK D;  3B08 A;  2NBW B;  1ZOY B;  2D11 A;  3MC8 A;  4ANV A;  4DXG A;  2ZCC A;  5LXI B;  4RM8 A;  1AAR A;  4L23 A;  3URY A;  2D2Q A;  4TQ1 A;  3KYC D;  2IDY A;  3PLV A;  3W1Y A;  2LXA A;  1TKE A;  2X8X X;  2KWC A;  3ENE A;  1OQR A;  2QHO A;  4BFR A;  1NEK B;  2RMM A;  4C7Y A;  5CHF A;  2WWZ A;  3AE1 B;  5KHO A;  1TS2 A;  4HEA 1;  1WGH A;  4PS8 A;  4TKN A;  1WR6 E;  3VFK A;  1Y8R C;  3TJP A;  3TEZ A;  2L0F A;  2FCQ A;  2ZZP B;  3ZKJ C;  4G50 A;  1CJE A;  1NDD A;  2AX5 A;  3JVZ X;  2ZVO A;  2V3P A;  3B9J A;  3EUB 2;  1FMA D;  2KAJ A;  1F2R C;  3U7D A;  2BS2 B;  3WA0 A;  1ESF A;  4NNJ B;  3VDZ A;  3RZW C;  4LNO A;  2DLB A;  2N9L A;  5H8Y E;  2WX0 A;  3HHM A;  1FPY A;  3A4R A;  2O6V B;  2D07 B;  1RM6 C;  2IO2 B;  1P0R A;  1GC7 A;  5L83 A;  1WE6 A;  2CR5 A;  2L0T A;  1QF6 A;  4MGY E;  1C78 A;  5BMH A;  2GRI A;  4GMV A;  3I3T B;  3ZNG C;  3AEB B;  3GB1 A;  1L4D B;  2J53 A;  1N63 A;  1MPE A;  3RNG C;  4ZDV A;  1MFW A;  2PKO A;  4EZK A;  3P4P B;  2WXH A;  1HTQ A;  1UNS A;  1ZKH A;  2BS4 B;  3LDZ E;  3MP9 A;  2MH7 A;  3RI7 C;  3QAR A;  2FUH B;  4JIO U;  2GOW A;  3RUL A;  1XLO A;  1MG8 A;  4RH6 A;  3ZDT A;  1L0Y B;  3DVN V;  2BT6 A;  2N7D A;  2I1K A;  2WXI A;  3NS1 A;  3ZLZ A;  2JU6 X;  3MFG A;  3ZXR A;  4BBN C;  4UDU C;  5GXG B;  3A4S C;  2PVO D;  2Z0D B;  2L52 A;  3W1S C;  4KKI A;  4BKS D;  3GOE A;  1FFU A;  3IAS 1;  1G6J A;  3SR6 A;  5E6P A;  4E71 A;  3VR8 B;  3B2G A;  1OEY J;  1FRD A;  1MG4 A;  2IY0 B;  2E3T A;  1K53 A;  2LEK A;  4DBG A;  4HCN B;  2KJ6 A;  2G4S A;  4WUR A;  3NG0 A;  1E8Y A;  1QOG A;  4OW0 A;  1HQR D;  2KO3 A;  1C76 A;  3AMZ A;  5FR3 A;  1C4A A;  1XT9 B;  1T3Q A;  1T5X D;  4K1R B;  1VZ7 A;  3SFD B;  1MVK A;  2D3B A;  3DVN U;  2NR2 A;  1FNV A;  3R7R A;  1TZ1 A;  2N9E B;  4RFB A;  1YN3 A;  2WYQ A;  2JZ3 B;  1JML A;  1ZE3 D;  5D2M B;  5BYR A;  1C4P A;  2KNB A;  4BKT A;  3UIO B;  2KQ4 X;  2RPQ A;  1B9R A;  1V5T A;  2V3S A;  3VH3 B;  2KWD A;  1GJZ A;  3C8Y