1WMHB

Crystal structure of a pb1 domain complex of protein kinase c iota and par6 alpha
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
82
structure length
82
Chain Sequence
SIVEVKSKFDAEFRRFALPRASVSGFQEFSRLLRAVHQIPGLDVLLGYTDAHGDLLPLTNDDSLHRALASGPPPLRLLVQKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein kinase C, iota type
publication title Structure of a Cell Polarity Regulator, a Complex between Atypical PKC and Par6 PB1 Domains
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/cell cycle
total genus 17
structure length 82
sequence length 82
ec nomenclature
pdb deposition date 2004-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00564 PB1 PB1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1wmhB00
4ANWA 3QCAA 1TGZB 2G4SA 2CS4A 2KC1A 3IBEA 2LRUA 2LZ6A 4IM2A 4PS7A 3ZNID 3DQVA 1WM3A 4M0WB 1QZEA 2G45B 3PT2B 4MGYE 2KXJA 4BOSC 3UF8A 4BFRA 4K7SA 1U4AA 2BYFA 3L54A 5G2NA 3H9DA 1XD3B 1LFDA 2C7HA 2K8HA 2MBQA 2KWVB 1ZKHA 3QX1A 2IBIB 1MG8A 1RAXA 2DAJA 4II2B 2O6VB 4K7WA 3ZNZB 3VTVA 1BT0A 2AEHA 3L0WB 3LDZE 2FCSA 3X23A 4ICVA 3ONSA 3QAQA 4LJOB 2JY6A 3ZKJC 1SGHA 3A1QA 3R7QA 2KJRA 4DDID 4IW0A 3GOEA 1V49A 1WXAA 4MDKE 4M8NA 4GIVA 2L7RA 1V86A 4BBNF 1WJUA 1WX9A 1YX6B 2ZNVB 3U30A 2ZVNA 3PPAA 1H8CA 4CO7A 2AWTA 3TBLD 2XK5A 2L8JA 1J19A 2L76A 4A3OA 3DVNV 2O2VA 4JIOU 1FXTB 2KWUB 4GDLB 2RR9A 3AXCA 2LRWA 3HIZA 4JQWC 1C3TA 3DDCB 1GC7A 1WXMA 3VUYA 3ALBA 3AU4A 4KDIC 5AEKB 2UWQA 1ISNA 1C1YB 3K9PB 4BKSA 1P9DU 1WXVA 3TCAA 4N9F4 1H4RA 1LQBA 4EZJA 4HDQA 3PV1A 4MEMA 3OLMD 2JPHA 3IVFA 2N7DA 3IG3A 2WX1A 1D3ZA 3PTFC 2DYBA 1WGRA 2V4LA 3U7DA 2ASQA 4B95A 5CHWA 5KHQA 2O6VA 4EEWA 3HHMA 3NOBA 5JH5C 1WGDA 5LXIB 1GJZA 3QQ8B 4URKA 4EZLA 4KVGB 4G3XB 3VDZA 3PSEB 2WYQA 2IY0B 2J0JA 4ZRJA 3KUDB 2JRHA 2DZJA 1WR6E 4LCDE 4W9DA 3WAMA 1V9JA 3MJWA 3A9JA 5L95C 2IYDB 2ZNVC 4WJNA 3L08A 3ENEA 3AI5A 1R4NI 1XT9B 3RULA 4GB9A 1LXDA 2ZZPB 4W9HA 3OJ3A 4DDGD 2L3ZA 3ZTDA 3KW5B 3L17A 3ZRCA 2LGXA 1WZ0A 3MTNB 4WJPA 1L7YA 5CTRC 2V3SA 2KMCA 4GDLA 2EMTA 2KKCA 3UIPB 4TV3A 4B9KA 2MBBB 2ZPNA 3PHWB 2GOWA 1WJ4A 1UZXB 3DBLI 3VH3B 1P3QU 2ZCCA 4NJ6A 4WWPA 4IWPA 5EDSA 5JHAA 2KFJA 2KDFB 2K39A 4DBGA 3UGBB 3ZDTA 4MM3A 2FCMA 3D32A 4W9KA 3GZNI 1J8CA 1OEYA 2D07B 1E7VA 1WZ3A 2NBVB 3R3MA 2KX0A 1GUAB 4IC7B 1EF5A 4HCPB 2JVCA 4J6IA 2KVRA 2DAFA 2GBNA 4BVUC 2KDEB 3L13A 3B08A 2HTHA 1P0RA 3ML8A 4E74A 2Z0DB 2C7MB 1WGYA 3W1SA 2L00B 3V62A 5LXHA 4XX5A 2GBKA 3M95A 4WAAA 5FR6A 2NBWB 4F1SA 3ZRFA 3VH4B 5DPWA 1WGGA 1PQSA 2Z0EB 4GN1A 2JT4B 2M4NA 2FUHB 3RUIB 2BKFA 3VTUA 2A5UA 2LXAA 2N1WA 4EUTA 3H7SA 4HVBA 4MGKE 1S1QB 2K8CA 2KK8A 2KMAA 2KX3A 2GBRA 1YIWA 4NQKE 1YD8U 2QHOA 3UIOB 4TUUA 1KLVA 1WRDB 4HPLB 3PVLA 4LJPB 1R4MI 4EZKA 1V5OA 2LGDA 4ASWC 3DOWA 3IFWB 4JL9A 3HM6X 1VCBA 2NPTA 4BOZB 2KWCA 4IG7B 5D94A 4RM8A 3NS8A 1WR1A 3A9JB 5CHVC 1V6EA 3CSFA 2ZVOA 1WYWB 4G11A 4NPNA 4MH0E 3B0AA 3DPDA 2UYZB 4PS8A 2YLMA 3BY4B 3RCZA 2RGFA 1Z2MA 1UELA 2R2OA 5J2RA 2JXXA 3V61A 2BWFA 2KD0A 1IYFA 1YJ1A 2FAZA 1P98A 3BINA 1A5RA 1RRBA 2PE6B 1P1AA 1TBEA 2KLCA 3NZUA 4IM3A 3ZNHB 3SDLC 2M8SA 4NY0A 3QHTA 3TMPB 3A9KA 4AJWA 3DVGX 1V80A 1Q5WB 1E5WA 2Y5BB 3PRZA 2G3QB 4GOCA 4BKGA 3CF6E 2JUOA 4II3B 1V5TA 3H7PA 5L83A 4K7UA 2DYMA 4HLEA 3B1LX 4WWNA 4BKTA 1KM7A 2FCNA 4MGZE 1Q1OA 4HK2A 2KQSA 3NZSA 1E8YA 1V81A 2JZ3B 2IO1B 2LUEA 2K8BA 3QJZA 1IPGA 2KNBA 2D3GA 2MBEA 2WX0A 2DYOA 4K81A 1J0GA 3V6CB 4MSMB 1TTNA 1X1MA 4RM9A 2MP2B 3QWZB 2XBBC 2CU1A 1RFAA 2BYEA 3APDA 3ML9A 3PLVA 2PJHA 5DCNA 4DHJD 1WY8A 3Q3FA 5JZEB 4CHKA 2HD5B 4K1RB 2I1KA 1E7UA 4M8MA 4W9GA 1E90A 2IO0B 2K6DB 4DHZE 1WX8A 4WWOA 4CYEA 3EC8A 3VTWA 4HWIB 1OEYJ 2HJ8A 5DPTA 5E6PA 2MWSB 4W9IA 3ZDMC 2DHZA 2OOBB 3KYCD 3DBRI 4WJOA 3RD2A 5KHOA 3RT3B 3PS6A 1S3SG 4LDTD 3WANA 1NDDA 3APFA 2DZMA 2LXCA 1AARA 2FIDA 4DHZB 3TL5A 4A20A 1Z5SB 2LASA 2C7NB 1E8WA 3EHVA 2FIFA 3PLUA 5C23A 1WJNA 3L10B 2IY1B 3X0WA 2V1YA 4GGQA 5G55A 4E3CA 2MA9B 4GMVA 2MSED 4DHJB 2NPTB 4FLHA 5TR5A 3K9OB 3QA8A 4AJYB 2M17A 2N9EB 1NBFC 2FNJB 3I3TB 4FN2A 1E8ZA 4AUQC 3AU5A 2KTFA 4W9FA 3RYTA 2CKHB 4DXAB 2KTRB 4B6WA 3PRPB 3WAPA 5C1ZA 1OQYA 2MP2A 1WX7A 3QC8B 2B3AA 2N4FA 1WI0A 2M1MA 1G6JA 3ZLZA 3T8MA 4ICUA 3PHXB 1KJTA 2FCQA 1WIAA 1WMHA 2MW5A 1ZGUB 1E8XA 3PZDA 2J0MA 2KLGA 2VRRB 4FJVB 4GXBA 4LDTB 3W1SC 1IP9A 3CMMB 3JYUA 3V60A 3A9KB 3H1UA 1LM8B 5GMVA 4XZ4A 2PEAA 4ANUA 1SE9A 3EECA 2AL6A 2JWZA 2MCNB 3H7PB 2J7QB 2LVPA 5D7GA 3V6EB 2N9PC 2KHWB 4IWQA 3WA0A 2KDBA 5J18A 4AWJA 2ZJDA 3L16A 1UBIA 4W9JA 4JGHB 2Z59B 2CHWA 4ZRKA 2KDIA 2RSUA 3OJ4B 2C9WB 3NHEB 4IWOA 3M62B 2NS5A 1GNUA 2KANA 2RPQA 3UQBA 3A33B 2K1FA 3H6NA 2IZVB 1GG3A 4TQ0A 2KO3A 3UQAA 1WM2A 2BYVE 3PGEA 4GDKA 4X57B 3VUXA 3VQIA 2D2QA 2CHZA 1YX5B 2BGFA 3JVZX 3ZIMA 2DX5B 1UD7A 4KV2A 5D6JB 3HK0A 3QIJA 3AULA 3VVWB 3KYDD 2MQJA 3RZWC 4MSQB 1XQQA 2BPSA 2L0TA 1KOTA 3VAWA 2WDTB 3O65B 2KTRA 3SHQA 2KOXA 4FHKA 4MJSA 2L05A 4E71A 2PPHA 4MELA 4NAWA 3ZNGC 1EF1A 5BO4B 3JSVB 1OTRB 1WGHA 2R2QA 3QK0A 2CR5A 3VHTC 2MRPA 1K8RB 3DBHI 2DZIA 3SU8X 4FBJB 3CSTA 4KZCA 4TQ1A 4P7IA 3DBSA 3HM3A 2MLBA 2NR2A 3M3JA 5HKHA 5AZFA 2LVQA 4FJYA 4FHJA 2RD0A 4KIKA 1I35A 3R66C 2PE9A 4KDLB 2GBJA 4ANVA 3R7RA 4AP4C 4ANXA 3A4SC 4HXDA 4ZRIA 2IO2B 3M63B 4NQLB 1UGMA 5CX3A 2JZZA 4FADA 2KJ6A 1OGWA 1WF9A 3ZW3A 1T0YA 3RZFA 1WE7A 2GMIC 