1WMHB

Crystal structure of a pb1 domain complex of protein kinase c iota and par6 alpha
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
82
structure length
82
Chain Sequence
SIVEVKSKFDAEFRRFALPRASVSGFQEFSRLLRAVHQIPGLDVLLGYTDAHGDLLPLTNDDSLHRALASGPPPLRLLVQKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a Cell Polarity Regulator, a Complex between Atypical PKC and Par6 PB1 Domains
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/cell cycle
molecule keywords Protein kinase C, iota type
total genus 17
structure length 82
sequence length 82
ec nomenclature
pdb deposition date 2004-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00564 PB1 PB1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1wmhB00
4LJPB 2LRUA 3JYUA 3I3TB 2GBRA 3DVGX 3KYCD 3M63B 4GGQA 4GMVA 4RMAA 1R4MI 2L3ZA 3AU5A 4AJYB 1V2YA 2G4SA 2KDEB 3PSEB 1AARA 3L0WB 4WJQA 3ZNID 2IO0B 2G3QB 1WH3A 3P2BA 2K25A 1UELA 3JSVA 3K9PB 1K8RB 1EF1A 2AWTA 1OEYA 1YQBA 3RZFA 2O2VA 1VCBA 3LJ3A 4FJYA 2PJHA 4JL9A 3SHQA 3X23A 2MLBA 4DBGA 2LGXA 1JRUA 1S1QB 2JRHA 2V1YA 2K6DB 1WJ4A 2DZKA 2KXJA 3JVZX 2KD0A 3NOBA 4CO7A 2LGYA 1V86A 2ZPYA 2NS5A 3X0WA 2YVCA 5GMVA 3V61A 2WX0A 3PRZA 2KJHB 2AL6A 2KVRA 4K81A 1SE9A 1WGYA 2BF8B 3DBSA 3V60A 1EUVB 3PLVA 4EUTA 2JXXA 2LVQA 1UBIA 5AEKB 1WR6E 4ICVA 1I42A 2KLGA 3TL5A 1OQYA 2M1MA 3KW5B 2KMCA 3H6NA 2OJRA 4DHJD 2RSUA 5DCNA 3SU8X 2DAJA 3QJZA 2NPTB 2G45B 3PVLA 1V6EA 1ZW7A 3RZWC 2DAFA 4G0NB 3Q3FA 3RD2A 3KYDD 3RYTA 2LGDA 3ZVVA 5D94A 1KLVA 2EKEC 4KV2A 2DHZA 2LI5A 2C9WB 2KQ7A 3WIMA 3ONSA 2RGFA 1E8WA 2HD5B 3DCGA 4PYUA 4EEWA 1RAXA 4M8MA 1NBFC 3PGEA 4GB9A 4FJVB 2LXCA 4MGIE 2NBWB 3HM6X 1LXDA 1WJNA 4BKTA 4GSWA 2FCSA 3QX1A 4ANVA 4IWOA 2MA9B 1WF9A 2GBNA 2MX2A 4WWOA 3JW0X 1GC6A 2L8JA 2MP2A 2Z0DB 2KK8A 2ZCCA 1WGRA 4NJ7A 2ZZPB 1V80A 2WWZA 4IC7B 4IM2A 4I6NB 3S2AA 3L10B 3HM3A 4J6IA 2M8SA 4HCNB 1WE7A 4GDLB 3A9KB 2ZJDA 1UZXB 2NPTA 3NY5A 3DPDA 2LXAA 2GBKA 2JWZA 3UINB 1SGHA 4TQ0A 1HE8A 4AJWA 3T8MA 2K8BA 3VTVA 2OOBB 1P1AA 2KFKA 4PS3A 2K1FA 2FAZA 3M95A 3GZNI 4HPMB 3H1UA 2D07B 3K9OB 3U30A 1E8YA 3QWZB 3UQBA 4K1RB 3ZNHB 4LDTD 4BOZB 2ZNVC 5CHFA 2RD0A 4HLEA 4A3PA 1X1MA 3L54A 4ANXA 4HK2A 4NQKE 3SD5A 4BKGA 1A5RA 3MTNB 2ZNVB 4KDIC 1YIWA 4DDGD 4MGYE 2XK5A 1V9JA 3MJWA 4HXDA 2LWPA 1WXMA 3GOEA 4ICUA 1KJTA 4B6WA 5J17A 1D3ZA 2FCNA 2L05A 3AXCA 2ZCBA 2MBBB 1WYWB 2A4ZA 2M0XA 1OTRB 4HCPB 2JUOA 3CSFA 5KHQA 3W1YA 3VFKA 3APDA 2MBOA 2N9EB 2R2OA 1EF5A 1H4RA 2ZEQA 4BBNF 2KZRA 2Z59B 1Z2MA 2D11A 3QHTA 5CX3A 1TGZB 3OJ3A 2NBUA 1RRBA 1WZ0A 2PE6B 4B95A 1CMXB 2CHWA 1UD7A 2KJ6A 2KFKB 2KWCA 2LVPA 2J0KA 2LVOA 4XZ4A 3QC8B 3EC8A 3PLUA 1OEYJ 1ISNA 3A9KA 3BY4B 2KNBA 2NCNA 2K8CA 2WX1A 1OGWA 4KDLB 3C0RB 5AZFA 3AI5A 2V3SA 3L16A 4FLHA 2LJ5A 4HJKA 4A20A 2IY0B 4GIVA 1F9JA 4OVUA 2KC1A 2CKHB 4F1SA 3TBLD 1WE6A 1LFDA 2DYBA 2N7EA 5DPTA 5LXHA 5TR5A 2QHOA 2C7HA 2KOXA 1YD8U 2C5LC 4WJOA 3PPAA 3O65B 2M4NA 4W9DA 2MWSB 2EMTA 2IY1B 1NDDA 2IO3B 1WXAA 2LASA 3VTUA 2CHZA 3B1LX 4BKSA 2PPHA 4W9CA 3VDZA 2LD9A 3ZUNA 3HHMA 4F7ZA 3LDZE 3PREA 3ML9A 1Q1OA 4ZYNA 1V81A 2BPSA 1J19A 4IW0A 2AEHA 4M8NA 3OAWA 4FN2A 2FNJB 2DZIA 4MGZE 4DK5A 3QK0A 3M62B 4IG7B 3UGBB 2MBEA 2N1WA 1M94A 1S3SG 2DYMA 2N9XA 5L83A 3WAOA 1WJ6A 5C23A 2Z0EB 5LXIB 2MBHA 2O6VB 1XQQA 4I6PA 2KTRB 4URKA 3A4SC 2CHXA 4AP4C 4ZRKA 2CU1A 3EHVA 3KUCB 2YLMA 2N7DA 2MP2B 4TUUA 3KVFB 4KSLC 3KUZA 4DHZB 1XT9B 3DDCB 3APFA 3QAQA 2ZVNA 4WJPA 3VQIA 3ZO5B 4FA6A 2KTFA 2PE9A 1WRDB 4GDLA 4HWIB 3H7SA 3VUYA 4N9F4 2NBVB 4LCDE 3A1QA 4KZ0A 4FADA 1BT0A 2I1JA 4E74A 3IFWB 2KN5A 1YJ1A 4E71A 1LM8B 4KIKB 3RUIB 3R7RA 1P3QU 4W9HA 1XD3B 4PYZA 5JHBA 2KQSA 1H8CA 1T0YA 3CF6E 1Q5WB 4TV3A 2JF5A 3IG3A 5JZEB 4CHKA 3TMPB 1LQBA 1U4AA 5DPWA 5CHWA 4EZKA 5G2NA 3D32A 5D7GA 3IVFA 3RT3B 3W1SA 1WJUA 2C60A 2HTHA 2KC2A 4GOCA 1UH6A 2XBBC 2O6VA 4B9KA 3BINA 4G50A 2BYEA 3H7PB 3N30A 2L0TA 2KMAA 4CYEA 1NI2A 2KTRA 4GU2A 4EZLA 1ZGUB 2XK5B 1V49A 5JH5C 3ALBA 2N1VA 4WAAA 4FBJB 4ZRIA 4II3B 4OVVA 4E3CA 2IO1B 3KH0A 1IP9A 4M0WB 4DWFA 3Q3JA 3PHWB 4MSQB 4GDKA 1WGGA 3DOWA 3ZIMA 2IBIB 3RULA 2AL3A 2ZVOA 1WXVA 2L7RA 2G4DB 2C7MB 4II2B 4PS7A 3ZTCA 3PS6A 3DVGY 3VH4B 2GOWA 2D10A 2EMSA 2BWES 4MGKE 1YX5B 2KWUB 3AU4A 3OJ4B 5E6OA 2N4FA 2J0MA 3UIPB 2LUEA 3ZDMC 1WX9A 4BOSC 2RPQA 1C3TA 3NZUA 3U8ZA 4DHJB 3A1QB 5E6PA 3KUDB 1E7UA 4MM3A 3PRMB 4MJSA 2D2QA 5J2RA 1Y8RC 4KIKA 4NPNA 3H7PA 3V62A 3ZRFA 4ZRJA 3VUWA 2FUHB 3UF8A 2IZVB 2KX3A 1RFAA 4W9LA 4K7WA 2ASQA 2BKFA 2FCMA 1L2NA 2AYOB 4KZCA 2GBJA 2A5UA 2MSED 2CR5A 5E6NA 4ASWC 4GDKB 1MG8A 3H9DA 3PT2B 1E5WA 3DVNU 3WAPA 3L17A 2NR2A 2KANA 1E7VA 1WZ3A 3R66C 3PRPB 4NAWB 1C1YB 1GUAB 1P98A 2WDTB 1WR1A 2J7QB 4MJSB 3DQVA 3VUXA 3QIJA 1WI0A 3WALA 2GMIC 1SIFA 3R7QA 4NJ6A 4FJZA 3SDLC 4IM0A 4RM9A 3WA0A 1TZ1A 2XEWA 1WXSA 1P9DU 2KHWB 3MHSD 4IWQA 4MEMA 4WJNA 4BBNC 4FHKA 4MELA 1E8ZA 1UBQA 4K7UA 5FR6A 4I6LB 2VRRB 2BGFA 1WMHB 3ZTDA 4RM8A 3ZKJC 2C7NB 5D6JB 5DPRA 2M17A 2K6QA 3B08A 4TKNA 2JZZA 4AWJA 1G6JA 3A9JB 2HJ8A 2UYZB 3IBEA 2JRIB 2B3AA 4KSKC 1WFYA 1Z5SB 3CSTA 1R4NI 3EFUA 4WQOB 5CTRC 3VXWA 3ZRCA 4DDID 3HIZA 4WWNA 2MRPA 3TIXA 2BKRB 2J0JA 1E90A 2KO3A 2MQJA 2DYOA 1P0RA 1WM2A 4LDTB 2IYDB 3WANA 3VH3B 4ZDVA 1WGDA 1WIAA 4YL8A 4BFRA 1V5OA 4FHJA 2JPHA 4FULA 3PZDA 3NS8A 4GN1A 2L0FA 2I1KA 4NAWA 4IWPA 5D2MB 2KFJA 4BVUC 3ZNZB 3N3KB 4X57B 5C1ZA 2W9NA 3PHXB 3CMMB 3PTFC 3WAMA 2FIDA 5IAAC 3M3JA 4XC2A 2DX5B 2KDIA 4W9KA 3QCAA 2REXA 1RLFA 4NQLB 1PQSA 3TJPA 5KHOA 3T9LA 1GG3A 3A4RA 3ZLZA 5JHAA 2BWFA 3DBLI 4IUMB 1V5TA 2BYFA 2LZ6A 3HK0A 3ZDTA 4HPLB 3DBRI 4A3OA 2RR9A 2PEAA 2V4LA 2DZMA 2ZPNA 3R3MA 4JQWC 3EECA 4MSMB 4AUQC 3B0AA 2JZ3B 5BO4B 3VAWA 4PS8A 5DPSA 1WY8A 1Q0WB 3ML8A 4W9JA 2R2QA 5IA7A 2JY6A 4G11A 4JIOU 4G3XB 1J0GA 1WMHA 3VTWA 1UGMA 1FXTB 4EKUA 2JVCA 4GXBA 4AOFA 2KWVB 3QARA 3NHEB 3QA8A 2LRWA 2K39A 3A33B 3NZSA 3IHPC 4HDQA 4ANUA 3A9JA 4WWPA 2FCQA 1E8XA 1WM3A 4HVBA 3ECIA 1WX8A 4IM3A 4P7IA 4LJOB 1VD2A 2KX0A 4NY0A 3DVNV 3APCA 3RCZA 1IYFA 5CHVC 1GJZA 2CS4A 5LLIA 3PV1A 2K8HA 2WYQA 3VHTC 3L13A 2D3GA 4W9GA 1EO6A 4NNJB 3JSVB 4JGHB 1I35A 2L76A 4W9FA 2FIFA 3UIOB 3ENEA 3OLMD 3L08A 4DXAB 3UQAA 1KOTA 2GBMA 2O2VB 3V6EB 2HE7A 4EZJA 1TTNA 1KM7A 2JT4B 2KDFB 1WX7A 5L95C 4W9EA 1IPGA 3ZNGC 2NVUI 2KDBA 3N32A 2BYVE 4XX5A 4K7SA 2MBQA 3DBHI 4BKSD 4ANWA 4EOYA 4JLCA 2MCNB 1TBEA 2N9PC 4MH0E 2DZJA 2KLCA 1J8CA 2UWQA 4DHZE 2KKCA 5AZGA 1YX6B 4EFOA 4KVGB 4TQ1A 3VVWB 5J18A 2IO2B 1L7YA 1ZKHA 2L00B 3W1SC 2DENB 3V6CB 1QZEA 4F8CB 3ZW3A 3AULA 3QQ8B 4HDOA 5EDSA 2KJRA 3U7DA 2O6VD 4W9IA 1GC7A 5HKHA 5AZHA 1WGHA 2Y5BB 1GNUA 2MW5A 3TCAA 5G55A 4MDKE
chains in the Genus database with same CATH superfamily