A;  3RN9 C;  2XK5 A;  1WRI A;  4GSW A;  2FCS A;  3RNE C;  4NJ7 A;  2KK8 A;  3TIX A;  1VJK A;  3AV8 A;  4AP4 C;  1YD8 U;  2BYT A;  1C1Y B;  3ZJU A;  4RGN A;  1UWM A;  3ZUN A;  1SIJ A;  4ZRK A;  4K3B A;  1AN8 A;  1IP9 A;  4BKG A;  2JF5 A;  3DBH B;  3DBR B;  4II3 B;  5AZF A;  1QLB B;  5T8I A;  4K7U A;  2ACZ B;  2KD0 A;  2DEN B;  4OVU A;  2A4Z A;  3E56 A;  5AZH A;  3U52 E;  4B0E A;  3QIJ A;  1IPG A;  4XX5 A;  2VH1 A;  2AQ2 B;  4ZHP A;  3HUI A;  3DQV A;  2Y5B B;  3DDC B;  1WX8 A;  2WNM A;  4NJC A;  4XC2 A;  1WZ0 A;  2L32 A;  4ITK A;  4XE0 A;  1WGD A;  4C4V A;  3PVL A;  3CWI A;  2CHZ A;  2EEL A;  3KH0 A;  2JXX A;  2AWT A;  2K25 A;  1A70 A;  1SB3 C;  4MM3 B;  2QMT A;  2M17 A;  3U2S C;  2QIE B;  3VXW A;  2BF8 B;  3DVG X;  1KOT A;  2KXJ A;  3C0R B;  4C56 C;  1XLQ A;  5HG2 A;  4RCO A;  1GNU A;  2KKC A;  2JSV X;  3APF A;  4EUT A;  2KFJ A;  2ZCB A;  1TGZ B;  2C7N B;  4A6Q A;  1LXD A;  4WWN A;  3JW0 X;  1I4H A;  2G45 B;  4M02 A;  3AEF B;  3SDL C;  2BW2 A;  3PT2 B;  2C9W B;  3I57 A;  2LMC A;  1DGJ A;  4AS1 A;  4WWP A;  4MSQ B;  4E3C A;  1LO5 D;  2V1Y A;  3EGR A;  3ZIM A;  2BB6 A;  2BYV E;  4M0W B;  3TCA A;  1WYG A;  2SEB D;  3FC4 A;  4RNA A;  3H1U A;  2GBR A;  1OQQ A;  2DYO A;  5JHA A;  1ZPS A;  2MWS B;  1HE8 A;  4AJY B;  4IM2 A;  4H2A A;  3KW5 B;  1D5X C;  2N9X A;  1B1Z A;  1I4Q A;  1WZ3 A;  2WS3 B;  4K81 A;  2Z59 B;  2VZK B;  2YEP F;  4ZRQ A;  2JY6 A;  1XCT L;  3PTF C;  3H7P A;  2DZM A;  1P7E A;  4DHZ B;  4A20 A;  1HTO A;  4C80 A;  3H9D A;  3L4P A;  3IT6 B;  3QHT A;  3BYT B;  4KGT A;  3RPF C;  1L0V B;  3P4R B;  2HD5 B;  2WXR A;  4KSK C;  4M00 A;  2MA9 B;  3ZNH B;  1FNU A;  1UEL A;  2CS4 A;  2QCZ A;  1LQB A;  2GBN A;  4LJO B;  2OHF A;  2GBK A;  1P98 A;  1YQ3 B;  4MEL A;  3KYD D;  1F52 A;  2V4I B;  4YSX B;  3I63 C;  1I42 A;  4HDQ A;  2QDF A;  2WXO A;  1V5O A;  4ARC A;  1A5R A;  2KFK B;  1JRO A;  2MJ3 A;  1FRR A;  3DBL I;  4GXB A;  5AUI A;  4YTN B;  1PFD A;  1TBE A;  2W3R