2N9XA 5DPSA 2HE7A 2YVCA 4KSKC 5CHFA 3U8ZA 4OVUA 4IUMB 2KZRA 3KUZA 1NI2A 4EFOA 1ZW7A 5IAAC 3VUWA 3ECIA 1HE8A 4IM0A 1RLFA 1YQBA 2D10A 3KUCB 5IA7A 3TIXA 4BBNC 1WMHB 2BWES 2LI5A 4G0NB 2ZCBA 4KZ0A 3ZO5B 3IHPC 3N30A 1EUVB 4AOFA 2DENB 4HJKA 2LGYA 2KFKB 2MBHA 2CHXA 5AZGA 2I1JA 1CMXB 4PYZA 4YL8A 3LJ3A 1L2NA 1VD2A 1TZ1A 2A4ZA 2JF5A 3SD5A 3ZUNA 4A3PA 2C5LC 3JSVA 2G4DB 2N7EA 5D2MB 2LJ5A 3UINB 3ZVVA 4HPMB 4ZYNA 1UBQA 2LWPA 3OAWA 3ZTCA 1WXSA 2N1VA 2W9NA 4ZDVA 2EKEC 5E6NA 3T9LA 3WIMA 3P2BA 4GDKB 3EFUA 3WAOA 3S2AA 2ZEQA 2ZPYA 2L0FA 2C60A 4GU2A 1I42A 3N3KB 4FJZA 4WJQA 5J17A 2NCNA 2OJRA 4MGIE 2KJHB 2NBUA 4FULA 4KSLC 4MJSB 2BF8B 2KQ7A 4NAWB 4XC2A 2BKRB 3JW0X 4I6NB 4BKSD 4NNJB 4I6PA 2XEWA 4W9LA 3N32A 1EO6A 3C0RB 2M0XA 3MHSD 4G50A 4I6LB 5AZHA 1GC6A 4PYUA 2D11A 3PREA 3WALA 3VFKA 1WH3A 1F9JA 2KN5A 2K25A 3W1YA 4F7ZA 4WQOB 2K6QA 4RMAA 3A4RA 2AL3A 2DZKA 1Q0WB 4GSWA 2JRIB 4W9EA 4DK5A 2LD9A 3A1QB 1UH6A 4KIKB 2REXA 2KFKA 2GBMA 3QARA 4OVVA 1SIFA 1WE6A 5E6OA 3VXWA 3TJPA 3KH0A 4EKUA 3KVFB 4PS3A 4W9CA 2EMSA 2NVUI 2MBOA 2O6VD 1V2YA 2WWZA 1WJ6A 2J0KA 3DVNU 5DPRA 3PRMB 4EOYA 1Y8RC 2XK5B 4DWFA 4HDOA 3NY5A 2O2VB 2LVOA 4JLCA 3DVGY 4NJ7A 2AYOB 3DCGA 3APCA 2IO3B 5LLIA 1JRUA 4F8CB 4FA6A 2MX2A 1M94A 3Q3JA 2KC2A 4TKNA 5JHBA 1WFYA 4HCNB
chains in the Genus database with same CATH superfamily
4DXGA 3QCAA 1C4AA 1KTKA 1TGZB 2G4SA 1NVID 3DQVA 1WM3A 1QZEA 1TKGA 3PT2B 3H9DA 1LGRA 2OEDA 2KWVB 1ZKHA 4II2B 3ZNZB 4RH6A 2WQYB 2FCSA 3X23A 4ICVA 2V3NA 4LTUA 2JY6A 2LGSA 1SGHA 3Q14C 3U52E 1L0XB 2X8XX 4NZLB 3R7QA 1V49A 4HKZE 4MDKE 1TKYA 2L7RA 3WCQA 1AN8A 1YX6B 2BB5A 3TBLD 1J19A 1STEA 1VRAB 4JIOU 1FXTB 1PGXA 3AE4B 4GDLB 5EE3A 2WU2B 4LK0M 2MJEA 1QT9A 3HIZA 1J7CA 3DDCB 5AEKB 2D3CA 1ISNA 5BMGA 3K9PB 2QILA 3RNFC 4N9F4 4ZHPA 1LQBA 4EZJA 1C79A 4MEMA 3IVFA 1OQQA 2NTTA 4M02A 4JE3B 3DHHC 2DYBA 3U7DA 2ASQA 5KHQA 3HHMA 5JH5C 1FM0D 5LXIB 1GJZA 3VDZA 2IY0B 2J0JA 4ZRJA 2DZJA 2UU7A 1CQVA 3A9JA 2IYDB 4WJNA 3RULA 1R4NI 1XT9B 1LXDA 4DDGD 3L17A 1WZ0A 2LGXA 5FK9C 2JYTA 3V3XA 4A55A 2KMCA 3Q69A 2BQQA 2KKCA 3GZNB 4TV3A 3ZJTA 1JWAD 1HZ5A 1WJ4A 1UZXB 4NJ6A 4IWPA 3N9YC 2KDMA 3Q8BA 4C56C 1SJED 3ZDTA 1OEYA 2JU6X 2VH1A 1T0QC 3R3MA 1XCQL 1JWSD 2JVCA 2KVRA 1I4GA 2HTHA 4IKGA 3AECB 4KGTA 5H92C 1D5ZC 1WGYA 3W1SA 5LXHA 2GBKA 4WAAA 1YN5A 5D3IB 5IOIA 1L0YB 1MJDA 2Z0EB 4RGOS 2FUHB 2A5UA 1L4DB 2KK8A 2GBRA 2QSDA 3MP9A 3VR9B 3PVLA 4AQ7A 3DHIC 1I4HA 4EZKA 1V5OA 4ASWC 3IFWB 3HM6X 3AE5B 3NS8A 1WR1A 3A9JB 4RM8A 5CHVC 4HROA 1ZE3D 4NPNA 4C4VB 4MH0E 4KGSA 2UYZB 4PS8A 3BY4B 4B0EA 1UNSA 5IO9A 2R2OA 2BWFA 2FAZA 1J7AA 3R2IA 3SFEB 4WWMA 4NY0A 3A9KA 1V80A 1Q5WB 4BKGA 3Q6BA 4II3B 3URYA 1RWSA 4BKTA 4MGZE 2OHFA 2KQSA 4C7YA 2IO1B 2LUEA 3AEEB 2K8BA 1V1PA 3HVZA 2D3GA 4K81A 1C4PA 2DYOA 1J0GA 2WXMA 1XLOA 2PIAA 2MP2B 1BXTA 2Y5PA 2CU1A 1ZP0B 2BYEA 3PLVA 5DCNA 3DBRB 1WY8A 3Q3FA 5JZEB 4D2KA 4W9GA 1KF6B 1E90A 2K9XA 3RMKC 1DYQA 2MEKA 5FKAC 5JXVA 4HWIB 1OEYJ 5DPTA 1TYGB 4NAMA 3B2FA 5E6PA 1ET6A 4LDTD 1AW7A 2LXCA 3RFZB 4KKJA 4YT0B 4YTNB 1WJNA 3L10B 2V1YA 2QCZA 1YN3A 1IBXA 1DOYA 4AJYB 4AUQC 3I3TB 1XEEA 3TEZA 1E8ZA 3AU5A 4W9FA 3ZXRA 1EWYC 3AEBB 3QC8B 1G6JA 1WIAA 2MW5A 4K3BA 3A9KB 1LM8B 5GMVA 1V97A 2PEAA 2LVPA 3V6EB 4IWQA 3NZ3A 3WA0A 2KDBA 1ZDXA 2ZJDA 4W9JA 1V1PB 3UQBA 3BZDB 2K1FA 2FUG1 1GG3A 4TQ0A 1WM2A 4X57B 3KWLA 1CJEA 2CHZA 2BGFA 4C7ZA 1HTOA 4MSQB 1XQQA 2BPSA 1KOTA 1TKEA 4MJSA 3NG0A 4ZRPA 3JSVB 1WGHA 3AE3B 2N7JA 3VHTC 2MRPA 4N6EB 4FBJB 4J3OD 4A6QA 4HKQA 1P7EA 1N62A 3HM3A 5H8YE 1UWMA 3M3JA 5AZFA 4FJYA 2RD0A 2WXIA 3A4SC 3M63B 4NQLB 4FADA 1SE2A 2KJ6A 1IBXB 1TS2A 3RZFA 1WE7A 2GMIC 4OVUA 3KUZA 2BVCA 1ZW7A 5IA7A 3I5JC 2E3TA 2LI5A 4G0NB 4KZ0A 4AOFA 1ZOYB 1GB4A 4A90A 2MBHA 4US9A 3AE1B 1JMLA 2K5PA 3N1ZC 2A4ZA 2Y5CA 3ZUNA 1N5WA 3T3OA 2N7EA 1R4NB 4HPMB 2D3BA 1UBQA 3GP7A 3TEWA 1JRPA 1WXSA 5E6NA 4AS1A 3EFUA 4YSXB 1SEBD 1F0ZA 2C60A 1T5XD 2HTME 1I4RA 5J17A 1B9RA 3L4PA 1C76A 4MGIE 2KJHB 4KSLC 1M4VA 4MJSB 3ZGZA 4OVZA 4NNJB 2I2YA 3MHSD 2D11A 3WALA 1B1ZA 1WRIA 2MHJA 2K3UA 2LD9A 5E6OA 3I9V1 2GBMA 3VXWA 1WE6A 3ZJUA 3KH0A 4W9CA 2DNFA 2MH7A 2INPE 2JYEA 2WWZA 5DPRA 4EOYA 1I4XA 1L0VB 3TUOA 1GAQB 2O2VB 2LVOA 3LB8C 2IGDA 3DCGA 2LHEA 1IGDA 4WURA 2KYWA 2AX5A 2MX2A 1M94A 4TKNA 4HCNB 4ANWA 3ZYYX 3ZNID 4BOSC 4MGYE 2KXJA 3UF8A 3L54A 1TY0A 5G2NA 1XD3B 2JZPA 1L4ZB 2FBWB 3QX1A 2DAJA 4K7WA 2O6VB 4XGAB 3LDZE 2CU3A 3NUHB 3QAQA 4LJOB 3KLSX 1J7BA 3A1QA 2KJRA 4IW0A 3GOEA 1WXAA 1V86A 4YXDB 4CO7A 2AWTA 4LNNA 4EE2A 3DVNV 2KWUB 2G1EA 2RR9A 3AXCA 1MHHE 2LRWA 1C3TA 2LFIA 1R7SA 3ALBA 3AU4A 4KDIC 1E7PB 2YEPB 1TS3A 3TCAA 3RNCC 1H4RA 1FRRA 1GOZA 3TSSA 4RFBA 3PV1A 1D5XC 1C9FA 2N7DA 3HVDA 1A70A 1D3ZA 2DWQA 2V4LA 2WXKA 2K22A 4A8XC 4EEWA 3NOBA 1WGDA 4EZLA 4P1CC 2J42A 2KACA 2WYQA 3MFGA 3RNEC 1N60A 1QKZA 4W9DA 5GXGB 3MJWA 4UDUC 5BYSA 1PYWD 1XXGA 2WXNA 4GB9A 3I63C 3Q3MC 3OJ3A 1Q10A 3MTNB 1L7YA 5CTRC 3TEXA 4GDLA 3NJTA 2EMTA 2KWDA 3H8HA 1QOGA 2G9HD 4IOIE 2ZPNA 2GOWA 1XLQA 2HDEA 2PVGC 5JHAA 2ZCCA 4WWPA 4MM3A 4W9KA 2DBYA 2BW2A 2NBVB 1XLPA 4CQNA 2KX0A 1GUAB 1EF5A 2V0GA 2VZKD 3L13A 2SAKA 3ML8A 4E74A 1RM6C 3VRBB 4XX5A 3M95A 2H89B 5FR6A 4WAFA 4F1SA 4REZA 3C19A 1R4MB 2M56B 1WGGA 4GN1A 1F2RI 1VZ7A 2M4NA 4C00A 2RDBC 2LXAA 2N1WA 2BTEA 5AUKA 2LHDA 1LO5D 2QHOA 3UIOB 4IDIA 4XE0A 2NPTA 4BAXA 