1WMHB

Crystal structure of a pb1 domain complex of protein kinase c iota and par6 alpha
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
82
structure length
82
Chain Sequence
SIVEVKSKFDAEFRRFALPRASVSGFQEFSRLLRAVHQIPGLDVLLGYTDAHGDLLPLTNDDSLHRALASGPPPLRLLVQKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a Cell Polarity Regulator, a Complex between Atypical PKC and Par6 PB1 Domains
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/cell cycle
molecule keywords Protein kinase C, iota type
total genus 17
structure length 82
sequence length 82
ec nomenclature
pdb deposition date 2004-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00564 PB1 PB1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1wmhB00
2AWTA 1WGHA 3DVNU 2Z0DB 4PYZA 3A1QB 1S3SG 2LZ6A 5J18A 4MELA 2D10A 4W9IA 3ZW3A 2C7NB 4GDLB 4FJVB 4YL8A 1YX6B 4EZLA 3B1LX 4W9DA 1FXTB 4ICVA 4K7WA 3PRPB 3VTVA 5G55A 3ZNHB 4EZJA 4ANWA 4FJYA 3I3TB 2BPSA 3APDA 1IYFA 3DOWA 4BBNF 5KHQA 1WI0A 3UQBA 2NVUI 3PLVA 3QK0A 2J0MA 1J19A 2LASA 1OTRB 3RCZA 1S1QB 2L00B 2ASQA 1WZ0A 1Z2MA 3PV1A 3LDZE 2KTFA 2XK5B 3UQAA 4BKTA 1KLVA 2HD5B 4K7SA 3QC8B 3PLUA 4FA6A 3PVLA 3EFUA 2KMAA 3DBHI 4FN2A 4LJPB 2G4DB 2CU1A 2MBQA 4GN1A 4IC7B 1NI2A 2KJ6A 2LRUA 3ALBA 4KV2A 3WAOA 3IFWB 2O2VA 1EF1A 2KJRA 4ASWC 1L7YA 3A9JA 3OJ4B 3BINA 1V49A 5CX3A 4W9HA 3IHPC 2N9PC 2ZEQA 3H7SA 4IM2A 2QHOA 1IPGA 2LI5A 3VDZA 2K6QA 4LCDE 3SD5A 1GC6A 4FHJA 2DYMA 1SIFA 2J0JA 3IBEA 3NY5A 3B08A 4ZDVA 1I42A 4MGYE 4IM0A 4GMVA 4MDKE 4AP4C 4M8NA 2LXAA 1V6EA 3KUDB 1E5WA 5E6PA 3M63B 3VUWA 4BBNC 2CHZA 3K9OB 2MSED 4E71A 1WZ3A 2CHXA 3HK0A 2ZNVC 4GOCA 3GOEA 2IO1B 2KX3A 1RLFA 3WIMA 3VQIA 4KIKB 2R2OA 2JUOA 3A4SC 4W9EA 5TR5A 1WJNA 3H6NA 4JIOU 1WX7A 1BT0A 4PS3A 1R4NI 4NJ7A 5G2NA 1WH3A 3APFA 1Q5WB 1E8YA 4A20A 3OAWA 3PSEB 4ZRJA 5AZFA 1NBFC 2PJHA 2N9EB 3PS6A 5CHVC 2L76A 3NS8A 3L17A 3RD2A 3SDLC 3N32A 4HDQA 1Q0WB 2KWVB 4HK2A 2Z0EB 5AEKB 1GC7A 3WALA 3PGEA 1LFDA 2G45B 2NS5A 2V1YA 2CR5A 3APCA 3MHSD 2C60A 3B0AA 1UBIA 2ZCCA 1L2NA 3RULA 2D07B 2C7MB 4PS8A 4NQKE 4HPLB 2BGFA 1XD3B 1G6JA 4DHZB 4GXBA 4BFRA 4HPMB 4B6WA 1V2YA 3A33B 4MGKE 4EZKA 4F7ZA 2KDEB 1NDDA 4BOZB 3H9DA 4F1SA 3SHQA 2JZ3B 2KFJA 2DYBA 1TBEA 3AU4A 4NQLB 4E74A 1GUAB 2KWCA 3DVGX 4B95A 3KUZA 4AJYB 1KJTA 2C5LC 3WAPA 4I6NB 3PTFC 4WWPA 2DX5B 1V5OA 2FCQA 4IWOA 2BYEA 1YQBA 3QARA 4MSMB 4K7UA 4RM9A 2ZVOA 5DPSA 3WA0A 5AZGA 2ZJDA 3KYDD 4HLEA 2C7HA 2W9NA 1X1MA 3KUCB 1F9JA 2EMSA 1Z5SB 4NPNA 5KHOA 3WANA 3WAMA 3R7QA 1WE6A 2WDTB 2ZVNA 4WQOB 4AWJA 2IY0B 5CTRC 2ZPYA 3Q3JA 3Q3FA 4A3OA 2V4LA 3AULA 3V6CB 3PT2B 3VUYA 2MA9B 2GBNA 4PYUA 3A9KB 1TGZB 2LUEA 2KANA 1ZGUB 4G11A 3PZDA 2NPTA 1IP9A 1V81A 4X57B 2LVOA 4WJQA 2DZIA 4TKNA 5LXHA 1WYWB 1ZKHA 1RFAA 3P2BA 1EUVB 4TQ1A 4I6PA 4XX5A 1LQBA 2LXCA 3RT3B 3IVFA 3ML8A 4GDKB 5GMVA 3ZNZB 1RAXA 2FCSA 3CMMB 4KSLC 1UD7A 2A4ZA 2RD0A 1P1AA 3DCGA 4II2B 3L16A 2ZCBA 1J0GA 2JY6A 2OOBB 2K6DB 3HM3A 2K25A 4KDLB 1EF5A 2VRRB 2KJHB 3M95A 2REXA 4HCNB 1A5RA 4OVVA 3TIXA 3D32A 2M4NA 2RR9A 3V6EB 2AEHA 5CHWA 4FJZA 2LWPA 2KDIA 1UELA 2CHWA 2KZRA 3PHWB 5C23A 2MBOA 1OEYJ 2MLBA 4GSWA 3ZIMA 3X23A 3ZTCA 4DDGD 1U4AA 2L0TA 2O6VA 3A1QA 3A9JB 3PHXB 4HWIB 4W9LA 3GZNI 1JRUA 3QQ8B 4JGHB 1D3ZA 2K8BA 4NJ6A 4IUMB 3NOBA 1YJ1A 2FNJB 1WGDA 4LJOB 2JT4B 4BKGA 4RM8A 1KM7A 3ENEA 4ANVA 4JLCA 1WE7A 3VTWA 2LVPA 4WJNA 3V60A 4KZCA 3JW0X 2L8JA 2KN5A 4GDKA 3ZRFA 4CYEA 3V61A 2GBJA 1YIWA 2L3ZA 5D2MB 1V5TA 2K1FA 2LVQA 3AU5A 2O6VD 5IAAC 5IA7A 2KDBA 1EO6A 4II3B 3T8MA 3VHTC 2LGDA 2M1MA 3UIPB 2XEWA 3C0RB 3OJ3A 1CMXB 1PQSA 4BOSC 4NY0A 5DCNA 4LDTD 2DZMA 4URKA 1WGGA 3V62A 3QA8A 2N1WA 3UINB 2IY1B 4K81A 2K39A 5DPRA 2LJ5A 3L0WB 2KQ7A 5D94A 1WR1A 2CS4A 3L08A 4FBJB 2B3AA 2FIFA 3H7PB 3UF8A 3A9KA 4XZ4A 2RPQA 5FR6A 2BKFA 4EKUA 4DXAB 2ZPNA 3ZDTA 2M8SA 3JYUA 1WJUA 3VAWA 5L95C 2PPHA 3ZVVA 3ZDMC 4DDID 2FUHB 2I1KA 3LJ3A 3VUXA 2KQSA 5LLIA 1J8CA 3RZWC 2KO3A 2EMTA 4G0NB 3RZFA 4ICUA 3M62B 1AARA 4KDIC 2HTHA 2AL3A 2RGFA 3ZLZA 2GBRA 3ZUNA 1WJ4A 2KMCA 3U30A 4IWQA 4BVUC 3CSFA 3EC8A 5JHAA 1ZW7A 2BYFA 4HJKA 2IBIB 5BO4B 1WMHA 4ZYNA 1P98A 3QWZB 4W9JA 2G3QB 2N7EA 2A5UA 3ZO5B 4WAAA 3DBRI 2N1VA 2K8HA 3SU8X 3M3JA 2DAJA 2NBVB 1V80A 2XBBC 1WXAA 1K8RB 2WYQA 3U8ZA 1OGWA 3PREA 1VCBA 1WFYA 1T0YA 4EOYA 2K8CA 1LXDA 2PE6B 3ZTDA 1XT9B 1E8XA 4N9F4 3W1SA 4EUTA 1LM8B 3HM6X 4J6IA 1WRDB 1UGMA 2JZZA 2KX0A 4GGQA 5CHFA 1WXVA 3BY4B 3AXCA 3T9LA 1WGYA 3AI5A 2KTRA 3KW5B 1WGRA 4MSQB 2MX2A 5EDSA 3CF6E 4E3CA 3TCAA 4F8CB 1Y8RC 4TQ0A 2G4SA 1KOTA 2KFKB 3EECA 2NPTB 1WR6E 5E6NA 2DAFA 1XQQA 2KLGA 3PPAA 5L83A 3NHEB 4EEWA 2J7QB 1E7UA 3ZKJC 3QJZA 1M94A 2ZZPB 2BKRB 2YLMA 2JRHA 2IO2B 2JRIB 1UBQA 2NBWB 2KC1A 4IM3A 2MBEA 4PS7A 1YX5B 2FCMA 2JWZA 4W9GA 1WM2A 4XC2A 5JH5C 1MG8A 1HE8A 2MBHA 2WX1A 2HE7A 4DK5A 1QZEA 2UYZB 1E90A 3H7PA 2MRPA 5JHBA 3L13A 3CSTA 4I6LB 2DHZA 1C3TA 2GBKA 1VD2A 3W1YA 4B9KA 2BWES 3ZRCA 2L7RA 1WIAA 2RSUA 4ANUA 3VFKA 4HVBA 3HIZA 5J17A 3W1SC 2KLCA 2KNBA 4MEMA 2MW5A 2PE9A 2I1JA 4TV3A 2LRWA 2KTRB 4KSKC 2IYDB 3NZSA 4W9CA 3VXWA 3TBLD 4IWPA 4MGZE 3DBLI 4LDTB 2MWSB 4DBGA 1RRBA 2YVCA 3K9PB 1Q1OA 4G50A 4GIVA 4MGIE 2FCNA 1V9JA 3DQVA 4WWOA 1SGHA 3KH0A 5D7GA 1GG3A 2BWFA 3ZNGC 2JVCA 2WWZA 2J0KA 2UWQA 4JQWC 4TUUA 2V3SA 1WX8A 4BKSA 3OLMD 5DPTA 3IG3A 3TJPA 2KK8A 2KVRA 2MP2B 2JPHA 3VVWB 1ISNA 2Y5BB 2D2QA 3JVZX 4HDOA 2LD9A 1E8ZA 3R7RA 1WY8A 3ONSA 4ANXA 4FHKA 3L10B 2DZKA 3R66C 4MJSA 2GBMA 4GU2A 2KHWB 2HJ8A 1H8CA 3ML9A 3JSVB 3QIJA 2IO3B 1C1YB 4M8MA 3ECIA 2IO0B 4AUQC 3N30A 5JZEB 4OVUA 5E6OA 2O6VB 2FAZA 5D6JB 2GOWA 2M0XA 3QX1A 4GDLA 4DHJB 4DHJD 3H1UA 4NNJB 2KKCA 3A4RA 3L54A 2AL6A 2KFKA 1TZ1A 3N3KB 2PEAA 3MJWA 4A3PA 4WJPA 4MH0E 4DHZE 3VH4B 5J2RA 1OEYA 4KIKA 1SE9A 2N9XA 3DPDA 3TMPB 1P0RA 3VH3B 2C9WB 4JL9A 4ZRKA 4AOFA 3NZUA 2NR2A 2D11A 5C1ZA 2KXJA 2XK5A 1WXMA 3QCAA 3KVFB 4DWFA 1V86A 1GJZA 1WMHB 2LGYA 1GNUA 3PRMB 2IZVB 2R2QA 3U7DA 1WX9A 2D3GA 1UH6A 5DPWA 2N7DA 4KVGB 2KOXA 1UZXB 1P3QU 4WWNA 4NAWA 2GMIC 3O65B 2M17A 3KYCD 3UGBB 3S2AA 2MBBB 4BKSD 5LXIB 4ZRIA 2KWUB 4FADA 4W9KA 1I35A 1E7VA 4M0WB 2AYOB 4WJOA 2BYVE 2JXXA 3R3MA 3PRZA 2L05A 4HXDA 2MQJA 2NCNA 4FLHA 2DYOA 5HKHA 2ZNVB 4MM3A 2LGXA 2DENB 4AJWA 1H4RA 1OQYA 2JF5A 2N4FA 1WXSA 4FULA 2Z59B 2CKHB 3DVNV 2KDFB 4GB9A 2MP2A 3ZNID 3MTNB 1E8WA 2EKEC 1WM3A 3DDCB 3QHTA 4HCPB 4RMAA 1WJ6A 4P7IA 3HHMA 4IG7B 4K1RB 4CHKA 3EHVA 1WF9A 5AZHA 2MCNB 4KZ0A 2KD0A 1TTNA 3TL5A 4MJSB 4G3XB 4CO7A 3VTUA 3RYTA 1R4MI 3DBSA 3QAQA 2NBUA 2L0FA 2WX0A 1P9DU 2BF8B 1YD8U 2DZJA 2KC2A 3DVGY 3JSVA 4IW0A 3UIOB 4EFOA 2FIDA 3RUIB 4NAWB 3X0WA 4W9FA 2O2VB 2OJRA
chains in the Genus database with same CATH superfamily