A;  3SD5 A;  4KDL B;  4II2 B;  3L17 A;  3AU5 A;  1UUP A;  4JX1 C;  5D7G A;  3LJ3 A;  1TS4 A;  5C2T B;  2FNJ B;  3S2A A;  2WQY B;  3TEW A;  4ANW A;  4WQM A;  2KWU B;  3BWU D;  1V97 A;  4TUU A;  1RWS A;  1D4B A;  1PGA A;  2LJI A;  4HJG E;  3W2D A;  3HM6 X;  1YJ1 A;  1TIF A;  1JWB D;  1IBX A;  1WXM A;  1YIW A;  5AZG A;  1F0Z A;  3R2I A;  1ET6 A;  2BPS A;  4K7S A;  4PYU A;  3Q8B A;  2CKH B;  3M3J A;  4FXC A;  3VAW A;  1YN4 A;  4W9K A;  1V86 A;  3P2B A;  3ETR A;  1GG3 A;  5HFY A;  2PE9 A;  4W9L A;  4FJV B;  1J7C A;  3V6C B;  2Y3A A;  2NTT A;  2UWQ A;  2VH2 A;  2OJR A;  3AN1 A;  1ISN A;  4JWS C;  1PUT A;  2R2O A;  4NQK E;  1VLB A;  1SE9 A;  3N3K B;  2W9N A;  3H8H A;  3QQ8 B;  1WGK A;  3TEX A;  2LUM A;  3K9O B;  4MGI E;  4FJY A;  1YQB A;  3AXC A;  1YNT E;  2N1V A;  4FAD A;  2VRR B;  1D6E C;  3P4S B;  3AE2 B;  2GI9 A;  4JQW C;  1NI2 A;  1I4P A;  2MCN B;  2LRW A;  3L0W B;  1EF1 A;  4W9E A;  2KVR A;  2PMV A;  1ENF A;  1NVI D;  4ZRJ A;  2FUG 1;  1SIF A;  2K8C A;  2WXM A;  2LI5 A;  4W9C A;  2QIL A;  1TYG B;  1YJJ A;  2QEJ C;  1J7A A;  2SAK A;  5I4D A;  1YX6 B;  1HEZ E;  5IAA C;  3PO0 A;  2ZJD A;  1P1A A;  1H8C A;  1I4G A;  4WH4 A;  3DHI C;  4HKQ A;  3P1M A;  4MSM B;  1F77 A;  2KMA A;  4GGQ A;  3BY4 B;  3J9C A;  4GDL A;  3N32 A;  4K3C A;  5AEK B;  1Z5S B;  1V81 A;  3Q3M C;  1KLU D;  2YEP B;  4WJO A;  4RMA A;  3FIL A;  3PPA A;  1WFY A;  4MJS A;  3JYU A;  5TSS A;  3V62 A;  3QX1 A;  2WXL A;  3RNA C;  4BZA A;  2IYD B;  2B3A A;  3P63 A;  4M8N A;  2AL3 A;  3ZVV A;  1QIL A;  1WRD B;  1WM3 A;  1JW9 D;  1PYW D;  2MX2 A;  2XN9 C;  3VUX A;  1E90 A;  2O6V D;  3Q3F A;  3OJ3 A;  3ZNI D;  1GAQ B;  4G0N B;  1HA5 A;  2C60 A;  4FUL A;  4NAW B;  3DHH C;  3PRE A;  5G55 A;  5CX3 A;  2LGI A;  4LJP B;  2KX3 A;  3NUH B;  2KDM A;  1JRU A;  3Q8A A;  4TMA B;  1WXA A;  1V1P B;  1SBB B;  2FCM A;  2YLM A;  3ZDM C;  4MGK E;  4KV2 A;  3ZTC A;  2GMI C;  4OZA A;  3CST A;  2D10 A;  3W5U B;  2MBQ A;  2NPT