5C3JB 2B76B 2GB1A 2PLPA 4IG7B 1TJEA 1V6EA 3CSFA 2ZVOA 1WYWB 4DXFA 4WH4A 1Z2MA 1UELA 5J2RA 2JXXA 3FKYA 4LNKA 3ABVB 1VJKA 2TSSA 1P98A 3BINA 1RRBA 2D3AA 1TBEA 2KLCA 2PE6B 1CK1A 4IM3A 3ZNHB 2V9HA 2M8SA 3QHTA 1NENB 4PK1A 4AJWA 2Y5BB 2G3QB 2WU5B 4GOCA 1EM7A 1FRDA 5L83A 4K7UA 1GB1A 1NYRA 1KLGD 4WWNA 3I57A 1V81A 4MM3B 3QJZA 2KNBA 2ACZB 1ZPSA 1ROEA 3AEGB 2KMMA 3QWZB 2XBBC 1ZXIA 3APDA 4DHJD 1N6ZA 5G5GA 4CHKA 2IGGA 4XDDA 5T8IA 1WX8A 4C4VA 2NTSA 2MWSB 4WJOA 3RT3B 1S3SG 1NDDA 2M0AA 3W5VB 3GE3C 4US8A 1AARA 4DHZB 2PVOD 4A20A 3B9JA 3PLUA 2KAJA 2N0SB 2LGIA 2IY1B 1TIFA 3X0WA 3SEBA 2NPTB 3K9OB 4FN2A 1NBFC 3EGRA 1NYQA 3RYTA 4DXAB 5D3DA 3IAM1 3OWEB 2Z8LA 1SSNA 4YTPB 2BBCA 3PRPB 2MP2A 5BMHA 2SEBD 3AM9A 1WMHA 1ZGUB 1E8XA 3AE9B 2VRRB 1WYGA 4GXBA 3W1SC 3JYUA 1WWTA 1FIQA 3H1UA 3AH7A 4XZ4A 3NRZA 3GB1A 1SE9A 2KT7A 4ANUA 2JWZA 2MCNB 5D7GA 2N9PC 1TS5A 3P4SB 4OW0A 2RSUA 3U2SC 3NHEB 3FILB 2KANA 2IZVB 1QOFA 4GDKA 1BMLC 1T0RC 2R61A 1JWUD 3ZIMA 1UD7A 5D6JB 3HK0A 3DBHB 3VRAB 3KYDD 4TMAB 2HJ1A 3EFCA 3RZWC 1F77A 2KQ4X 3U4EG 2L0TA 3VAWA 3SHQA 2KOXA 4LNFA 1XCTL 5BO4B 2R2QA 1XLNA 3QK0A 2CR5A 4RGMA 3SU8X 1VLBA 1AYFA 4KZCA 4TQ1A 2MLBA 5HKHA 4KIKA 4K3CA 2EELA 2GBJA 4ANVA 3R7RA 4ZRIA 2IO2B 2WGSA 5CX3A 1UGMA 1WF9A 1EWCA 1P7FA 2MJDA 2N9XA 5DPSA 5CHFA 4EFOA 1D6EC 4XDCA 2BYTA 1YQBA 3KUCB 3TIXA 4BBNC 1WMHB 2BWES 2ZCBA 3IHPC 3N30A 3AMZA 2ZW0A 2KFKB 2I1JA 4PYZA 1C77A 3LJ3A 1VD2A 4XYCA 3SFDB 3JSVA 1T3QA 3AE8B 3UINB 5D2MB 1YOVB 4ZYNA 2LWPA 2EKEC 3WIMA 1QILA 3RNGC 4GDKB 3S2AA 1WSPA 3N20C 2J52A 1I42A 1L6UA 2NCNA 2OJRA 1ESFA 5HHDG 2BF8B 4ARCA 3JW0X 4I6NB 4NJCA 4I6PA 2XEWA 4W9LA 4YSYB 1JWBD 3N32A 1EO6A 4PYUA 4WQMA 3PREA 4ACFA 1WH3A 1JCKB 1F9JA 2AL3A 2DZKA 4W9EA 2JX5A 4KIKB 2REXA 2VH2A 3QARA 4EKUA 3TJPA 3KVFB 1K52A 4PS3A 2EMSA 3J9CA 1I4QA 3DVNU 3PRMB 1Y8RC 1DOIA 2XK5B 4DWFA 1SBBB 3NY5A 3DVGY 4NJ7A 3APCA 2IO3B 5FR3A 1JRUA 1EU4A 3FAHA 3ZJVA 3Q3JA 2M19A 1FNWA 3MHZA 1I4PA 2LRUA 2LZ6A 2WXOA 4IM2A 3BWUD 1LFDA 2K8HA 1FFVA 4C80A 1HXYD 1SXTA 1DOXA 2IBIB 1MG8A 3VR8B 3C8YA 1KLUD 3VTVA 1BT0A 2AEHA 4H2AA 3CWIA 1NEKB 3NVWA 2RMMA 3GE8C 1L6VA 4O1NA 4M8NA 4GIVA 4BBNF 1N5XA 1WX9A 5BYRA 2ZNVB 3PPAA 1H8CA 2L76A 2O2VA 2V4IB 2CJOA 4JQWC 1WXMA 3VUYA 1C1YB 4BKSA 1WXVA 2FE8A 2QMTA 3Q3OC 2QJLA 2WHIA 3KQ4A 2DLBA 4HDQA 2JPHA 3IG3A 2WX1A 3PTFC 2BS4B 4ZHOA 5CHWA 2O6VA 5AUIA 4A9AA 5HFYA 4QAYA 1FCLA 1HTQA 3Q2AC 3KUDB 2JRHA 3P42A 1WR6E 2WXRA 3WAMA 4LNOA 4YTMB 3ENEA 1YQ4B 3AI5A 2WXFA 4W9HA 3ZRCA 1MPEA 5EE1A 4RCOA 2AQ1B 4KGRA 4MH8A 2WXHA 1FMAD 3PZ7A 3CIRB 1YJJA 3V05A 3AE7B 4DBGA 3UGBB 3T3NA 3D32A 3GZNI 2D07B 1E7VA 4IC7B 4HCPB 4GLSC 2GBNA 4LNIA 3NVYA 1YMHE 3B08A 1XF5L 5E6JA 2Z0DB 1IGCA 1TS4A 2IGHA 1FEHA 2C7MB 4P6VF 3V62A 4N58A 4MT5A 1CZPA 2LUMA 1PQSA 1ZDVA 2LMCA 2JT4B 5G5HA 4L1BA 3RUIB 4HVBA 4MGKE 1S1QB 2K8CA 2KMAA 2KX3A 4NQKE 2W55A 1YD8U 4TUUA 2CJNA 4HPLB 2WXJA 2MJ3A 4LJPB 1V1OA 4JL9A 1VCBA 2KWCA 5D94A 3MC0B 3HRDD 4G11A 3B0AA 3DHGC 3DPDA 2YLMA 1IUEA 1BUIC 1QOBA 3RCZA 3NVZA 2KD0A 1IYFA 1L5PA 1E0ZA 1C4CA 1P1AA 3SDLC 2N9KA 3DVGX 1MHXA 1E5WA 3BYYB 3CF6E 3H7PA 4HLEA 1KM7A 1Q1OA 5HG2A 1E8YA 3RN9C 2JZ3B 1MFWA 1E6EB 2WX0A 1C78A 1TTNA 2K0PA 3FC4A 2IPKD 1QLBB 5IN7A 5EE9A 1N63A 2PJHA 1KRHA 5TSSA 2HD5B 4K1RB 2I1KA 1ZXHA 3P4QB 3LYYA 2GLSA 4M8MA 4ZYSA 4WWOA 4CYEA 2QEJC 3EC8A 2HJ8A 1PGAA 3ZDMC 2OOBB 3KYCD 3AV8A 3DBRI 3RD2A 2H88B 3PS6A 2WDQB 3APFA 2BB6A 4JWUC 1F1HA 1PUTA 5MPOA 2RDGA 1Z5SB 2LASA 1E8WA 3EHVA 5C23A 1KFYB 2BT6A 1NI3A 2MA9B 2MSED 5TR5A 1ENFA 2M17A 1YN4A 2N9EB 4KKIA 3KWVA 4TSSA 2KTRB 4B6WA 3Q8FA 5C1ZA 3BVMA 1WX7A 2B3AA 2N4FA 1WI0A 2M1MA 4ICUA 3PHXB 1KJTA 2FCQA 2KLGA 4LDTB 3V60A 2RDHA 2AQ3B 4L23A 2AL6A 3H7PB 2J7QB 2KHWB 4HPPA 2JSVX 5J18A 4AWJA 3L16A 3BVGA 4JGHB 2L83A 2CHWA 1FCCC 3OJ4B 3M62B 1PDXA 1T0SC 2NS5A 1GNUA 3A33B 2KO3A 3UQAA 2BYVE 1TY2A 2W82A 3VQIA 2D2QA 3JVZX 2INDC 2DX5B 3AULA 2KN4A 3VVWB 2MQJA 2IJ0A 1ET9A 4ARIA 4HJGE 2L05A 3ZNGC 1EF1A 1OTRB 1TZOA 3CSTA 4P7IA 3UI3A 2NR2A 3DWGC 2LVQA 1I35A 1VZ6A 2PKOA 2PE9A 2L52A 4ANXA 3AEFB 3MC9A 1FXIA 1SIJA 4ITKA 1KH0A 1OQRA 2LJIA 1T0YA 1QOAA 3P4PB 3U7ZA 2HE7A 2YVCA 4KSKC 3NS1A 3U8ZA 3FILA 4S17A 3GS2A 1SE3A 1HE8A 3ECIA 3P1MA 4ZRQA 1FD6A 1HQRD 3ZO5B 1EUVB 2DENB 2WNMA 4M0WA 1DGJA 1ZUD2 4YL8A 5C2TB 2Q5WD 1SF0A 3HUIA 1TZ1A 3IAS1 2C5LC 1SJHD 3ZVVA 4USAA 2WXLA 4YWGG 2QDFA 2N1VA 1YQ3B 1JALA 2ZEQA 2WS3B 2ZW1A 1QQRA 3N3KB 4FJZA 3PO0A 2NBUA 3Q8AA 2J4XA 3OG5A 2BKRB 4HEA1 4BKSD 2M0XA 4KX6B 1GC6A 2K25A 3A4RA 2NMQA 1Q0WB 2WDRB 2JRIB 1UH6A 1FO4A 2KFKA 1SIFA 3RNAC 2NVUI 2MBOA 2O6VD 4L2YA 1WJ6A 3RPFC 3Q8EA 3E56A 1WFYA 1UGJA 1RYJA 2QIEB 3IBEA 2CS4A 2KC1A 4PS7A 4M0WB 2G45B 2EKIA 4BFRA 4K7SA 1U4AA 2BYFA 4HRSA 2C7HA 1N61A 2MBQA 1RAXA 3L0WB 1E10A 1UUPA 3ONSA 1JROA 3ZKJC 4DDID 3AN1A 4XWTA 3IT6B 1WJUA 5LNK1 3BIID 4M01A 3U30A 2ZVNA 1T6BX 1YJIA 2XK5A 2L8JA 4A3OA 1F2RC 1D5MC 1GC7A 1WGKA 2UWQA 4RGNA 1P9DU 2XN9C 1FXAA 3OLMD 4BZAA 2I38A 1WGRA 1PGBA 1RFKA 4B95A 5IKCM 4LLGM 4N59A 3QQ8B 4URKA 4KVGB 4G3XB 3PSEB 1WXQA 4LCDE 1V9JA 5L95C 2ZNVC 5EE0A 3L08A 1QF6A 3SR6A 2ZZPB 2L3ZA 3ZTDA 3KW5B 1FNUA 4WJPA 4FXCA 1HA5A 1OFFA 2LEKA 2V3SA 4OZCA 3UIPB 2WXQA 4MACA 4B9KA 2MBBB 3PHWB 3BK1A 3DBLI 3VH3B 1P3QU 5EDSA 1VR9A 2KFJA 3AE6B 2KDFB 2K39A 4JPSA 3TEYA 2JWUA 1E9MA 3P63A 2FCMA 1AWDA 1J8CA 1WZ3A 