2LJIA 2LZ6A 3ZYYX 4W9IA 3ZW3A 4FJVB 4YL8A 2ON8A 3B1LX 3Q6BA 2W54A 4K7WA 3ZNHB 2BPSA 3DOWA 2WP9B 2M56B 2X38A 3PLVA 2FBWB 2LASA 3RCZA 2ASQA 3PV1A 4HJGE 4BKTA 4K7SA 2X8XX 3DBHI 4FN2A 4LJPB 2MBQA 4IC7B 1NI2A 3IXSA 2RDBC 4KV2A 3IFWB 1N60A 1L7YA 5CX3A 5IKCM 1XO3A 4YT0B 3H7SA 3NZ3A 2QHOA 1IPGA 4XE0A 5FK9C 3EUB2 4LCDE 2KT7A 3U2SC 4YTMB 2J0JA 3Q8CA 3SFEB 4MGYE 4MDKE 2LFIA 2LXAA 3AEFB 2CHZA 3K9OB 1JRPA 4E71A 3MP9A 1VR9A 4GOCA 4WWMA 1RLFA 3GB1A 1LO5D 1XLNA 2JUOA 4JIOU 4RCOA 1WX7A 1R7SA 4NJ7A 5G2NA 1WH3A 3OAWA 2D3CA 3AEGB 5AZFA 4OW0A 5CHVC 2L76A 3L17A 2KWVB 3ZGZA 3WALA 2G45B 2INNE 3TSSA 3B0AA 2JU6X 2UU7A 3AE2B 3W5VB 1L2NA 4NQKE 1QOGA 1T0SC 4RGMA 1CZPA 4DHZB 1V8CA 4REZA 4F1SA 3SHQA 2JZ3B 2KFJA 5C2TB 4E74A 1KLUD 3DVGX 4WWPA 2FCQA 1YQBA 2BVCA 4K7UA 4RM9A 2ZVOA 4KGRA 2EMSA 2MJDA 1KF6B 1WE6A 2CJNA 4OVZA 4WQOB 2IY0B 1WXQA 2CU3A 2BS4B 5H92C 3J9CA 3VUYA 2MA9B 2GBNA 2CJOA 2NPTA 4RGNA 2WXHA 4JWUC 2V0GA 4PK1A 2DZIA 4TKNA 1WYWB 2WXRA 3P2BA 4XX5A 4I6PA 1P1AA 3P4SB 1MJDA 3MC8A 2K25A 3NVWA 1A5RA 4OVVA 1VDVA 1J7BA 1TYGB 1FO4A 2AEHA 5CHWA 3KWLA 1ZP0B 2KZRA 5C23A 4DDGD 2L0TA 3A9JB 1RFKA 1F1HA 1JRUA 4JGHB 5EE9A 2WXFA 1UGJA 1T6BX 3MC9A 3Q3OC 4BKGA 4RGTA 1KM7A 1E9MA 2INCC 3ENEA 1JQ4A 2LVPA 3PZ8A 2GRIA 2L3ZA 3AEDB 2JYTA 1EO6A 2LGDA 5AUIA 1JW9D 3C0RB 3DBLB 4NY0A 1FFUA 1TKGA 3V62A 4N58A 2N1WA 1D6EC 4K81A 4LK0M 2K39A 4ZYSA 2LJ5A 5D94A 4FBJB 5HHDG 2RPQA 2BBCA 3ZDTA 3VAWA 2PPHA 3ZVVA 1TJEA 4DDID 3BK1A 4ZRQA 1XEEA 3Q8BA 3RI7C 2AL3A 4JE3B 1WJ4A 5JHAA 2BYFA 1T0QC 1WMHA 1N6ZA 1KRHA 3RNGC 3ZO5B 1K53A 2N1VA 2K8HA 5IP4D 1E10A 2DAJA 1GB4A 1WXAA 3U8ZA 1HQRD 4USAA 4DXGA 1VCBA 1WFYA 2D3AA 4MT5A 2K8CA 1LXDA 3ZTDA 4US8A 1E8XA 1VLBA 2VH1A 1DOYA 3W1SA 3HM6X 1E7PB 1UGMA 2JZZA 4HKZE 4GGQA 3DWGC 5CHFA 1ZXIA 5HFYA 5G5HA 2H88B 1EWYC 3AXCA 1WGYA 4ZOHC 2KTRA 1WGRA 3NG0A 5EDSA 5JXVA 5FKAC 3PPAA 4KX6B 3NHEB 4EEWA 2J7QB 2ZZPB 2LHEA 2NBWB 2KC1A 3RMKC 1MG8A 3RFZB 2HE7A 4YXDB 1JWMD 3H7PA 3CSTA 4HRSA 1KFYB 3I5JC 1FXIA 3W1YA 2LEKA 1IBXB 1JWUD 2KLCA 2PKOA 2JZPA 3VXWA 3TBLD 2Y5PA 5TSSA 3AB5A 4TSSA 3DHIC 3DQVA 1ZDVA 4C7ZA 2J0KA 2V3SA 2SEBD 2J52A 3VVWB 1NI3A 1E8ZA 1WY8A 4FHKA 3L10B 1C77A 2DZKA 3H8HA 1ZOYB 3QIJA 3T3OA 3N30A 5JZEB 3FC4A 4IDIA 4OVUA 2O6VB 2M0XA 3IAM1 4DHJB 3A4RA 2KFKA 2PEAA 1TKYA 1FPYA 3DHGC 5J2RA 3DPDA 4WAFA 1FCCC 1SBBB 1TT5B 4ZRKA 3NZUA 2D11A 3QCAA 4DWFA 2JQRB 2LGYA 3N20C 1QLBB 1UH6A 2L52A 2N7DA 2BTEA 4UDUC 4LNOA 2WXOA 4WWNA 2GMIC 3E9SA 4RF1A 1I4GA 2JX5A 5IOIA 2LHDA 3S2AA 2WXLA 4S17A 3HVZA 2R61A 4HXDA 2NCNA 5HKHA 3AM9A 1NENB 2N4FA 2Z59B 1VZ7A 1SEBD 2J53A 1E8WA 2EKEC 3QHTA 2MHJA 4RMAA 4XWTA 4IG7B 4CHKA 1K52A 5AZHA 2SAKA 4MJSB 4G3XB 3VTUA 3QAQA 2L0FA 3JSVA 1TZOA 3UIOB 1MG4A 5L95C 2WXGA 2OJRA 2O2VB 2AWTA 3DVNU 1F0ZA 2Z0DB 1S3SG 5J18A 1QOFA 5D3DA 4GDLB 1SE4A 1TS3A 3AH7A 4EZLA 3BVMA 5G55A 4EZJA 4FJYA 1PDXA 5KHQA 2NVUI 5EE3A 2J0MA 2L00B 4M02A 2RMMA 4YSXB 3BIID 2KTFA 2XK5B 1KLVA 2HD5B 1FRDA 1K51A 3PVLA 1T0RC 4HPPA 2G4DB 4LTUA 2IPKD 4WURA 3GS2A 4C00A 2FE8A 3BINA 4W9HA 2HTME 1GOZA 2N9PC 2WDVB 3SEBA 1R4MB 4FHJA 1SIFA 3U7ZA 1B9RA 4ZDVA 3URYA 2RPVA 1I42A 1EWCA 4GMVA 4AP4C 3KUDB 1E5WA 5E6PA 3HK0A 2ZNVC 2IO1B 5LNK1 1I4HA 3WCQA 3VQIA 2DWQA 1ROEA 4OZBA 2PLPA 3A4SC 1TIFA 1XLQA 1XXGA 1TS5A 4KGSA 1E8YA 3FILA 4ZRJA 3T3NA 2N9EB 3PS6A 1QF6A 4L2YA 4HDQA 1Q0WB 3ZXRA 2WDRB 5AEKB 2NS5A 3APCA 3O13A 2GB1A 2C60A 3FAHA 2ZCCA 3AEAB 2QIEB 3RULA 2D07B 2C7MB 2H89B 1UF0A 3HVDA 4NZLB 1V2YA 3V05A 1PGAA 3HRDD 4EZKA 4BOZB 3RNCC 3H9DA 2BT6A 3AU4A 1GUAB 3AN1A 3KUZA 2C5LC 3WAPA 2QJLA 1GPXA 2IGHA 3I63C 3QARA 4MSMB 3IAS1 3WA0A 3KYDD 1OQQA 3ZJUA 2M19A 1YNTE 5KHOA 3WANA 4EE2A 2ZVNA 4AWJA 3MC0B 5CTRC 2ZPYA 4A3OA 3EFCA 3AULA 3V6CB 4NJCA 1TGZB 2KANA 4G11A 3NS1A 1IP9A 3NVYA 4DQOC 1ZKHA 4TQ1A 4RNAA 2E6XA 4GDKB 3ZNZB 3CMMB 3TEXA 4II2B 2ZCBA 3OWEB 3P1MA 2BS2B 2JY6A 1J0GA 3MJ5A 1T3QA 1EF5A 2VRRB 3HUIA 2REXA 4XDDA 2M4NA 2WU2B 4FJZA 2LWPA 2CHWA 2MBOA 1OEYJ 3ZIMA 3X23A 1FNUA 1NEKB 3PHXB 1SF0A 4HWIB 4C80A 2G9HD 4KKIA 2DNFA 4NJ6A 1WGDA 2JT4B 3ETRA 3VTWA 3ZJTA 3V60A 4A9AA 5HG2A 2L8JA 2KN5A 3N1XC 4C4VA 2K1FA 2LVQA 4II3B 2IGGA 3UIPB 2XEWA 1TS4A 1BUIC 1CMXB 1PQSA 4B0MA 4AQ7A 1JCKB 2K5PA 3UINB 4MH8A 2RDHA 3KLSX 3L08A 2B3AA 5FR6A 2BKFA 1FMAD 1WJUA 2FUHB 3LJ3A 1JROA 3VUXA 2KQSA 5LLIA 3RZWC 4G0NB 1Q10A 4ICUA 4C4VB 4L23A 2GBRA 3ZUNA 2V3PA 2VZKB 3U30A 3GE3C 2WGSA 3CSFA 4OZAA 2IBIB 5BO4B 4LLGM 1P98A 2G3QB 3BYTB 4OHJA 5BMIA 3SU8X 2NBVB 2XBBC 4MACA 3W9CB 1T0YA 1N63A 4XYCA 1MI0A 4M0WA 2V3NA 4GLSC 3L4PA 4JWSC 4MSQB 3CF6E 3TCAA 5BMGA 2IDYA 3EECA 3OG5A 2N9LA 1DOXA 1HA5A 1E7UA 3QJZA 1YQ3B 4C7YA 4W9GA 1JMLA 2GLSA 5JH5C 2L83A 1QZEA 1E90A 3L13A 1AN8A 1VD2A 3ZRCA 2L7RA 2WXNA 3VFKA 5J17A 2MW5A 2IYDB 3NZSA 4IWPA 3N9YC 4LDTB 2MWSB 1RRBA 3K9PB 1V1PA 5EE0A 4GIVA 4WQMA 5D7GA 1GG3A 3ZNGC 1GAQB 1VZ8A 4JQWC 4TUUA 3TJPA 2JPHA 2D2QA 2Z8LA 4HDOA 4ZRPA 1SSNA 2LD9A 3R7RA 3ONSA 4ANXA 2Y5CA 2ZW1A 2GBMA 4GU2A 2KHWB 1PGBA 4ZHOA 3ML9A 2IO3B 2VZKD 4A55A 3ECIA 4PT5A 2IO0B 1RYJA 2BYTA 2ONQA 2FAZA 4GDLA 3QX1A 2NTTA 3L54A 3N3KB 1KTKA 1TZ1A 3P4RB 3MJWA 4DHZE 2BW2A 1L0VB 2KDMA 2KAJA 3BWUD 4JL9A 4AOFA 2NR2A 2XK5A 1WXMA 1WMHB 4A90A 1YOVB 2R2QA 3U7DA 3N1YC 4KVGB 2KOXA 1UZXB 1P3QU 4R3DA 2M17A 3KYCD 4YSZB 1I4QA 1E7VA 2WXKA 3MHZA 1YJIA 2JXXA 4S0RA 3SR6A 3AE1B 1R4NB 2ZNVB 3RNEC 4BAXA 2QCZA 4GB9A 1A70A 1PFDA 1GB1A 2PW9A 1EM7A 1YQ4B 4DXFA 1N61A 2KVZA 1TTNA 3TL5A 3DBSA 2NBUA 4BZAA 4QAYA 4EFOA 2OHFA 3RUIB 2PTLA 4NAWB 1N62A 4W9FA 4PYZA 1F2RI 3A1QB 2D10A 1YX6B 2MJEA 4US9A 1C4PA 1FXTB 2HJ1A 2N0SB 4HEA1 3VTVA 5G5GA 1QOBA 4ANWA 1TS2A 3APDA 1WI0A 3UQBA 4HKQA 3QK0A 1J19A 1S1QB 1WZ0A 1Z2MA 4IKGA 3UQAA 4Q2JA 1J7CA 1KH0A 3EFUA 3BVGA 2CU1A 2RDGA 3DHHC 4LNNA 1SJED 2YEPF 3PO0A 3WAOA 2PMVA 2KJRA 4ASWC 3OJ4B 2I2YA 1V49A 2ZEQA 3NVZA 4IM2A 3VDZA 4D2KA 5GXGB 2DYMA 5I4DA 2IGDA 3NY5A 1HEZE 3SFDB 4KGTA 4P16A 3VUWA 1XCQL 3M63B 1YN4A 1WZ3A 4YTNB 2KX3A 2R2OA 2D3BA 3H6NA 1BT0A 1WWTA 1R4NI 2LGIA 1Q5WB 3PSEB 2KN4A 2PJHA 3NS8A 3DBHB 3N32A 2Z0EB 1GC7A 3AE4B 1UWXA 3N1ZC 2CR5A 1UUPA 3MHSD 3EA6A 1EU4A 3RNBC 1VJKA 4TMAB 4HPLB 1XD3B 3Q14C 3NUHB 5MPOA 3A33B 2B76B 4F7ZA 2KDEB 4ZHPA 1NVID 3NRZA 2Q5WD 2DYBA 4B95A 1MHXA 4I6NB 3PTFC 2DX5B 4IWOA 5IO9A 2HDEA 5DPSA 4HLEA 2C7HA 1X1MA 3KUCB 1F9JA 4XWWA 3Q3MC 2WDTB 1D5MC 3Q3JA 3Q3FA 2V4LA 3PT2B 4LNKA 2LUEA 1YN3A 3PZDA 2QDFA 1V81A 4X57B 1BXTA 2PVOD 4WJQA 5LXHA 1Y56A 2GI9A 1EUVB 1TY2A 2LXCA 1YJJA 3IVFA 3AV8A 5GMVA 1RAXA 2FCSA 2RD0A 3L16A 2OOBB 4JPSA 3CIRB 3HM3A 3ZQ4A 2KJHB 3LXFA 3M95A 4HCNB 2BQQA 3TIXA 1QT9A 2RR9A 3V6EB 3AE6B 1UELA 3PHWB 5T8IA 4GSWA 3ZTCA 2KMMA 2O6VA 3A1QA 2BS3B 4W9LA 3GZNI 3QQ8B 3AE3B 4FXCA 1ZPSA 1V1PB 2K8BA 4IUMB 4LJOB 3NOBA 1YJ1A 1DGJA 4RM8A 2K9XA 4ANVA 1P7EA 4JX1C 4WJNA 4KZCA 1VZ6A 2QSDA 3JW0X 3ZRFA 3V61A 1FRRA 3ZJVA 1XCTL 1YIWA 5D2MB 1V5TA 5IA7A 2KDBA 2WXQA 3VHTC 2AQ3B 3OJ3A 2JYEA 4LDTD 1HZ5A 1WGGA 3IT4B 3QA8A 1C76A 3W2DA 2IY1B 3FKYA 5DPRA 3L0WB 2KQ7A 1ZE3D 2CS4A 1L6UA 4YWGG 1SJHD 2FIFA 3A9KA 4XZ4A 4DXAB 2WXIA 2KYWA 2ZPNA 4A8XC 3JYUA 5AUKA 2KACA 2LUMA 1CQVA 2I1KA 5BYRA 2MEKA 1J8CA 2KO3A 2EMTA 2QILA 4LNFA 3RZFA 1FXAA 1AARA 2JWUA 3MFGA 3VRAB 5D3IB 4BVUC 1ZW7A 1STEA 4HJKA 2N9KA 4P6VF 1I7HA 4ZYNA 1XLOA 2A5UA 4WAAA 3DBRI 3M3JA 1K8RB 3R2TA 1C78A 3PREA 4EOYA 3UI3A 1XT9B 1DYQA 1KLGD 4N9F4 4C56C 4WIPA 1LM8B 2WDQB 2KX0A 4J6IA 1SE2A 1WRIA 1WXVA 1IBXA 4ARCA 1AW7A 2EELA 3T9LA 3AI5A 3KW5B 4E3CA 4F8CB 1Y8RC 2G4SA 5E6NA 2DAFA 1XQQA 1JALA 2BKRB 2YLMA 3AE9B 2JRHA 2IO2B 1UBQA 2MBEA 2FCMA 2JWZA 1C79A 1HE8A 2MBHA 4DK5A 1QKZA 5JHBA 1B1ZA 1N5XA 1C3TA 2GBKA 2RSUA 1WIAA 4ANUA 1MFWA 4MEMA 2XN9C 2PE9A 1FNWA 2LRWA 2KTRB 4KSKC 2ZW0A 3LYYA 3DBLI 3TUOA 1F52A 1Q1OA 1V9JA 2FCNA 4M00A 4WWOA 5C3JB 1QILA 1WGKA 3KH0A 2AQ1B 2BWFA 2WWZA 2UWQA 5IN7A 3OLMD 5DPTA 1P7FA 1SE3A 2OEDA 2KK8A 2KVRA 2MP2B 4K3CA 1L6VA 2Y5BB 4XDCA 2L1AA 3AE7B 2HJ8A 1H8CA 1C1YB 4H2AA 2G1EA 4AUQC 