A;  2M56 B;  2RPV A;  2G3Q B;  3KWV A;  1C4C A;  1YN5 A;  2LRU A;  3RNF C;  3VR9 B;  1NYQ A;  2I2Y A;  1WX9 A;  4L2Y A;  2NVU I;  1FD6 A;  1D3Z A;  4DXA B;  1Q0W B;  1MHX A;  2BKR B;  2INN E;  2INC C;  5FK9 C;  1F9J A;  4GLS C;  4WJQ A;  1RRB A;  3RNC C;  4J6I A;  1C79 A;  3SU8 X;  3DBL B;  5D3D A;  1UBQ A;  1SE2 A;  2I38 A;  4A8X C;  1FXI A;  4YSY B;  2KOX A;  4DDG D;  2KDF B;  4BKS A;  1E8X A;  4HPP A;  2O2V A;  2J42 A;  2MHJ A;  3QJZ A;  3BK1 A;  2DNF A;  1BUI C;  2PIA A;  3AE4 B;  5TR5 A;  5IA7 A;  1KH0 A;  1KFY B;  3A9J A;  4HRO A;  2KC1 A;  2E6X A;  3Q2A C;  1IUE A;  5EE0 A;  5IOI A;  2IO0 B;  1ET9 A;  4DWF A;  3TBL D;  1CQV A;  4IG7 B;  5DPT A;  4XGA B;  2N9K A;  1N61 A;  2GBM A;  1FM0 D;  1IGD A;  3IBE A;  4FJZ A;  2DZI A;  3NVW A;  4XWW A;  2K22 A;  1XO3 A;  1NEN B;  5G5G A;  1QOF A;  2KC2 A;  2KMC A;  3JSV B;  3P42 A;  4F8C B;  2ZEQ A;  1WI0 A;  1PGX A;  4PT5 A;  1S1Q B;  3AE7 B;  2K6D B;  3BVZ A;  2V0G A;  3V6E B;  2L3Z A;  2BQQ A;  2IGG A;  4K7W A;  1Y56 A;  2BS3 B;  4USA A;  3HK0 A;  3NVZ A;  3PHW B;  2PJH A;  3NY5 A;  3KVF B;  1N5W A;  2DX5 B;  2WGS A;  3T3O A;  2WHI A;  2UYZ B;  3T3N A;  2EKI A;  3KUD B;  4C00 A;  2ONQ A; 
#chains in the Genus database with same CATH homology
 4K81 A;  1K8R B;  1WMH A;  1WXV A;  2Z59 B;  4XZ4 A;  2JRI B;  4AUQ C;  4B6W A;  4EKU A;  4EOY A;  2LVP A;  2JY6 A;  4HXD A;  1L2N A;  3L16 A;  3PTF C;  3H7P A;  2DZM A;  2K1F A;  5GMV A;  1WJ4 A;  4DHZ B;  1L7Y A;  1WMH B;  4FHJ A;  4A20 A;  2M8S A;  2Z0E B;  3H9D A;  3QHT A;  4WJP A;  4EEW A;  1I35 A;  1NBF C;  2J0K A;  3PGE A;  1WJ6 A;  3H7P B;  3PSE B;  1LM8 B;  1J0G A;  2JZZ A;  2M1M A;  2HD5 B;  3L54 A;  2K6Q A;  4I6N B;  4JGH B;  2WDT B;  3IFW B;  4KSK C;  2DYM A;  3A9K A;  2MA9 B;  3WAM A;  3ZNH B;  2K8B A;  3N30 A;  2LGD A;  2C7M B;  1UEL A;  2CS4 A;  1KM7 A;  1UH6 A;  4YL8 A;  4E74 A;  1LQB A;  1TTN A;  2MBO A;  5FR6 A;  2IZV B;  2JT4 B;  2GBN A;  3H6N A;  4EFO