2INNE 1SE4A 2AQ2B 4J6IA 2DAFA 2WXPA 4RF1A 4BVUC 2KDEB 3AEAB 1P0RA 2L00B 2JQRB 2RPVA 2NBWB 1K53A 3ZRFA 2QC8A 3VH4B 4Q2JA 5DPWA 2BKFA 3VTUA 4EUTA 3H7SA 1YIWA 3AE2B 2XNAC 1KLVA 1WRDB 4M00A 4YSZB 2VZKB 1R4MI 2LGDA 3DOWA 4BOZB 3R8BA 2RGFA 3RI7C 3V61A 5HI1A 1YJ1A 2J53A 1A5RA 3NZUA 2IDYA 3TMPB 1V8CA 1SB3C 3PRZA 3O13A 2JUOA 1V5TA 2GRIA 2DYMA 3B1LX 4P1BC 2BS2B 2FCNA 4RNAA 4HK2A 3NZSA 3NVVA 3IT4B 1IPGA 2MBEA 1K50A 4RF0A 3V6CB 4MSMB 1X1MA 3BK2A 4RM9A 1JW9D 1XO3A 1RFAA 3ML9A 1ACCA 3E9SA 3ETRA 1HZ6A 1E7UA 2IO0B 4OZAA 2K6DB 4DHZE 2KVZA 3VTWA 1MVKA 4B0MA 4W9IA 2DHZA 5KHOA 3WANA 4JWSC 2DZMA 4WIPA 2FIDA 3TL5A 2E6XA 2C7NB 2WXGA 2FIFA 4P16A 1TT5B 4GGQA 1YNTE 5G55A 4E3CA 2W3RA 4GMVA 2N9LA 2ON8A 4FLHA 4DHJB 2W54A 3QA8A 2FNJB 2KTFA 4OZBA 2CKHB 3R2TA 3B2GA 3BVZA 4PT5A 3WAPA 4R3DA 1OQYA 2PTLA 3EA6A 1Y56A 2PMVA 3ZLZA 3T8MA 3PZDA 2J0MA 4FJVB 1IP9A 3CMMB 3BYTB 3EECA 1K51A 3LXFA 1UBIA 2Z59B 1MG4A 4ZRKA 2KDIA 4IWOA 2C9WB 2RPQA 3ZQ4A 3H6NA 5BMIA 1MI0A 3PGEA 3VUXA 4RGTA 1YX5B 4KV2A 1JQ4A 3QIJA 2WDVB 2ICIA 5BYQA 2WDTB 3O65B 2KTRA 4FHKA 1UWXA 4E71A 2PPHA 4MELA 4NAWA 2V3PA 2L32A 1K8RB 3DBHI 2DZIA 3MC8A 1I7HA 3DBSA 4FHJA 3R66C 4KDLB 4AP4C 3N1XC 4HXDA 2JZZA 1HEZE 2ONQA 2PW9A 2Y3AA 3EUB2 1OGWA 3ZW3A 4IUMB 2KZRA 1NI2A 5IAAC 3VUWA 4IM0A 1RLFA 2D10A 4XWWA 4HJKA 2LGYA 3IXSA 1VDVA 2CHXA 2WP9B 2YEPF 5AZGA 1CMXB 3PZ8A 1F52A 1D4BA 3N1YC 3W9CB 1FFUA 1L2NA 2JF5A 3SD5A 4A3PA 3ZXVA 4JX1C 1FNVA 2G4DB 2LJ5A 3OAWA 3Q8CA 3ZTCA 2W9NA 4ZDVA 3T9LA 3P2BA 3Q3NC 3WAOA 5IP4D 2ZPYA 1JWMD 2L0FA 2GI9A 1PFDA 4GU2A 2OJWA 4WJQA 3AB5A 2X38A 2W3SA 3DBLB 1UF0A 5I4DA 4FULA 2KQ7A 4NAWB 4XC2A 1GPXA 3P4RB 2BS3B 3C0RB 4I6LB 4G50A 3MJ5A 5AZHA 3AEDB 1FPYA 3VFKA 2KN5A 3W1YA 4F7ZA 4WQOB 2K6QA 4RMAA 4GSWA 4DK5A 4OHJA 3A1QB 4OVVA 1EU3A 3W5UB 2JXTA 1VZ8A 2WLBA 4ZOHC 1V2YA 2J0KA 4S0RA 3DWMA 2INCC 2L1AA 4HDOA 3W2DA 4JLCA 2AYOB 3RNBC 4DQOC 5LLIA 2D5GA 4F8CB 4FA6A 2KC2A 5JHBA
chains in the Genus database with same CATH topology
4ANWA 3QCAA 1TGZB 2G4SA 2CS4A 2KC1A 3IBEA 2LRUA 2LZ6A 4IM2A 4PS7A 3ZNID 3DQVA 1WM3A 4M0WB 1QZEA 2G45B 3PT2B 4MGYE 2KXJA 4BOSC 3UF8A 4BFRA 4K7SA 1U4AA 2BYFA 3L54A 5G2NA 3H9DA 1XD3B 1LFDA 2C7HA 2K8HA 2MBQA 2KWVB 1ZKHA 3QX1A 2IBIB 1MG8A 1RAXA 2DAJA 4II2B 2O6VB 4K7WA 3ZNZB 3VTVA 1BT0A 2AEHA 3L0WB 3LDZE 2FCSA 3X23A 4ICVA 3ONSA 3QAQA 4LJOB 2JY6A 3ZKJC 1SGHA 3A1QA 3R7QA 2KJRA 4DDID 4IW0A 3GOEA 1V49A 1WXAA 4MDKE 4M8NA 4GIVA 2L7RA 1V86A 4BBNF 1WJUA 1WX9A 1YX6B 2ZNVB 3U30A 2ZVNA 3PPAA 1H8CA 4CO7A 2AWTA 3TBLD 2XK5A 2L8JA 1J19A 2L76A 4A3OA 3DVNV 2O2VA 4JIOU 1FXTB 2KWUB 4GDLB 2RR9A 3AXCA 2LRWA 3HIZA 4JQWC 1C3TA 3DDCB 1GC7A 1WXMA 3VUYA 3ALBA 3AU4A 4KDIC 5AEKB 2UWQA 1ISNA 1C1YB 3K9PB 4BKSA 1P9DU 1WXVA 3TCAA 4N9F4 1H4RA 1LQBA 4EZJA 4HDQA 3PV1A 4MEMA 3OLMD 2JPHA 3IVFA 2N7DA 3IG3A 2WX1A 1D3ZA 3PTFC 2DYBA 1WGRA 2V4LA 3U7DA 2ASQA 4B95A 5CHWA 5KHQA 2O6VA 4EEWA 3HHMA 3NOBA 5JH5C 1WGDA 5LXIB 1GJZA 3QQ8B 4URKA 4EZLA 4KVGB 4G3XB 3VDZA 3PSEB 2WYQA 2IY0B 2J0JA 4ZRJA 3KUDB 2JRHA 2DZJA 1WR6E 4LCDE 4W9DA 3WAMA 1V9JA 3MJWA 3A9JA 5L95C 2IYDB 2ZNVC 4WJNA 3L08A 3ENEA 3AI5A 1R4NI 1XT9B 3RULA 4GB9A 1LXDA 2ZZPB 4W9HA 3OJ3A 4DDGD 2L3ZA 3ZTDA 3KW5B 3L17A 3ZRCA 2LGXA 1WZ0A 3MTNB 4WJPA 1L7YA 5CTRC 2V3SA 2KMCA 4GDLA 2EMTA 2KKCA 3UIPB 4TV3A 4B9KA 2MBBB 2ZPNA 3PHWB 2GOWA 1WJ4A 1UZXB 3DBLI 3VH3B 1P3QU 2ZCCA 4NJ6A 4WWPA 4IWPA 5EDSA 5JHAA 2KFJA 2KDFB 2K39A 4DBGA 3UGBB 3ZDTA 4MM3A 2FCMA 3D32A 4W9KA 3GZNI 1J8CA 1OEYA 2D07B 1E7VA 1WZ3A 2NBVB 3R3MA 2KX0A 1GUAB 4IC7B 1EF5A 4HCPB 2JVCA 4J6IA 2KVRA 2DAFA 2GBNA 4BVUC 2KDEB 3L13A 3B08A 2HTHA 1P0RA 3ML8A 4E74A 2Z0DB 2C7MB 1WGYA 3W1SA 2L00B 3V62A 5LXHA 4XX5A 2GBKA 3M95A 4WAAA 5FR6A 2NBWB 4F1SA 3ZRFA 3VH4B 5DPWA 1WGGA 1PQSA 2Z0EB 4GN1A 2JT4B 2M4NA 2FUHB 3RUIB 2BKFA 3VTUA 2A5UA 2LXAA 2N1WA 4EUTA 3H7SA 4HVBA 4MGKE 1S1QB 2K8CA 2KK8A 2KMAA 2KX3A 2GBRA 1YIWA 4NQKE 1YD8U 2QHOA 3UIOB 4TUUA 1KLVA 1WRDB 4HPLB 3PVLA 4LJPB 1R4MI 4EZKA 1V5OA 2LGDA 4ASWC 3DOWA 3IFWB 4JL9A 3HM6X 1VCBA 2NPTA 4BOZB 2KWCA 4IG7B 5D94A 4RM8A 3NS8A 1WR1A 3A9JB 5CHVC 1V6EA 3CSFA 2ZVOA 1WYWB 4G11A 4NPNA 4MH0E 3B0AA 3DPDA 2UYZB 4PS8A 2YLMA 3BY4B 3RCZA 2RGFA 1Z2MA 1UELA 2R2OA 5J2RA 2JXXA 3V61A 2BWFA 2KD0A 1IYFA 1YJ1A 2FAZA 1P98A 3BINA 1A5RA 1RRBA 2PE6B 1P1AA 1TBEA 2KLCA 3NZUA 4IM3A 3ZNHB 3SDLC 2M8SA 4NY0A 3QHTA 3TMPB 3A9KA 4AJWA 3DVGX 1V80A 1Q5WB 1E5WA 2Y5BB 3PRZA 2G3QB 4GOCA 4BKGA 3CF6E 2JUOA 4II3B 1V5TA 3H7PA 5L83A 4K7UA 2DYMA 4HLEA 3B1LX 4WWNA 4BKTA 1KM7A 2FCNA 4MGZE 1Q1OA 4HK2A 2KQSA 3NZSA 1E8YA 1V81A 2JZ3B 2IO1B 2LUEA 2K8BA 3QJZA 1IPGA 2KNBA 2D3GA 2MBEA 2WX0A 2DYOA 4K81A 1J0GA 3V6CB 4MSMB 1TTNA 1X1MA 4RM9A 2MP2B 3QWZB 2XBBC 2CU1A 1RFAA 2BYEA 3APDA 3ML9A 3PLVA 2PJHA 5DCNA 4DHJD 1WY8A 3Q3FA 5JZEB 4CHKA 2HD5B 4K1RB 2I1KA 1E7UA 4M8MA 4W9GA 1E90A 2IO0B 2K6DB 4DHZE 1WX8A 4WWOA 4CYEA 3EC8A 3VTWA 4HWIB 1OEYJ 2HJ8A 5DPTA 5E6PA 2MWSB 4W9IA 3ZDMC 2DHZA 2OOBB 3KYCD 3DBRI 4WJOA 3RD2A 5KHOA 3RT3B 3PS6A 1S3SG 4LDTD 3WANA 1NDDA 3APFA 2DZMA 2LXCA 1AARA 2FIDA 4DHZB 3TL5A 4A20A 1Z5SB 2LASA 2C7NB 1E8WA 3EHVA 2FIFA 3PLUA 5C23A 1WJNA 3L10B 2IY1B 3X0WA 2V1YA 4GGQA 5G55A 4E3CA 2MA9B 4GMVA 2MSED 4DHJB 2NPTB 4FLHA 5TR5A 3K9OB 3QA8A 4AJYB 2M17A 2N9EB 1NBFC 2FNJB 3I3TB 4FN2A 1E8ZA 4AUQC 3AU5A 2KTFA 4W9FA 3RYTA 2CKHB 4DXAB 