5BMHA 3ABVB 3DBRB 3I9V1 1ESFA 2D5GA 2WXPA 3AMZA 3DWMA 4YTPB 2KKCA 2AL6A 3TEZA 1RWSA 4MH0E 2FUG1 3TMPB 1P0RA 1YMHE 3VH3B 2C9WB 5C1ZA 1NYQA 3B2GA 3KVFB 1GJZA 3U4EG 3PRMB 2IZVB 1WX9A 1I4XA 1AYFA 1HZ6A 2D3GA 5DPWA 4WH4A 4A6QA 2W3SA 2ACZB 3O65B 3UGBB 4BKSD 4FADA 4W9KA 4AS1A 1I35A 4M0WB 2AYOB 4WJOA 2BYVE 3R3MA 2L05A 1I4PA 4FLHA 2DYOA 4MM3A 3EGRA 4AJWA 1H4RA 1OQYA 2JF5A 1WXSA 4FULA 1EU3A 2KDFB 3ZNID 1ZDXA 3DDCB 3C19A 4P7IA 5BYSA 4M01A 4RF0A 1ACCA 1WF9A 4KZ0A 4CO7A 3RYTA 2LGSA 3VRBB 3DVGY 1P9DU 2BF8B 1YD8U 4IW0A 1C4AA 2FIDA 2QC8A 4N6EB 3X0WA 1JWAD 1WGHA 2K22A 4MELA 1FFVA 2C7NB 1L0XB 1ZUD2 2J42A 4W9DA 4ICVA 3PRPB 2INPE 2V4IB 3I3TB 1IYFA 2DBYA 4BBNF 4OZCA 1D5XC 1OTRB 4P1CC 1XLPA 1JWBD 1AWDA 3LDZE 3QC8B 3PLUA 4FA6A 2KMAA 3NJTA 4GN1A 2KJ6A 2LRUA 3ALBA 2O2VA 1EF1A 5H8YE 3BZDB 3A9JA 3FILB 3IHPC 1DOIA 2LI5A 2K6QA 2WXJA 3SD5A 1GC6A 3RN9C 3IBEA 5FR3A 2KQ4X 3B08A 1NYRA 1IGCA 4IM0A 3LB8C 4M8NA 2E3TA 1V6EA 4BBNC 2MSED 5BYQA 2CHXA 3P63A 3GOEA 3WIMA 1PGXA 3VR8B 4KIKB 1MHHE 2W82A 2DLBA 4W9EA 2WQYB 5TR5A 1WJNA 4PS3A 3APFA 1M4VA 1TKEA 4A20A 2KWDA 1NBFC 3GE8C 3RD2A 4HROA 3SDLC 2N7JA 3P42A 3PZ7A 2AQ2B 2W3RA 4HK2A 2PIAA 3PGEA 1LFDA 3NVVA 2V1YA 3Q3NC 1UBIA 4PS8A 2BGFA 1G6JA 1SIJA 1F2RC 1L4ZB 4GXBA 4BFRA 4HPMB 4B6WA 4MGKE 2JSVX 4P1BC 1NDDA 3Q69A 2I38A 1TBEA 4NQLB 1L4DB 2KWCA 4AJYB 1KJTA 2TSSA 1V5OA 3VR9B 2BYEA 2QMTA 5AZGA 2ZJDA 1FEHA 4ITKA 2W9NA 1QQRA 1CK1A 1Z5SB 4NPNA 3WAMA 3R7QA 3I57A 3KQ4A 4LNIA 2VH2A 2L32A 1PYWD 1N5WA 4PYUA 1D5ZC 3A9KB 1ZGUB 2OJWA 1JWSD 1V1OA 2LVOA 3P4QB 1K50A 1RFAA 1LQBA 1QOAA 3RT3B 3ML8A 1ENFA 2WHIA 4KSLC 1UD7A 2A4ZA 3DCGA 3P4PB 2MH7A 2K6DB 2AX5A 4KDLB 1TY0A 3D32A 3IT6B 1UNSA 1IGDA 3Q2AC 2KDIA 2MLBA 1U4AA 2WLBA 1D3ZA 2JXTA 2FNJB 3AEBB 4JLCA 1WE7A 1VRAB 3Q8FA 1FCLA 5EE1A 4GDKA 4CYEA 2GBJA 1ET6A 3AU5A 5IAAC 2O6VD 3T8MA 2M1MA 2Y3AA 3B9JA 4BOSC 4YSYB 5DCNA 3V3XA 4URKA 2DZMA 2WNMA 3E56A 1YN5A 1WR1A 1BMLC 3H7PB 3UF8A 1L0YB 4RFBA 4EKUA 4J3OD 3CWIA 2M8SA 4ACFA 2YEPB 1J7AA 3ZDMC 1F77A 1HTOA 3TEWA 1MVKA 3AEEB 1C4CA 3M62B 2EKIA 4KDIC 2HTHA 2RGFA 3ZLZA 2KMCA 3BYYB 4IWQA 1XF5L 2WS3B 3EC8A 3W5UB 4IOIE 2INDC 4W9JA 3QWZB 2N7EA 2J4XA 1ZXHA 3RNFC 1V80A 2WYQA 2V9HA 1OGWA 2NMQA 2PE6B 1LGRA 1HXYD 1E6EB 2LMCA 4EUTA 1WRDB 1MPEA 3BY4B 4L1BA 3RNAC 1FNVA 4CQNA 4N59A 2MX2A 1SB3C 2BB6A 4TQ0A 1OFFA 1KOTA 2KFKB 2NPTB 1WR6E 2MJ3A 2QEJC 2KLGA 5L83A 3ZKJC 1RM6C 1M94A 3GZNB 2WXMA 5HI1A 4ARIA 2JRIB 4IM3A 4PS7A 1YX5B 4XC2A 1WM2A 2WX1A 2XNAC 2UYZB 4O1NA 3TEYA 2MRPA 2W55A 5E6JA 3AE5B 4I6LB 1IUEA 2DHZA 4RGOS 4B9KA 2BWES 4K3BA 1D4BA 4HVBA 3HIZA 3W1SC 2KNBA 1PUTA 3AE8B 2I1JA 3BVZA 4TV3A 1ET9A 2WU5B 1WSPA 3B2FA 4W9CA 4MGZE 1L5PA 1OQRA 4DBGA 2YVCA 1T5XD 4G50A 4MGIE 3Q8EA 1SGHA 2M0AA 2K3UA 4MM3B 2JVCA 4BKSA 1WX8A 3IG3A 1ISNA 3JVZX 1FM0D 3BK2A 3ZXVA 3R66C 1WYGA 1I4RA 4MJSA 1FD6A 3JSVB 4NAMA 4M8MA 3Q8AA 5E6OA 1HTQA 5D6JB 2GOWA 4DHJD 3H1UA 4NNJB 1V97A 4A3PA 3GP7A 4WJPA 4KKJA 3VH4B 1OEYA 4KIKA 1SE9A 2N9XA 1CJEA 3KWVA 2K0PA 2KXJA 1V86A 3U52E 1GNUA 2NTSA 3C8YA 2BB5A 4NAWA 4B0EA 3AECB 2MBBB 2IJ0A 5LXIB 4ZRIA 2KWUB 3RPFC 3PRZA 2MQJA 2LGXA 2DENB 4RH6A 1C9FA 2CKHB 3DVNV 1SXTA 2MP2A 3MTNB 4HCPB 1WM3A 2ICIA 1WJ6A 3HHMA 1E0ZA 3R2IA 4K1RB 3R8BA 3EHVA 2MCNB 2KD0A 1R4MI 2WX0A 2DZJA 2KC2A 1FIQA 1UWMA 4XGAB 2PVGC
chains in the Genus database with same CATH topology
2AWTA 1WGHA 3DVNU 2Z0DB 4PYZA 3A1QB 1S3SG 2LZ6A 5J18A 4MELA 2D10A 4W9IA 3ZW3A 2C7NB 4GDLB 4FJVB 4YL8A 1YX6B 4EZLA 3B1LX 4W9DA 1FXTB 4ICVA 4K7WA 3PRPB 3VTVA 5G55A 3ZNHB 4EZJA 4ANWA 4FJYA 3I3TB 2BPSA 3APDA 1IYFA 3DOWA 4BBNF 5KHQA 1WI0A 3UQBA 2NVUI 3PLVA 3QK0A 2J0MA 1J19A 2LASA 1OTRB 3RCZA 1S1QB 2L00B 2ASQA 1WZ0A 1Z2MA 3PV1A 3LDZE 2KTFA 2XK5B 3UQAA 4BKTA 1KLVA 2HD5B 4K7SA 3QC8B 3PLUA 4FA6A 3PVLA 3EFUA 2KMAA 3DBHI 4FN2A 4LJPB 2G4DB 2CU1A 2MBQA 4GN1A 4IC7B 1NI2A 2KJ6A 2LRUA 3ALBA 4KV2A 3WAOA 3IFWB 2O2VA 1EF1A 2KJRA 4ASWC 1L7YA 3A9JA 3OJ4B 3BINA 1V49A 5CX3A 4W9HA 3IHPC 2N9PC 2ZEQA 3H7SA 4IM2A 2QHOA 1IPGA 2LI5A 3VDZA 2K6QA 4LCDE 3SD5A 1GC6A 4FHJA 2DYMA 1SIFA 2J0JA 3IBEA 3NY5A 3B08A 4ZDVA 1I42A 4MGYE 4IM0A 4GMVA 4MDKE 4AP4C 4M8NA 2LXAA 1V6EA 3KUDB 1E5WA 5E6PA 3M63B 3VUWA 4BBNC 2CHZA 3K9OB 2MSED 4E71A 1WZ3A 2CHXA 3HK0A 2ZNVC 4GOCA 3GOEA 2IO1B 2KX3A 1RLFA 3WIMA 3VQIA 4KIKB 2R2OA 2JUOA 3A4SC 4W9EA 5TR5A 1WJNA 3H6NA 4JIOU 1WX7A 1BT0A 4PS3A 1R4NI 4NJ7A 5G2NA 1WH3A 3APFA 1Q5WB 1E8YA 4A20A 3OAWA 3PSEB 4ZRJA 5AZFA 1NBFC 2PJHA 2N9EB 3PS6A 5CHVC 2L76A 3NS8A 3L17A 3RD2A 3SDLC 3N32A 4HDQA 1Q0WB 2KWVB 4HK2A 2Z0EB 5AEKB 1GC7A 3WALA 3PGEA 1LFDA 2G45B 2NS5A 2V1YA 2CR5A 3APCA 3MHSD 2C60A 3B0AA 1UBIA 2ZCCA 1L2NA 3RULA 2D07B 2C7MB 4PS8A 4NQKE 4HPLB 2BGFA 1XD3B 1G6JA 4DHZB 4GXBA 4BFRA 4HPMB 4B6WA 1V2YA 3A33B 4MGKE 4EZKA 4F7ZA 2KDEB 1NDDA 4BOZB 3H9DA 4F1SA 3SHQA 2JZ3B 2KFJA 2DYBA 1TBEA 3AU4A 4NQLB 4E74A 1GUAB 2KWCA 3DVGX 4B95A 3KUZA 4AJYB 1KJTA 2C5LC 3WAPA 4I6NB 3PTFC 4WWPA 2DX5B 1V5OA 2FCQA 4IWOA 2BYEA 1YQBA 3QARA 4MSMB 4K7UA 4RM9A 2ZVOA 5DPSA 3WA0A 5AZGA 2ZJDA 3KYDD 4HLEA 2C7HA 2W9NA 1X1MA 3KUCB 1F9JA 2EMSA 1Z5SB 4NPNA 5KHOA 3WANA 3WAMA 3R7QA 1WE6A 2WDTB 2ZVNA 4WQOB 4AWJA 2IY0B 5CTRC 2ZPYA 3Q3JA 3Q3FA 4A3OA 2V4LA 3AULA 3V6CB 3PT2B 3VUYA 2MA9B 2GBNA 4PYUA 3A9KB 1TGZB 2LUEA 2KANA 1ZGUB 4G11A 3PZDA 2NPTA 1IP9A 1V81A 4X57B 2LVOA 4WJQA 2DZIA 4TKNA 5LXHA 1WYWB 1ZKHA 1RFAA 3P2BA 1EUVB 4TQ1A 4I6PA 4XX5A 1LQBA 2LXCA 3RT3B 3IVFA 3ML8A 4GDKB 5GMVA 3ZNZB 1RAXA 2FCSA 3CMMB 4KSLC 1UD7A 2A4ZA 2RD0A 1P1AA 3DCGA 4II2B 3L16A 2ZCBA 1J0GA 2JY6A 2OOBB 2K6DB 3HM3A 2K25A 4KDLB 1EF5A 2VRRB 2KJHB 3M95A 2REXA 4HCNB 1A5RA 4OVVA 3TIXA 3D32A 2M4NA 2RR9A 3V6EB 2AEHA 5CHWA 4FJZA 2LWPA 2KDIA 1UELA 2CHWA 2KZRA 3PHWB 5C23A 2MBOA 1OEYJ 2MLBA 4GSWA 3ZIMA 3X23A 3ZTCA 4DDGD 1U4AA 2L0TA 2O6VA 3A1QA 3A9JB 3PHXB 4HWIB 4W9LA 3GZNI 1JRUA 3QQ8B 4JGHB 1D3ZA 2K8BA 4NJ6A 4IUMB 3NOBA 1YJ1A 2FNJB 1WGDA 4LJOB 2JT4B 4BKGA 4RM8A 1KM7A 3ENEA 4ANVA 4JLCA 1WE7A 3VTWA 2LVPA 4WJNA 3V60A 4KZCA 3JW0X 2L8JA 2KN5A 4GDKA 3ZRFA 4CYEA 3V61A 2GBJA 1YIWA 2L3ZA 5D2MB 1V5TA 2K1FA 2LVQA 3AU5A 2O6VD 5IAAC 5IA7A 2KDBA 1EO6A 4II3B 3T8MA 3VHTC 2LGDA 2M1MA 3UIPB 2XEWA 3C0RB 3OJ3A 1CMXB 1PQSA 4BOSC 4NY0A 5DCNA 4LDTD 2DZMA 4URKA 1WGGA 3V62A 3QA8A 2N1WA 3UINB 2IY1B 4K81A 2K39A 5DPRA 2LJ5A 3L0WB 2KQ7A 5D94A 1WR1A 2CS4A 3L08A 4FBJB 2B3AA 2FIFA 3H7PB 3UF8A 3A9KA 4XZ4A 2RPQA 5FR6A 2BKFA 4EKUA 4DXAB 2ZPNA 3ZDTA 2M8SA 3JYUA 1WJUA 3VAWA 5L95C 2PPHA 3ZVVA 3ZDMC 4DDID 2FUHB 2I1KA 3LJ3A 3VUXA 2KQSA 5LLIA 1J8CA 3RZWC 2KO3A 2EMTA 4G0NB 3RZFA 4ICUA 3M62B 1AARA 4KDIC 2HTHA 2AL3A 2RGFA 3ZLZA 2GBRA 3ZUNA 1WJ4A 2KMCA 3U30A 4IWQA 4BVUC 3CSFA 3EC8A 5JHAA 1ZW7A 2BYFA 4HJKA 2IBIB 5BO4B 1WMHA 4ZYNA 1P98A 3QWZB 4W9JA 2G3QB 2N7EA 2A5UA 3ZO5B 4WAAA 3DBRI 2N1VA 2K8HA 3SU8X 3M3JA 2DAJA 2NBVB 1V80A 2XBBC 1WXAA 1K8RB 2WYQA 3U8ZA 1OGWA 3PREA 1VCBA 1WFYA 1T0YA 4EOYA 2K8CA 1LXDA 2PE6B 3ZTDA 1XT9B 1E8XA 4N9F4 3W1SA 4EUTA 1LM8B 3HM6X 4J6IA 1WRDB 1UGMA 2JZZA 2KX0A 4GGQA 5CHFA 1WXVA 3BY4B 3AXCA 3T9LA 1WGYA 3AI5A 2KTRA 3KW5B 1WGRA 4MSQB 2MX2A 5EDSA 3CF6E 4E3CA 3TCAA 4F8CB 1Y8RC 4TQ0A 2G4SA 1KOTA 2KFKB 3EECA 2NPTB 1WR6E 5E6NA 2DAFA 1XQQA 2KLGA 3PPAA 5L83A 3NHEB 4EEWA 2J7QB 1E7UA 3ZKJC 3QJZA 1M94A 2ZZPB 2BKRB 2YLMA 2JRHA 2IO2B 2JRIB 1UBQA 2NBWB 2KC1A 