2BTEA 3DVGX 1D5XC 1R4MI 4JWUC 1AARA 3ZNID 5HG2A 3K9PB 3EFCA 5LNK1 1EF1A 3WCQA 1F1HA 2PJHA 1UWMA 3PZ8A 3RNBC 3NVVA 2LGYA 2J53A 1FXAA 4XDDA 2YVCA 4L2YA 2AL6A 4K81A 3DBSA 2JXXA 3RPFC 1UBIA 1FM0D 1WR6E 1I42A 2LGSA 2IJ0A 1ZP0B 3N20C 1C4AA 2RSUA 2K0PA 1FNWA 1V6EA 2FUG1 3AMZA 3RZWC 2DAFA 4G0NB 4P1CC 3DHGC 3ZVVA 4US8A 1L0VB 2BB6A 2LI5A 1FEHA 2RGFA 4XYCA 3URYA 5IO9A 4RFBA 1K53A 4MGIE 2NBWB 4BKTA 5HI1A 2MX2A 1WF9A 2GBNA 4C4VB 2L8JA 1JWMD 3AEFB 2WWZA 1I4RA 4IM2A 3ZGZA 2L83A 3AM9A 4J6IA 2M8SA 2NPTA 3P4RB 5EE9A 2JWZA 4P16A 2KN4A 1TJEA 2INDC 2D07B 3K9OB 2J4XA 4LDTD 1PGAA 4KX6B 5CHFA 2WXGA 3FILA 4BKGA 3I5JC 2YEPF 4DDGD 3MJWA 1V9JA 2AQ3B 1KJTA 3BK1A 1D3ZA 2FCNA 2L05A 3AXCA 4HCPB 2M0XA 2QC8A 3CSFA 2N9LA 3OWEB 1TS3A 3VFKA 2R2OA 1EF5A 2KZRA 1ZPSA 2D11A 4RGMA 4JX1C 5CX3A 4N6EB 3FILB 2BW2A 1J7CA 5BYQA 1WZ0A 3E56A 2CHWA 2KWCA 2LVPA 2J0KA 3QC8B 3BY4B 3W9CB 4LNFA 5AZFA 4FLHA 2IY0B 4GIVA 4OVUA 2KC1A 5FKAC 2DYBA 2N7EA 5LXHA 5TR5A 3FC4A 3Q3OC 2IGDA 3AE9B 1SJHD 2H88B 2QHOA 1YD8U 2WNMA 4WJOA 1V1OA 2MWSB 2LASA 3AEEB 3TUOA 3B1LX 3SEBA 1BUIC 3VDZA 1FMAD 4IOIE 1J19A 4M8NA 2FNJB 4MGZE 3QK0A 2W55A 2G1EA 1S3SG 5L83A 2JYTA 2WXNA 2Z0EB 1P7EA 4A6QA 2LHEA 1FFUA 1I4HA 3A4SC 2CHXA 4AP4C 1T3QA 1MHXA 2LEKA 4TUUA 3BYTB 2PIAA 4KSLC 3Q8AA 2WP9B 3DDCB 2ZVNA 3VQIA 3ZO5B 3VRAB 2KAJA 2W82A 4NZLB 4HWIB 3H7SA 3VUYA 2V3NA 4LCDE 4KZ0A 1FRRA 3A1QA 4ZOHC 1YJ1A 1LM8B 2INCC 3R7RA 4M0WA 5JHBA 1T0YA 4Q2JA 2JF5A 3TMPB 1LQBA 3D32A 1WJUA 2M0AA 2HTHA 2O6VA 3H7PB 4CYEA 1ZGUB 1RM6C 2IO1B 3KH0A 4M0WB 3BVGA 4GDKA 1WGGA 3DOWA 2ZVOA 3GB1A 2RDBC 2SAKA 1HA5A 4II2B 2ONQA 5GXGB 1EU4A 1JWSD 3PS6A 4USAA 4C7ZA 1DOYA 1GPXA 3P4SB 1NVID 3AEBB 2EELA 2LUEA 1C3TA 1HEZE 3KUDB 1FPYA 5TSSA 4MJSA 1XO3A 1R7SA 2FUHB 2IZVB 1RFAA 4K7WA 2BKFA 2GBJA 4YXDB 1L4DB 3DBRB 1VLBA 5I4DA 2NMQA 1P98A 1WR1A 4MJSB 1WI0A 1FIQA 1SIFA 3R7QA 3R2TA 4FJZA 4NJ6A 5G5GA 2XEWA 3MHSD 4WJNA 4WURA 5D6JB 1PGBA 2E6XA 3B08A 4TKNA 2JZZA 4AWJA 2HJ8A 2JRIB 1ZXIA 2WQYB 1R4NI 2Q5WD 3HIZA 3ZXVA 2BKRB 4KGSA 1WM2A 2QJLA 3P42A 5AUIA 1GB1A 1WGDA 3C19A 2BS2B 4BFRA 4FHJA 2JPHA 4FULA 4GN1A 5D2MB 3KWLA 4BVUC 3CMMB 3Q14C 4LNNA 3QCAA 3J9CA 2BS4B 2BWFA 2FBWB 3DBLI 2LZ6A 5JXVA 3DBRI 4A3OA 3EECA 4MSMB 5BO4B 3V3XA 3VAWA 5DPSA 4W9JA 2R2QA 2JY6A 1XLPA 2LGIA 1FXTB 1XLQA 4GXBA 2WDVB 1OQRA 4EKUA 4RCOA 2LRWA 2WLBA 2K39A 3A33B 4M01A 3A9JA 4WWPA 1TKGA 2KT7A 1C77A 1WX8A 2VH1A 1QT9A 3DVNV 3APCA 2K8HA 2QSDA 3UIOB 2INPE 3ENEA 4ZHPA 4O1NA 2HE7A 4OZAA 2JT4B 1WX7A 4W9EA 1UF0A 3ZNGC 1KRHA 2SEBD 3N32A 3VR9B 4XX5A 4K7SA 3DBHI 4EOYA 4MH0E 2VH2A 2KKCA 2ACZB 1I4PA 5AZGA 4HJGE 1YX6B 4KVGB 4TQ1A 1GAQB 2L00B 1ZKHA 2W54A 1QZEA 5IOIA 2WHIA 2IGGA 1GNUA 3TCAA 4HKQA 5G55A 4MDKE 2LRUA 3I3TB 2GBRA 3M63B 4GGQA 4GMVA 1IGCA 2CJNA 3NUHB 4AJYB 1V2YA 2KDEB 1UGJA 2IO0B 2L1AA 2AWTA 1OEYA 3RZFA 4FJYA 1FO4A 4JL9A 3X23A 2V1YA 4CO7A 1ZXHA 1CJEA 2D3BA 1L0YB 2WX0A 3PRZA 2PVGC 1KTKA 3V60A 4EUTA 1F2RI 3SFEB 3N1YC 1YN3A 1Y56A 3KW5B 4DHJD 3UI3A 5IKCM 1TS4A 3SU8X 1WXQA 2NPTB 3ZJUA 3RYTA 4RGOS 1YJIA 4IKGA 5D94A 1N62A 1KLVA 4C80A 2C9WB 2RPVA 3ONSA 2V9HA 4EEWA 4GB9A 1F0ZA 3R2IA 1MVKA 3HM6X 1LXDA 1C76A 2BVCA 2FCSA 4ANVA 1ET9A 4WWOA 1GC6A 4B0EA 2N0SB 1YN4A 1FD6A 4I6NB 3S2AA 3L10B 4HCNB 2LXAA 3UINB 4A8XC 3ZXRA 1HE8A 1ZDVA 1TZOA 3Q69A 2JQRB 4JE3B 3GE8C 2OOBB 4KGRA 1P1AA 2KFKA 2K1FA 2FAZA 3ZNHB 2I2YA 3TEWA 4HLEA 2D3AA 4A3PA 1E6EB 3EUB2 4RF1A 4L23A 4ANXA 4NQKE 3SD5A 4FXCA 4KKIA 1YIWA 4J3OD 3IT4B 1L0XB 1XCTL 3RNEC 3ZQ4A 1SB3C 2ZCBA 1OTRB 2RDGA 1I4QA 2L32A 2N9EB 2ZEQA 4BBNF 1SIJA 1RRBA 4B95A 2Y5PA 4XZ4A 1YJJA 1L5PA 1OEYJ 2FE8A 2JYEA 4KDLB 2WX1A 1OGWA 5FK9C 3AI5A 4WWMA 1FNUA 4HJKA 4A20A 2CKHB 3TBLD 2JU6X 2KOXA 2C5LC 3PPAA 4WIPA 2M4NA 1F52A 4YTNB 2CHZA 4BKSA 1N6ZA 2LD9A 3HHMA 4KKJA 1Q1OA 3MC9A 4ZYNA 3IXSA 1QLBB 1OQQA 4IW0A 1HZ5A 4IG7B 2UU7A 1M94A 2N9XA 1WJ6A 2H89B 1M4VA 2IPKD 2O6VB 1YN5A 1XQQA 2KTRB 4URKA 3EHVA 1TKYA 3KUZA 1XF5L 3QAQA 3APFA 4WJPA 2KTFA 4US9A 1AYFA 4FADA 1PUTA 1XEEA 3Q3MC 2I1JA 3DBLB 3AEAB 4S0RA 3RUIB 4HEA1 1P3QU 1XD3B 4PYZA 1KH0A 1Q5WB 4TV3A 3IG3A 3Q6BA 5HHDG 1N63A 3LB8C 1N5WA 5G2NA 1RWSA 4YTMB 3W1SA 4GOCA 3BINA 1EM7A 5MPOA 2PW9A 2XK5B 3ALBA 2N1VA 4WAAA 4FBJB 4ZRIA 4E3CA 1UUPA 3Q8FA 1KF6B 1EU3A 2V3PA 3O13A 1F77A 3VH4B 4EE2A 2GOWA 2D10A 3BK2A 4DXGA 2MJEA 1XLNA 1YX5B 4KGTA 2K3UA 2KWUB 3AU4A 5E6OA 2N4FA 2K22A 3UIPB 3ZDMC 2HDEA 5BMHA 4XWTA 4MM3A 2KWDA 3PRMB 1ZOYB 1Y8RC 4KIKA 4HROA 3V62A 3MC8A 4W9LA 2ASQA 4WAFA 1L2NA 2AYOB 3AH7A 4KZCA 2B76B 2MSED 2CR5A 4ASWC 1MG8A 4ZYSA 3PT2B 3WAPA 2KMMA 2KANA 1E7VA 1JWAD 2WDTB 3E9SA 5C3JB 2OHFA 2EKIA 3WA0A 1V97A 4IM0A 1TZ1A 1WXSA 1WGKA 2KHWB 4GLSC 4MELA 5FR6A 2X8XX 1NEKB 1WMHB 2K5PA 3ZTDA 1XCQL 4RM8A 3ZKJC 2C7NB 2M17A 2YEPB 3C8YA 4YT0B 1QOGA 3IBEA 2B3AA 4KSKC 3ZRCA 1Z5SB 2MHJA 5CTRC 3EFUA 4BKSD 4DDID 3TEYA 4WWNA 2BS3B 2J0JA 2D5GA 1T6BX 2MQJA 2IYDB 4YWGG 4YL8A 1YQ3B 4ITKA 3PZDA 3LYYA 3NS8A 1YOVB 4IWPA 1QOBA 1MPEA 3WAMA 2FIDA 5IAAC 4XC2A 3OG5A 1SJED 3TJPA 2W3SA 1GG3A 3ZLZA 5JHAA 1WYGA 1V8CA 4IUMB 3NRZA 2BYTA 5IP4D 2PEAA 2DZMA 4JQWC 3B0AA 1L6UA 3HUIA 1J0GA 3Q2AC 3Q8CA 3N1XC 4AOFA 1L6VA 3IHPC 1VZ8A 4HVBA 1C4CA 2M19A 2LFIA 4IM3A 4P7IA 1HQRD 4LJOB 4NJCA 1IYFA 5CHVC 2ZW0A 2CS4A 5LLIA 3VHTC 2D3GA 4NNJB 3JSVB 1C79A 4JGHB 1I35A 3L08A 1TTNA 1TS5A 5L95C 2NVUI 2KDBA 2BYVE 2IGHA 2N9PC 1TT5B 2DZJA 1KLUD 2VZKB 1MFWA 2L52A 4EFOA 2MJDA 2IO2B 1E9MA 1L7YA 4UDUC 3ZW3A 3AULA 3QQ8B 2O6VD 2RMMA 5AZHA 2Y5BB 2GB1A 1B1ZA 1IGDA 4LJPB 2GRIA 5T8IA 1DGJA 1SE3A 2KYWA 5FR3A 1AW7A 4LLGM 1WRIA 2G4SA 3I63C 1BMLC 3L0WB 2WU5B 3GP7A 3P2BA 3EA6A 3JSVA 1K8RB 3AEGB 1VCBA 2R61A 3SHQA 3KQ4A 4LK0M 2LGXA 1JRUA 1HXYD 2JRHA 4ZRPA 3ABVB 2DZKA 2G9HD 3NOBA 4A90A 3HVZA 3AE4B 4AQ7A 2ZPYA 5EE3A 3X0WA 5GMVA 3V61A 1WWTA 2IDYA 1VZ7A 4HRSA 1SE9A 1EUVB 3PLVA 1E0ZA 2LVQA 5AEKB 2QILA 1OQYA 2KMCA 3H6NA 1SEBD 2HJ1A 5DCNA 3T3NA 2DAJA 4LNIA 1ZW7A 4ZRQA 3Q3FA 2WDRB 2LGDA 1J7BA 2QEJC 2V0GA 1JW9D 3P63A 3I9V1 1KFYB 1EWYC 1N5XA 2DHZA 3ETRA 1E8WA 4PYUA 1C9FA 1RAXA 4M8MA 4HPPA 3KLSX 4YTPB 1WJNA 2WXKA 3H8HA 3QX1A 2WDQB 2KK8A 2ZCCA 1YMHE 2WXRA 2ZZPB 1V80A 2ICIA 3U52E 3HM3A 3A9KB 2ZJDA 3NY5A 3DPDA 1SGHA 2LMCA 2INNE 3N9YC 1E10A 3T8MA 2BT6A 1VR9A 4PS3A 4B0MA 3M95A 3GZNI 3RNGC 3H1UA 3U30A 1T0QC 1E8YA 3QWZB 3FKYA 4K1RB 3Q8EA 4BOZB 1QQRA 4P6VF 4OHJA 1X1MA 4RF0A 1ACCA 1PFDA 1A5RA 3AECB 2ZNVB 4MGYE 2XK5A 1TIFA 2LWPA 4ICUA 3RN9C 5J17A 3BWUD 2MBBB 2A4ZA 2JUOA 1V1PA 3W1YA 5IN7A 2MBOA 1H4RA 2Z59B 2PMVA 3PO0A 3OJ3A 2KJ6A 1UD7A 1FFVA 2KFKB 2LVOA 4QAYA 3EC8A 4LTUA 3PLUA 4XWWA 3A9KA 1ISNA 3B9JA 2KNBA 2NCNA 2K8CA 3NJTA 3C0RB 3L16A 3L4PA 1D4BA 2LJ5A 1F9JA 5G5HA 1LGRA 4C7YA 1WE6A 1LFDA 4AS1A 3DBHB 1L4ZB 4W9DA 4W9CA 1MJDA 3ZUNA 3LDZE 3R8BA 1JQ4A 2Y3AA 1T5XD 2DZIA 4DK5A 3M62B 3UGBB 1ROEA 2DYMA 3AE7B 1V1PB 2MH7A 1NYQA 4HKZE 2Z8LA 5LXIB 2MBHA 4OVZA 4I6PA 1D6EC 1ESFA 2WXPA 3MFGA 2YLMA 3EGRA 2N7DA 2MP2B 4RGNA 4DHZB 1NI3A 1XT9B 3VR8B 4FA6A 1HTQA 2J42A 4GDLA 4N9F4 4BAXA 1JMLA 2M56B 3IFWB 1AWDA 4E71A 1QOFA 1ZUD2 3RNAC 4D2KA 5JZEB 1U4AA 2WXMA 5DPWA 4EZKA 4MM3B 5D7GA 3IVFA 4DXFA 1UH6A 2XBBC 4B9KA 3MC0B 1VZ6A 2L0TA 1NI2A 2KTRA 4GU2A 3NVYA 4WH4A 4DWFA 5EE0A 1UWXA 3PHWB 2QMTA 1WXVA 4PS7A 3DVGY 1DOIA 2EMSA 5D3IB 1ET6A 3LXFA 1SE2A 3HRDD 3HVDA 3NZUA 3AE2B 3U8ZA 4CQNA 2DBYA 3A1QB 2TSSA 1P7FA 4OZBA 2D2QA 3ZRFA 1JWBD 2KX3A 3SR6A 2FCMA 3TEZA 2A5UA 1T0SC 3H9DA 1E5WA 3DVNU 1EWCA 3L17A 4ARCA 2NR2A 1WZ3A 3GZNB 3R66C 4NAWB 1GUAB 2WXJA 2J7QB 4LNOA 1J7AA 3DQVA 3VUXA 3QIJA 3SDLC 3V05A 1C78A 4MEMA 2D3CA 4FHKA 1E8ZA 2BGFA 1N60A 1SF0A 5DPRA 2LHDA 1D5MC 3P4PB 4OZCA 1G6JA 3A9JB 2UYZB 1WFYA 3CSTA 3I57A 1XLOA 2MRPA 2WU2B 1E90A 2KO3A 5BYSA 2DYOA 3NZ3A 4LDTB 4ZDVA 1WIAA 2PLPA 1V5OA 1K51A 4MH8A 2L0FA 2I1KA 2KFJA 3VRBB 3N3KB 5C1ZA 2W9NA 1MHHE 3M3JA 2K9XA 4W9KA 3AE3B 4NQLB 1RLFA 1PQSA 2BB5A 3T9LA 3A4RA 1V5TA 2BYFA 3HK0A 3MJ5A 3RI7C 4HPLB 2RR9A 1BXTA 2V4LA 5BMIA 3R3MA 