A;  2REX A;  2LJ5 A;  4LJO B;  2HJ8 A;  3ALB A;  3GZN I;  2L7R A;  4TQ0 A;  3A9K B;  1WGG A;  2GBK A;  2RR9 A;  1P98 A;  3APC A;  4MEL A;  3U8Z A;  3KYD D;  3RZF A;  2MBH A;  1T0Y A;  1WR1 A;  3M95 A;  3UGB B;  1I42 A;  3ZTD A;  4HDQ A;  4HPM B;  2LUE A;  2NBU A;  2HE7 A;  1V5O A;  3CMM B;  3CSF A;  1QZE A;  2LGY A;  3ZRF A;  1CMX B;  1A5R A;  2KFK B;  4ANX A;  4NJ6 A;  4BOZ B;  3UIN B;  1WJN A;  3WAP A;  2MQJ A;  2MSE D;  2RGF A;  4DDI D;  3DBL I;  2DZK A;  3VTV A;  4MM3 A;  4GXB A;  2ASQ A;  1YX5 B;  2LWP A;  2MBE A;  5LLI A;  1R4M I;  1TBE A;  3VHT C;  2RSU A;  3SD5 A;  4EZL A;  4KDL B;  4II2 B;  1C3T A;  4CHK A;  3RD2 A;  4ANU A;  3L17 A;  4P7I A;  3AU5 A;  3AUL A;  1EF5 A;  1Z2M A;  3DVG Y;  5L95 C;  3HM3 A;  4W9G A;  5D7G A;  3LJ3 A;  3DBH I;  3DBR I;  3PS6 A;  3TMP B;  2MP2 A;  4IWP A;  2FNJ B;  5C23 A;  3S2A A;  3MHS D;  3ZRC A;  3QAQ A;  3HIZ A;  2L05 A;  1E5W A;  5J18 A;  4ANW A;  5KHQ A;  4WAA A;  4GDL B;  3WAN A;  4CYE A;  1E8Z A;  3RCZ A;  2KWU B;  4MGZ E;  4DHZ E;  2LVQ A;  2MLB A;  3X0W A;  3VVW B;  3UQA A;  4ICU A;  3UIP B;  4N9F 4;  1WGY A;  2MP2 B;  3EHV A;  3L08 A;  3JSV A;  4TUU A;  1EO6 A;  4W9J A;  4B9K A;  3A1Q B;  3EC8 A;  2J0M A;  2M4N A;  4HPL B;  3HM6 X;  4HJK A;  4HVB A;  1YJ1 A;  4JL9 A;  1KJT A;  2BGF A;  4MJS B;  1WXM A;  2BWF A;  1YIW A;  5AZG A;  4W9H A;  1OGW A;  4GDK A;  2KJR A;  1E7V A;  4AJW A;  1XQQ A;  3VH4 B;  5DPR A;  3VTU A;  2BPS A;  2L8J A;  2OOB B;  1WGR A;  4K7S A;  2IO3 B;  2M0X A;  2CKH B;  3DBS A;  3AU4 A;  4PYU A;  2I1J A;  3M3J A;  3VAW A;  3ML9 A;  3M63 B;  4W9K A;  5BO4 B;  1Q1O A;  2NBV B;  1H4R A;  5E6N A;  2J7Q B;  1V86 A;  3P2B A;  4GDK B;  4TV3 A;  2ZPN A;  1GC6 A;  1GG3 A;  1UBI A;  2KDE B;  2PE9 A;  2JRH A;  4IM0 A;  1V80 A;  4FJV B;  4W9L A;  2MRP A;  1WXS A;  4HCP B;  2LGX A;  3V6C B;  3OJ4 B;  2ZNV B;  4I6P A;  5HKH A;  2UWQ A;  1WF9 A;  4JLC A;  2OJR A;  1ISN A;  1E7U A;  2KHW B;  4WJN A;  2L76 