2KTRB 4B6WA 3PRPB 3WAPA 5C1ZA 1OQYA 2MP2A 1WX7A 3QC8B 2B3AA 2N4FA 1WI0A 2M1MA 1G6JA 3ZLZA 3T8MA 4ICUA 3PHXB 1KJTA 2FCQA 1WIAA 1WMHA 2MW5A 1ZGUB 1E8XA 3PZDA 2J0MA 2KLGA 2VRRB 4FJVB 4GXBA 4LDTB 3W1SC 1IP9A 3CMMB 3JYUA 3V60A 3A9KB 3H1UA 1LM8B 5GMVA 4XZ4A 2PEAA 4ANUA 1SE9A 3EECA 2AL6A 2JWZA 2MCNB 3H7PB 2J7QB 2LVPA 5D7GA 3V6EB 2N9PC 2KHWB 4IWQA 3WA0A 2KDBA 5J18A 4AWJA 2ZJDA 3L16A 1UBIA 4W9JA 4JGHB 2Z59B 2CHWA 4ZRKA 2KDIA 2RSUA 3OJ4B 2C9WB 3NHEB 4IWOA 3M62B 2NS5A 1GNUA 2KANA 2RPQA 3UQBA 3A33B 2K1FA 3H6NA 2IZVB 1GG3A 4TQ0A 2KO3A 3UQAA 1WM2A 2BYVE 3PGEA 4GDKA 4X57B 3VUXA 3VQIA 2D2QA 2CHZA 1YX5B 2BGFA 3JVZX 3ZIMA 2DX5B 1UD7A 4KV2A 5D6JB 3HK0A 3QIJA 3AULA 3VVWB 3KYDD 2MQJA 3RZWC 4MSQB 1XQQA 2BPSA 2L0TA 1KOTA 3VAWA 2WDTB 3O65B 2KTRA 3SHQA 2KOXA 4FHKA 4MJSA 2L05A 4E71A 2PPHA 4MELA 4NAWA 3ZNGC 1EF1A 5BO4B 3JSVB 1OTRB 1WGHA 2R2QA 3QK0A 2CR5A 3VHTC 2MRPA 1K8RB 3DBHI 2DZIA 3SU8X 4FBJB 3CSTA 4KZCA 4TQ1A 4P7IA 3DBSA 3HM3A 2MLBA 2NR2A 3M3JA 5HKHA 5AZFA 2LVQA 4FJYA 4FHJA 2RD0A 4KIKA 1I35A 3R66C 2PE9A 4KDLB 2GBJA 4ANVA 3R7RA 4AP4C 4ANXA 3A4SC 4HXDA 4ZRIA 2IO2B 3M63B 4NQLB 1UGMA 5CX3A 2JZZA 4FADA 2KJ6A 1OGWA 1WF9A 3ZW3A 1T0YA 3RZFA 1WE7A 2GMIC 2N9XA 5DPSA 2HE7A 2YVCA 4KSKC 5CHFA 3U8ZA 4OVUA 4IUMB 2KZRA 3KUZA 1NI2A 4EFOA 1ZW7A 5IAAC 3VUWA 3ECIA 1HE8A 4IM0A 1RLFA 1YQBA 2D10A 3KUCB 5IA7A 3TIXA 4BBNC 1WMHB 2BWES 2LI5A 4G0NB 2ZCBA 4KZ0A 3ZO5B 3IHPC 3N30A 1EUVB 4AOFA 2DENB 4HJKA 2LGYA 2KFKB 2MBHA 2CHXA 5AZGA 2I1JA 1CMXB 4PYZA 4YL8A 3LJ3A 1L2NA 1VD2A 1TZ1A 2A4ZA 2JF5A 3SD5A 3ZUNA 4A3PA 2C5LC 3JSVA 2G4DB 2N7EA 5D2MB 2LJ5A 3UINB 3ZVVA 4HPMB 4ZYNA 1UBQA 2LWPA 3OAWA 3ZTCA 1WXSA 2N1VA 2W9NA 4ZDVA 2EKEC 5E6NA 3T9LA 3WIMA 3P2BA 4GDKB 3EFUA 3WAOA 3S2AA 2ZEQA 2ZPYA 2L0FA 2C60A 4GU2A 1I42A 3N3KB 4FJZA 4WJQA 5J17A 2NCNA 2OJRA 4MGIE 2KJHB 2NBUA 4FULA 4KSLC 4MJSB 2BF8B 2KQ7A 4NAWB 4XC2A 2BKRB 3JW0X 4I6NB 4BKSD 4NNJB 4I6PA 2XEWA 4W9LA 3N32A 1EO6A 3C0RB 2M0XA 3MHSD 4G50A 4I6LB 5AZHA 1GC6A 4PYUA 2D11A 3PREA 3WALA 3VFKA 1WH3A 1F9JA 2KN5A 2K25A 3W1YA 4F7ZA 4WQOB 2K6QA 4RMAA 3A4RA 2AL3A 2DZKA 1Q0WB 4GSWA 2JRIB 4W9EA 4DK5A 2LD9A 3A1QB 1UH6A 4KIKB 2REXA 2KFKA 2GBMA 3QARA 4OVVA 1SIFA 1WE6A 5E6OA 3VXWA 3TJPA 3KH0A 4EKUA 3KVFB 4PS3A 4W9CA 2EMSA 2NVUI 2MBOA 2O6VD 1V2YA 2WWZA 1WJ6A 2J0KA 3DVNU 5DPRA 3PRMB 4EOYA 1Y8RC 2XK5B 4DWFA 4HDOA 3NY5A 2O2VB 2LVOA 4JLCA 3DVGY 4NJ7A 2AYOB 3DCGA 3APCA 2IO3B 5LLIA 1JRUA 4F8CB 4FA6A 2MX2A 1M94A 3Q3JA 2KC2A 4TKNA 5JHBA 1WFYA 4HCNB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ANW A;  3QCA A;  1TGZ B;  2G4S A;  2CS4 A;  2KC1 A;  3IBE A;  2LRU A;  2LZ6 A;  4IM2 A;  4PS7 A;  3ZNI D;  3DQV A;  1WM3 A;  4M0W B;  1QZE A;  2G45 B;  3PT2 B;  4MGY E;  2KXJ A;  4BOS C;  3UF8 A;  4BFR A;  4K7S A;  1U4A A;  2BYF A;  3L54 A;  5G2N A;  3H9D A;  1XD3 B;  1LFD A;  2C7H A;  2K8H A;  2MBQ A;  2KWV B;  1ZKH A;  3QX1 A;  2IBI B;  1MG8 A;  1RAX A;  2DAJ A;  4II2 B;  2O6V B;  4K7W A;  3ZNZ B;  3VTV A;  1BT0 A;  2AEH A;  3L0W B;  3LDZ E;  2FCS A;  3X23 A;  4ICV A;  3ONS A;  3QAQ A;  4LJO B;  2JY6 A;  3ZKJ C;  1SGH A;  3A1Q A;  3R7Q A;  2KJR A;  4DDI D;  4IW0 A;  3GOE A;  1V49 A;  1WXA A;  4MDK E;  4M8N A;  4GIV A;  2L7R A;  1V86 A;  4BBN F;  1WJU A;  1WX9 A;  1YX6 B;  2ZNV B;  3U30 A;  2ZVN A;  3PPA A;  1H8C A;  4CO7 A;  2AWT A;  3TBL D;  2XK5 A;  2L8J A;  1J19 A;  2L76 A;  4A3O A;  3DVN V;  2O2V A;  4JIO U;  1FXT B;  2KWU B;  4GDL B;  2RR9 A;  3AXC A;  2LRW A;  3HIZ A;  4JQW C;  1C3T A;  3DDC B;  1GC7 A;  1WXM A;  3VUY A;  3ALB A;  3AU4 A;  4KDI C;  5AEK B;  2UWQ A;  1ISN A;  1C1Y B;  3K9P B;  4BKS A;  1P9D U;  1WXV A;  3TCA A;  4N9F 4;  1H4R A;  1LQB A;  4EZJ A;  4HDQ A;  3PV1 A;  4MEM A;  3OLM D;  2JPH A;  3IVF A;  2N7D A;  3IG3 A;  2WX1 A;  1D3Z A;  3PTF C;  2DYB A;  1WGR A;  2V4L A;  3U7D A;  2ASQ A;  4B95 A;  5CHW A;  5KHQ A;  2O6V A;  4EEW A;  3HHM A;  3NOB A;  5JH5 C;  1WGD A;  5LXI B;  1GJZ A;  3QQ8 B;  4URK A;  4EZL A;  4KVG B;  4G3X B;  3VDZ A;  3PSE B;  2WYQ A;  2IY0 B;  2J0J A;  4ZRJ A;  3KUD B;  2JRH A;  2DZJ A;  1WR6 E;  4LCD E;  4W9D A;  3WAM A;  1V9J A;  3MJW A;  3A9J A;  5L95 C;  2IYD B;  2ZNV C;  4WJN A;  3L08 A;  3ENE A;  3AI5 A;  1R4N I;  1XT9 B;  3RUL A;  4GB9 A;  1LXD A;  2ZZP B;  4W9H A;  3OJ3 A;  4DDG D;  2L3Z A;  3ZTD A;  3KW5 B;  3L17 A;  3ZRC A;  2LGX A;  1WZ0 A;  3MTN B;  4WJP A;  1L7Y A;  5CTR C;  2V3S A;  2KMC A;  4GDL A;  2EMT A;  2KKC A;  3UIP B;  4TV3 A;  4B9K A;  2MBB B;  2ZPN A;  3PHW B;  2GOW A;  1WJ4 A;  1UZX B;  3DBL I;  3VH3 B;  1P3Q U;  2ZCC A;  4NJ6 A;  4WWP A;  4IWP A;  5EDS A;  5JHA A;  2KFJ A;  2KDF B;  2K39 A;  4DBG A;  3UGB B;  3ZDT A;  4MM3 A;  2FCM A;  3D32 A;  4W9K A;  3GZN I;  1J8C A;  1OEY A;  2D07 B;  1E7V A;  1WZ3 A;  2NBV B;  3R3M A;  2KX0 A;  1GUA B;  4IC7 B;  1EF5 A;  4HCP B;  2JVC A;  4J6I A;  2KVR A;  2DAF A;  2GBN A;  4BVU C;  2KDE B;  3L13 A;  3B08 A;  2HTH A;  1P0R A;  3ML8 A;  4E74 A;  2Z0D B;  2C7M B;  1WGY A;  3W1S A;  2L00 B;  3V62 A;  5LXH A;  4XX5 A;  2GBK A;  3M95 A;  4WAA A;  5FR6 A;  2NBW B;  4F1S A;  3ZRF A;  3VH4 B;  5DPW A;  1WGG A;  1PQS A;  2Z0E B;  4GN1 A;  2JT4 B;  2M4N A;  2FUH B;  3RUI B;  2BKF A;  3VTU A;  2A5U A;  2LXA A;  2N1W A;  4EUT A;  3H7S