2AX5A 3NVWA 2JZ3B 1WY8A 1Q0WB 3ML8A 2BBCA 4JIOU 1C4PA 3VTWA 2JVCA 2OJWA 3NHEB 3QA8A 4JPSA 3NZSA 4HDQA 5BMGA 2KDMA 2FCQA 1WM3A 2WGSA 3ECIA 4P1BC 2HTME 4H2AA 2N9KA 4IDIA 2KX0A 4NY0A 1GJZA 3PV1A 3L13A 4W9GA 4ACFA 2WS3B 3UQAA 1KOTA 2O2VB 3V6EB 3P4QB 2VZKD 3DWGC 3DHHC 4ANWA 3RMKC 2MCNB 1TBEA 1J8CA 4TSSA 3VVWB 2MEKA 2WXFA 3W1SC 1CK1A 2DENB 1HZ6A 3NG0A 5EDSA 4HDOA 2KJRA 1STEA 4W9IA 1ZDXA 1GC7A 2V4IB 4K3CA 2XNAC 2X38A 4MT5A 3JYUA 4RMAA 3KYCD 4L1BA 2L3ZA 3AU5A 2DWQA 3PSEB 1TY2A 3NVZA 4WJQA 1F2RC 2G3QB 1WH3A 3U7ZA 2K25A 1UELA 2QDFA 4N58A 1YQBA 2O2VA 3LJ3A 2MLBA 4DBGA 1VJKA 1S1QB 4NAMA 3IAS1 1K52A 2K6DB 1WJ4A 1QKZA 2DLBA 2KXJA 2KD0A 3JVZX 3ZJTA 1HTOA 1V86A 2NS5A 3IT6B 2KJHB 2KVRA 1FNVA 3RFZB 1WGYA 2BF8B 2KACA 4ICVA 2KLGA 3TL5A 1JWUD 2M1MA 2OJRA 3DWMA 1RYJA 3QJZA 2G45B 3PVLA 1FCCC 1SBBB 3GS2A 3RD2A 3KYDD 4RH6A 2OEDA 2BQQA 4C00A 2EKEC 4KV2A 2PVOD 1VDVA 2KQ7A 3WIMA 2HD5B 3BVZA 1LO5D 3DCGA 4M02A 1NBFC 3CIRB 3PGEA 4TMAB 2XN9C 4FJVB 2LXCA 4DQOC 3FAHA 1KLGD 2I38A 4GSWA 4IWOA 2QCZA 2MA9B 5C2TB 3JW0X 1ZE3D 1I7HA 1XXGA 1ENFA 1JALA 2MP2A 2Z0DB 1WGRA 4NJ7A 4IC7B 1WE7A 4GDLB 3P1MA 1D5ZC 1UZXB 2GBKA 2KQ4X 5BYRA 4TQ0A 4AJWA 1Q10A 4R3DA 2K8BA 3VTVA 1FXIA 3Q8BA 2AQ2B 4HPMB 4S17A 3UQBA 2ZNVC 2RD0A 2WXLA 3AE8B 3L54A 2WXHA 4HK2A 3B2FA 3AN1A 3MTNB 3TSSA 1UNSA 4KDIC 1WSPA 4HXDA 4C4VA 1WXMA 3GOEA 1RFKA 4B6WA 3U4EG 2NTSA 3Q3NC 1WYWB 5KHQA 3BZDB 1FRDA 3APDA 1Z2MA 3QHTA 1TGZB 2NBUA 1VRAB 1JROA 2PE6B 1CMXB 5D3DA 1NYRA 3DHIC 2RDHA 5H8YE 1IUEA 2JWUA 2V3SA 1GOZA 1E7PB 4F1SA 1CZPA 1YNTE 5DPTA 3AE6B 3TEXA 4RNAA 2C7HA 2NTTA 3O65B 2EMTA 2IY1B 1NDDA 2IO3B 1WXAA 5EE1A 3VTUA 2PPHA 2JZPA 2GI9A 1I4XA 3AB5A 4F7ZA 1I4GA 3PREA 3ML9A 3AEDB 3N1ZC 3W5VB 1V81A 2BPSA 2JXTA 2AEHA 3OAWA 4FN2A 2MBEA 2N1WA 3WAOA 3BYYB 5C23A 3ZJVA 4MACA 2QIEB 1AN8A 2WXOA 2Y5CA 4ZRKA 2CU1A 2LJIA 3KUCB 1MI0A 3KVFB 5HFYA 1PGXA 1K50A 2PE9A 1WRDB 4A55A 4YSXB 2E3TA 2NBVB 3GE3C 2W3RA 1BT0A 4E74A 4XDCA 2KN5A 2CU3A 4KIKB 2ON8A 4A9AA 2WXQA 4W9HA 2KQSA 1H8CA 3CF6E 1SXTA 4CHKA 3BIID 5CHWA 3B2GA 4XGAB 3RT3B 2C60A 2KC2A 4G50A 2BYEA 3N30A 2KMAA 1A70A 4EZLA 4ZHOA 1V49A 5JH5C 4II3B 4OVVA 1YQ4B 1IP9A 3Q3JA 4MSQB 3ZIMA 1DYQA 2IBIB 3RULA 2AL3A 2L7RA 2G4DB 2C7MB 4C56C 3ZTCA 4WQMA 1CQVA 2BWES 4MGKE 3T3OA 2LUMA 3OJ4B 2J0MA 1SE4A 3MP9A 4BOSC 1WX9A 2RPQA 4DHJB 4YSZB 5E6PA 4ARIA 1E7UA 5J2RA 2MJ3A 4NPNA 3RNCC 2AQ1B 3H7PA 4ZRJA 3VUWA 1N61A 3UF8A 3BVMA 5E6NA 4GDKB 4M00A 5H92C 3PRPB 2ZW1A 1C1YB 1NENB 1R4MB 5AUKA 4PK1A 1IBXB 3WALA 2GMIC 2PKOA 4RM9A 1P9DU 4BBNC 4IWQA 3KWVA 1UBQA 2WXIA 4K7UA 4XE0A 4I6LB 2VRRB 3IAM1 2PTLA 2K6QA 3RNFC 1TS2A 2JX5A 4PT5A 4WQOB 3VXWA 1TYGB 3TIXA 1QILA 1IBXA 1SSNA 1JCKB 1P0RA 2CJOA 3WANA 3VH3B 1QF6A 1T0RC 4RGTA 3U2SC 3NS1A 4NAWA 3ZNZB 4X57B 3PHXB 3PTFC 4BZAA 3MHZA 2DX5B 2KDIA 2J52A 2REXA 1OFFA 5KHOA 2JSVX 1GB4A 1PDXA 3AV8A 3ZDTA 1TY0A 2ZPNA 1B9RA 4AUQC 3PZ7A 4PS8A 5E6JA 5IA7A 4G11A 4G3XB 1WMHA 1UGMA 2KWVB 3ZYYX 3QARA 4OW0A 4ANUA 4LNKA 1E8XA 4N59A 1VD2A 3RCZA 5HKHA 3SFDB 2WYQA 1EO6A 1R4NB 2L76A 4W9FA 2FIFA 3OLMD 3W2DA 4DXAB 2GBMA 1FCLA 1TKEA 4JWSC 4EZJA 1DOXA 1KM7A 2KDFB 1IPGA 3CWIA 2DNFA 2MBQA 4JLCA 2KLCA 3AE1B 4YSYB 2UWQA 4DHZE 2N7JA 1QOAA 4K3BA 3W5UB 1MG4A 5J18A 1JRPA 4REZA 3V6CB 4F8CB 1PYWD 3U7DA 2KVZA 1WGHA 2GLSA 3AE5B 2MW5A
chains in the Genus database with same CATH topology
4LJPB 2LRUA 3JYUA 3I3TB 2GBRA 3DVGX 3KYCD 3M63B 4GGQA 4GMVA 4RMAA 1R4MI 2L3ZA 3AU5A 4AJYB 1V2YA 2G4SA 2KDEB 3PSEB 1AARA 3L0WB 4WJQA 3ZNID 2IO0B 2G3QB 1WH3A 3P2BA 2K25A 1UELA 3JSVA 3K9PB 1K8RB 1EF1A 2AWTA 1OEYA 1YQBA 3RZFA 2O2VA 1VCBA 3LJ3A 4FJYA 2PJHA 4JL9A 3SHQA 3X23A 2MLBA 4DBGA 2LGXA 1JRUA 1S1QB 2JRHA 2V1YA 2K6DB 1WJ4A 2DZKA 2KXJA 3JVZX 2KD0A 3NOBA 4CO7A 2LGYA 1V86A 2ZPYA 2NS5A 3X0WA 2YVCA 5GMVA 3V61A 2WX0A 3PRZA 2KJHB 2AL6A 2KVRA 4K81A 1SE9A 1WGYA 2BF8B 3DBSA 3V60A 1EUVB 3PLVA 4EUTA 2JXXA 2LVQA 1UBIA 5AEKB 1WR6E 4ICVA 1I42A 2KLGA 3TL5A 1OQYA 2M1MA 3KW5B 2KMCA 3H6NA 2OJRA 4DHJD 2RSUA 5DCNA 3SU8X 2DAJA 3QJZA 2NPTB 2G45B 3PVLA 1V6EA 1ZW7A 3RZWC 2DAFA 4G0NB 3Q3FA 3RD2A 3KYDD 3RYTA 2LGDA 3ZVVA 5D94A 1KLVA 2EKEC 4KV2A 2DHZA 2LI5A 2C9WB 2KQ7A 3WIMA 3ONSA 2RGFA 1E8WA 2HD5B 3DCGA 4PYUA 4EEWA 1RAXA 4M8MA 1NBFC 3PGEA 4GB9A 4FJVB 2LXCA 4MGIE 2NBWB 3HM6X 1LXDA 1WJNA 4BKTA 4GSWA 2FCSA 3QX1A 4ANVA 4IWOA 2MA9B 1WF9A 2GBNA 2MX2A 4WWOA 3JW0X 1GC6A 2L8JA 2MP2A 2Z0DB 2KK8A 2ZCCA 1WGRA 4NJ7A 2ZZPB 1V80A 2WWZA 4IC7B 4IM2A 4I6NB 3S2AA 3L10B 3HM3A 4J6IA 2M8SA 4HCNB 1WE7A 4GDLB 3A9KB 2ZJDA 1UZXB 2NPTA 3NY5A 3DPDA 2LXAA 2GBKA 2JWZA 3UINB 1SGHA 4TQ0A 1HE8A 4AJWA 3T8MA 2K8BA 3VTVA 2OOBB 1P1AA 2KFKA 4PS3A 2K1FA 2FAZA 3M95A 3GZNI 4HPMB 3H1UA 2D07B 3K9OB 3U30A 1E8YA 3QWZB 3UQBA 4K1RB 3ZNHB 4LDTD 4BOZB 2ZNVC 5CHFA 2RD0A 4HLEA 4A3PA 1X1MA 3L54A 4ANXA 4HK2A 4NQKE 3SD5A 4BKGA 1A5RA 3MTNB 2ZNVB 4KDIC 1YIWA 4DDGD 4MGYE 2XK5A 1V9JA 3MJWA 4HXDA 2LWPA 1WXMA 3GOEA 4ICUA 1KJTA 4B6WA 5J17A 1D3ZA 2FCNA 2L05A 3AXCA 2ZCBA 2MBBB 1WYWB 2A4ZA 2M0XA 1OTRB 4HCPB 2JUOA 3CSFA 5KHQA 3W1YA 3VFKA 3APDA 2MBOA 2N9EB 2R2OA 1EF5A 1H4RA 2ZEQA 4BBNF 2KZRA 2Z59B 1Z2MA 2D11A 3QHTA 5CX3A 1TGZB 3OJ3A 2NBUA 1RRBA 1WZ0A 2PE6B 4B95A 1CMXB 2CHWA 1UD7A 2KJ6A 2KFKB 2KWCA 2LVPA 2J0KA 2LVOA 4XZ4A 3QC8B 3EC8A 3PLUA 1OEYJ 1ISNA 3A9KA 3BY4B 2KNBA 2NCNA 2K8CA 2WX1A 1OGWA 4KDLB 3C0RB 5AZFA 3AI5A 2V3SA 3L16A 4FLHA 2LJ5A 4HJKA 4A20A 2IY0B 4GIVA 1F9JA 4OVUA 2KC1A 2CKHB 4F1SA 3TBLD 1WE6A 1LFDA 2DYBA 2N7EA 5DPTA 5LXHA 5TR5A 2QHOA 2C7HA 2KOXA 1YD8U 2C5LC 4WJOA 3PPAA 3O65B 2M4NA 4W9DA 2MWSB 2EMTA 2IY1B 1NDDA 2IO3B 1WXAA 2LASA 3VTUA 2CHZA 3B1LX 4BKSA 2PPHA 4W9CA 3VDZA 2LD9A 3ZUNA 3HHMA 4F7ZA 3LDZE 3PREA 3ML9A 1Q1OA 4ZYNA 1V81A 2BPSA 1J19A 4IW0A 2AEHA 4M8NA 3OAWA 4FN2A 2FNJB 2DZIA 4MGZE 4DK5A 3QK0A 3M62B 4IG7B 3UGBB 2MBEA 2N1WA 1M94A 1S3SG 2DYMA 2N9XA 5L83A 3WAOA 1WJ6A 5C23A 2Z0EB 5LXIB 2MBHA 2O6VB 1XQQA 4I6PA 2KTRB 4URKA 3A4SC 2CHXA 4AP4C 4ZRKA 2CU1A 3EHVA 3KUCB 2YLMA 2N7DA 2MP2B 4TUUA 3KVFB 4KSLC 3KUZA 4DHZB 1XT9B 3DDCB 3APFA 3QAQA 2ZVNA 4WJPA 3VQIA 3ZO5B 4FA6A 2KTFA 2PE9A 1WRDB 4GDLA 4HWIB 3H7SA 3VUYA 4N9F4 2NBVB 4LCDE 3A1QA 4KZ0A 4FADA 1BT0A 2I1JA 4E74A 3IFWB 2KN5A 1YJ1A 4E71A 1LM8B 4KIKB 3RUIB 3R7RA 1P3QU 4W9HA 1XD3B 4PYZA 5JHBA 2KQSA 1H8CA 1T0YA 3CF6E 1Q5WB 4TV3A 2JF5A 3IG3A 5JZEB 4CHKA 3TMPB 1LQBA 1U4AA 5DPWA 5CHWA 4EZKA 5G2NA 3D32A 5D7GA 3IVFA 3RT3B 3W1SA 1WJUA 2C60A 2HTHA 2KC2A 4GOCA 1UH6A 2XBBC 2O6VA 4B9KA 3BINA 4G50A 2BYEA 3H7PB 3N30A 2L0TA 2KMAA 4CYEA 1NI2A 2KTRA 4GU2A 4EZLA 1ZGUB 2XK5B 1V49A 5JH5C 3ALBA 2N1VA 4WAAA 4FBJB 4ZRIA 4II3B 4OVVA 4E3CA 2IO1B 3KH0A 1IP9A 4M0WB 4DWFA 3Q3JA 3PHWB 4MSQB 4GDKA 1WGGA 3DOWA 3ZIMA 2IBIB 3RULA 2AL3A 2ZVOA 1WXVA 2L7RA 2G4DB 2C7MB 4II2B 4PS7A 3ZTCA 3PS6A 3DVGY 3VH4B 2GOWA 2D10A 2EMSA 2BWES 4MGKE 1YX5B 2KWUB 3AU4A 3OJ4B 5E6OA 2N4FA 2J0MA 3UIPB 2LUEA 3ZDMC 1WX9A 4BOSC 2RPQA 1C3TA 3NZUA 3U8ZA 4DHJB 3A1QB 5E6PA 3KUDB 1E7UA 4MM3A 3PRMB 4MJSA 2D2QA 5J2RA 1Y8RC 4KIKA 4NPNA 3H7PA 3V62A 3ZRFA 4ZRJA 3VUWA 2FUHB 3UF8A 2IZVB 2KX3A 1RFAA 4W9LA 4K7WA 2ASQA 2BKFA 2FCMA 1L2NA 2AYOB 4KZCA 2GBJA 2A5UA 2MSED 2CR5A 5E6NA 4ASWC 4GDKB 1MG8A 3H9DA 3PT2B 1E5WA 3DVNU 3WAPA 3L17A 2NR2A 2KANA 1E7VA 1WZ3A 3R66C 3PRPB 4NAWB 1C1YB 1GUAB 1P98A 2WDTB 1WR1A 2J7QB 4MJSB 3DQVA 3VUXA 