A;  4W9I A;  3B08 A;  1P3Q U;  1R4N I;  2D11 A;  2NBW B;  2R2O A;  3ECI A;  4ANV A;  5LXH A;  2KDI A;  4NQK E;  2ZCC A;  1SE9 A;  3N3K B;  5LXI B;  4RM8 A;  1AAR A;  3PLU A;  2JVC A;  2V4L A;  2D2Q A;  1P9D U;  2W9N A;  1V6E A;  4TQ1 A;  3PRP B;  3KYC D;  4WWO A;  3QQ8 B;  4W9D A;  3PLV A;  3W1Y A;  2LXA A;  2K39 A;  2KWC A;  3ENE A;  4IWQ A;  2QHO A;  4BFR A;  2RD0 A;  4ICV A;  3K9O B;  4AOF A;  4A3P A;  4MGI E;  1UD7 A;  4FJY A;  3ZNZ B;  5CHF A;  2WWZ A;  2AYO B;  3AI5 A;  1YQB A;  5C1Z A;  2GBJ A;  3AXC A;  5KHO A;  4KDI C;  4W9F A;  4EZJ A;  2LVO A;  1WGH A;  2N1V A;  4PS8 A;  4FAD A;  4TKN A;  1WR6 E;  2NPT B;  2VRR B;  4FHK A;  3VFK A;  1Y8R C;  4HWI B;  4JQW C;  1NI2 A;  2MCN B;  3TJP A;  1ZW7 A;  2LRW A;  3L0W B;  1X1M A;  1EF1 A;  2L0F A;  2FCQ A;  1PQS A;  2R2Q A;  2ZZP B;  4W9E A;  3ZKJ C;  2KVR A;  2LZ6 A;  2BKF A;  2MBB B;  4G50 A;  3T8M A;  4FLH A;  2FAZ A;  1NDD A;  1RLF A;  2PE6 B;  3JVZ X;  2KTR A;  4ZRJ A;  3VUW A;  1SIF A;  2G4D B;  2K8C A;  2N7E A;  2ZVO A;  5JH5 C;  2LI5 A;  1WYW B;  4GIV A;  4W9C A;  2KFK A;  4BVU C;  3U7D A;  2FIF A;  2KN5 A;  4MH0 E;  4KZC A;  3IG3 A;  3WA0 A;  1YX6 B;  2KTR B;  5IAA C;  2IY1 B;  4GU2 A;  4NNJ B;  2ZJD A;  3VDZ A;  1P1A A;  4BBN F;  3RZW C;  1UGM A;  2DAJ A;  3T9L A;  3K9P B;  1H8C A;  4IWO A;  2WX0 A;  4ZRI A;  3QA8 A;  2BYF A;  2XK5 B;  2XBB C;  3HHM A;  1OEY A;  4I6L B;  2A5U A;  2KAN A;  4GN1 A;  3A4R A;  2FCN A;  2O6V B;  4WQO B;  2D07 B;  4MSM B;  2IO2 B;  1P0R A;  2KMA A;  4GGQ A;  1GC7 A;  3BY4 B;  3QCA A;  4KVG B;  4GDL A;  3N32 A;  4DHJ D;  1WE6 A;  2CR5 A;  2L0T A;  5L83 A;  5AEK B;  4MGY E;  2ZPY A;  1Z5S B;  1V81 A;  4GMV A;  4LDT B;  3I3T B;  3ZNG C;  4KZ0 A;  2O2V B;  1V9J A;  3A1Q A;  3Q3J A;  5EDS A;  4WJO A;  2EKE C;  4ZDV A;  4RMA A;  3WAL A;  1WX7 A;  3M62 B;  3PPA A;  1WFY A;  4MJS A;  2N1W A;  3PRM B;  3R3M A;  4EZK A;  4AWJ A;  2KQS A;  3A9J B;  3JYU A;  3NS8 A;  1OTR B;  1ZKH