A;  4HVB A;  4MGK E;  1S1Q B;  2K8C A;  2KK8 A;  2KMA A;  2KX3 A;  2GBR A;  1YIW A;  4NQK E;  1YD8 U;  2QHO A;  3UIO B;  4TUU A;  1KLV A;  1WRD B;  4HPL B;  3PVL A;  4LJP B;  1R4M I;  4EZK A;  1V5O A;  2LGD A;  4ASW C;  3DOW A;  3IFW B;  4JL9 A;  3HM6 X;  1VCB A;  2NPT A;  4BOZ B;  2KWC A;  4IG7 B;  5D94 A;  4RM8 A;  3NS8 A;  1WR1 A;  3A9J B;  5CHV C;  1V6E A;  3CSF A;  2ZVO A;  1WYW B;  4G11 A;  4NPN A;  4MH0 E;  3B0A A;  3DPD A;  2UYZ B;  4PS8 A;  2YLM A;  3BY4 B;  3RCZ A;  2RGF A;  1Z2M A;  1UEL A;  2R2O A;  5J2R A;  2JXX A;  3V61 A;  2BWF A;  2KD0 A;  1IYF A;  1YJ1 A;  2FAZ A;  1P98 A;  3BIN A;  1A5R A;  1RRB A;  2PE6 B;  1P1A A;  1TBE A;  2KLC A;  3NZU A;  4IM3 A;  3ZNH B;  3SDL C;  2M8S A;  4NY0 A;  3QHT A;  3TMP B;  3A9K A;  4AJW A;  3DVG X;  1V80 A;  1Q5W B;  1E5W A;  2Y5B B;  3PRZ A;  2G3Q B;  4GOC A;  4BKG A;  3CF6 E;  2JUO A;  4II3 B;  1V5T A;  3H7P A;  5L83 A;  4K7U A;  2DYM A;  4HLE A;  3B1L X;  4WWN A;  4BKT A;  1KM7 A;  2FCN A;  4MGZ E;  1Q1O A;  4HK2 A;  2KQS A;  3NZS A;  1E8Y A;  1V81 A;  2JZ3 B;  2IO1 B;  2LUE A;  2K8B A;  3QJZ A;  1IPG A;  2KNB A;  2D3G A;  2MBE A;  2WX0 A;  2DYO A;  4K81 A;  1J0G A;  3V6C B;  4MSM B;  1TTN A;  1X1M A;  4RM9 A;  2MP2 B;  3QWZ B;  2XBB C;  2CU1 A;  1RFA A;  2BYE A;  3APD A;  3ML9 A;  3PLV A;  2PJH A;  5DCN A;  4DHJ D;  1WY8 A;  3Q3F A;  5JZE B;  4CHK A;  2HD5 B;  4K1R B;  2I1K A;  1E7U A;  4M8M A;  4W9G A;  1E90 A;  2IO0 B;  2K6D B;  4DHZ E;  1WX8 A;  4WWO A;  4CYE A;  3EC8 A;  3VTW A;  4HWI B;  1OEY J;  2HJ8 A;  5DPT A;  5E6P A;  2MWS B;  4W9I A;  3ZDM C;  2DHZ A;  2OOB B;  3KYC D;  3DBR I;  4WJO A;  3RD2 A;  5KHO A;  3RT3 B;  3PS6 A;  1S3S G;  4LDT D;  3WAN A;  1NDD A;  3APF A;  2DZM A;  2LXC A;  1AAR A;  2FID A;  4DHZ B;  3TL5 A;  4A20 A;  1Z5S B;  2LAS A;  2C7N B;  1E8W A;  3EHV A;  2FIF A;  3PLU A;  5C23 A;  1WJN A;  3L10 B;  2IY1 B;  3X0W A;  2V1Y A;  4GGQ A;  5G55 A;  4E3C A;  2MA9 B;  4GMV A;  2MSE D;  4DHJ B;  2NPT B;  4FLH A;  5TR5 A;  3K9O B;  3QA8 A;  4AJY B;  2M17 A;  2N9E B;  1NBF C;  2FNJ B;  3I3T B;  4FN2 A;  1E8Z A;  4AUQ C;  3AU5 A;  2KTF A;  4W9F A;  3RYT A;  2CKH B;  4DXA B;  2KTR B;  4B6W A;  3PRP B;  3WAP A;  5C1Z A;  1OQY A;  2MP2 A;  1WX7 A;  3QC8 B;  2B3A A;  2N4F A;  1WI0 A;  2M1M A;  1G6J A;  3ZLZ A;  3T8M A;  4ICU A;  3PHX B;  1KJT A;  2FCQ A;  1WIA A;  1WMH A;  2MW5 A;  1ZGU B;  1E8X A;  3PZD A;  2J0M A;  2KLG A;  2VRR B;  4FJV B;  4GXB A;  4LDT B;  3W1S C;  1IP9 A;  3CMM B;  3JYU A;  3V60 A;  3A9K B;  3H1U A;  1LM8 B;  5GMV A;  4XZ4 A;  2PEA A;  4ANU A;  1SE9 A;  3EEC A;  2AL6 A;  2JWZ A;  2MCN B;  3H7P B;  2J7Q B;  2LVP A;  5D7G A;  3V6E B;  2N9P C;  2KHW B;  4IWQ A;  3WA0 A;  2KDB A;  5J18 A;  4AWJ A;  2ZJD A;  3L16 A;  1UBI A;  4W9J A;  4JGH B;  2Z59 B;  2CHW A;  4ZRK A;  2KDI A;  2RSU A;  3OJ4 B;  2C9W B;  3NHE B;  4IWO A;  3M62 B;  2NS5 A;  1GNU A;  2KAN A;  2RPQ A;  3UQB A;  3A33 B;  2K1F A;  3H6N A;  2IZV B;  1GG3 A;  4TQ0 A;  2KO3 A;  3UQA A;  1WM2 A;  2BYV E;  3PGE A;  4GDK A;  4X57 B;  3VUX A;  3VQI A;  2D2Q A;  2CHZ A;  1YX5 B;  2BGF A;  3JVZ X;  3ZIM A;  2DX5 B;  1UD7 A;  4KV2 A;  5D6J B;  3HK0 A;  3QIJ A;  3AUL A;  3VVW B;  3KYD D;  2MQJ A;  3RZW C;  4MSQ B;  1XQQ A;  2BPS A;  2L0T A;  1KOT A;  3VAW A;  2WDT B;  3O65 B;  2KTR A;  3SHQ A;  2KOX A;  4FHK A;  4MJS A;  2L05 A;  4E71 A;  2PPH A;  4MEL A;  4NAW A;  3ZNG C;  1EF1 A;  5BO4 B;  3JSV B;  1OTR B;  1WGH A;  2R2Q A;  3QK0 A;  2CR5 A;  3VHT C;  2MRP A;  1K8R B;  3DBH I;  2DZI A;  3SU8 X;  4FBJ B;  3CST A;  4KZC A;  4TQ1 A;  4P7I A;  3DBS A;  3HM3 A;  2MLB A;  2NR2 A;  3M3J A;  5HKH A;  5AZF A;  2LVQ A;  4FJY A;  4FHJ A;  2RD0 A;  4KIK A;  1I35 A;  3R66 C;  2PE9 A;  4KDL B;  2GBJ A;  4ANV A;  3R7R A;  4AP4 C;  4ANX A;  3A4S C;  4HXD A;  4ZRI A;  2IO2 B;  3M63 B;  4NQL B;  1UGM A;  5CX3 A;  2JZZ A;  4FAD A;  2KJ6 A;  1OGW A;  1WF9 A;  3ZW3 A;  1T0Y A;  3RZF A;  1WE7 A;  2GMI C;  2N9X A;  5DPS A;  2HE7 A;  2YVC A;  4KSK C;  5CHF A;  3U8Z A;  4OVU A;  4IUM B;  2KZR A;  3KUZ A;  1NI2 A;  4EFO A;  1ZW7 A;  5IAA C;  3VUW A;  3ECI A;  1HE8 A;  4IM0 A;  1RLF A;  1YQB A;  2D10 A;  3KUC B;  5IA7 A;  3TIX A;  4BBN C;  1WMH B;  2BWE S;  2LI5 A;  4G0N B;  2ZCB A;  4KZ0 A;  3ZO5 B;  3IHP C;  3N30 A;  1EUV B;  4AOF A;  2DEN B;  4HJK A;  2LGY A;  2KFK B;  2MBH A;  2CHX A;  5AZG A;  2I1J A;  1CMX B;  4PYZ A;  4YL8 A;  3LJ3 A;  1L2N A;  1VD2 A;  1TZ1 A;  2A4Z A;  2JF5 A;  3SD5 A;  3ZUN A;  4A3P A;  2C5L C;  3JSV A;  2G4D B;  2N7E A;  5D2M B;  2LJ5 A;  3UIN B;  3ZVV A;  4HPM B;  4ZYN A;  1UBQ A;  2LWP A;  3OAW A;  3ZTC A;  1WXS A;  2N1V A;  2W9N A;  4ZDV A;  2EKE C;  5E6N A;  3T9L A;  3WIM A;  3P2B A;  4GDK B;  3EFU A;  3WAO A;  3S2A A;  2ZEQ A;  2ZPY A;  2L0F A;  2C60 A;  4GU2 A;  1I42 A;  3N3K B;  4FJZ A;  4WJQ A;  5J17 A;  2NCN A;  2OJR A;  4MGI E;  2KJH B;  2NBU A;  4FUL A;  4KSL C;  4MJS B;  2BF8 B;  2KQ7 A;  4NAW B;  4XC2 A;  2BKR B;  3JW0 X;  4I6N B;  4BKS D;  4NNJ B;  4I6P A;  2XEW A;  4W9L A;  3N32 A;  1EO6 A;  3C0R B;  2M0X A;  3MHS D;  4G50 A;  4I6L B;  5AZH A;  1GC6 A;  4PYU A;  2D11 A;  3PRE A;  3WAL A;  3VFK A;  1WH3 A;  1F9J A;  2KN5 A;  2K25 A;  3W1Y A;  4F7Z A;  4WQO B;  2K6Q A;  4RMA A;  3A4R A;  2AL3 A;  2DZK A;  1Q0W B;  4GSW A;  2JRI B;  4W9E A;  4DK5 A;  2LD9 A;  3A1Q B;  1UH6 A;  4KIK B;  2REX A;  2KFK A;  2GBM A;  3QAR A;  4OVV A;  1SIF A;  1WE6 A;  5E6O A;  3VXW A;  3TJP A;  3KH0 A;  4EKU A;  3KVF B;  4PS3 A;  4W9C A;  2EMS A;  2NVU I;  2MBO A;  2O6V D;  1V2Y A;  2WWZ A;  1WJ6 A;  2J0K A;  3DVN U;  5DPR A;  3PRM B;  4EOY A;  1Y8R C;  2XK5 B;  4DWF A;  4HDO A;  3NY5 A;  2O2V B;  2LVO A;  4JLC A;  3DVG Y;  4NJ7 A;  2AYO B;  3DCG A;  3APC A;  2IO3 B;  5LLI A;  1JRU A;  4F8C B;  4FA6 A;  2MX2 A;  1M94 A;  3Q3J A;  2KC2 A;  4TKN A;  5JHB A;  1WFY A;  4HCN B; 