3QIJA 1WI0A 3WALA 2GMIC 1SIFA 3R7QA 4NJ6A 4FJZA 3SDLC 4IM0A 4RM9A 3WA0A 1TZ1A 2XEWA 1WXSA 1P9DU 2KHWB 3MHSD 4IWQA 4MEMA 4WJNA 4BBNC 4FHKA 4MELA 1E8ZA 1UBQA 4K7UA 5FR6A 4I6LB 2VRRB 2BGFA 1WMHB 3ZTDA 4RM8A 3ZKJC 2C7NB 5D6JB 5DPRA 2M17A 2K6QA 3B08A 4TKNA 2JZZA 4AWJA 1G6JA 3A9JB 2HJ8A 2UYZB 3IBEA 2JRIB 2B3AA 4KSKC 1WFYA 1Z5SB 3CSTA 1R4NI 3EFUA 4WQOB 5CTRC 3VXWA 3ZRCA 4DDID 3HIZA 4WWNA 2MRPA 3TIXA 2BKRB 2J0JA 1E90A 2KO3A 2MQJA 2DYOA 1P0RA 1WM2A 4LDTB 2IYDB 3WANA 3VH3B 4ZDVA 1WGDA 1WIAA 4YL8A 4BFRA 1V5OA 4FHJA 2JPHA 4FULA 3PZDA 3NS8A 4GN1A 2L0FA 2I1KA 4NAWA 4IWPA 5D2MB 2KFJA 4BVUC 3ZNZB 3N3KB 4X57B 5C1ZA 2W9NA 3PHXB 3CMMB 3PTFC 3WAMA 2FIDA 5IAAC 3M3JA 4XC2A 2DX5B 2KDIA 4W9KA 3QCAA 2REXA 1RLFA 4NQLB 1PQSA 3TJPA 5KHOA 3T9LA 1GG3A 3A4RA 3ZLZA 5JHAA 2BWFA 3DBLI 4IUMB 1V5TA 2BYFA 2LZ6A 3HK0A 3ZDTA 4HPLB 3DBRI 4A3OA 2RR9A 2PEAA 2V4LA 2DZMA 2ZPNA 3R3MA 4JQWC 3EECA 4MSMB 4AUQC 3B0AA 2JZ3B 5BO4B 3VAWA 4PS8A 5DPSA 1WY8A 1Q0WB 3ML8A 4W9JA 2R2QA 5IA7A 2JY6A 4G11A 4JIOU 4G3XB 1J0GA 1WMHA 3VTWA 1UGMA 1FXTB 4EKUA 2JVCA 4GXBA 4AOFA 2KWVB 3QARA 3NHEB 3QA8A 2LRWA 2K39A 3A33B 3NZSA 3IHPC 4HDQA 4ANUA 3A9JA 4WWPA 2FCQA 1E8XA 1WM3A 4HVBA 3ECIA 1WX8A 4IM3A 4P7IA 4LJOB 1VD2A 2KX0A 4NY0A 3DVNV 3APCA 3RCZA 1IYFA 5CHVC 1GJZA 2CS4A 5LLIA 3PV1A 2K8HA 2WYQA 3VHTC 3L13A 2D3GA 4W9GA 1EO6A 4NNJB 3JSVB 4JGHB 1I35A 2L76A 4W9FA 2FIFA 3UIOB 3ENEA 3OLMD 3L08A 4DXAB 3UQAA 1KOTA 2GBMA 2O2VB 3V6EB 2HE7A 4EZJA 1TTNA 1KM7A 2JT4B 2KDFB 1WX7A 5L95C 4W9EA 1IPGA 3ZNGC 2NVUI 2KDBA 3N32A 2BYVE 4XX5A 4K7SA 2MBQA 3DBHI 4BKSD 4ANWA 4EOYA 4JLCA 2MCNB 1TBEA 2N9PC 4MH0E 2DZJA 2KLCA 1J8CA 2UWQA 4DHZE 2KKCA 5AZGA 1YX6B 4EFOA 4KVGB 4TQ1A 3VVWB 5J18A 2IO2B 1L7YA 1ZKHA 2L00B 3W1SC 2DENB 3V6CB 1QZEA 4F8CB 3ZW3A 3AULA 3QQ8B 4HDOA 5EDSA 2KJRA 3U7DA 2O6VD 4W9IA 1GC7A 5HKHA 5AZHA 1WGHA 2Y5BB 1GNUA 2MW5A 3TCAA 5G55A 4MDKE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LJP B;  2LRU A;  3JYU A;  3I3T B;  2GBR A;  3DVG X;  3KYC D;  3M63 B;  4GGQ A;  4GMV A;  4RMA A;  1R4M I;  2L3Z A;  3AU5 A;  4AJY B;  1V2Y A;  2G4S A;  2KDE B;  3PSE B;  1AAR A;  3L0W B;  4WJQ A;  3ZNI D;  2IO0 B;  2G3Q B;  1WH3 A;  3P2B A;  2K25 A;  1UEL A;  3JSV A;  3K9P B;  1K8R B;  1EF1 A;  2AWT A;  1OEY A;  1YQB A;  3RZF A;  2O2V A;  1VCB A;  3LJ3 A;  4FJY A;  2PJH A;  4JL9 A;  3SHQ A;  3X23 A;  2MLB A;  4DBG A;  2LGX A;  1JRU A;  1S1Q B;  2JRH A;  2V1Y A;  2K6D B;  1WJ4 A;  2DZK A;  2KXJ A;  3JVZ X;  2KD0 A;  3NOB A;  4CO7 A;  2LGY A;  1V86 A;  2ZPY A;  2NS5 A;  3X0W A;  2YVC A;  5GMV A;  3V61 A;  2WX0 A;  3PRZ A;  2KJH B;  2AL6 A;  2KVR A;  4K81 A;  1SE9 A;  1WGY A;  2BF8 B;  3DBS A;  3V60 A;  1EUV B;  3PLV A;  4EUT A;  2JXX A;  2LVQ A;  1UBI A;  5AEK B;  1WR6 E;  4ICV A;  1I42 A;  2KLG A;  3TL5 A;  1OQY A;  2M1M A;  3KW5 B;  2KMC A;  3H6N A;  2OJR A;  4DHJ D;  2RSU A;  5DCN A;  3SU8 X;  2DAJ A;  3QJZ A;  2NPT B;  2G45 B;  3PVL A;  1V6E A;  1ZW7 A;  3RZW C;  2DAF A;  4G0N B;  3Q3F A;  3RD2 A;  3KYD D;  3RYT A;  2LGD A;  3ZVV A;  5D94 A;  1KLV A;  2EKE C;  4KV2 A;  2DHZ A;  2LI5 A;  2C9W B;  2KQ7 A;  3WIM A;  3ONS A;  2RGF A;  1E8W A;  2HD5 B;  3DCG A;  4PYU A;  4EEW A;  1RAX A;  4M8M A;  1NBF C;  3PGE A;  4GB9 A;  4FJV B;  2LXC A;  4MGI E;  2NBW B;  3HM6 X;  1LXD A;  1WJN A;  4BKT A;  4GSW A;  2FCS A;  3QX1 A;  4ANV A;  4IWO A;  2MA9 B;  1WF9 A;  2GBN A;  2MX2 A;  4WWO A;  3JW0 X;  1GC6 A;  2L8J A;  2MP2 A;  2Z0D B;  2KK8 A;  2ZCC A;  1WGR A;  4NJ7 A;  2ZZP B;  1V80 A;  2WWZ A;  4IC7 B;  4IM2 A;  4I6N B;  3S2A A;  3L10 B;  3HM3 A;  4J6I A;  2M8S A;  4HCN B;  1WE7 A;  4GDL B;  3A9K B;  2ZJD A;  1UZX B;  2NPT A;  3NY5 A;  3DPD A;  2LXA A;  2GBK A;  2JWZ A;  3UIN B;  1SGH A;  4TQ0 A;  1HE8 A;  4AJW A;  3T8M A;  2K8B A;  3VTV A;  2OOB B;  1P1A A;  2KFK A;  4PS3 A;  2K1F A;  2FAZ A;  3M95 A;  3GZN I;  4HPM B;  3H1U A;  2D07 B;  3K9O B;  3U30 A;  1E8Y A;  3QWZ B;  3UQB A;  4K1R B;  3ZNH B;  4LDT D;  4BOZ B;  2ZNV C;  5CHF A;  2RD0 A;  4HLE A;  4A3P A;  1X1M A;  3L54 A;  4ANX A;  4HK2 A;  4NQK E;  3SD5 A;  4BKG A;  1A5R A;  3MTN B;  2ZNV B;  4KDI C;  1YIW A;  4DDG D;  4MGY E;  2XK5 A;  1V9J A;  3MJW A;  4HXD A;  2LWP A;  1WXM A;  3GOE A;  4ICU A;  1KJT A;  4B6W A;  5J17 A;  1D3Z A;  2FCN A;  2L05 A;  3AXC A;  2ZCB A;  2MBB B;  1WYW B;  2A4Z A;  2M0X A;  1OTR B;  4HCP B;  2JUO A;  3CSF A;  5KHQ A;  3W1Y A;  3VFK A;  3APD A;  2MBO A;  2N9E B;  2R2O A;  1EF5 A;  1H4R A;  2ZEQ A;  4BBN F;  2KZR A;  2Z59 B;  1Z2M A;  2D11 A;  3QHT A;  5CX3 A;  1TGZ B;  3OJ3 A;  2NBU A;  1RRB A;  1WZ0 A;  2PE6 B;  4B95 A;  1CMX B;  2CHW A;  1UD7 A;  2KJ6 A;  2KFK B;  2KWC A;  2LVP A;  2J0K A;  2LVO A;  4XZ4 A;  3QC8 B;  3EC8 A;  3PLU A;  1OEY J;  1ISN A;  3A9K A;  3BY4 B;  2KNB A;  2NCN A;  2K8C A;  2WX1 A;  1OGW A;  4KDL B;  3C0R B;  5AZF A;  3AI5 A;  2V3S A;  3L16 A;  4FLH A;  2LJ5 A;  4HJK A;  4A20 A;  2IY0 B;  4GIV A;  1F9J A;  4OVU A;  2KC1 A;  2CKH B;  4F1S A;  3TBL D;  1WE6 A;  1LFD A;  2DYB A;  2N7E A;  5DPT A;  5LXH A;  5TR5 A;  2QHO A;  2C7H A;  2KOX A;  1YD8 U;  2C5L C;  4WJO A;  3PPA A;  3O65 B;  2M4N A;  4W9D A;  2MWS B;  2EMT A;  2IY1 B;  1NDD A;  2IO3 B;  1WXA A;  2LAS A;  3VTU A;  2CHZ A;  3B1L X;  4BKS A;  2PPH A;  4W9C A;  3VDZ A;  2LD9 A;  3ZUN A;  3HHM A;  4F7Z A;  3LDZ E;  3PRE A;  3ML9 A;  1Q1O A;  4ZYN A;  1V81 A;  2BPS A;  1J19 A;  4IW0 A;  2AEH A;  4M8N A;  3OAW A;  4FN2 A;  2FNJ B;  2DZI A;  4MGZ E;  4DK5 A;  3QK0 A;  3M62 B;  4IG7 B;  3UGB B;  2MBE A;  2N1W A;  1M94 A;  1S3S G;  2DYM A;  2N9X A;  5L83 A;  3WAO A;  1WJ6 A;  5C23 A;  2Z0E B;  5LXI B;  2MBH A;  2O6V B;  1XQQ A;  4I6P A;  2KTR B;  4URK A;  3A4S C;  2CHX A;  4AP4 C;  4ZRK A;  2CU1 A;  3EHV A;  3KUC B;  2YLM A;  2N7D A;  2MP2 B;  4TUU A;  3KVF B;  4KSL C;  3KUZ A;  4DHZ B;  1XT9 B;  3DDC B;  3APF A;  3QAQ A;  2ZVN A;  4WJP A;  3VQI A;  3ZO5 B;  4FA6 A;  2KTF A;  2PE9 A;  1WRD B;  4GDL A;  4HWI B;  3H7S A;  3VUY A;  4N9F 4;  2NBV B;  4LCD E;  3A1Q A;  4KZ0 A;  4FAD A;  1BT0 A;  2I1J A;  4E74 A;  3IFW B;  2KN5 A;  1YJ1 A;  4E71 A;  1LM8 B;  4KIK B;  3RUI B;  3R7R A;  1P3Q U;  4W9H A;  1XD3 B;  4PYZ A;  5JHB A;  2KQS A;  1H8C A;  1T0Y A;  3CF6 E;  1Q5W B;  4TV3 A;  2JF5 A;  3IG3 A;  5JZE B;  4CHK A;  3TMP B;  1LQB A;  1U4A A;  5DPW A;  5CHW A;  4EZK A;  5G2N A;  3D32 A;  5D7G A;  3IVF A;  3RT3 B;  3W1S A;  1WJU A;  2C60 A;  2HTH A;  2KC2 A;  4GOC A;  1UH6 A;  2XBB C;  2O6V A;  4B9K A;  3BIN A;  4G50 A;  2BYE A;  3H7P B;  3N30 A;  2L0T A;  2KMA A;  4CYE A;  1NI2 A;  2KTR A;  4GU2 A;  4EZL A;  1ZGU B;  2XK5 B;  1V49 A;  5JH5 C;  3ALB A;  2N1V A;  4WAA A;  4FBJ B;  4ZRI A;  4II3 B;  4OVV A;  4E3C A;  2IO1 B;  3KH0 A;  1IP9 A;  4M0W B;  4DWF A;  3Q3J A;  3PHW B;  4MSQ B;  4GDK A;  1WGG A;  3DOW A;  3ZIM A;  2IBI B;  3RUL A;  2AL3 A;  2ZVO A;  1WXV A;  2L7R A;  2G4D B;  2C7M B;  4II2 B;  4PS7 A;  3ZTC A;  3PS6 A;  3DVG Y;  3VH4 B;  2GOW A;  2D10 A;  2EMS A;  2BWE S;  4MGK E;  1YX5 B;  2KWU B;  3AU4 A;  3OJ4 B;  5E6O A;  2N4F A;  2J0M A;  3UIP B;  2LUE A;  3ZDM C;  1WX9 A;  4BOS C;  2RPQ A;  1C3T A;  3NZU A;  3U8Z A;  4DHJ B;  3A1Q B;  5E6P A;  3KUD