4IM3A 2MBEA 4PS7A 1YX5B 2FCMA 2JWZA 4W9GA 1WM2A 4XC2A 5JH5C 1MG8A 1HE8A 2MBHA 2WX1A 2HE7A 4DK5A 1QZEA 2UYZB 1E90A 3H7PA 2MRPA 5JHBA 3L13A 3CSTA 4I6LB 2DHZA 1C3TA 2GBKA 1VD2A 3W1YA 4B9KA 2BWES 3ZRCA 2L7RA 1WIAA 2RSUA 4ANUA 3VFKA 4HVBA 3HIZA 5J17A 3W1SC 2KLCA 2KNBA 4MEMA 2MW5A 2PE9A 2I1JA 4TV3A 2LRWA 2KTRB 4KSKC 2IYDB 3NZSA 4W9CA 3VXWA 3TBLD 4IWPA 4MGZE 3DBLI 4LDTB 2MWSB 4DBGA 1RRBA 2YVCA 3K9PB 1Q1OA 4G50A 4GIVA 4MGIE 2FCNA 1V9JA 3DQVA 4WWOA 1SGHA 3KH0A 5D7GA 1GG3A 2BWFA 3ZNGC 2JVCA 2WWZA 2J0KA 2UWQA 4JQWC 4TUUA 2V3SA 1WX8A 4BKSA 3OLMD 5DPTA 3IG3A 3TJPA 2KK8A 2KVRA 2MP2B 2JPHA 3VVWB 1ISNA 2Y5BB 2D2QA 3JVZX 4HDOA 2LD9A 1E8ZA 3R7RA 1WY8A 3ONSA 4ANXA 4FHKA 3L10B 2DZKA 3R66C 4MJSA 2GBMA 4GU2A 2KHWB 2HJ8A 1H8CA 3ML9A 3JSVB 3QIJA 2IO3B 1C1YB 4M8MA 3ECIA 2IO0B 4AUQC 3N30A 5JZEB 4OVUA 5E6OA 2O6VB 2FAZA 5D6JB 2GOWA 2M0XA 3QX1A 4GDLA 4DHJB 4DHJD 3H1UA 4NNJB 2KKCA 3A4RA 3L54A 2AL6A 2KFKA 1TZ1A 3N3KB 2PEAA 3MJWA 4A3PA 4WJPA 4MH0E 4DHZE 3VH4B 5J2RA 1OEYA 4KIKA 1SE9A 2N9XA 3DPDA 3TMPB 1P0RA 3VH3B 2C9WB 4JL9A 4ZRKA 4AOFA 3NZUA 2NR2A 2D11A 5C1ZA 2KXJA 2XK5A 1WXMA 3QCAA 3KVFB 4DWFA 1V86A 1GJZA 1WMHB 2LGYA 1GNUA 3PRMB 2IZVB 2R2QA 3U7DA 1WX9A 2D3GA 1UH6A 5DPWA 2N7DA 4KVGB 2KOXA 1UZXB 1P3QU 4WWNA 4NAWA 2GMIC 3O65B 2M17A 3KYCD 3UGBB 3S2AA 2MBBB 4BKSD 5LXIB 4ZRIA 2KWUB 4FADA 4W9KA 1I35A 1E7VA 4M0WB 2AYOB 4WJOA 2BYVE 2JXXA 3R3MA 3PRZA 2L05A 4HXDA 2MQJA 2NCNA 4FLHA 2DYOA 5HKHA 2ZNVB 4MM3A 2LGXA 2DENB 4AJWA 1H4RA 1OQYA 2JF5A 2N4FA 1WXSA 4FULA 2Z59B 2CKHB 3DVNV 2KDFB 4GB9A 2MP2A 3ZNID 3MTNB 1E8WA 2EKEC 1WM3A 3DDCB 3QHTA 4HCPB 4RMAA 1WJ6A 4P7IA 3HHMA 4IG7B 4K1RB 4CHKA 3EHVA 1WF9A 5AZHA 2MCNB 4KZ0A 2KD0A 1TTNA 3TL5A 4MJSB 4G3XB 4CO7A 3VTUA 3RYTA 1R4MI 3DBSA 3QAQA 2NBUA 2L0FA 2WX0A 1P9DU 2BF8B 1YD8U 2DZJA 2KC2A 3DVGY 3JSVA 4IW0A 3UIOB 4EFOA 2FIDA 3RUIB 4NAWB 3X0WA 4W9FA 2O2VB 2OJRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AWT A;  1WGH A;  3DVN U;  2Z0D B;  4PYZ A;  3A1Q B;  1S3S G;  2LZ6 A;  5J18 A;  4MEL A;  2D10 A;  4W9I A;  3ZW3 A;  2C7N B;  4GDL B;  4FJV B;  4YL8 A;  1YX6 B;  4EZL A;  3B1L X;  4W9D A;  1FXT B;  4ICV A;  4K7W A;  3PRP B;  3VTV A;  5G55 A;  3ZNH B;  4EZJ A;  4ANW A;  4FJY A;  3I3T B;  2BPS A;  3APD A;  1IYF A;  3DOW A;  4BBN F;  5KHQ A;  1WI0 A;  3UQB A;  2NVU I;  3PLV A;  3QK0 A;  2J0M A;  1J19 A;  2LAS A;  1OTR B;  3RCZ A;  1S1Q B;  2L00 B;  2ASQ A;  1WZ0 A;  1Z2M A;  3PV1 A;  3LDZ E;  2KTF A;  2XK5 B;  3UQA A;  4BKT A;  1KLV A;  2HD5 B;  4K7S A;  3QC8 B;  3PLU A;  4FA6 A;  3PVL A;  3EFU A;  2KMA A;  3DBH I;  4FN2 A;  4LJP B;  2G4D B;  2CU1 A;  2MBQ A;  4GN1 A;  4IC7 B;  1NI2 A;  2KJ6 A;  2LRU A;  3ALB A;  4KV2 A;  3WAO A;  3IFW B;  2O2V A;  1EF1 A;  2KJR A;  4ASW C;  1L7Y A;  3A9J A;  3OJ4 B;  3BIN A;  1V49 A;  5CX3 A;  4W9H A;  3IHP C;  2N9P C;  2ZEQ A;  3H7S A;  4IM2 A;  2QHO A;  1IPG A;  2LI5 A;  3VDZ A;  2K6Q A;  4LCD E;  3SD5 A;  1GC6 A;  4FHJ A;  2DYM A;  1SIF A;  2J0J A;  3IBE A;  3NY5 A;  3B08 A;  4ZDV A;  1I42 A;  4MGY E;  4IM0 A;  4GMV A;  4MDK E;  4AP4 C;  4M8N A;  2LXA A;  1V6E A;  3KUD B;  1E5W A;  5E6P A;  3M63 B;  3VUW A;  4BBN C;  2CHZ A;  3K9O B;  2MSE D;  4E71 A;  1WZ3 A;  2CHX A;  3HK0 A;  2ZNV C;  4GOC A;  3GOE A;  2IO1 B;  2KX3 A;  1RLF A;  3WIM A;  3VQI A;  4KIK B;  2R2O A;  2JUO A;  3A4S C;  4W9E A;  5TR5 A;  1WJN A;  3H6N A;  4JIO U;  1WX7 A;  1BT0 A;  4PS3 A;  1R4N I;  4NJ7 A;  5G2N A;  1WH3 A;  3APF A;  1Q5W B;  1E8Y A;  4A20 A;  3OAW A;  3PSE B;  4ZRJ A;  5AZF A;  1NBF C;  2PJH A;  2N9E B;  3PS6 A;  5CHV C;  2L76 A;  3NS8 A;  3L17 A;  3RD2 A;  3SDL C;  3N32 A;  4HDQ A;  1Q0W B;  2KWV B;  4HK2 A;  2Z0E B;  5AEK B;  1GC7 A;  3WAL A;  3PGE A;  1LFD A;  2G45 B;  2NS5 A;  2V1Y A;  2CR5 A;  3APC A;  3MHS D;  2C60 A;  3B0A A;  1UBI A;  2ZCC A;  1L2N A;  3RUL A;  2D07 B;  2C7M B;  4PS8 A;  4NQK E;  4HPL B;  2BGF A;  1XD3 B;  1G6J A;  4DHZ B;  4GXB A;  4BFR A;  4HPM B;  4B6W A;  1V2Y A;  3A33 B;  4MGK E;  4EZK A;  4F7Z A;  2KDE B;  1NDD A;  4BOZ B;  3H9D A;  4F1S A;  3SHQ A;  2JZ3 B;  2KFJ A;  2DYB A;  1TBE A;  3AU4 A;  4NQL B;  4E74 A;  1GUA B;  2KWC A;  3DVG X;  4B95 A;  3KUZ A;  4AJY B;  1KJT A;  2C5L C;  3WAP A;  4I6N B;  3PTF C;  4WWP A;  2DX5 B;  1V5O A;  2FCQ A;  4IWO A;  2BYE A;  1YQB A;  3QAR A;  4MSM B;  4K7U A;  4RM9 A;  2ZVO A;  5DPS A;  3WA0 A;  5AZG A;  2ZJD A;  3KYD D;  4HLE A;  2C7H A;  2W9N A;  1X1M A;  3KUC B;  1F9J A;  2EMS A;  1Z5S B;  4NPN A;  5KHO A;  3WAN A;  3WAM A;  3R7Q A;  1WE6 A;  2WDT B;  2ZVN A;  4WQO B;  4AWJ A;  2IY0 B;  5CTR C;  2ZPY A;  3Q3J A;  3Q3F A;  4A3O A;  2V4L A;  3AUL A;  3V6C B;  3PT2 B;  3VUY A;  2MA9 B;  2GBN A;  4PYU A;  3A9K B;  1TGZ B;  2LUE A;  2KAN A;  1ZGU B;  4G11 A;  3PZD A;  2NPT A;  1IP9 A;  1V81 A;  4X57 B;  2LVO A;  4WJQ A;  2DZI A;  4TKN A;  5LXH A;  1WYW B;  1ZKH A;  1RFA A;  3P2B A;  1EUV B;  4TQ1 A;  4I6P A;  4XX5 A;  1LQB A;  2LXC A;  3RT3 B;  3IVF A;  3ML8 A;  4GDK B;  5GMV A;  3ZNZ B;  1RAX A;  2FCS A;  3CMM B;  4KSL C;  1UD7 A;  2A4Z A;  2RD0 A;  1P1A A;  3DCG A;  4II2 B;  3L16 A;  2ZCB A;  1J0G A;  2JY6 A;  2OOB B;  2K6D B;  3HM3 A;  2K25 A;  4KDL B;  1EF5 A;  2VRR B;  2KJH B;  3M95 A;  2REX A;  4HCN B;  1A5R A;  4OVV A;  3TIX A;  3D32 A;  2M4N A;  2RR9 A;  3V6E B;  2AEH A;  5CHW A;  4FJZ A;  2LWP A;  2KDI A;  1UEL A;  2CHW A;  2KZR A;  3PHW B;  5C23 A;  2MBO A;  1OEY J;  2MLB A;  4GSW A;  3ZIM A;  3X23 A;  3ZTC A;  4DDG D;  1U4A A;  2L0T A;  2O6V A;  3A1Q A;  3A9J B;  3PHX B;  4HWI B;  4W9L A;  3GZN I;  1JRU A;  3QQ8 B;  4JGH B;  1D3Z A;  2K8B A;  4NJ6 A;  4IUM B;  3NOB A;  1YJ1 A;  2FNJ B;  1WGD A;  4LJO B;  2JT4 B;  4BKG A;  4RM8 A;  1KM7 A;  3ENE A;  4ANV A;  4JLC A;  1WE7 A;  3VTW A;  2LVP A;  4WJN A;  3V60 A;  4KZC A;  3JW0 X;  2L8J A;  2KN5 A;  4GDK A;  3ZRF A;  4CYE A;  3V61 A;  2GBJ A;  1YIW A;  2L3Z A;  5D2M B;  1V5T A;  2K1F A;  2LVQ A;  3AU5 A;  2O6V D;  5IAA C;  5IA7 A;  2KDB A;  1EO6 A;  4II3 B;  3T8M A;  3VHT C;  2LGD A;  2M1M A;  3UIP B;  2XEW A;  3C0R B;  3OJ3 A;  1CMX B;  1PQS A;  4BOS C;  4NY0 A;  5DCN A;  4LDT D;  2DZM A;  4URK A;  1WGG A;  3V62 A;  3QA8 A;  2N1W A;  3UIN B;  2IY1 B;  4K81 A;  2K39 A;  5DPR A;  2LJ5 A;  3L0W B;  2KQ7 A;  5D94 A;  1WR1 A;  2CS4 A;  3L08 A;  4FBJ B;  2B3A A;  2FIF A;  3H7P B;  3UF8 A;  3A9K A;  4XZ4 A;  2RPQ A;  5FR6 A;  2BKF A;  4EKU A;  4DXA B;  2ZPN A;  3ZDT A;  2M8S A;  3JYU A;  1WJU A;  3VAW A;  5L95 C;  2PPH A;  3ZVV A;  3ZDM C;  4DDI D;  2FUH B;  2I1K A;  3LJ3 A;  3VUX A;  2KQS A;  5LLI A;  1J8C A;  3RZW C;  2KO3 A;  2EMT A;  4G0N B;  3RZF A;  4ICU A;  3M62 B;  1AAR A;  4KDI C;  2HTH A;  2AL3 A;  2RGF A;  3ZLZ A;  2GBR A;  3ZUN A;  1WJ4 A;  2KMC A;  3U30 A;  4IWQ A;  4BVU C;  3CSF A;  3EC8 A;  5JHA A;  1ZW7 A;  2BYF A;  4HJK A;  2IBI B;  5BO4 B;  1WMH A;  4ZYN A;  1P98 A;  3QWZ B;  4W9J A;  2G3Q B;  2N7E A;  2A5U A;  3ZO5 B;  4WAA A;  3DBR I;  2N1V A;  2K8H A;  3SU8 X;  3M3J A;  2DAJ A;  2NBV B;  1V80 A;  2XBB C;  1WXA A;  1K8R B;  2WYQ A;  3U8Z A;  1OGW A;  3PRE A;  1VCB A;  1WFY A;  1T0Y A;  4EOY A;  2K8C A;  1LXD A;  2PE6 B;  3ZTD A;  1XT9 B;  1E8X A;  4N9F 