#chains in the Genus database with same CATH topology
 4DXG A;  3QCA A;  1C4A A;  1KTK A;  1TGZ B;  2G4S A;  1NVI D;  3DQV A;  1WM3 A;  1QZE A;  1TKG A;  3PT2 B;  3H9D A;  1LGR A;  2OED A;  2KWV B;  1ZKH A;  4II2 B;  3ZNZ B;  4RH6 A;  2WQY B;  2FCS A;  3X23 A;  4ICV A;  2V3N A;  4LTU A;  2JY6 A;  2LGS A;  1SGH A;  3Q14 C;  3U52 E;  1L0X B;  2X8X X;  4NZL B;  3R7Q A;  1V49 A;  4HKZ E;  4MDK E;  1TKY A;  2L7R A;  3WCQ A;  1AN8 A;  1YX6 B;  2BB5 A;  3TBL D;  1J19 A;  1STE A;  1VRA B;  4JIO U;  1FXT B;  1PGX A;  3AE4 B;  4GDL B;  5EE3 A;  2WU2 B;  4LK0 M;  2MJE A;  1QT9 A;  3HIZ A;  1J7C A;  3DDC B;  5AEK B;  2D3C A;  1ISN A;  5BMG A;  3K9P B;  2QIL A;  3RNF C;  4N9F 4;  4ZHP A;  1LQB A;  4EZJ A;  1C79 A;  4MEM A;  3IVF A;  1OQQ A;  2NTT A;  4M02 A;  4JE3 B;  3DHH C;  2DYB A;  3U7D A;  2ASQ A;  5KHQ A;  3HHM A;  5JH5 C;  1FM0 D;  5LXI B;  1GJZ A;  3VDZ A;  2IY0 B;  2J0J A;  4ZRJ A;  2DZJ A;  2UU7 A;  1CQV A;  3A9J A;  2IYD B;  4WJN A;  3RUL A;  1R4N I;  1XT9 B;  1LXD A;  4DDG D;  3L17 A;  1WZ0 A;  2LGX A;  5FK9 C;  2JYT A;  3V3X A;  4A55 A;  2KMC A;  3Q69 A;  2BQQ A;  2KKC A;  3GZN B;  4TV3 A;  3ZJT A;  1JWA D;  1HZ5 A;  1WJ4 A;  1UZX B;  4NJ6 A;  4IWP A;  3N9Y C;  2KDM A;  3Q8B A;  4C56 C;  1SJE D;  3ZDT A;  1OEY A;  2JU6 X;  2VH1 A;  1T0Q C;  3R3M A;  1XCQ L;  1JWS D;  2JVC A;  2KVR A;  1I4G A;  2HTH A;  4IKG A;  3AEC B;  4KGT A;  5H92 C;  1D5Z C;  1WGY A;  3W1S A;  5LXH A;  2GBK A;  4WAA A;  1YN5 A;  5D3I B;  5IOI A;  1L0Y B;  1MJD A;  2Z0E B;  4RGO S;  2FUH B;  2A5U A;  1L4D B;  2KK8 A;  2GBR A;  2QSD A;  3MP9 A;  3VR9 B;  3PVL A;  4AQ7 A;  3DHI C;  1I4H A;  4EZK A;  1V5O A;  4ASW C;  3IFW B;  3HM6 X;  3AE5 B;  3NS8 A;  1WR1 A;  3A9J B;  4RM8 A;  5CHV C;  4HRO A;  1ZE3 D;  4NPN A;  4C4V B;  4MH0 E;  4KGS A;  2UYZ B;  4PS8 A;  3BY4 B;  4B0E A;  1UNS A;  5IO9 A;  2R2O A;  2BWF A;  2FAZ A;  1J7A A;  3R2I A;  3SFE B;  4WWM A;  4NY0 A;  3A9K A;  1V80 A;  1Q5W B;  4BKG A;  3Q6B A;  4II3 B;  3URY A;  1RWS A;  4BKT A;  4MGZ E;  2OHF A;  2KQS A;  4C7Y A;  2IO1 B;  2LUE A;  3AEE B;  2K8B A;  1V1P A;  3HVZ A;  2D3G A;  4K81 A;  1C4P A;  2DYO A;  1J0G A;  2WXM A;  1XLO A;  2PIA A;  2MP2 B;  1BXT A;  2Y5P A;  2CU1 A;  1ZP0 B;  2BYE A;  3PLV A;  5DCN A;  3DBR B;  1WY8 A;  3Q3F A;  5JZE B;  4D2K A;  4W9G A;  1KF6 B;  1E90 A;  2K9X A;  3RMK C;  1DYQ A;  2MEK A;  5FKA C;  5JXV A;  4HWI B;  1OEY J;  5DPT A;  1TYG B;  4NAM A;  3B2F A;  5E6P A;  1ET6 A;  4LDT D;  1AW7 A;  2LXC A;  3RFZ B;  4KKJ A;  4YT0 B;  4YTN B;  1WJN A;  3L10 B;  2V1Y A;  2QCZ A;  1YN3 A;  1IBX A;  1DOY A;  4AJY B;  4AUQ C;  3I3T B;  1XEE A;  3TEZ A;  1E8Z A;  3AU5 A;  4W9F A;  3ZXR A;  1EWY C;  3AEB B;  3QC8 B;  1G6J A;  1WIA A;  2MW5 A;  4K3B A;  3A9K B;  1LM8 B;  5GMV A;  1V97 A;  2PEA A;  2LVP A;  3V6E B;  4IWQ A;  3NZ3 A;  3WA0 A;  2KDB A;  1ZDX A;  2ZJD A;  4W9J A;  1V1P B;  3UQB A;  3BZD B;  2K1F A;  2FUG 1;  1GG3 A;  4TQ0 A;  1WM2 A;  4X57 B;  3KWL A;  1CJE A;  2CHZ A;  2BGF A;  4C7Z A;  1HTO A;  4MSQ B;  1XQQ A;  2BPS A;  1KOT A;  1TKE A;  4MJS A;  3NG0 A;  4ZRP A;  3JSV B;  1WGH A;  3AE3 B;  2N7J A;  3VHT C;  2MRP A;  4N6E B;  4FBJ B;  4J3O D;  4A6Q A;  4HKQ A;  1P7E A;  1N62 A;  3HM3 A;  5H8Y E;  1UWM A;  3M3J A;  5AZF A;  4FJY A;  2RD0 A;  2WXI A;  3A4S C;  3M63 B;  4NQL B;  4FAD A;  1SE2 A;  2KJ6 A;  1IBX B;  1TS2 A;  3RZF A;  1WE7 A;  2GMI C;  4OVU A;  3KUZ A;  2BVC A;  1ZW7 A;  5IA7 A;  3I5J C;  2E3T A;  2LI5 A;  4G0N B;  4KZ0 A;  4AOF A;  1ZOY B;  1GB4 A;  4A90 A;  2MBH A;  4US9 A;  3AE1 B;  1JML A;  2K5P A;  3N1Z C;  2A4Z A;  2Y5C A;  3ZUN A;  1N5W A;  3T3O A;  2N7E A;  1R4N B;  4HPM B;  2D3B A;  1UBQ A;  3GP7 A;  3TEW A;  1JRP A;  1WXS A;  5E6N A;  4AS1 A;  3EFU A;  4YSX B;  1SEB D;  1F0Z A;  2C60 A;  1T5X D;  2HTM E;  1I4R A;  5J17 A;  1B9R A;  3L4P A;  1C76 A;  4MGI E;  2KJH B;  4KSL C;  1M4V A;  4MJS B;  3ZGZ A;  4OVZ A;  4NNJ B;  2I2Y A;  3MHS D;  2D11 A;  3WAL A;  1B1Z A;  1WRI A;  2MHJ A;  2K3U A;  2LD9 A;  5E6O A;  3I9V 1;  2GBM A;  3VXW A;  1WE6 A;  3ZJU A;  3KH0 A;  4W9C A;  2DNF A;  2MH7 A;  2INP E;  2JYE A;  2WWZ A;  5DPR A;  4EOY A;  1I4X A;  1L0V B;  3TUO A;  1GAQ B;  2O2V B;  2LVO A;  3LB8 C;  2IGD A;  3DCG A;  2LHE A;  1IGD A;  4WUR A;  2KYW A;  2AX5 A;  2MX2 A;  1M94 A;  4TKN A;  4HCN B;  4ANW A;  3ZYY X;  3ZNI D;  4BOS C;  4MGY E;  2KXJ A;  3UF8 A;  3L54 A;  1TY0 A;  5G2N A;  1XD3 B;  2JZP A;  1L4Z B;  2FBW B;  3QX1 A;  2DAJ A;  4K7W A;  2O6V B;  4XGA B;  3LDZ E;  2CU3 A;  3NUH B;  3QAQ A;  