B;  1E7U A;  4MM3 A;  3PRM B;  4MJS A;  2D2Q A;  5J2R A;  1Y8R C;  4KIK A;  4NPN A;  3H7P A;  3V62 A;  3ZRF A;  4ZRJ A;  3VUW A;  2FUH B;  3UF8 A;  2IZV B;  2KX3 A;  1RFA A;  4W9L A;  4K7W A;  2ASQ A;  2BKF A;  2FCM A;  1L2N A;  2AYO B;  4KZC A;  2GBJ A;  2A5U A;  2MSE D;  2CR5 A;  5E6N A;  4ASW C;  4GDK B;  1MG8 A;  3H9D A;  3PT2 B;  1E5W A;  3DVN U;  3WAP A;  3L17 A;  2NR2 A;  2KAN A;  1E7V A;  1WZ3 A;  3R66 C;  3PRP B;  4NAW B;  1C1Y B;  1GUA B;  1P98 A;  2WDT B;  1WR1 A;  2J7Q B;  4MJS B;  3DQV A;  3VUX A;  3QIJ A;  1WI0 A;  3WAL A;  2GMI C;  1SIF A;  3R7Q A;  4NJ6 A;  4FJZ A;  3SDL C;  4IM0 A;  4RM9 A;  3WA0 A;  1TZ1 A;  2XEW A;  1WXS A;  1P9D U;  2KHW B;  3MHS D;  4IWQ A;  4MEM A;  4WJN A;  4BBN C;  4FHK A;  4MEL A;  1E8Z A;  1UBQ A;  4K7U A;  5FR6 A;  4I6L B;  2VRR B;  2BGF A;  1WMH B;  3ZTD A;  4RM8 A;  3ZKJ C;  2C7N B;  5D6J B;  5DPR A;  2M17 A;  2K6Q A;  3B08 A;  4TKN A;  2JZZ A;  4AWJ A;  1G6J A;  3A9J B;  2HJ8 A;  2UYZ B;  3IBE A;  2JRI B;  2B3A A;  4KSK C;  1WFY A;  1Z5S B;  3CST A;  1R4N I;  3EFU A;  4WQO B;  5CTR C;  3VXW A;  3ZRC A;  4DDI D;  3HIZ A;  4WWN A;  2MRP A;  3TIX A;  2BKR B;  2J0J A;  1E90 A;  2KO3 A;  2MQJ A;  2DYO A;  1P0R A;  1WM2 A;  4LDT B;  2IYD B;  3WAN A;  3VH3 B;  4ZDV A;  1WGD A;  1WIA A;  4YL8 A;  4BFR A;  1V5O A;  4FHJ A;  2JPH A;  4FUL A;  3PZD A;  3NS8 A;  4GN1 A;  2L0F A;  2I1K A;  4NAW A;  4IWP A;  5D2M B;  2KFJ A;  4BVU C;  3ZNZ B;  3N3K B;  4X57 B;  5C1Z A;  2W9N A;  3PHX B;  3CMM B;  3PTF C;  3WAM A;  2FID A;  5IAA C;  3M3J A;  4XC2 A;  2DX5 B;  2KDI A;  4W9K A;  3QCA A;  2REX A;  1RLF A;  4NQL B;  1PQS A;  3TJP A;  5KHO A;  3T9L A;  1GG3 A;  3A4R A;  3ZLZ A;  5JHA A;  2BWF A;  3DBL I;  4IUM B;  1V5T A;  2BYF A;  2LZ6 A;  3HK0 A;  3ZDT A;  4HPL B;  3DBR I;  4A3O A;  2RR9 A;  2PEA A;  2V4L A;  2DZM A;  2ZPN A;  3R3M A;  4JQW C;  3EEC A;  4MSM B;  4AUQ C;  3B0A A;  2JZ3 B;  5BO4 B;  3VAW A;  4PS8 A;  5DPS A;  1WY8 A;  1Q0W B;  3ML8 A;  4W9J A;  2R2Q A;  5IA7 A;  2JY6 A;  4G11 A;  4JIO U;  4G3X B;  1J0G A;  1WMH A;  3VTW A;  1UGM A;  1FXT B;  4EKU A;  2JVC A;  4GXB A;  4AOF A;  2KWV B;  3QAR A;  3NHE B;  3QA8 A;  2LRW A;  2K39 A;  3A33 B;  3NZS A;  3IHP C;  4HDQ A;  4ANU A;  3A9J A;  4WWP A;  2FCQ A;  1E8X A;  1WM3 A;  4HVB A;  3ECI A;  1WX8 A;  4IM3 A;  4P7I A;  4LJO B;  1VD2 A;  2KX0 A;  4NY0 A;  3DVN V;  3APC A;  3RCZ A;  1IYF A;  5CHV C;  1GJZ A;  2CS4 A;  5LLI A;  3PV1 A;  2K8H A;  2WYQ A;  3VHT C;  3L13 A;  2D3G A;  4W9G A;  1EO6 A;  4NNJ B;  3JSV B;  4JGH B;  1I35 A;  2L76 A;  4W9F A;  2FIF A;  3UIO B;  3ENE A;  3OLM D;  3L08 A;  4DXA B;  3UQA A;  1KOT A;  2GBM A;  2O2V B;  3V6E B;  2HE7 A;  4EZJ A;  1TTN A;  1KM7 A;  2JT4 B;  2KDF B;  1WX7 A;  5L95 C;  4W9E A;  1IPG A;  3ZNG C;  2NVU I;  2KDB A;  3N32 A;  2BYV E;  4XX5 A;  4K7S A;  2MBQ A;  3DBH I;  4BKS D;  4ANW A;  4EOY A;  4JLC A;  2MCN B;  1TBE A;  2N9P C;  4MH0 E;  2DZJ A;  2KLC A;  1J8C A;  2UWQ A;  4DHZ E;  2KKC A;  5AZG A;  1YX6 B;  4EFO A;  4KVG B;  4TQ1 A;  3VVW B;  5J18 A;  2IO2 B;  1L7Y A;  1ZKH A;  2L00 B;  3W1S C;  2DEN B;  3V6C B;  1QZE A;  4F8C B;  3ZW3 A;  3AUL A;  3QQ8 B;  4HDO A;  5EDS A;  2KJR A;  3U7D A;  2O6V D;  4W9I A;  1GC7 A;  5HKH A;  5AZH A;  1WGH A;  2Y5B B;  1GNU A;  2MW5 A;  3TCA A;  5G55 A;  4MDK E; 
#chains in the Genus database with same CATH topology
 2BTE A;  3DVG X;  1D5X C;  1R4M I;  4JWU C;  1AAR A;  3ZNI D;  5HG2 A;  3K9P B;  3EFC A;  5LNK 1;  1EF1 A;  3WCQ A;  1F1H A;  2PJH A;  1UWM A;  3PZ8 A;  3RNB C;  3NVV A;  2LGY A;  2J53 A;  1FXA A;  4XDD A;  2YVC A;  4L2Y A;  2AL6 A;  4K81 A;  3DBS A;  2JXX A;  3RPF C;  1UBI A;  1FM0 D;  1WR6 E;  1I42 A;  2LGS A;  2IJ0 A;  1ZP0 B;  3N20 C;  1C4A A;  2RSU A;  2K0P A;  1FNW A;  1V6E A;  2FUG 1;  3AMZ A;  3RZW C;  2DAF A;  4G0N B;  4P1C C;  3DHG C;  3ZVV A;  4US8 A;  1L0V B;  2BB6 A;  2LI5 A;  1FEH A;  2RGF A;  4XYC A;  3URY A;  5IO9 A;  4RFB A;  1K53 A;  4MGI E;  2NBW B;  4BKT A;  5HI1 A;  2MX2 A;  1WF9 A;  2GBN A;  4C4V B;  2L8J A;  1JWM D;  3AEF B;  2WWZ A;  1I4R A;  4IM2 A;  3ZGZ A;  2L83 A;  3AM9 A;  4J6I A;  2M8S A;  2NPT A;  3P4R B;  5EE9 A;  2JWZ A;  4P16 A;  2KN4 A;  1TJE A;  2IND C;  2D07 B;  3K9O B;  2J4X A;  4LDT D;  1PGA A;  4KX6 B;  5CHF A;  2WXG A;  3FIL A;  4BKG A;  3I5J C;  2YEP F;  4DDG D;  3MJW A;  1V9J A;  2AQ3 B;  1KJT A;  3BK1 A;  1D3Z A;  2FCN A;  2L05 A;  3AXC A;  4HCP B;  2M0X A;  2QC8 A;  3CSF A;  2N9L A;  3OWE B;  1TS3 A;  3VFK A;  2R2O A;  1EF5 A;  2KZR A;  1ZPS A;  2D11 A;  4RGM A;  4JX1 C;  5CX3 A;  4N6E B;  3FIL B;  2BW2 A;  1J7C A;  5BYQ A;  1WZ0 A;  3E56 A;  2CHW A;  2KWC A;  2LVP A;  2J0K A;  3QC8 B;  3BY4 B;  3W9C B;  4LNF A;  5AZF A;  4FLH A;  2IY0 B;  4GIV A;  4OVU A;  2KC1 A;  5FKA C;  2DYB A;  2N7E A;  5LXH A;  5TR5 A;  3FC4 A;  3Q3O C;  2IGD A;  3AE9 B;  1SJH D;  2H88 B;  2QHO A;  1YD8 U;  2WNM A;  4WJO A;  1V1O A;  2MWS B;  2LAS A;  3AEE B;  3TUO A;  3B1L X;  3SEB A;  1BUI C;  3VDZ A;  1FMA D;  4IOI E;  1J19 A;  4M8N A;  2FNJ B;  4MGZ E;  3QK0 A;  2W55 A;  2G1E A;  1S3S G;  5L83 A;  2JYT A;  2WXN A;  2Z0E B;  1P7E A;  4A6Q A;  2LHE A;  1FFU A;  1I4H A;  3A4S C;  2CHX A;  4AP4 C;  1T3Q A;  1MHX A;  2LEK A;  4TUU A;  3BYT B;  2PIA A;  4KSL C;  3Q8A A;  2WP9 B;  3DDC B;  2ZVN A;  3VQI A;  3ZO5 B;  3VRA B;  2KAJ A;  2W82 A;  4NZL B;  4HWI B;  3H7S A;  3VUY A;  2V3N A;  4LCD E;  4KZ0 A;  1FRR A;  3A1Q A;  4ZOH C;  1YJ1 A;  1LM8 B;  2INC C;  3R7R A;  4M0W A;  5JHB A;  1T0Y A;  4Q2J A;  2JF5 A;  3TMP B;  1LQB A;  3D32 A;  1WJU A;  2M0A A;  2HTH A;  2O6V A;  3H7P B;  4CYE A;  1ZGU B;  1RM6 C;  2IO1 B;  3KH0 A;  4M0W B;  3BVG A;  4GDK A;  1WGG A;  3DOW A;  2ZVO A;  3GB1 A;  2RDB C;  2SAK A;  1HA5 A;  4II2 B;  2ONQ A;  5GXG B;  1EU4 A;  1JWS D;  3PS6 A;  4USA A;  4C7Z A;  1DOY A;  1GPX A;  3P4S B;  1NVI D;  3AEB B;  2EEL A;  2LUE A;  1C3T A;  1HEZ E;  3KUD B;  1FPY A;  5TSS A;  4MJS A;  1XO3 A;  1R7S A;  2FUH B;  2IZV B;  1RFA A;  4K7W A;  2BKF A;  2GBJ A;  4YXD B;  1L4D B;  3DBR B;  1VLB A;  5I4D A;  2NMQ A;  1P98 A;  1WR1 A;  4MJS B;  1WI0 A;  1FIQ A;  1SIF A;  3R7Q A;  3R2T A;  4FJZ A;  4NJ6 A;  5G5G A;  2XEW A;  3MHS D;  4WJN A;  4WUR A;  5D6J B;  1PGB A;  2E6X A;  3B08 A;  4TKN A;  2JZZ A;  4AWJ A;  2HJ8 A;  2JRI B;  1ZXI A;  2WQY B;  1R4N I;  2Q5W D;  3HIZ A;  3ZXV A;  2BKR B;  4KGS A;  1WM2 A;  2QJL A;  3P42 A;  5AUI A;  1GB1 A;  1WGD A;  3C19 A;  2BS2 B;  4BFR A;  4FHJ A;  2JPH A;  4FUL A;  4GN1 A;  5D2M B;  3KWL A;  4BVU C;  3CMM B;  3Q14 C;  4LNN A;  3QCA A;  3J9C A;  2BS4 B;  2BWF A;  2FBW B;  3DBL I;  2LZ6 A;  5JXV A;  3DBR I;  4A3O A;  3EEC A;  4MSM B;  5BO4 B;  3V3X A;  3VAW A;  5DPS A;  4W9J A;  2R2Q A;  2JY6 A;  1XLP A;  2LGI A;  1FXT B;  1XLQ A;  4GXB A;  2WDV B;  1OQR A;  4EKU A;  4RCO A;  2LRW A;  2WLB A;  2K39 A;  3A33 B;  4M01 A;  3A9J A;  4WWP A;  1TKG A;  2KT7 A;  1C77 A;  1WX8 A;  2VH1 A;  1QT9 A;  3DVN V;  3APC A;  2K8H A;  2QSD A;  3UIO B;  2INP E;  3ENE A;  4ZHP A;  4O1N A;  2HE7 A;  4OZA A;  2JT4 B;  1WX7 A;  4W9E A;  1UF0 A;  3ZNG C;  1KRH A;  2SEB D;  3N32 A;  3VR9 