4;  3W1S A;  4EUT A;  1LM8 B;  3HM6 X;  4J6I A;  1WRD B;  1UGM A;  2JZZ A;  2KX0 A;  4GGQ A;  5CHF A;  1WXV A;  3BY4 B;  3AXC A;  3T9L A;  1WGY A;  3AI5 A;  2KTR A;  3KW5 B;  1WGR A;  4MSQ B;  2MX2 A;  5EDS A;  3CF6 E;  4E3C A;  3TCA A;  4F8C B;  1Y8R C;  4TQ0 A;  2G4S A;  1KOT A;  2KFK B;  3EEC A;  2NPT B;  1WR6 E;  5E6N A;  2DAF A;  1XQQ A;  2KLG A;  3PPA A;  5L83 A;  3NHE B;  4EEW A;  2J7Q B;  1E7U A;  3ZKJ C;  3QJZ A;  1M94 A;  2ZZP B;  2BKR B;  2YLM A;  2JRH A;  2IO2 B;  2JRI B;  1UBQ A;  2NBW B;  2KC1 A;  4IM3 A;  2MBE A;  4PS7 A;  1YX5 B;  2FCM A;  2JWZ A;  4W9G A;  1WM2 A;  4XC2 A;  5JH5 C;  1MG8 A;  1HE8 A;  2MBH A;  2WX1 A;  2HE7 A;  4DK5 A;  1QZE A;  2UYZ B;  1E90 A;  3H7P A;  2MRP A;  5JHB A;  3L13 A;  3CST A;  4I6L B;  2DHZ A;  1C3T A;  2GBK A;  1VD2 A;  3W1Y A;  4B9K A;  2BWE S;  3ZRC A;  2L7R A;  1WIA A;  2RSU A;  4ANU A;  3VFK A;  4HVB A;  3HIZ A;  5J17 A;  3W1S C;  2KLC A;  2KNB A;  4MEM A;  2MW5 A;  2PE9 A;  2I1J A;  4TV3 A;  2LRW A;  2KTR B;  4KSK C;  2IYD B;  3NZS A;  4W9C A;  3VXW A;  3TBL D;  4IWP A;  4MGZ E;  3DBL I;  4LDT B;  2MWS B;  4DBG A;  1RRB A;  2YVC A;  3K9P B;  1Q1O A;  4G50 A;  4GIV A;  4MGI E;  2FCN A;  1V9J A;  3DQV A;  4WWO A;  1SGH A;  3KH0 A;  5D7G A;  1GG3 A;  2BWF A;  3ZNG C;  2JVC A;  2WWZ A;  2J0K A;  2UWQ A;  4JQW C;  4TUU A;  2V3S A;  1WX8 A;  4BKS A;  3OLM D;  5DPT A;  3IG3 A;  3TJP A;  2KK8 A;  2KVR A;  2MP2 B;  2JPH A;  3VVW B;  1ISN A;  2Y5B B;  2D2Q A;  3JVZ X;  4HDO A;  2LD9 A;  1E8Z A;  3R7R A;  1WY8 A;  3ONS A;  4ANX A;  4FHK A;  3L10 B;  2DZK A;  3R66 C;  4MJS A;  2GBM A;  4GU2 A;  2KHW B;  2HJ8 A;  1H8C A;  3ML9 A;  3JSV B;  3QIJ A;  2IO3 B;  1C1Y B;  4M8M A;  3ECI A;  2IO0 B;  4AUQ C;  3N30 A;  5JZE B;  4OVU A;  5E6O A;  2O6V B;  2FAZ A;  5D6J B;  2GOW A;  2M0X A;  3QX1 A;  4GDL A;  4DHJ B;  4DHJ D;  3H1U A;  4NNJ B;  2KKC A;  3A4R A;  3L54 A;  2AL6 A;  2KFK A;  1TZ1 A;  3N3K B;  2PEA A;  3MJW A;  4A3P A;  4WJP A;  4MH0 E;  4DHZ E;  3VH4 B;  5J2R A;  1OEY A;  4KIK A;  1SE9 A;  2N9X A;  3DPD A;  3TMP B;  1P0R A;  3VH3 B;  2C9W B;  4JL9 A;  4ZRK A;  4AOF A;  3NZU A;  2NR2 A;  2D11 A;  5C1Z A;  2KXJ A;  2XK5 A;  1WXM A;  3QCA A;  3KVF B;  4DWF A;  1V86 A;  1GJZ A;  1WMH B;  2LGY A;  1GNU A;  3PRM B;  2IZV B;  2R2Q A;  3U7D A;  1WX9 A;  2D3G A;  1UH6 A;  5DPW A;  2N7D A;  4KVG B;  2KOX A;  1UZX B;  1P3Q U;  4WWN A;  4NAW A;  2GMI C;  3O65 B;  2M17 A;  3KYC D;  3UGB B;  3S2A A;  2MBB B;  4BKS D;  5LXI B;  4ZRI A;  2KWU B;  4FAD A;  4W9K A;  1I35 A;  1E7V A;  4M0W B;  2AYO B;  4WJO A;  2BYV E;  2JXX A;  3R3M A;  3PRZ A;  2L05 A;  4HXD A;  2MQJ A;  2NCN A;  4FLH A;  2DYO A;  5HKH A;  2ZNV B;  4MM3 A;  2LGX A;  2DEN B;  4AJW A;  1H4R A;  1OQY A;  2JF5 A;  2N4F A;  1WXS A;  4FUL A;  2Z59 B;  2CKH B;  3DVN V;  2KDF B;  4GB9 A;  2MP2 A;  3ZNI D;  3MTN B;  1E8W A;  2EKE C;  1WM3 A;  3DDC B;  3QHT A;  4HCP B;  4RMA A;  1WJ6 A;  4P7I A;  3HHM A;  4IG7 B;  4K1R B;  4CHK A;  3EHV A;  1WF9 A;  5AZH A;  2MCN B;  4KZ0 A;  2KD0 A;  1TTN A;  3TL5 A;  4MJS B;  4G3X B;  4CO7 A;  3VTU A;  3RYT A;  1R4M I;  3DBS A;  3QAQ A;  2NBU A;  2L0F A;  2WX0 A;  1P9D U;  2BF8 B;  1YD8 U;  2DZJ A;  2KC2 A;  3DVG Y;  3JSV A;  4IW0 A;  3UIO B;  4EFO A;  2FID A;  3RUI B;  4NAW B;  3X0W A;  4W9F A;  2O2V B;  2OJR A; 
#chains in the Genus database with same CATH topology
 2LJI A;  2LZ6 A;  3ZYY X;  4W9I A;  3ZW3 A;  4FJV B;  4YL8 A;  2ON8 A;  3B1L X;  3Q6B A;  2W54 A;  4K7W A;  3ZNH B;  2BPS A;  3DOW A;  2WP9 B;  2M56 B;  2X38 A;  3PLV A;  2FBW B;  2LAS A;  3RCZ A;  2ASQ A;  3PV1 A;  4HJG E;  4BKT A;  4K7S A;  2X8X X;  3DBH I;  4FN2 A;  4LJP B;  2MBQ A;  4IC7 B;  1NI2 A;  3IXS A;  2RDB C;  4KV2 A;  3IFW B;  1N60 A;  1L7Y A;  5CX3 A;  5IKC M;  1XO3 A;  4YT0 B;  3H7S A;  3NZ3 A;  2QHO A;  1IPG A;  4XE0 A;  5FK9 C;  3EUB 2;  4LCD E;  2KT7 A;  3U2S C;  4YTM B;  2J0J A;  3Q8C A;  3SFE B;  4MGY E;  4MDK E;  2LFI A;  2LXA A;  3AEF B;  2CHZ A;  3K9O B;  1JRP A;  4E71 A;  3MP9 A;  1VR9 A;  4GOC A;  4WWM A;  1RLF A;  3GB1 A;  1LO5 D;  1XLN A;  2JUO A;  4JIO U;  4RCO A;  1WX7 A;  1R7S A;  4NJ7 A;  5G2N A;  1WH3 A;  3OAW A;  2D3C A;  3AEG B;  5AZF A;  4OW0 A;  5CHV C;  2L76 A;  3L17 A;  2KWV B;  3ZGZ A;  3WAL A;  2G45 B;  2INN E;  3TSS A;  3B0A A;  2JU6 X;  2UU7 A;  3AE2 B;  3W5V B;  1L2N A;  4NQK E;  1QOG A;  1T0S C;  4RGM A;  1CZP A;  4DHZ B;  1V8C A;  4REZ A;  4F1S A;  3SHQ A;  2JZ3 B;  2KFJ A;  5C2T B;  4E74 A;  1KLU D;  3DVG X;  4WWP A;  2FCQ A;  1YQB A;  2BVC A;  4K7U A;  4RM9 A;  2ZVO A;  4KGR A;  2EMS A;  2MJD A;  1KF6 B;  1WE6 A;  2CJN A;  4OVZ A;  4WQO B;  2IY0 B;  1WXQ A;  2CU3 A;  2BS4 B;  5H92 C;  3J9C A;  3VUY A;  2MA9 B;  2GBN A;  2CJO A;  2NPT A;  4RGN A;  2WXH A;  4JWU C;  2V0G A;  4PK1 A;  2DZI A;  4TKN A;  1WYW B;  2WXR A;  3P2B A;  4XX5 A;  4I6P A;  1P1A A;  3P4S B;  1MJD A;  3MC8 A;  2K25 A;  3NVW A;  1A5R A;  4OVV A;  1VDV A;  1J7B A;  1TYG B;  1FO4 A;  2AEH A;  5CHW A;  3KWL A;  1ZP0 B;  2KZR A;  5C23 A;  4DDG D;  2L0T A;  3A9J B;  1RFK A;  1F1H A;  1JRU A;  4JGH B;  5EE9 A;  2WXF A;  1UGJ A;  1T6B X;  3MC9 A;  3Q3O C;  4BKG A;  4RGT A;  1KM7 A;  1E9M A;  2INC C;  3ENE A;  1JQ4 A;  2LVP A;  3PZ8 A;  2GRI A;  2L3Z A;  3AED B;  2JYT A;  1EO6 A;  2LGD A;  5AUI A;  1JW9 D;  3C0R B;  3DBL B;  4NY0 A;  1FFU A;  1TKG A;  3V62 A;  4N58 A;  2N1W A;  1D6E C;  4K81 A;  4LK0 M;  2K39 A;  4ZYS A;  2LJ5 A;  5D94 A;  4FBJ B;  5HHD G;  2RPQ A;  2BBC A;  3ZDT A;  3VAW A;  2PPH A;  3ZVV A;  1TJE A;  4DDI D;  3BK1 A;  4ZRQ A;  1XEE A;  3Q8B A;  3RI7 C;  2AL3 A;  4JE3 B;  1WJ4 A;  5JHA A;  2BYF A;  1T0Q C;  1WMH A;  1N6Z A;  1KRH A;  3RNG C;  3ZO5 B;  1K53 A;  2N1V A;  2K8H A;  5IP4 D;  1E10 A;  2DAJ A;  1GB4 A;  1WXA A;  3U8Z A;  1HQR D;  4USA A;  4DXG A;  1VCB A;  1WFY A;  2D3A A;  4MT5 A;  2K8C A;  1LXD A;  3ZTD A;  4US8 A;  1E8X A;  1VLB A;  2VH1 A;  1DOY A;  3W1S A;  3HM6 X;  1E7P B;  1UGM A;  2JZZ A;  4HKZ E;  4GGQ A;  3DWG C;  5CHF A;  1ZXI A;  5HFY A;  5G5H A;  2H88 B;  1EWY C;  3AXC A;  1WGY A;  4ZOH C;  2KTR A;  1WGR A;  3NG0 A;  5EDS A;  5JXV A;  5FKA C;  3PPA A;  4KX6 B;  3NHE B;  4EEW A;  2J7Q B;  2ZZP B;  2LHE A;  2NBW B;  2KC1 A;  3RMK C;  1MG8 A;  3RFZ B;  2HE7 A;  4YXD B;  1JWM D;  3H7P A;  3CST A;  4HRS A;  1KFY B;  3I5J C;  1FXI A;  3W1Y A;  2LEK A;  1IBX B;  1JWU D;  2KLC A;  2PKO A;  2JZP A;  3VXW A;  3TBL D;  2Y5P A;  5TSS A;  3AB5 A;  4TSS A;  3DHI C;  3DQV A;  1ZDV A;  4C7Z A;  2J0K A;  2V3S A;  2SEB D;  2J52 A;  3VVW B;  1NI3 A;  1E8Z A;  1WY8 A;  4FHK A;  3L10 B;  1C77 A;  2DZK A;  3H8H A;  1ZOY B;  3QIJ A;  3T3O A;  3N30 A;  5JZE B;  3FC4 A;  4IDI A;  4OVU A;  2O6V B;  2M0X A;  3IAM 1;  4DHJ B;  3A4R A;  2KFK A;  2PEA A;  1TKY A;  1FPY A;  3DHG C;  5J2R A;  3DPD A;  4WAF A;  1FCC C;  1SBB B;  1TT5 B;  4ZRK A;  3NZU A;  2D11 A;  3QCA A;  4DWF A;  2JQR B;  2LGY A;  3N20 C;  1QLB B;  1UH6 A;  2L52 A;  2N7D A;  2BTE A;  4UDU C;  4LNO A;  2WXO A;  4WWN A;  2GMI C;  3E9S A;  4RF1 A;  1I4G A;  2JX5 A;  5IOI A;  2LHD A;  3S2A A;  2WXL A;  4S17 A;  3HVZ A;  2R61 A;  4HXD A;  2NCN