A;  3NZS A;  3V62 A;  3LDZ E;  2C5L C;  4PS3 A;  4G3X B;  1LFD A;  3QX1 A;  2J0J A;  3EEC A;  2LAS A;  3QAR A;  2FUH B;  4JIO U;  2GOW A;  3U30 A;  2IYD B;  2B3A A;  3RUL A;  1U4A A;  3KUZ A;  2DZJ A;  3A33 B;  4M8N A;  1MG8 A;  2AL3 A;  3ZDT A;  3ZVV A;  1WRD B;  3DVN V;  1WM3 A;  3W1S A;  2N7D A;  2KQ7 A;  1V49 A;  2MX2 A;  2I1K A;  1VCB A;  4IUM B;  3ZLZ A;  3VUX A;  4BBN C;  1E90 A;  2O6V D;  5D6J B;  3Q3F A;  3OJ3 A;  4RM9 A;  3ZNI D;  2AEH A;  4GB9 A;  3A4S C;  4G0N B;  2C60 A;  4FUL A;  4MEM A;  1WJU A;  4NAW B;  3PRE A;  5G55 A;  2Z0D B;  5CX3 A;  3R7Q A;  3V61 A;  4LJP B;  3W1S C;  2LD9 A;  1IYF A;  3SHQ A;  4LDT D;  5JHB A;  4BKS D;  2KX3 A;  3GOE A;  1G6J A;  2CHX A;  1JRU A;  2KDB A;  5E6P A;  4E71 A;  1OEY J;  1WXA A;  3RT3 B;  2ZNV C;  2PEA A;  2FCM A;  2YLM A;  2IY0 B;  3ZDM C;  3UF8 A;  4DBG A;  4HCN B;  3VTW A;  4MGK E;  1WE7 A;  2KJ6 A;  4KV2 A;  3ZTC A;  2GMI C;  1FXT B;  3R66 C;  2G4S A;  2D3G A;  3CST A;  2D10 A;  1E8Y A;  3VUY A;  2KO3 A;  3OAW A;  5CTR C;  2MBQ A;  3VQI A;  2NPT A;  2G3Q B;  1XT9 B;  4HLE A;  1OQY A;  2LRU A;  2C7H A;  1XD3 B;  4K1R B;  1WX9 A;  2NVU I;  3DVN U;  4A3O A;  4DHJ B;  2NR2 A;  3R7R A;  1D3Z A;  1TZ1 A;  3L13 A;  1E8W A;  2N9E B;  3NHE B;  3NOB A;  4DXA B;  2WYQ A;  1Q0W B;  4NPN A;  2BKR B;  2JZ3 B;  4FN2 A;  5D2M B;  1F9J A;  2KWV B;  4ZYN A;  2YVC A;  5J17 A;  3CF6 E;  2L00 B;  4WJQ A;  2KNB A;  4BKT A;  3DPD A;  3APD A;  3PV1 A;  1RRB A;  4X57 B;  4PYZ A;  3UIO B;  3IHP C;  3WIM A;  2NS5 A;  3D32 A;  1WM2 A;  2RPQ A;  3DCG A;  1V5T A;  4HK2 A;  3ONS A;  4J6I A;  2V3S A;  3PHX B;  3VH3 B;  2IO1 B;  2EMS A;  2KLC A;  3SU8 X;  1GJZ A;  1J8C A;  1VD2 A;  2XK5 A;  1UBQ A;  2IBI B;  4GSW A;  2FCS A;  4NJ7 A;  2KK8 A;  3TIX A;  3QC8 B;  2DHZ A;  1YD8 U;  4AP4 C;  1C1Y B;  3RYT A;  3ZUN A;  2O6V A;  2KOX A;  4IC7 B;  3L10 B;  4LCD E;  4ZRK A;  1IP9 A;  1SGH A;  2XEW A;  4BKG A;  4F1S A;  2JF5 A;  4II3 B;  5AZF