B;  4XX5 A;  4K7S A;  3DBH I;  4EOY A;  4MH0 E;  2VH2 A;  2KKC A;  2ACZ B;  1I4P A;  5AZG A;  4HJG E;  1YX6 B;  4KVG B;  4TQ1 A;  1GAQ B;  2L00 B;  1ZKH A;  2W54 A;  1QZE A;  5IOI A;  2WHI A;  2IGG A;  1GNU A;  3TCA A;  4HKQ A;  5G55 A;  4MDK E;  2LRU A;  3I3T B;  2GBR A;  3M63 B;  4GGQ A;  4GMV A;  1IGC A;  2CJN A;  3NUH B;  4AJY B;  1V2Y A;  2KDE B;  1UGJ A;  2IO0 B;  2L1A A;  2AWT A;  1OEY A;  3RZF A;  4FJY A;  1FO4 A;  4JL9 A;  3X23 A;  2V1Y A;  4CO7 A;  1ZXH A;  1CJE A;  2D3B A;  1L0Y B;  2WX0 A;  3PRZ A;  2PVG C;  1KTK A;  3V60 A;  4EUT A;  1F2R I;  3SFE B;  3N1Y C;  1YN3 A;  1Y56 A;  3KW5 B;  4DHJ D;  3UI3 A;  5IKC M;  1TS4 A;  3SU8 X;  1WXQ A;  2NPT B;  3ZJU A;  3RYT A;  4RGO S;  1YJI A;  4IKG A;  5D94 A;  1N62 A;  1KLV A;  4C80 A;  2C9W B;  2RPV A;  3ONS A;  2V9H A;  4EEW A;  4GB9 A;  1F0Z A;  3R2I A;  1MVK A;  3HM6 X;  1LXD A;  1C76 A;  2BVC A;  2FCS A;  4ANV A;  1ET9 A;  4WWO A;  1GC6 A;  4B0E A;  2N0S B;  1YN4 A;  1FD6 A;  4I6N B;  3S2A A;  3L10 B;  4HCN B;  2LXA A;  3UIN B;  4A8X C;  3ZXR A;  1HE8 A;  1ZDV A;  1TZO A;  3Q69 A;  2JQR B;  4JE3 B;  3GE8 C;  2OOB B;  4KGR A;  1P1A A;  2KFK A;  2K1F A;  2FAZ A;  3ZNH B;  2I2Y A;  3TEW A;  4HLE A;  2D3A A;  4A3P A;  1E6E B;  3EUB 2;  4RF1 A;  4L23 A;  4ANX A;  4NQK E;  3SD5 A;  4FXC A;  4KKI A;  1YIW A;  4J3O D;  3IT4 B;  1L0X B;  1XCT L;  3RNE C;  3ZQ4 A;  1SB3 C;  2ZCB A;  1OTR B;  2RDG A;  1I4Q A;  2L32 A;  2N9E B;  2ZEQ A;  4BBN F;  1SIJ A;  1RRB A;  4B95 A;  2Y5P A;  4XZ4 A;  1YJJ A;  1L5P A;  1OEY J;  2FE8 A;  2JYE A;  4KDL B;  2WX1 A;  1OGW A;  5FK9 C;  3AI5 A;  4WWM A;  1FNU A;  4HJK A;  4A20 A;  2CKH B;  3TBL D;  2JU6 X;  2KOX A;  2C5L C;  3PPA A;  4WIP A;  2M4N A;  1F52 A;  4YTN B;  2CHZ A;  4BKS A;  1N6Z A;  2LD9 A;  3HHM A;  4KKJ A;  1Q1O A;  3MC9 A;  4ZYN A;  3IXS A;  1QLB B;  1OQQ A;  4IW0 A;  1HZ5 A;  4IG7 B;  2UU7 A;  1M94 A;  2N9X A;  1WJ6 A;  2H89 B;  1M4V A;  2IPK D;  2O6V B;  1YN5 A;  1XQQ A;  2KTR B;  4URK A;  3EHV A;  1TKY A;  3KUZ A;  1XF5 L;  3QAQ A;  3APF A;  4WJP A;  2KTF A;  4US9 A;  1AYF A;  4FAD A;  1PUT A;  1XEE A;  3Q3M C;  2I1J A;  3DBL B;  3AEA B;  4S0R A;  3RUI B;  4HEA 1;  1P3Q U;  1XD3 B;  4PYZ A;  1KH0 A;  1Q5W B;  4TV3 A;  3IG3 A;  3Q6B A;  5HHD G;  1N63 A;  3LB8 C;  1N5W A;  5G2N A;  1RWS A;  4YTM B;  3W1S A;  4GOC A;  3BIN A;  1EM7 A;  5MPO A;  2PW9 A;  2XK5 B;  3ALB A;  2N1V A;  4WAA A;  4FBJ B;  4ZRI A;  4E3C A;  1UUP A;  3Q8F A;  1KF6 B;  1EU3 A;  2V3P A;  3O13 A;  1F77 A;  3VH4 B;  4EE2 A;  2GOW A;  2D10 A;  3BK2 A;  4DXG A;  2MJE A;  1XLN A;  1YX5 B;  4KGT A;  2K3U A;  2KWU B;  3AU4 A;  5E6O A;  2N4F A;  2K22 A;  3UIP B;  3ZDM C;  2HDE A;  5BMH A;  4XWT A;  4MM3 A;  2KWD A;  3PRM B;  1ZOY B;  1Y8R C;  4KIK A;  4HRO A;  3V62 A;  3MC8 A;  4W9L A;  2ASQ A;  4WAF A;  1L2N A;  2AYO B;  3AH7 A;  4KZC A;  2B76 B;  2MSE D;  2CR5 A;  4ASW C;  1MG8 A;  4ZYS A;  3PT2 B;  3WAP A;  2KMM A;  2KAN A;  1E7V A;  1JWA D;  2WDT B;  3E9S A;  5C3J B;  2OHF A;  2EKI A;  3WA0 A;  1V97 A;  4IM0 A;  1TZ1 A;  1WXS A;  1WGK A;  2KHW B;  4GLS C;  4MEL A;  5FR6 A;  2X8X X;  1NEK B;  1WMH B;  2K5P A;  3ZTD A;  1XCQ L;  4RM8 A;  3ZKJ C;  2C7N B;  2M17 A;  2YEP B;  3C8Y A;  4YT0 B;  1QOG A;  3IBE A;  2B3A A;  4KSK C;  3ZRC A;  1Z5S B;  2MHJ A;  5CTR C;  3EFU A;  4BKS D;  4DDI D;  3TEY A;  4WWN A;  2BS3 B;  2J0J A;  2D5G A;  1T6B X;  2MQJ A;  2IYD B;  4YWG G;  4YL8 A;  1YQ3 B;  4ITK A;  3PZD A;  3LYY A;  3NS8 A;  1YOV B;  4IWP A;  1QOB A;  1MPE A;  3WAM A;  2FID A;  5IAA C;  4XC2 A;  3OG5 A;  1SJE D;  3TJP A;  2W3S A;  1GG3 A;  3ZLZ A;  5JHA A;  1WYG A;  1V8C A;  4IUM B;  3NRZ A;  2BYT A;  5IP4 D;  2PEA A;  2DZM A;  4JQW C;  3B0A A;  1L6U A;  3HUI A;  1J0G A;  3Q2A C;  3Q8C A;  3N1X C;  4AOF A;  1L6V A;  3IHP C;  1VZ8 A;  4HVB A;  1C4C A;  2M19 A;  2LFI A;  4IM3 A;  4P7I A;  1HQR D;  4LJO B;  4NJC A;  1IYF A;  5CHV C;  2ZW0 A;  2CS4 A;  5LLI A;  3VHT C;  2D3G A;  4NNJ B;  3JSV B;  1C79 A;  4JGH B;  1I35 A;  3L08 A;  1TTN A;  1TS5 A;  5L95 C;  2NVU I;  2KDB A;  2BYV E;  2IGH A;  2N9P C;  1TT5 B;  2DZJ A;  1KLU D;  2VZK B;  1MFW A;  2L52 A;  4EFO A;  2MJD A;  2IO2 B;  1E9M A;  1L7Y A;  4UDU C;  3ZW3 A;  3AUL A;  3QQ8 B;  2O6V D;  2RMM A;  5AZH A;  2Y5B B;  2GB1 A;  1B1Z A;  1IGD A;  4LJP B;  2GRI A;  5T8I A;  1DGJ A;  1SE3 A;  2KYW A;  5FR3 A;  1AW7 A;  4LLG M;  1WRI A;  2G4S A;  3I63 C;  1BML C;  3L0W B;  2WU5 B;  3GP7 A;  3P2B A;  3EA6 A;  3JSV A;  1K8R B;  3AEG B;  1VCB A;  2R61 A;  3SHQ A;  3KQ4 A;  4LK0 M;  2LGX A;  1JRU A;  1HXY D;  2JRH A;  4ZRP A;  3ABV B;  2DZK A;  2G9H D;  3NOB A;  4A90 A;  3HVZ A;  3AE4 B;  4AQ7 A;  2ZPY A;  5EE3 A;  3X0W A;  5GMV A;  3V61 A;  1WWT A;  2IDY A;  1VZ7 A;  4HRS A;  1SE9 A;  1EUV B;  3PLV A;  1E0Z A;  2LVQ A;  5AEK B;  2QIL A;  1OQY A;  2KMC A;  3H6N A;  1SEB D;  2HJ1 A;  5DCN A;  3T3N A;  2DAJ A;  4LNI A;  1ZW7 A;  4ZRQ A;  3Q3F A;  2WDR B;  2LGD A;  1J7B A;  2QEJ C;  2V0G A;  1JW9 D;  3P63 A;  3I9V 1;  1KFY B;  1EWY C;  1N5X A;  2DHZ A;  3ETR A;  1E8W A;  4PYU A;  1C9F A;  1RAX A;  4M8M A;  4HPP A;  3KLS X;  4YTP B;  1WJN A;  2WXK A;  3H8H A;  3QX1 A;  2WDQ B;  2KK8 A;  2ZCC A;  1YMH E;  2WXR A;  2ZZP B;  1V80 A;  2ICI A;  3U52 E;  3HM3 A;  3A9K B;  2ZJD A;  3NY5 A;  3DPD A;  1SGH A;  2LMC A;  2INN E;  3N9Y C;  1E10 A;  3T8M A;  2BT6 A;  1VR9 A;  4PS3 A;  4B0M A;  3M95 A;  3GZN I;  3RNG C;  3H1U A;  3U30 A;  1T0Q C;  1E8Y A;  3QWZ B;  3FKY A;  4K1R B;  3Q8E A;  4BOZ B;  1QQR A;  4P6V F;  4OHJ A;  1X1M A;  4RF0 A;  1ACC A;  1PFD A;  1A5R A;  3AEC B;  2ZNV B;  4MGY E;  2XK5 A;  1TIF A;  2LWP A;  4ICU A;  3RN9 C;  5J17 A;  3BWU D;  2MBB B;  2A4Z A;  2JUO A;  1V1P A;  3W1Y A;  5IN7 A;  2MBO A;  1H4R A;  2Z59 B;  2PMV A;  3PO0 A;  3OJ3 A;  2KJ6 A;  1UD7 A;  1FFV A;  2KFK B;  2LVO A;  4QAY A;  3EC8 A;  4LTU A;  3PLU A;  4XWW A;  3A9K A;  1ISN A;  3B9J A;  2KNB A;  2NCN A;  2K8C A;  3NJT A;  3C0R B;  3L16 A;  3L4P A;  1D4B A;  2LJ5 A;  1F9J A;  5G5H A;  1LGR A;  4C7Y A;  1WE6 A;  1LFD A;  4AS1 A;  3DBH B;  1L4Z B;  4W9D A;  4W9C A;  1MJD A;  3ZUN A;  3LDZ E;  3R8B A;  1JQ4 A;  2Y3A A;  1T5X D;  2DZI A;  4DK5 A;  3M62 B;  3UGB B;  1ROE A;  2DYM A;  3AE7 B;  1V1P B;  2MH7 A;  1NYQ A;  4HKZ E;  2Z8L A;  5LXI B;  2MBH A;  4OVZ A;  4I6P A;  1D6E C;  1ESF A;  2WXP A;  3MFG A;  2YLM A;  3EGR A;  2N7D A;  2MP2 B;  4RGN A;  4DHZ B;  1NI3 A;  1XT9 B;  3VR8 B;  4FA6 A;  1HTQ A;  2J42 A;  4GDL A;  4N9F 4;  4BAX A;  1JML A;  2M56 B;  3IFW B;  1AWD A;  4E71 A;  1QOF A;  1ZUD 2;  3RNA C;  4D2K A;  5JZE B;  1U4A A;  2WXM A;  5DPW A;  4EZK A;  4MM3 B;  5D7G A;  3IVF A;  4DXF A;  1UH6 A;  2XBB C;  4B9K A;  3MC0 B;  1VZ6 A;  2L0T A;  1NI2 A;  2KTR A;  4GU2 A;  3NVY A;  4WH4 A;  4DWF A;  5EE0 A;  1UWX A;  3PHW B;  2QMT A;  1WXV A;  4PS7 A;  3DVG Y;  1DOI A;  2EMS A;  5D3I B;  1ET6 A;  3LXF A;  1SE2 A;  3HRD D;  3HVD A;  3NZU A;  3AE2 B;  3U8Z A;  4CQN A;  2DBY A;  3A1Q B;  2TSS A;  1P7F A;  4OZB A;  2D2Q A;  3ZRF A;  1JWB D;  2KX3 A;  3SR6 A;  2FCM A;  3TEZ A;  2A5U A;  1T0S C;  3H9D A;  1E5W A;  3DVN U;  1EWC A;  3L17 