A;  5HKH A;  3AM9 A;  1NEN B;  2N4F A;  2Z59 B;  1VZ7 A;  1SEB D;  2J53 A;  1E8W A;  2EKE C;  3QHT A;  2MHJ A;  4RMA A;  4XWT A;  4IG7 B;  4CHK A;  1K52 A;  5AZH A;  2SAK A;  4MJS B;  4G3X B;  3VTU A;  3QAQ A;  2L0F A;  3JSV A;  1TZO A;  3UIO B;  1MG4 A;  5L95 C;  2WXG A;  2OJR A;  2O2V B;  2AWT A;  3DVN U;  1F0Z A;  2Z0D B;  1S3S G;  5J18 A;  1QOF A;  5D3D A;  4GDL B;  1SE4 A;  1TS3 A;  3AH7 A;  4EZL A;  3BVM A;  5G55 A;  4EZJ A;  4FJY A;  1PDX A;  5KHQ A;  2NVU I;  5EE3 A;  2J0M A;  2L00 B;  4M02 A;  2RMM A;  4YSX B;  3BII D;  2KTF A;  2XK5 B;  1KLV A;  2HD5 B;  1FRD A;  1K51 A;  3PVL A;  1T0R C;  4HPP A;  2G4D B;  4LTU A;  2IPK D;  4WUR A;  3GS2 A;  4C00 A;  2FE8 A;  3BIN A;  4W9H A;  2HTM E;  1GOZ A;  2N9P C;  2WDV B;  3SEB A;  1R4M B;  4FHJ A;  1SIF A;  3U7Z A;  1B9R A;  4ZDV A;  3URY A;  2RPV A;  1I42 A;  1EWC A;  4GMV A;  4AP4 C;  3KUD B;  1E5W A;  5E6P A;  3HK0 A;  2ZNV C;  2IO1 B;  5LNK 1;  1I4H A;  3WCQ A;  3VQI A;  2DWQ A;  1ROE A;  4OZB A;  2PLP A;  3A4S C;  1TIF A;  1XLQ A;  1XXG A;  1TS5 A;  4KGS A;  1E8Y A;  3FIL A;  4ZRJ A;  3T3N A;  2N9E B;  3PS6 A;  1QF6 A;  4L2Y A;  4HDQ A;  1Q0W B;  3ZXR A;  2WDR B;  5AEK B;  2NS5 A;  3APC A;  3O13 A;  2GB1 A;  2C60 A;  3FAH A;  2ZCC A;  3AEA B;  2QIE B;  3RUL A;  2D07 B;  2C7M B;  2H89 B;  1UF0 A;  3HVD A;  4NZL B;  1V2Y A;  3V05 A;  1PGA A;  3HRD D;  4EZK A;  4BOZ B;  3RNC C;  3H9D A;  2BT6 A;  3AU4 A;  1GUA B;  3AN1 A;  3KUZ A;  2C5L C;  3WAP A;  2QJL A;  1GPX A;  2IGH A;  3I63 C;  3QAR A;  4MSM B;  3IAS 1;  3WA0 A;  3KYD D;  1OQQ A;  3ZJU A;  2M19 A;  1YNT E;  5KHO A;  3WAN A;  4EE2 A;  2ZVN A;  4AWJ A;  3MC0 B;  5CTR C;  2ZPY A;  4A3O A;  3EFC A;  3AUL A;  3V6C B;  4NJC A;  1TGZ B;  2KAN A;  4G11 A;  3NS1 A;  1IP9 A;  3NVY A;  4DQO C;  1ZKH A;  4TQ1 A;  4RNA A;  2E6X A;  4GDK B;  3ZNZ B;  3CMM B;  3TEX A;  4II2 B;  2ZCB A;  3OWE B;  3P1M A;  2BS2 B;  2JY6 A;  1J0G A;  3MJ5 A;  1T3Q A;  1EF5 A;  2VRR B;  3HUI A;  2REX A;  4XDD A;  2M4N A;  2WU2 B;  4FJZ A;  2LWP A;  2CHW A;  2MBO A;  1OEY J;  3ZIM A;  3X23 A;  1FNU A;  1NEK B;  3PHX B;  1SF0 A;  4HWI B;  4C80 A;  2G9H D;  4KKI A;  2DNF A;  4NJ6 A;  1WGD A;  2JT4 B;  3ETR A;  3VTW A;  3ZJT A;  3V60 A;  4A9A A;  5HG2 A;  2L8J A;  2KN5 A;  3N1X C;  4C4V A;  2K1F A;  2LVQ A;  4II3 B;  2IGG A;  3UIP B;  2XEW A;  1TS4 A;  1BUI C;  1CMX B;  1PQS A;  4B0M A;  4AQ7 A;  1JCK B;  2K5P A;  3UIN B;  4MH8 A;  2RDH A;  3KLS X;  3L08 A;  2B3A A;  5FR6 A;  2BKF A;  1FMA D;  1WJU A;  2FUH B;  3LJ3 A;  1JRO A;  3VUX A;  2KQS A;  5LLI A;  3RZW C;  4G0N B;  1Q10 A;  4ICU A;  4C4V B;  4L23 A;  2GBR A;  3ZUN A;  2V3P A;  2VZK B;  3U30 A;  3GE3 C;  2WGS A;  3CSF A;  4OZA A;  2IBI B;  5BO4 B;  4LLG M;  1P98 A;  2G3Q B;  3BYT B;  4OHJ A;  5BMI A;  3SU8 X;  2NBV B;  2XBB C;  4MAC A;  3W9C B;  1T0Y A;  1N63 A;  4XYC A;  1MI0 A;  4M0W A;  2V3N A;  4GLS C;  3L4P A;  4JWS C;  4MSQ B;  3CF6 E;  3TCA A;  5BMG A;  2IDY A;  3EEC A;  3OG5 A;  2N9L A;  1DOX A;  1HA5 A;  1E7U A;  3QJZ A;  1YQ3 B;  4C7Y A;  4W9G A;  1JML A;  2GLS A;  5JH5 C;  2L83 A;  1QZE A;  1E90 A;  3L13 A;  1AN8 A;  1VD2 A;  3ZRC A;  2L7R A;  2WXN A;  3VFK A;  5J17 A;  2MW5 A;  2IYD B;  3NZS A;  4IWP A;  3N9Y C;  4LDT B;  2MWS B;  1RRB A;  3K9P B;  1V1P A;  5EE0 A;  4GIV A;  4WQM A;  5D7G A;  1GG3 A;  3ZNG C;  1GAQ B;  1VZ8 A;  4JQW C;  4TUU A;  3TJP A;  2JPH A;  2D2Q A;  2Z8L A;  4HDO A;  4ZRP A;  1SSN A;  2LD9 A;  3R7R A;  3ONS A;  4ANX A;  2Y5C A;  2ZW1 A;  2GBM A;  4GU2 A;  2KHW B;  1PGB A;  4ZHO A;  3ML9 A;  2IO3 B;  2VZK D;  4A55 A;  3ECI A;  4PT5 A;  2IO0 B;  1RYJ A;  2BYT A;  2ONQ A;  2FAZ A;  4GDL A;  3QX1 A;  2NTT A;  3L54 A;  3N3K B;  1KTK A;  1TZ1 A;  3P4R B;  3MJW A;  4DHZ E;  2BW2 A;  1L0V B;  2KDM A;  2KAJ A;  3BWU D;  4JL9 A;  4AOF A;  2NR2 A;  2XK5 A;  1WXM A;  1WMH B;  4A90 A;  1YOV B;  2R2Q A;  3U7D A;  3N1Y C;  4KVG B;  2KOX A;  1UZX B;  1P3Q U;  4R3D A;  2M17 A;  3KYC D;  4YSZ B;  1I4Q A;  1E7V A;  2WXK A;  3MHZ A;  1YJI A;  2JXX A;  4S0R A;  3SR6 A;  3AE1 B;  1R4N B;  2ZNV B;  3RNE C;  4BAX A;  2QCZ A;  4GB9 A;  1A70 A;  1PFD A;  1GB1 A;  2PW9 A;  1EM7 A;  1YQ4 B;  4DXF A;  1N61 A;  2KVZ A;  1TTN A;  3TL5 A;  3DBS A;  2NBU A;  4BZA A;  4QAY A;  4EFO A;  2OHF A;  3RUI B;  2PTL A;  4NAW B;  1N62 A;  4W9F A;  4PYZ A;  1F2R I;  3A1Q B;  2D10 A;  1YX6 B;  2MJE A;  4US9 A;  1C4P A;  1FXT B;  2HJ1 A;  2N0S B;  4HEA 1;  3VTV A;  5G5G A;  1QOB A;  4ANW A;  1TS2 A;  3APD A;  1WI0 A;  3UQB A;  4HKQ A;  3QK0 A;  1J19 A;  1S1Q B;  1WZ0 A;  1Z2M A;  4IKG A;  3UQA A;  4Q2J A;  1J7C A;  1KH0 A;  3EFU A;  3BVG A;  2CU1 A;  2RDG A;  3DHH C;  4LNN A;  1SJE D;  2YEP F;  3PO0 A;  3WAO A;  2PMV A;  2KJR A;  4ASW C;  3OJ4 B;  2I2Y A;  1V49 A;  2ZEQ A;  3NVZ A;  4IM2 A;  3VDZ A;  4D2K A;  5GXG B;  2DYM A;  5I4D A;  2IGD A;  3NY5 A;  1HEZ E;  3SFD B;  4KGT A;  4P16 A;  3VUW A;  1XCQ L;  3M63 B;  1YN4 A;  1WZ3 A;  4YTN B;  2KX3 A;  2R2O A;  2D3B A;  3H6N A;  1BT0 A;  1WWT A;  1R4N I;  2LGI A;  1Q5W B;  3PSE B;  2KN4 A;  2PJH A;  3NS8 A;  3DBH B;  3N32 A;  2Z0E B;  1GC7 A;  3AE4 B;  1UWX A;  3N1Z C;  2CR5 A;  1UUP A;  3MHS D;  3EA6 A;  1EU4 A;  3RNB C;  1VJK A;  4TMA B;  4HPL B;  1XD3 B;  3Q14 C;  3NUH B;  5MPO A;  3A33 B;  2B76 B;  4F7Z A;  2KDE B;  4ZHP A;  1NVI D;  3NRZ A;  2Q5W D;  2DYB A;  4B95 A;  1MHX A;  4I6N B;  3PTF C;  2DX5 B;  4IWO A;  5IO9 A;  2HDE A;  5DPS A;  4HLE A;  2C7H A;  1X1M A;  3KUC B;  1F9J A;  4XWW A;  3Q3M C;  2WDT B;  1D5M C;  3Q3J A;  3Q3F A;  2V4L A;  3PT2 B;  4LNK A;  2LUE A;  1YN3 A;  3PZD A;  2QDF A;  1V81 A;  4X57 B;  1BXT A;  2PVO D;  4WJQ A;  5LXH A;  1Y56 A;  2GI9 A;  1EUV B;  1TY2 A;  2LXC A;  1YJJ A;  3IVF A;  3AV8 A;  5GMV A;  1RAX A;  2FCS A;  2RD0 A;  3L16 A;  2OOB B;  4JPS A;  3CIR B;  3HM3 A;  3ZQ4 A;  2KJH B;  3LXF A;  3M95 A;  4HCN B;  2BQQ A;  3TIX A;  1QT9 A;  2RR9 A;  3V6E B;  3AE6 B;  1UEL A;  3PHW B;  5T8I A;  4GSW A;  3ZTC A;  2KMM A;  2O6V A;  3A1Q A;  2BS3 B;  4W9L A;  3GZN I;  3QQ8 B;  3AE3 B;  4FXC A;  1ZPS A;  1V1P B;  2K8B A;  4IUM B;  4LJO B;  3NOB A;  1YJ1 A;  1DGJ A;  4RM8 A;  2K9X A;  4ANV A;  1P7E A;  4JX1 C;  4WJN A;  4KZC A;  1VZ6 A;  2QSD A;  3JW0 X;  3ZRF A;  3V61 A;  1FRR A;  3ZJV A;  1XCT L;  1YIW A;  5D2M B;  1V5T A;  5IA7 A;  2KDB A;  2WXQ A;  3VHT C;  2AQ3 B;  3OJ3 A;  2JYE A;  4LDT D;  1HZ5 A;  1WGG A;  3IT4 B;  3QA8 A;  1C76 A;  3W2D A;  2IY1 B;  3FKY A;  5DPR A;  3L0W B;  2KQ7 A;  1ZE3 D;  2CS4 A;  1L6U A;  4YWG G;  1SJH D;  2FIF A;  3A9K A;  4XZ4 A;  4DXA B;  2WXI A;  2KYW A;  2ZPN A;  4A8X C;  3JYU A;  5AUK A;  2KAC A;  2LUM A;  1CQV A;  2I1K A;  5BYR A;  2MEK A;  1J8C A;  2KO3 A;  2EMT A;  2QIL A;  4LNF A;  3RZF A;  1FXA A;  1AAR A;  2JWU A;  3MFG A;  3VRA B;  5D3I B;  4BVU C;  1ZW7 A;  1STE A;  4HJK A;  2N9K A;  4P6V F;  1I7H A;  4ZYN A;  1XLO A;  2A5U A;  4WAA A;  3DBR I;  3M3J A;  1K8R B;  3R2T A;  1C78 A;  3PRE A;  4EOY A;  3UI3 A;  1XT9 B;  1DYQ A;  1KLG D;  4N9F 4;  4C56 C;  4WIP A;  1LM8 B;  2WDQ B;  2KX0 A;  4J6I A;  1SE2 A;  1WRI A;  1WXV A;  1IBX A;  4ARC A;  1AW7 A;  2EEL A;  3T9L