A;  4DDG D;  3OLM D;  4K7U A;  4BOS C;  2KDF B;  5E6O A;  2JUO A;  1ZGU B;  2KD0 A;  1E8X A;  2DEN B;  2HTH A;  4PS7 A;  2DAF A;  4OVU A;  4BKS A;  2O2V A;  1J19 A;  4IW0 A;  2A4Z A;  3QJZ A;  2NCN A;  5AZH A;  5CHW A;  3KUC B;  1V2Y A;  2PPH A;  3QIJ A;  1IPG A;  4F7Z A;  4XX5 A;  5TR5 A;  4GOC A;  5IA7 A;  5G2N A;  3A9J A;  2KC1 A;  2DYB A;  2KZR A;  3DQV A;  2Y5B B;  3DDC B;  5CHV C;  3QWZ B;  1S3S G;  1WX8 A;  3H7S A;  3PZD A;  3PRZ A;  4XC2 A;  1WZ0 A;  1WIA A;  2CHW A;  1GUA B;  4G11 A;  1WGD A;  4MDK E;  4NY0 A;  2KLG A;  1KLV A;  2IO0 B;  4DWF A;  3TBL D;  3PVL A;  4KSL C;  2KX0 A;  3IVF A;  2CHZ A;  3KH0 A;  2JXX A;  2AWT A;  2K25 A;  4IG7 B;  3MJW A;  3DOW A;  5D94 A;  5DPT A;  4FBJ B;  2LXC A;  3WAO A;  2AL6 A;  2GBM A;  2M17 A;  4ASW C;  3VXW A;  4FA6 A;  2BF8 B;  3DVG X;  3IBE A;  3NZU A;  4FJZ A;  2FID A;  1KOT A;  2KXJ A;  3C0R B;  4NAW A;  2DZI A;  2CU1 A;  3RUI B;  3ZW3 A;  5DCN A;  3O65 B;  1GNU A;  2KKC A;  2JPH A;  1Q5W B;  3APF A;  4HDO A;  3B1L X;  4EUT A;  3UQB A;  2ZVN A;  2WX1 A;  2KFJ A;  2ZCB A;  2KC2 A;  1TGZ B;  2KMC A;  2C7N B;  3JSV B;  1LXD A;  4WWN A;  1M94 A;  2BYE A;  5JZE B;  3JW0 X;  4OVV A;  4DK5 A;  4F8C B;  2ZEQ A;  1RAX A;  1WY8 A;  3EFU A;  1WI0 A;  4URK A;  2G45 B;  3SDL C;  1UZX B;  1S1Q B;  1BT0 A;  3PT2 B;  3V60 A;  2C9W B;  3B0A A;  4WWP A;  4MSQ B;  4E3C A;  4KIK A;  2K6D B;  2V1Y A;  4M8M A;  4CO7 A;  5DPS A;  3ZIM A;  2BYV E;  4M0W B;  3TCA A;  5DPW A;  3V6E B;  4B95 A;  3TL5 A;  2L3Z A;  2K8H A;  2MW5 A;  2N9P C;  4NQL B;  3H1U A;  5J2R A;  2GBR A;  2KTF A;  2JWZ A;  2DYO A;  4K7W A;  5JHA A;  4IM3 A;  3ZO5 B;  4KIK B;  3HK0 A;  3PHW B;  2BWE S;  2MWS B;  2PJH A;  3NY5 A;  1HE8 A;  3KVF B;  4AJY B;  4IM2 A;  3BIN A;  2DX5 B;  3MTN B;  2EMT A;  3KW5 B;  3X23 A;  2N9X A;  3QK0 A;  2UYZ B;  2KJH B;  3ML8 A;  1WZ3 A;  1EUV B;  2N4F A;  3KUD B;  1RFA A;  1WH3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...