A;  4ARC A;  2NR2 A;  1WZ3 A;  3GZN B;  3R66 C;  4NAW B;  1GUA B;  2WXJ A;  2J7Q B;  4LNO A;  1J7A A;  3DQV A;  3VUX A;  3QIJ A;  3SDL C;  3V05 A;  1C78 A;  4MEM A;  2D3C A;  4FHK A;  1E8Z A;  2BGF A;  1N60 A;  1SF0 A;  5DPR A;  2LHD A;  1D5M C;  3P4P B;  4OZC A;  1G6J A;  3A9J B;  2UYZ B;  1WFY A;  3CST A;  3I57 A;  1XLO A;  2MRP A;  2WU2 B;  1E90 A;  2KO3 A;  5BYS A;  2DYO A;  3NZ3 A;  4LDT B;  4ZDV A;  1WIA A;  2PLP A;  1V5O A;  1K51 A;  4MH8 A;  2L0F A;  2I1K A;  2KFJ A;  3VRB B;  3N3K B;  5C1Z A;  2W9N A;  1MHH E;  3M3J A;  2K9X A;  4W9K A;  3AE3 B;  4NQL B;  1RLF A;  1PQS A;  2BB5 A;  3T9L A;  3A4R A;  1V5T A;  2BYF A;  3HK0 A;  3MJ5 A;  3RI7 C;  4HPL B;  2RR9 A;  1BXT A;  2V4L A;  5BMI A;  3R3M A;  2AX5 A;  3NVW A;  2JZ3 B;  1WY8 A;  1Q0W B;  3ML8 A;  2BBC A;  4JIO U;  1C4P A;  3VTW A;  2JVC A;  2OJW A;  3NHE B;  3QA8 A;  4JPS A;  3NZS A;  4HDQ A;  5BMG A;  2KDM A;  2FCQ A;  1WM3 A;  2WGS A;  3ECI A;  4P1B C;  2HTM E;  4H2A A;  2N9K A;  4IDI A;  2KX0 A;  4NY0 A;  1GJZ A;  3PV1 A;  3L13 A;  4W9G A;  4ACF A;  2WS3 B;  3UQA A;  1KOT A;  2O2V B;  3V6E B;  3P4Q B;  2VZK D;  3DWG C;  3DHH C;  4ANW A;  3RMK C;  2MCN B;  1TBE A;  1J8C A;  4TSS A;  3VVW B;  2MEK A;  2WXF A;  3W1S C;  1CK1 A;  2DEN B;  1HZ6 A;  3NG0 A;  5EDS A;  4HDO A;  2KJR A;  1STE A;  4W9I A;  1ZDX A;  1GC7 A;  2V4I B;  4K3C A;  2XNA C;  2X38 A;  4MT5 A;  3JYU A;  4RMA A;  3KYC D;  4L1B A;  2L3Z A;  3AU5 A;  2DWQ A;  3PSE B;  1TY2 A;  3NVZ A;  4WJQ A;  1F2R C;  2G3Q B;  1WH3 A;  3U7Z A;  2K25 A;  1UEL A;  2QDF A;  4N58 A;  1YQB A;  2O2V A;  3LJ3 A;  2MLB A;  4DBG A;  1VJK A;  1S1Q B;  4NAM A;  3IAS 1;  1K52 A;  2K6D B;  1WJ4 A;  1QKZ A;  2DLB A;  2KXJ A;  2KD0 A;  3JVZ X;  3ZJT A;  1HTO A;  1V86 A;  2NS5 A;  3IT6 B;  2KJH B;  2KVR A;  1FNV A;  3RFZ B;  1WGY A;  2BF8 B;  2KAC A;  4ICV A;  2KLG A;  3TL5 A;  1JWU D;  2M1M A;  2OJR A;  3DWM A;  1RYJ A;  3QJZ A;  2G45 B;  3PVL A;  1FCC C;  1SBB B;  3GS2 A;  3RD2 A;  3KYD D;  4RH6 A;  2OED A;  2BQQ A;  4C00 A;  2EKE C;  4KV2 A;  2PVO D;  1VDV A;  2KQ7 A;  3WIM A;  2HD5 B;  3BVZ A;  1LO5 D;  3DCG A;  4M02 A;  1NBF C;  3CIR B;  3PGE A;  4TMA B;  2XN9 C;  4FJV B;  2LXC A;  4DQO C;  3FAH A;  1KLG D;  2I38 A;  4GSW A;  4IWO A;  2QCZ A;  2MA9 B;  5C2T B;  3JW0 X;  1ZE3 D;  1I7H A;  1XXG A;  1ENF A;  1JAL A;  2MP2 A;  2Z0D B;  1WGR A;  4NJ7 A;  4IC7 B;  1WE7 A;  4GDL B;  3P1M A;  1D5Z C;  1UZX B;  2GBK A;  2KQ4 X;  5BYR A;  4TQ0 A;  4AJW A;  1Q10 A;  4R3D A;  2K8B A;  3VTV A;  1FXI A;  3Q8B A;  2AQ2 B;  4HPM B;  4S17 A;  3UQB A;  2ZNV C;  2RD0 A;  2WXL A;  3AE8 B;  3L54 A;  2WXH A;  4HK2 A;  3B2F A;  3AN1 A;  3MTN B;  3TSS A;  1UNS A;  4KDI C;  1WSP A;  4HXD A;  4C4V A;  1WXM A;  3GOE A;  1RFK A;  4B6W A;  3U4E G;  2NTS A;  3Q3N C;  1WYW B;  5KHQ A;  3BZD B;  1FRD A;  3APD A;  1Z2M A;  3QHT A;  1TGZ B;  2NBU A;  1VRA B;  1JRO A;  2PE6 B;  1CMX B;  5D3D A;  1NYR A;  3DHI C;  2RDH A;  5H8Y E;  1IUE A;  2JWU A;  2V3S A;  1GOZ A;  1E7P B;  4F1S A;  1CZP A;  1YNT E;  5DPT A;  3AE6 B;  3TEX A;  4RNA A;  2C7H A;  2NTT A;  3O65 B;  2EMT A;  2IY1 B;  1NDD A;  2IO3 B;  1WXA A;  5EE1 A;  3VTU A;  2PPH A;  2JZP A;  2GI9 A;  1I4X A;  3AB5 A;  4F7Z A;  1I4G A;  3PRE A;  3ML9 A;  3AED B;  3N1Z C;  3W5V B;  1V81 A;  2BPS A;  2JXT A;  2AEH A;  3OAW A;  4FN2 A;  2MBE A;  2N1W A;  3WAO A;  3BYY B;  5C23 A;  3ZJV A;  4MAC A;  2QIE B;  1AN8 A;  2WXO A;  2Y5C A;  4ZRK A;  2CU1 A;  2LJI A;  3KUC B;  1MI0 A;  3KVF B;  5HFY A;  1PGX A;  1K50 A;  2PE9 A;  1WRD B;  4A55 A;  4YSX B;  2E3T A;  2NBV B;  3GE3 C;  2W3R A;  1BT0 A;  4E74 A;  4XDC A;  2KN5 A;  2CU3 A;  4KIK B;  2ON8 A;  4A9A A;  2WXQ A;  4W9H A;  2KQS A;  1H8C A;  3CF6 E;  1SXT A;  4CHK A;  3BII D;  5CHW A;  3B2G A;  4XGA B;  3RT3 B;  2C60 A;  2KC2 A;  4G50 A;  2BYE A;  3N30 A;  2KMA A;  1A70 A;  4EZL A;  4ZHO A;  1V49 A;  5JH5 C;  4II3 B;  4OVV A;  1YQ4 B;  1IP9 A;  3Q3J A;  4MSQ B;  3ZIM A;  1DYQ A;  2IBI B;  3RUL A;  2AL3 A;  2L7R A;  2G4D B;  2C7M B;  4C56 C;  3ZTC A;  4WQM A;  1CQV A;  2BWE S;  4MGK E;  3T3O A;  2LUM A;  3OJ4 B;  2J0M A;  1SE4 A;  3MP9 A;  4BOS C;  1WX9 A;  2RPQ A;  4DHJ B;  4YSZ B;  5E6P A;  4ARI A;  1E7U A;  5J2R A;  2MJ3 A;  4NPN A;  3RNC C;  2AQ1 B;  3H7P A;  4ZRJ A;  3VUW A;  1N61 A;  3UF8 A;  3BVM A;  5E6N A;  4GDK B;  4M00 A;  5H92 C;  3PRP B;  2ZW1 A;  1C1Y B;  1NEN B;  1R4M B;  5AUK A;  4PK1 A;  1IBX B;  3WAL A;  2GMI C;  2PKO A;  4RM9 A;  1P9D U;  4BBN C;  4IWQ A;  3KWV A;  1UBQ A;  2WXI A;  4K7U A;  4XE0 A;  4I6L B;  2VRR B;  3IAM 1;  2PTL A;  2K6Q A;  3RNF C;  1TS2 A;  2JX5 A;  4PT5 A;  4WQO B;  3VXW A;  1TYG B;  3TIX A;  1QIL A;  1IBX A;  1SSN A;  1JCK B;  1P0R A;  2CJO A;  3WAN A;  3VH3 B;  1QF6 A;  1T0R C;  4RGT A;  3U2S C;  3NS1 A;  4NAW A;  3ZNZ B;  4X57 B;  3PHX B;  3PTF C;  4BZA A;  3MHZ A;  2DX5 B;  2KDI A;  2J52 A;  2REX A;  1OFF A;  5KHO A;  2JSV X;  1GB4 A;  1PDX A;  3AV8 A;  3ZDT A;  1TY0 A;  2ZPN A;  1B9R A;  4AUQ C;  3PZ7 A;  4PS8 A;  5E6J A;  5IA7 A;  4G11 A;  4G3X B;  1WMH A;  1UGM A;  2KWV B;  3ZYY X;  3QAR A;  4OW0 A;  4ANU A;  4LNK A;  1E8X A;  4N59 A;  1VD2 A;  3RCZ A;  5HKH A;  3SFD B;  2WYQ A;  1EO6 A;  1R4N B;  2L76 A;  4W9F A;  2FIF A;  3OLM D;  3W2D A;  4DXA B;  2GBM A;  1FCL A;  1TKE A;  4JWS C;  4EZJ A;  1DOX A;  1KM7 A;  2KDF B;  1IPG A;  3CWI A;  2DNF A;  2MBQ A;  4JLC A;  2KLC A;  3AE1 B;  4YSY B;  2UWQ A;  4DHZ E;  2N7J A;  1QOA A;  4K3B A;  3W5U B;  1MG4 A;  5J18 A;  1JRP A;  4REZ A;  3V6C B;  4F8C B;  1PYW D;  3U7D A;  2KVZ A;  1WGH A;  2GLS A;  3AE5 B;  2MW5 A; 
#chains in the Genus database with same CATH homology
 4LJP B;  2LRU A;  3JYU A;  3I3T B;  2GBR A;  3DVG X;  3KYC D;  3M63 B;  4GGQ A;  4GMV A;  4RMA A;  1R4M I;  2L3Z A;  3AU5 A;  4AJY B;  1V2Y A;  2G4S A;  2KDE B;  3PSE B;  1AAR A;  3L0W B;  4WJQ A;  3ZNI D;  2IO0 B;  2G3Q B;  1WH3 A;  3P2B A;  2K25 A;  1UEL A;  3JSV A;  3K9P B;  1K8R B;  1EF1 A;  2AWT A;  1OEY A;  1YQB A;  3RZF A;  2O2V A;  1VCB A;  3LJ3 A;  4FJY A;  2PJH A;  4JL9 A;  3SHQ A;  3X23 A;  2MLB A;  4DBG A;  2LGX A;  1JRU A;  1S1Q B;  2JRH A;  2V1Y A;  2K6D B;  1WJ4 A;  2DZK A;  2KXJ A;  3JVZ X;  2KD0 A;  3NOB A;  4CO7 A;  2LGY A;  1V86 A;  2ZPY A;  2NS5 A;  3X0W A;  2YVC A;  5GMV A;  3V61 A;  2WX0 A;  3PRZ A;  2KJH B;  2AL6 A;  2KVR A;  4K81 A;  1SE9 A;  1WGY A;  2BF8 B;  3DBS A;  3V60 A;  1EUV B;  3PLV A;  4EUT A;  2JXX A;  2LVQ A;  1UBI A;  5AEK B;  1WR6 E;  4ICV A;  1I42 A;  2KLG A;  3TL5 A;  1OQY A;  2M1M A;  3KW5 B;  2KMC A;  3H6N A;  2OJR A;  4DHJ D;  2RSU A;  5DCN A;  3SU8 X;  2DAJ A;  3QJZ A;  2NPT B;  2G45 B;  3PVL A;  1V6E A;  1ZW7 A;  3RZW C;  2DAF A;  4G0N B;  3Q3F A;  3RD2 A;  3KYD D;  3RYT A;  2LGD A;  3ZVV A;  5D94 A;  1KLV A;  2EKE C;  4KV2 A;  2DHZ A;  2LI5 A;  2C9W B;  2KQ7 A;  3WIM A;  3ONS A;  2RGF A;  1E8W A;  2HD5 B;  3DCG A;  4PYU A;  4EEW A;  1RAX A;  4M8M A;  1NBF C;  3PGE A;  4GB9 A;  4FJV B;  2LXC A;  4MGI E;  2NBW B;  3HM6 X;  1LXD A;  1WJN A;  4BKT A;  4GSW A;  2FCS A;  3QX1 A;  4ANV A;  4IWO A;  2MA9 B;  1WF9 A;  2GBN A;  2MX2 A;  4WWO A;  3JW0 