A;  3AI5 A;  3KW5 B;  4E3C A;  4F8C B;  1Y8R C;  2G4S A;  5E6N A;  2DAF A;  1XQQ A;  1JAL A;  2BKR B;  2YLM A;  3AE9 B;  2JRH A;  2IO2 B;  1UBQ A;  2MBE A;  2FCM A;  2JWZ A;  1C79 A;  1HE8 A;  2MBH A;  4DK5 A;  1QKZ A;  5JHB A;  1B1Z A;  1N5X A;  1C3T A;  2GBK A;  2RSU A;  1WIA A;  4ANU A;  1MFW A;  4MEM A;  2XN9 C;  2PE9 A;  1FNW A;  2LRW A;  2KTR B;  4KSK C;  2ZW0 A;  3LYY A;  3DBL I;  3TUO A;  1F52 A;  1Q1O A;  1V9J A;  2FCN A;  4M00 A;  4WWO A;  5C3J B;  1QIL A;  1WGK A;  3KH0 A;  2AQ1 B;  2BWF A;  2WWZ A;  2UWQ A;  5IN7 A;  3OLM D;  5DPT A;  1P7F A;  1SE3 A;  2OED A;  2KK8 A;  2KVR A;  2MP2 B;  4K3C A;  1L6V A;  2Y5B B;  4XDC A;  2L1A A;  3AE7 B;  2HJ8 A;  1H8C A;  1C1Y B;  4H2A A;  2G1E A;  4AUQ C;  5BMH A;  3ABV B;  3DBR B;  3I9V 1;  1ESF A;  2D5G A;  2WXP A;  3AMZ A;  3DWM A;  4YTP B;  2KKC A;  2AL6 A;  3TEZ A;  1RWS A;  4MH0 E;  2FUG 1;  3TMP B;  1P0R A;  1YMH E;  3VH3 B;  2C9W B;  5C1Z A;  1NYQ A;  3B2G A;  3KVF B;  1GJZ A;  3U4E G;  3PRM B;  2IZV B;  1WX9 A;  1I4X A;  1AYF A;  1HZ6 A;  2D3G A;  5DPW A;  4WH4 A;  4A6Q A;  2W3S A;  2ACZ B;  3O65 B;  3UGB B;  4BKS D;  4FAD A;  4W9K A;  4AS1 A;  1I35 A;  4M0W B;  2AYO B;  4WJO A;  2BYV E;  3R3M A;  2L05 A;  1I4P A;  4FLH A;  2DYO A;  4MM3 A;  3EGR A;  4AJW A;  1H4R A;  1OQY A;  2JF5 A;  1WXS A;  4FUL A;  1EU3 A;  2KDF B;  3ZNI D;  1ZDX A;  3DDC B;  3C19 A;  4P7I A;  5BYS A;  4M01 A;  4RF0 A;  1ACC A;  1WF9 A;  4KZ0 A;  4CO7 A;  3RYT A;  2LGS A;  3VRB B;  3DVG Y;  1P9D U;  2BF8 B;  1YD8 U;  4IW0 A;  1C4A A;  2FID A;  2QC8 A;  4N6E B;  3X0W A;  1JWA D;  1WGH A;  2K22 A;  4MEL A;  1FFV A;  2C7N B;  1L0X B;  1ZUD 2;  2J42 A;  4W9D A;  4ICV A;  3PRP B;  2INP E;  2V4I B;  3I3T B;  1IYF A;  2DBY A;  4BBN F;  4OZC A;  1D5X C;  1OTR B;  4P1C C;  1XLP A;  1JWB D;  1AWD A;  3LDZ E;  3QC8 B;  3PLU A;  4FA6 A;  2KMA A;  3NJT A;  4GN1 A;  2KJ6 A;  2LRU A;  3ALB A;  2O2V A;  1EF1 A;  5H8Y E;  3BZD B;  3A9J A;  3FIL B;  3IHP C;  1DOI A;  2LI5 A;  2K6Q A;  2WXJ A;  3SD5 A;  1GC6 A;  3RN9 C;  3IBE A;  5FR3 A;  2KQ4 X;  3B08 A;  1NYR A;  1IGC A;  4IM0 A;  3LB8 C;  4M8N A;  2E3T A;  1V6E A;  4BBN C;  2MSE D;  5BYQ A;  2CHX A;  3P63 A;  3GOE A;  3WIM A;  1PGX A;  3VR8 B;  4KIK B;  1MHH E;  2W82 A;  2DLB A;  4W9E A;  2WQY B;  5TR5 A;  1WJN A;  4PS3 A;  3APF A;  1M4V A;  1TKE A;  4A20 A;  2KWD A;  1NBF C;  3GE8 C;  3RD2 A;  4HRO A;  3SDL C;  2N7J A;  3P42 A;  3PZ7 A;  2AQ2 B;  2W3R A;  4HK2 A;  2PIA A;  3PGE A;  1LFD A;  3NVV A;  2V1Y A;  3Q3N C;  1UBI A;  4PS8 A;  2BGF A;  1G6J A;  1SIJ A;  1F2R C;  1L4Z B;  4GXB A;  4BFR A;  4HPM B;  4B6W A;  4MGK E;  2JSV X;  4P1B C;  1NDD A;  3Q69 A;  2I38 A;  1TBE A;  4NQL B;  1L4D B;  2KWC A;  4AJY B;  1KJT A;  2TSS A;  1V5O A;  3VR9 B;  2BYE A;  2QMT A;  5AZG A;  2ZJD A;  1FEH A;  4ITK A;  2W9N A;  1QQR A;  1CK1 A;  1Z5S B;  4NPN A;  3WAM A;  3R7Q A;  3I57 A;  3KQ4 A;  4LNI A;  2VH2 A;  2L32 A;  1PYW D;  1N5W A;  4PYU A;  1D5Z C;  3A9K B;  1ZGU B;  2OJW A;  1JWS D;  1V1O A;  2LVO A;  3P4Q B;  1K50 A;  1RFA A;  1LQB A;  1QOA A;  3RT3 B;  3ML8 A;  1ENF A;  2WHI A;  4KSL C;  1UD7 A;  2A4Z A;  3DCG A;  3P4P B;  2MH7 A;  2K6D B;  2AX5 A;  4KDL B;  1TY0 A;  3D32 A;  3IT6 B;  1UNS A;  1IGD A;  3Q2A C;  2KDI A;  2MLB A;  1U4A A;  2WLB A;  1D3Z A;  2JXT A;  2FNJ B;  3AEB B;  4JLC A;  1WE7 A;  1VRA B;  3Q8F A;  1FCL A;  5EE1 A;  4GDK A;  4CYE A;  2GBJ A;  1ET6 A;  3AU5 A;  5IAA C;  2O6V D;  3T8M A;  2M1M A;  2Y3A A;  3B9J A;  4BOS C;  4YSY B;  5DCN A;  3V3X A;  4URK A;  2DZM A;  2WNM A;  3E56 A;  1YN5 A;  1WR1 A;  1BML C;  3H7P B;  3UF8 A;  1L0Y B;  4RFB A;  4EKU A;  4J3O D;  3CWI A;  2M8S A;  4ACF A;  2YEP B;  1J7A A;  3ZDM C;  1F77 A;  1HTO A;  3TEW A;  1MVK A;  3AEE B;  1C4C A;  3M62 B;  2EKI A;  4KDI C;  2HTH A;  2RGF A;  3ZLZ A;  2KMC A;  3BYY B;  4IWQ A;  1XF5 L;  2WS3 B;  3EC8 A;  3W5U B;  4IOI E;  2IND C;  4W9J A;  3QWZ B;  2N7E A;  2J4X A;  1ZXH A;  3RNF C;  1V80 A;  2WYQ A;  2V9H A;  1OGW A;  2NMQ A;  2PE6 B;  1LGR A;  1HXY D;  1E6E B;  2LMC A;  4EUT A;  1WRD B;  1MPE A;  3BY4 B;  4L1B A;  3RNA C;  1FNV A;  4CQN A;  4N59 A;  2MX2 A;  1SB3 C;  2BB6 A;  4TQ0 A;  1OFF A;  1KOT A;  2KFK B;  2NPT B;  1WR6 E;  2MJ3 A;  2QEJ C;  2KLG A;  5L83 A;  3ZKJ C;  1RM6 C;  1M94 A;  3GZN B;  2WXM A;  5HI1 A;  4ARI A;  2JRI B;  4IM3 A;  4PS7 A;  1YX5 B;  4XC2 A;  1WM2 A;  2WX1 A;  2XNA C;  2UYZ B;  4O1N A;  3TEY A;  2MRP A;  2W55 A;  5E6J A;  3AE5 B;  4I6L B;  1IUE A;  2DHZ A;  4RGO S;  4B9K A;  2BWE S;  4K3B A;  1D4B A;  4HVB A;  3HIZ A;  3W1S C;  2KNB A;  1PUT A;  3AE8 B;  2I1J A;  3BVZ A;  4TV3 A;  1ET9 A;  2WU5 B;  1WSP A;  3B2F A;  4W9C A;  4MGZ E;  1L5P A;  1OQR A;  4DBG A;  2YVC A;  1T5X D;  4G50 A;  4MGI E;  3Q8E A;  1SGH A;  2M0A A;  2K3U A;  4MM3 B;  2JVC A;  4BKS A;  1WX8 A;  3IG3 A;  1ISN A;  3JVZ X;  1FM0 D;  3BK2 A;  3ZXV A;  3R66 C;  1WYG A;  1I4R A;  4MJS A;  1FD6 A;  3JSV B;  4NAM A;  4M8M A;  3Q8A A;  5E6O A;  1HTQ A;  5D6J B;  2GOW A;  4DHJ D;  3H1U A;  4NNJ B;  1V97 A;  4A3P A;  3GP7 A;  4WJP A;  4KKJ A;  3VH4 B;  1OEY A;  4KIK A;  1SE9 A;  2N9X A;  1CJE A;  3KWV A;  2K0P A;  2KXJ A;  1V86 A;  3U52 E;  1GNU A;  2NTS A;  3C8Y A;  2BB5 A;  4NAW A;  4B0E A;  3AEC B;  2MBB B;  2IJ0 A;  5LXI B;  4ZRI A;  2KWU B;  3RPF C;  3PRZ A;  2MQJ A;  2LGX A;  2DEN B;  4RH6 A;  1C9F A;  2CKH B;  3DVN V;  1SXT A;  2MP2 A;  3MTN B;  4HCP B;  1WM3 A;  2ICI A;  1WJ6 A;  3HHM A;  1E0Z A;  3R2I A;  4K1R B;  3R8B A;  3EHV A;  2MCN B;  2KD0 A;  1R4M I;  2WX0 A;  2DZJ A;  2KC2 A;  1FIQ A;  1UWM A;  4XGA B;  2PVG C; 
#chains in the Genus database with same CATH homology
 2AWT A;  1WGH A;  3DVN U;  2Z0D B;  4PYZ A;  3A1Q B;  1S3S G;  2LZ6 A;  5J18 A;  4MEL A;  2D10 A;  4W9I A;  3ZW3 A;  2C7N B;  4GDL B;  4FJV B;  4YL8 A;  1YX6 B;  4EZL A;  3B1L X;  4W9D A;  1FXT B;  4ICV A;  4K7W A;  3PRP B;  3VTV A;  5G55 A;  3ZNH B;  4EZJ A;  4ANW A;  4FJY A;  3I3T B;  2BPS A;  3APD A;  1IYF A;  3DOW A;  4BBN F;  5KHQ A;  1WI0 A;  3UQB A;  2NVU I;  3PLV A;  3QK0 A;  2J0M A;  1J19 A;  2LAS A;  1OTR B;  3RCZ A;  1S1Q B;  2L00 B;  2ASQ A;  1WZ0 A;  1Z2M A;  3PV1 A;  3LDZ E;  2KTF A;  2XK5 B;  3UQA A;  4BKT A;  1KLV A;  2HD5 B;  4K7S A;  3QC8 B;  3PLU A;  4FA6 A;  3PVL A;  3EFU A;  2KMA A;  3DBH I;  4FN2 A;  4LJP B;  2G4D B;  2CU1 A;  2MBQ A;  4GN1 A;  4IC7 B;  1NI2 A;  2KJ6 A;  2LRU A;  3ALB A;  4KV2 A;  3WAO A;  3IFW B;  2O2V A;  1EF1 A;  2KJR A;  4ASW C;  1L7Y A;  3A9J A;  3OJ4 B;  3BIN A;  1V49 A;  5CX3 A;  4W9H A;  3IHP C;  2N9P C;  2ZEQ A;  3H7S A;  4IM2 A;  2QHO A;  1IPG A;  2LI5 A;  3VDZ A;  2K6Q A;  4LCD E;  3SD5 A;  1GC6 A;  4FHJ A;  2DYM A;  1SIF A;  2J0J A;  3IBE A;  3NY5 A;  3B08 A;  4ZDV A;  1I42 A;  4MGY E;  4IM0 A;  4GMV A;  4MDK E;  4AP4 C;  4M8N A;  2LXA A;  1V6E A;  3KUD B;  1E5W A;  5E6P A;  3M63 B;  3VUW A;  4BBN C;  2CHZ A;  3K9O B;  2MSE D;  4E71 A;  1WZ3 A;  2CHX A;  3HK0 A;  2ZNV C;  4GOC A;  3GOE A;  2IO1 B;  2KX3 A;  1RLF A;  3WIM A;  3VQI A;  4KIK B;  2R2O A;  2JUO A;  3A4S C;  4W9E A;  5TR5 A;  1WJN A;  3H6N A;  4JIO U;  1WX7 A;  1BT0 A;  4PS3 