X;  1GC6 A;  2L8J A;  2MP2 A;  2Z0D B;  2KK8 A;  2ZCC A;  1WGR A;  4NJ7 A;  2ZZP B;  1V80 A;  2WWZ A;  4IC7 B;  4IM2 A;  4I6N B;  3S2A A;  3L10 B;  3HM3 A;  4J6I A;  2M8S A;  4HCN B;  1WE7 A;  4GDL B;  3A9K B;  2ZJD A;  1UZX B;  2NPT A;  3NY5 A;  3DPD A;  2LXA A;  2GBK A;  2JWZ A;  3UIN B;  1SGH A;  4TQ0 A;  1HE8 A;  4AJW A;  3T8M A;  2K8B A;  3VTV A;  2OOB B;  1P1A A;  2KFK A;  4PS3 A;  2K1F A;  2FAZ A;  3M95 A;  3GZN I;  4HPM B;  3H1U A;  2D07 B;  3K9O B;  3U30 A;  1E8Y A;  3QWZ B;  3UQB A;  4K1R B;  3ZNH B;  4LDT D;  4BOZ B;  2ZNV C;  5CHF A;  2RD0 A;  4HLE A;  4A3P A;  1X1M A;  3L54 A;  4ANX A;  4HK2 A;  4NQK E;  3SD5 A;  4BKG A;  1A5R A;  3MTN B;  2ZNV B;  4KDI C;  1YIW A;  4DDG D;  4MGY E;  2XK5 A;  1V9J A;  3MJW A;  4HXD A;  2LWP A;  1WXM A;  3GOE A;  4ICU A;  1KJT A;  4B6W A;  5J17 A;  1D3Z A;  2FCN A;  2L05 A;  3AXC A;  2ZCB A;  2MBB B;  1WYW B;  2A4Z A;  2M0X A;  1OTR B;  4HCP B;  2JUO A;  3CSF A;  5KHQ A;  3W1Y A;  3VFK A;  3APD A;  2MBO A;  2N9E B;  2R2O A;  1EF5 A;  1H4R A;  2ZEQ A;  4BBN F;  2KZR A;  2Z59 B;  1Z2M A;  2D11 A;  3QHT A;  5CX3 A;  1TGZ B;  3OJ3 A;  2NBU A;  1RRB A;  1WZ0 A;  2PE6 B;  4B95 A;  1CMX B;  2CHW A;  1UD7 A;  2KJ6 A;  2KFK B;  2KWC A;  2LVP A;  2J0K A;  2LVO A;  4XZ4 A;  3QC8 B;  3EC8 A;  3PLU A;  1OEY J;  1ISN A;  3A9K A;  3BY4 B;  2KNB A;  2NCN A;  2K8C A;  2WX1 A;  1OGW A;  4KDL B;  3C0R B;  5AZF A;  3AI5 A;  2V3S A;  3L16 A;  4FLH A;  2LJ5 A;  4HJK A;  4A20 A;  2IY0 B;  4GIV A;  1F9J A;  4OVU A;  2KC1 A;  2CKH B;  4F1S A;  3TBL D;  1WE6 A;  1LFD A;  2DYB A;  2N7E A;  5DPT A;  5LXH A;  5TR5 A;  2QHO A;  2C7H A;  2KOX A;  1YD8 U;  2C5L C;  4WJO A;  3PPA A;  3O65 B;  2M4N A;  4W9D A;  2MWS B;  2EMT A;  2IY1 B;  1NDD A;  2IO3 B;  1WXA A;  2LAS A;  3VTU A;  2CHZ A;  3B1L X;  4BKS A;  2PPH A;  4W9C A;  3VDZ A;  2LD9 A;  3ZUN A;  3HHM A;  4F7Z A;  3LDZ E;  3PRE A;  3ML9 A;  1Q1O A;  4ZYN A;  1V81 A;  2BPS A;  1J19 A;  4IW0 A;  2AEH A;  4M8N A;  3OAW A;  4FN2 A;  2FNJ B;  2DZI A;  4MGZ E;  4DK5 A;  3QK0 A;  3M62 B;  4IG7 B;  3UGB B;  2MBE A;  2N1W A;  1M94 A;  1S3S G;  2DYM A;  2N9X A;  5L83 A;  3WAO A;  1WJ6 A;  5C23 A;  2Z0E B;  5LXI B;  2MBH A;  2O6V B;  1XQQ A;  4I6P A;  2KTR B;  4URK A;  3A4S C;  2CHX A;  4AP4 C;  4ZRK A;  2CU1 A;  3EHV A;  3KUC B;  2YLM A;  2N7D A;  2MP2 B;  4TUU A;  3KVF B;  4KSL C;  3KUZ A;  4DHZ B;  1XT9 B;  3DDC B;  3APF A;  3QAQ A;  2ZVN A;  4WJP A;  3VQI A;  3ZO5 B;  4FA6 A;  2KTF A;  2PE9 A;  1WRD B;  4GDL A;  4HWI B;  3H7S A;  3VUY A;  4N9F 4;  2NBV B;  4LCD E;  3A1Q A;  4KZ0 A;  4FAD A;  1BT0 A;  2I1J A;  4E74 A;  3IFW B;  2KN5 A;  1YJ1 A;  4E71 A;  1LM8 B;  4KIK B;  3RUI B;  3R7R A;  1P3Q U;  4W9H A;  1XD3 B;  4PYZ A;  5JHB A;  2KQS A;  1H8C A;  1T0Y A;  3CF6 E;  1Q5W B;  4TV3 A;  2JF5 A;  3IG3 A;  5JZE B;  4CHK A;  3TMP B;  1LQB A;  1U4A A;  5DPW A;  5CHW A;  4EZK A;  5G2N A;  3D32 A;  5D7G A;  3IVF A;  3RT3 B;  3W1S A;  1WJU A;  2C60 A;  2HTH A;  2KC2 A;  4GOC A;  1UH6 A;  2XBB C;  2O6V A;  4B9K A;  3BIN A;  4G50 A;  2BYE A;  3H7P B;  3N30 A;  2L0T A;  2KMA A;  4CYE A;  1NI2 A;  2KTR A;  4GU2 A;  4EZL A;  1ZGU B;  2XK5 B;  1V49 A;  5JH5 C;  3ALB A;  2N1V A;  4WAA A;  4FBJ B;  4ZRI A;  4II3 B;  4OVV A;  4E3C A;  2IO1 B;  3KH0 A;  1IP9 A;  4M0W B;  4DWF A;  3Q3J A;  3PHW B;  4MSQ B;  4GDK A;  1WGG A;  3DOW A;  3ZIM A;  2IBI B;  3RUL A;  2AL3 A;  2ZVO A;  1WXV A;  2L7R A;  2G4D B;  2C7M B;  4II2 B;  4PS7 A;  3ZTC A;  3PS6 A;  3DVG Y;  3VH4 B;  2GOW A;  2D10 A;  2EMS A;  2BWE S;  4MGK E;  1YX5 B;  2KWU B;  3AU4 A;  3OJ4 B;  5E6O A;  2N4F A;  2J0M A;  3UIP B;  2LUE A;  3ZDM C;  1WX9 A;  4BOS C;  2RPQ A;  1C3T A;  3NZU A;  3U8Z A;  4DHJ B;  3A1Q B;  5E6P A;  3KUD B;  1E7U A;  4MM3 A;  3PRM B;  4MJS A;  2D2Q A;  5J2R A;  1Y8R C;  4KIK A;  4NPN A;  3H7P A;  3V62 A;  3ZRF A;  4ZRJ A;  3VUW A;  2FUH B;  3UF8 A;  2IZV B;  2KX3 A;  1RFA A;  4W9L A;  4K7W A;  2ASQ A;  2BKF A;  2FCM A;  1L2N A;  2AYO B;  4KZC A;  2GBJ A;  2A5U A;  2MSE D;  2CR5 A;  5E6N A;  4ASW C;  4GDK B;  1MG8 A;  3H9D A;  3PT2 B;  1E5W A;  3DVN U;  3WAP A;  3L17 A;  2NR2 A;  2KAN A;  1E7V A;  1WZ3 A;  3R66 C;  3PRP B;  4NAW B;  1C1Y B;  1GUA B;  1P98 A;  2WDT B;  1WR1 A;  2J7Q B;  4MJS B;  3DQV A;  3VUX A;  3QIJ A;  1WI0 A;  3WAL A;  2GMI C;  1SIF A;  3R7Q A;  4NJ6 A;  4FJZ A;  3SDL C;  4IM0 A;  4RM9 A;  3WA0 A;  1TZ1 A;  2XEW A;  1WXS A;  1P9D U;  2KHW B;  3MHS D;  4IWQ A;  4MEM A;  4WJN A;  4BBN C;  4FHK A;  4MEL A;  1E8Z A;  1UBQ A;  4K7U A;  5FR6 A;  4I6L B;  2VRR B;  2BGF A;  1WMH B;  3ZTD A;  4RM8 A;  3ZKJ C;  2C7N B;  5D6J B;  5DPR A;  2M17 A;  2K6Q A;  3B08 A;  4TKN A;  2JZZ A;  4AWJ A;  1G6J A;  3A9J B;  2HJ8 A;  2UYZ B;  3IBE A;  2JRI B;  2B3A A;  4KSK C;  1WFY A;  1Z5S B;  3CST A;  1R4N I;  3EFU A;  4WQO B;  5CTR C;  3VXW A;  3ZRC A;  4DDI D;  3HIZ A;  4WWN A;  2MRP A;  3TIX A;  2BKR B;  2J0J A;  1E90 A;  2KO3 A;  2MQJ A;  2DYO A;  1P0R A;  1WM2 A;  4LDT B;  2IYD B;  3WAN A;  3VH3 B;  4ZDV A;  1WGD A;  1WIA A;  4YL8 A;  4BFR A;  1V5O A;  4FHJ A;  2JPH A;  4FUL A;  3PZD A;  3NS8 A;  4GN1 A;  2L0F A;  2I1K A;  4NAW A;  4IWP A;  5D2M B;  2KFJ A;  4BVU C;  3ZNZ B;  3N3K B;  4X57 B;  5C1Z A;  2W9N A;  3PHX B;  3CMM B;  3PTF C;  3WAM A;  2FID A;  5IAA C;  3M3J A;  4XC2 A;  2DX5 B;  2KDI A;  4W9K A;  3QCA A;  2REX A;  1RLF A;  4NQL B;  1PQS A;  3TJP A;  5KHO A;  3T9L A;  1GG3 A;  3A4R A;  3ZLZ A;  5JHA A;  2BWF A;  3DBL I;  4IUM B;  1V5T A;  2BYF A;  2LZ6 A;  3HK0 A;  3ZDT A;  4HPL B;  3DBR I;  4A3O A;  2RR9 A;  2PEA A;  2V4L A;  2DZM A;  2ZPN A;  3R3M A;  4JQW C;  3EEC A;  4MSM B;  4AUQ C;  3B0A A;  2JZ3 B;  5BO4 B;  3VAW A;  4PS8 A;  5DPS A;  1WY8 A;  1Q0W B;  3ML8 A;  4W9J A;  2R2Q A;  5IA7 A;  2JY6 A;  4G11 A;  4JIO U;  4G3X B;  1J0G A;  1WMH A;  3VTW A;  1UGM A;  1FXT B;  4EKU A;  2JVC A;  4GXB A;  4AOF A;  2KWV B;  3QAR A;  3NHE B;  3QA8 A;  2LRW A;  2K39 A;  3A33 B;  3NZS A;  3IHP C;  4HDQ A;  4ANU A;  3A9J A;  4WWP A;  2FCQ A;  1E8X A;  1WM3 A;  4HVB A;  3ECI A;  1WX8 A;  4IM3 A;  4P7I A;  4LJO B;  1VD2 A;  2KX0 A;  4NY0 A;  3DVN V;  3APC A;  3RCZ A;  1IYF A;  5CHV C;  1GJZ A;  2CS4 A;  5LLI A;  3PV1 A;  2K8H A;  2WYQ A;  3VHT C;  3L13 A;  2D3G A;  4W9G A;  1EO6 A;  4NNJ B;  3JSV B;  4JGH B;  1I35 A;  2L76 A;  4W9F A;  2FIF A;  3UIO B;  3ENE A;  3OLM D;  3L08 A;  4DXA B;  3UQA A;  1KOT A;  2GBM A;  2O2V B;  3V6E B;  2HE7 A;  4EZJ A;  1TTN A;  1KM7 A;  2JT4 B;  2KDF B;  1WX7 A;  5L95 C;  4W9E A;  1IPG A;  3ZNG C;  2NVU I;  2KDB A;  3N32 A;  2BYV E;  4XX5 A;  4K7S A;  2MBQ A;  3DBH I;  4BKS D;  4ANW A;  4EOY A;  4JLC A;  2MCN B;  1TBE A;  2N9P C;  4MH0 E;  2DZJ A;  2KLC A;  1J8C A;  2UWQ A;  4DHZ E;  2KKC A;  5AZG A;  1YX6 B;  4EFO A;  4KVG B;  4TQ1 A;  3VVW B;  5J18 A;  2IO2 B;  1L7Y A;  1ZKH A;  2L00 B;  3W1S C;  2DEN B;  3V6C B;  1QZE A;  4F8C B;  3ZW3 A;  3AUL A;  3QQ8 B;  4HDO A;  5EDS A;  2KJR A;  3U7D A;  2O6V D;  4W9I A;  1GC7 A;  5HKH A;  5AZH A;  1WGH A;  2Y5B B;  1GNU A;  2MW5 A;  3TCA A;  5G55 A;  4MDK E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...