A;  1R4N I;  4NJ7 A;  5G2N A;  1WH3 A;  3APF A;  1Q5W B;  1E8Y A;  4A20 A;  3OAW A;  3PSE B;  4ZRJ A;  5AZF A;  1NBF C;  2PJH A;  2N9E B;  3PS6 A;  5CHV C;  2L76 A;  3NS8 A;  3L17 A;  3RD2 A;  3SDL C;  3N32 A;  4HDQ A;  1Q0W B;  2KWV B;  4HK2 A;  2Z0E B;  5AEK B;  1GC7 A;  3WAL A;  3PGE A;  1LFD A;  2G45 B;  2NS5 A;  2V1Y A;  2CR5 A;  3APC A;  3MHS D;  2C60 A;  3B0A A;  1UBI A;  2ZCC A;  1L2N A;  3RUL A;  2D07 B;  2C7M B;  4PS8 A;  4NQK E;  4HPL B;  2BGF A;  1XD3 B;  1G6J A;  4DHZ B;  4GXB A;  4BFR A;  4HPM B;  4B6W A;  1V2Y A;  3A33 B;  4MGK E;  4EZK A;  4F7Z A;  2KDE B;  1NDD A;  4BOZ B;  3H9D A;  4F1S A;  3SHQ A;  2JZ3 B;  2KFJ A;  2DYB A;  1TBE A;  3AU4 A;  4NQL B;  4E74 A;  1GUA B;  2KWC A;  3DVG X;  4B95 A;  3KUZ A;  4AJY B;  1KJT A;  2C5L C;  3WAP A;  4I6N B;  3PTF C;  4WWP A;  2DX5 B;  1V5O A;  2FCQ A;  4IWO A;  2BYE A;  1YQB A;  3QAR A;  4MSM B;  4K7U A;  4RM9 A;  2ZVO A;  5DPS A;  3WA0 A;  5AZG A;  2ZJD A;  3KYD D;  4HLE A;  2C7H A;  2W9N A;  1X1M A;  3KUC B;  1F9J A;  2EMS A;  1Z5S B;  4NPN A;  5KHO A;  3WAN A;  3WAM A;  3R7Q A;  1WE6 A;  2WDT B;  2ZVN A;  4WQO B;  4AWJ A;  2IY0 B;  5CTR C;  2ZPY A;  3Q3J A;  3Q3F A;  4A3O A;  2V4L A;  3AUL A;  3V6C B;  3PT2 B;  3VUY A;  2MA9 B;  2GBN A;  4PYU A;  3A9K B;  1TGZ B;  2LUE A;  2KAN A;  1ZGU B;  4G11 A;  3PZD A;  2NPT A;  1IP9 A;  1V81 A;  4X57 B;  2LVO A;  4WJQ A;  2DZI A;  4TKN A;  5LXH A;  1WYW B;  1ZKH A;  1RFA A;  3P2B A;  1EUV B;  4TQ1 A;  4I6P A;  4XX5 A;  1LQB A;  2LXC A;  3RT3 B;  3IVF A;  3ML8 A;  4GDK B;  5GMV A;  3ZNZ B;  1RAX A;  2FCS A;  3CMM B;  4KSL C;  1UD7 A;  2A4Z A;  2RD0 A;  1P1A A;  3DCG A;  4II2 B;  3L16 A;  2ZCB A;  1J0G A;  2JY6 A;  2OOB B;  2K6D B;  3HM3 A;  2K25 A;  4KDL B;  1EF5 A;  2VRR B;  2KJH B;  3M95 A;  2REX A;  4HCN B;  1A5R A;  4OVV A;  3TIX A;  3D32 A;  2M4N A;  2RR9 A;  3V6E B;  2AEH A;  5CHW A;  4FJZ A;  2LWP A;  2KDI A;  1UEL A;  2CHW A;  2KZR A;  3PHW B;  5C23 A;  2MBO A;  1OEY J;  2MLB A;  4GSW A;  3ZIM A;  3X23 A;  3ZTC A;  4DDG D;  1U4A A;  2L0T A;  2O6V A;  3A1Q A;  3A9J B;  3PHX B;  4HWI B;  4W9L A;  3GZN I;  1JRU A;  3QQ8 B;  4JGH B;  1D3Z A;  2K8B A;  4NJ6 A;  4IUM B;  3NOB A;  1YJ1 A;  2FNJ B;  1WGD A;  4LJO B;  2JT4 B;  4BKG A;  4RM8 A;  1KM7 A;  3ENE A;  4ANV A;  4JLC A;  1WE7 A;  3VTW A;  2LVP A;  4WJN A;  3V60 A;  4KZC A;  3JW0 X;  2L8J A;  2KN5 A;  4GDK A;  3ZRF A;  4CYE A;  3V61 A;  2GBJ A;  1YIW A;  2L3Z A;  5D2M B;  1V5T A;  2K1F A;  2LVQ A;  3AU5 A;  2O6V D;  5IAA C;  5IA7 A;  2KDB A;  1EO6 A;  4II3 B;  3T8M A;  3VHT C;  2LGD A;  2M1M A;  3UIP B;  2XEW A;  3C0R B;  3OJ3 A;  1CMX B;  1PQS A;  4BOS C;  4NY0 A;  5DCN A;  4LDT D;  2DZM A;  4URK A;  1WGG A;  3V62 A;  3QA8 A;  2N1W A;  3UIN B;  2IY1 B;  4K81 A;  2K39 A;  5DPR A;  2LJ5 A;  3L0W B;  2KQ7 A;  5D94 A;  1WR1 A;  2CS4 A;  3L08 A;  4FBJ B;  2B3A A;  2FIF A;  3H7P B;  3UF8 A;  3A9K A;  4XZ4 A;  2RPQ A;  5FR6 A;  2BKF A;  4EKU A;  4DXA B;  2ZPN A;  3ZDT A;  2M8S A;  3JYU A;  1WJU A;  3VAW A;  5L95 C;  2PPH A;  3ZVV A;  3ZDM C;  4DDI D;  2FUH B;  2I1K A;  3LJ3 A;  3VUX A;  2KQS A;  5LLI A;  1J8C A;  3RZW C;  2KO3 A;  2EMT A;  4G0N B;  3RZF A;  4ICU A;  3M62 B;  1AAR A;  4KDI C;  2HTH A;  2AL3 A;  2RGF A;  3ZLZ A;  2GBR A;  3ZUN A;  1WJ4 A;  2KMC A;  3U30 A;  4IWQ A;  4BVU C;  3CSF A;  3EC8 A;  5JHA A;  1ZW7 A;  2BYF A;  4HJK A;  2IBI B;  5BO4 B;  1WMH A;  4ZYN A;  1P98 A;  3QWZ B;  4W9J A;  2G3Q B;  2N7E A;  2A5U A;  3ZO5 B;  4WAA A;  3DBR I;  2N1V A;  2K8H A;  3SU8 X;  3M3J A;  2DAJ A;  2NBV B;  1V80 A;  2XBB C;  1WXA A;  1K8R B;  2WYQ A;  3U8Z A;  1OGW A;  3PRE A;  1VCB A;  1WFY A;  1T0Y A;  4EOY A;  2K8C A;  1LXD A;  2PE6 B;  3ZTD A;  1XT9 B;  1E8X A;  4N9F 4;  3W1S A;  4EUT A;  1LM8 B;  3HM6 X;  4J6I A;  1WRD B;  1UGM A;  2JZZ A;  2KX0 A;  4GGQ A;  5CHF A;  1WXV A;  3BY4 B;  3AXC A;  3T9L A;  1WGY A;  3AI5 A;  2KTR A;  3KW5 B;  1WGR A;  4MSQ B;  2MX2 A;  5EDS A;  3CF6 E;  4E3C A;  3TCA A;  4F8C B;  1Y8R C;  4TQ0 A;  2G4S A;  1KOT A;  2KFK B;  3EEC A;  2NPT B;  1WR6 E;  5E6N A;  2DAF A;  1XQQ A;  2KLG A;  3PPA A;  5L83 A;  3NHE B;  4EEW A;  2J7Q B;  1E7U A;  3ZKJ C;  3QJZ A;  1M94 A;  2ZZP B;  2BKR B;  2YLM A;  2JRH A;  2IO2 B;  2JRI B;  1UBQ A;  2NBW B;  2KC1 A;  4IM3 A;  2MBE A;  4PS7 A;  1YX5 B;  2FCM A;  2JWZ A;  4W9G A;  1WM2 A;  4XC2 A;  5JH5 C;  1MG8 A;  1HE8 A;  2MBH A;  2WX1 A;  2HE7 A;  4DK5 A;  1QZE A;  2UYZ B;  1E90 A;  3H7P A;  2MRP A;  5JHB A;  3L13 A;  3CST A;  4I6L B;  2DHZ A;  1C3T A;  2GBK A;  1VD2 A;  3W1Y A;  4B9K A;  2BWE S;  3ZRC A;  2L7R A;  1WIA A;  2RSU A;  4ANU A;  3VFK A;  4HVB A;  3HIZ A;  5J17 A;  3W1S C;  2KLC A;  2KNB A;  4MEM A;  2MW5 A;  2PE9 A;  2I1J A;  4TV3 A;  2LRW A;  2KTR B;  4KSK C;  2IYD B;  3NZS A;  4W9C A;  3VXW A;  3TBL D;  4IWP A;  4MGZ E;  3DBL I;  4LDT B;  2MWS B;  4DBG A;  1RRB A;  2YVC A;  3K9P B;  1Q1O A;  4G50 A;  4GIV A;  4MGI E;  2FCN A;  1V9J A;  3DQV A;  4WWO A;  1SGH A;  3KH0 A;  5D7G A;  1GG3 A;  2BWF A;  3ZNG C;  2JVC A;  2WWZ A;  2J0K A;  2UWQ A;  4JQW C;  4TUU A;  2V3S A;  1WX8 A;  4BKS A;  3OLM D;  5DPT A;  3IG3 A;  3TJP A;  2KK8 A;  2KVR A;  2MP2 B;  2JPH A;  3VVW B;  1ISN A;  2Y5B B;  2D2Q A;  3JVZ X;  4HDO A;  2LD9 A;  1E8Z A;  3R7R A;  1WY8 A;  3ONS A;  4ANX A;  4FHK A;  3L10 B;  2DZK A;  3R66 C;  4MJS A;  2GBM A;  4GU2 A;  2KHW B;  2HJ8 A;  1H8C A;  3ML9 A;  3JSV B;  3QIJ A;  2IO3 B;  1C1Y B;  4M8M A;  3ECI A;  2IO0 B;  4AUQ C;  3N30 A;  5JZE B;  4OVU A;  5E6O A;  2O6V B;  2FAZ A;  5D6J B;  2GOW A;  2M0X A;  3QX1 A;  4GDL A;  4DHJ B;  4DHJ D;  3H1U A;  4NNJ B;  2KKC A;  3A4R A;  3L54 A;  2AL6 A;  2KFK A;  1TZ1 A;  3N3K B;  2PEA A;  3MJW A;  4A3P A;  4WJP A;  4MH0 E;  4DHZ E;  3VH4 B;  5J2R A;  1OEY A;  4KIK A;  1SE9 A;  2N9X A;  3DPD A;  3TMP B;  1P0R A;  3VH3 B;  2C9W B;  4JL9 A;  4ZRK A;  4AOF A;  3NZU A;  2NR2 A;  2D11 A;  5C1Z A;  2KXJ A;  2XK5 A;  1WXM A;  3QCA A;  3KVF B;  4DWF A;  1V86 A;  1GJZ A;  1WMH B;  2LGY A;  1GNU A;  3PRM B;  2IZV B;  2R2Q A;  3U7D A;  1WX9 A;  2D3G A;  1UH6 A;  5DPW A;  2N7D A;  4KVG B;  2KOX A;  1UZX B;  1P3Q U;  4WWN A;  4NAW A;  2GMI C;  3O65 B;  2M17 A;  3KYC D;  3UGB B;  3S2A A;  2MBB B;  4BKS D;  5LXI B;  4ZRI A;  2KWU B;  4FAD A;  4W9K A;  1I35 A;  1E7V A;  4M0W B;  2AYO B;  4WJO A;  2BYV E;  2JXX A;  3R3M A;  3PRZ A;  2L05 A;  4HXD A;  2MQJ A;  2NCN A;  4FLH A;  2DYO A;  5HKH A;  2ZNV B;  4MM3 A;  2LGX A;  2DEN B;  4AJW A;  1H4R A;  1OQY A;  2JF5 A;  2N4F A;  1WXS A;  4FUL A;  2Z59 B;  2CKH B;  3DVN V;  2KDF B;  4GB9 A;  2MP2 A;  3ZNI D;  3MTN B;  1E8W A;  2EKE C;  1WM3 A;  3DDC B;  3QHT A;  4HCP B;  4RMA A;  1WJ6 A;  4P7I A;  3HHM A;  4IG7 B;  4K1R B;  4CHK A;  3EHV A;  1WF9 A;  5AZH A;  2MCN B;  4KZ0 A;  2KD0 A;  1TTN A;  3TL5 A;  4MJS B;  4G3X B;  4CO7 A;  3VTU A;  3RYT A;  1R4M I;  3DBS A;  3QAQ A;  2NBU A;  2L0F A;  2WX0 A;  1P9D U;  2BF8 B;  1YD8 U;  2DZJ A;  2KC2 A;  3DVG Y;  3JSV A;  4IW0 A;  3UIO B;  4EFO A;  2FID A;  3RUI B;  4NAW B;  3X0W A;  4W9F A;  2O2V B;  2OJR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...