4LJO B;  3KLS X;  1J7B A;  3A1Q A;  2KJR A;  4IW0 A;  3GOE A;  1WXA A;  1V86 A;  4YXD B;  4CO7 A;  2AWT A;  4LNN A;  4EE2 A;  3DVN V;  2KWU B;  2G1E A;  2RR9 A;  3AXC A;  1MHH E;  2LRW A;  1C3T A;  2LFI A;  1R7S A;  3ALB A;  3AU4 A;  4KDI C;  1E7P B;  2YEP B;  1TS3 A;  3TCA A;  3RNC C;  1H4R A;  1FRR A;  1GOZ A;  3TSS A;  4RFB A;  3PV1 A;  1D5X C;  1C9F A;  2N7D A;  3HVD A;  1A70 A;  1D3Z A;  2DWQ A;  2V4L A;  2WXK A;  2K22 A;  4A8X C;  4EEW A;  3NOB A;  1WGD A;  4EZL A;  4P1C C;  2J42 A;  2KAC A;  2WYQ A;  3MFG A;  3RNE C;  1N60 A;  1QKZ A;  4W9D A;  5GXG B;  3MJW A;  4UDU C;  5BYS A;  1PYW D;  1XXG A;  2WXN A;  4GB9 A;  3I63 C;  3Q3M C;  3OJ3 A;  1Q10 A;  3MTN B;  1L7Y A;  5CTR C;  3TEX A;  4GDL A;  3NJT A;  2EMT A;  2KWD A;  3H8H A;  1QOG A;  2G9H D;  4IOI E;  2ZPN A;  2GOW A;  1XLQ A;  2HDE A;  2PVG C;  5JHA A;  2ZCC A;  4WWP A;  4MM3 A;  4W9K A;  2DBY A;  2BW2 A;  2NBV B;  1XLP A;  4CQN A;  2KX0 A;  1GUA B;  1EF5 A;  2V0G A;  2VZK D;  3L13 A;  2SAK A;  3ML8 A;  4E74 A;  1RM6 C;  3VRB B;  4XX5 A;  3M95 A;  2H89 B;  5FR6 A;  4WAF A;  4F1S A;  4REZ A;  3C19 A;  1R4M B;  2M56 B;  1WGG A;  4GN1 A;  1F2R I;  1VZ7 A;  2M4N A;  4C00 A;  2RDB C;  2LXA A;  2N1W A;  2BTE A;  5AUK A;  2LHD A;  1LO5 D;  2QHO A;  3UIO B;  4IDI A;  4XE0 A;  2NPT A;  4BAX A;  5C3J B;  2B76 B;  2GB1 A;  2PLP A;  4IG7 B;  1TJE A;  1V6E A;  3CSF A;  2ZVO A;  1WYW B;  4DXF A;  4WH4 A;  1Z2M A;  1UEL A;  5J2R A;  2JXX A;  3FKY A;  4LNK A;  3ABV B;  1VJK A;  2TSS A;  1P98 A;  3BIN A;  1RRB A;  2D3A A;  1TBE A;  2KLC A;  2PE6 B;  1CK1 A;  4IM3 A;  3ZNH B;  2V9H A;  2M8S A;  3QHT A;  1NEN B;  4PK1 A;  4AJW A;  2Y5B B;  2G3Q B;  2WU5 B;  4GOC A;  1EM7 A;  1FRD A;  5L83 A;  4K7U A;  1GB1 A;  1NYR A;  1KLG D;  4WWN A;  3I57 A;  1V81 A;  4MM3 B;  3QJZ A;  2KNB A;  2ACZ B;  1ZPS A;  1ROE A;  3AEG B;  2KMM A;  3QWZ B;  2XBB C;  1ZXI A;  3APD A;  4DHJ D;  1N6Z A;  5G5G A;  4CHK A;  2IGG A;  4XDD A;  5T8I A;  1WX8 A;  4C4V A;  2NTS A;  2MWS B;  4WJO A;  3RT3 B;  1S3S G;  1NDD A;  2M0A A;  3W5V B;  3GE3 C;  4US8 A;  1AAR A;  4DHZ B;  2PVO D;  4A20 A;  3B9J A;  3PLU A;  2KAJ A;  2N0S B;  2LGI A;  2IY1 B;  1TIF A;  3X0W A;  3SEB A;  2NPT B;  3K9O B;  4FN2 A;  1NBF C;  3EGR A;  1NYQ A;  3RYT A;  4DXA B;  5D3D A;  3IAM 1;  3OWE B;  2Z8L A;  1SSN A;  4YTP B;  2BBC A;  3PRP B;  2MP2 A;  5BMH A;  2SEB D;  3AM9 A;  1WMH A;  1ZGU B;  1E8X A;  3AE9 B;  2VRR B;  1WYG A;  4GXB A;  3W1S C;  3JYU A;  1WWT A;  1FIQ A;  3H1U A;  3AH7 A;  4XZ4 A;  3NRZ A;  3GB1 A;  1SE9 A;  2KT7 A;  4ANU A;  2JWZ A;  2MCN B;  5D7G A;  2N9P C;  1TS5 A;  3P4S B;  4OW0 A;  2RSU A;  3U2S C;  3NHE B;  3FIL B;  2KAN A;  2IZV B;  1QOF A;  4GDK A;  1BML C;  1T0R C;  2R61 A;  1JWU D;  3ZIM A;  1UD7 A;  5D6J B;  3HK0 A;  3DBH B;  3VRA B;  3KYD D;  4TMA B;  2HJ1 A;  3EFC A;  3RZW C;  1F77 A;  2KQ4 X;  3U4E G;  2L0T A;  3VAW A;  3SHQ A;  2KOX A;  4LNF A;  1XCT L;  5BO4 B;  2R2Q A;  1XLN A;  3QK0 A;  2CR5 A;  4RGM A;  3SU8 X;  1VLB A;  1AYF A;  4KZC A;  4TQ1 A;  2MLB A;  5HKH A;  4KIK A;  4K3C A;  2EEL A;  2GBJ A;  4ANV A;  3R7R A;  4ZRI A;  2IO2 B;  2WGS A;  5CX3 A;  1UGM A;  1WF9 A;  1EWC A;  1P7F A;  2MJD A;  2N9X A;  5DPS A;  5CHF A;  4EFO A;  1D6E C;  4XDC A;  2BYT A;  1YQB A;  3KUC B;  3TIX A;  4BBN C;  1WMH B;  2BWE S;  2ZCB A;  3IHP C;  3N30 A;  3AMZ A;  2ZW0 A;  2KFK B;  2I1J A;  4PYZ A;  1C77 A;  3LJ3 A;  1VD2 A;  4XYC A;  3SFD B;  3JSV A;  1T3Q A;  3AE8 B;  3UIN B;  5D2M B;  1YOV B;  4ZYN A;  2LWP A;  2EKE C;  3WIM A;  1QIL A;  3RNG C;  4GDK B;  3S2A A;  1WSP A;  3N20 C;  2J52 A;  1I42 A;  1L6U A;  2NCN A;  2OJR A;  1ESF A;  5HHD G;  2BF8 B;  4ARC A;  3JW0 X;  4I6N B;  4NJC A;  4I6P A;  2XEW A;  4W9L A;  4YSY B;  1JWB D;  3N32 A;  1EO6 A;  4PYU A;  4WQM A;  3PRE A;  4ACF A;  1WH3 A;  1JCK B;  1F9J A;  2AL3 A;  2DZK A;  4W9E A;  2JX5 A;  4KIK B;  2REX A;  2VH2 A;  3QAR A;  4EKU A;  3TJP A;  3KVF B;  1K52 A;  4PS3 A;  2EMS A;  3J9C A;  1I4Q A;  3DVN U;  3PRM B;  1Y8R C;  1DOI A;  2XK5 B;  4DWF A;  1SBB B;  3NY5 A;  3DVG Y;  4NJ7 A;  3APC A;  2IO3 B;  5FR3 A;  1JRU A;  1EU4 A;  3FAH A;  3ZJV A;  3Q3J A;  2M19 A;  1FNW A;  3MHZ A;  1I4P A;  2LRU A;  2LZ6 A;  2WXO A;  4IM2 A;  3BWU D;  1LFD A;  2K8H A;  1FFV A;  4C80 A;  1HXY D;  1SXT A;  1DOX A;  2IBI B;  1MG8 A;  3VR8 B;  3C8Y A;  1KLU D;  3VTV A;  1BT0 A;  2AEH A;  4H2A A;  3CWI A;  1NEK B;  3NVW A;  2RMM A;  3GE8 C;  1L6V A;  4O1N A;  4M8N A;  4GIV A;  4BBN F;  1N5X A;  1WX9 A;  5BYR A;  2ZNV B;  3PPA A;  1H8C A;  2L76 A;  2O2V A;  2V4I B;  2CJO A;  4JQW C;  1WXM A;  3VUY A;  1C1Y B;  4BKS A;  1WXV A;  2FE8 A;  2QMT A;  3Q3O C;  2QJL A;  2WHI A;  3KQ4 A;  2DLB A;  4HDQ A;  2JPH A;  3IG3 A;  2WX1 A;  3PTF C;  2BS4 B;  4ZHO A;  5CHW A;  2O6V A;  5AUI A;  4A9A A;  5HFY A;  4QAY A;  1FCL A;  1HTQ A;  3Q2A C;  3KUD B;  2JRH A;  3P42 A;  1WR6 E;  2WXR A;  3WAM A;  4LNO A;  4YTM B;  3ENE A;  1YQ4 B;  3AI5 A;  2WXF A;  4W9H A;  3ZRC A;  1MPE A;  5EE1 A;  4RCO A;  2AQ1 B;  4KGR A;  4MH8 A;  2WXH A;  1FMA D;  3PZ7 A;  3CIR B;  1YJJ A;  3V05 A;  3AE7 B;  4DBG A;  3UGB B;  3T3N A;  3D32 A;  3GZN I;  2D07 B;  1E7V A;  4IC7 B;  4HCP B;  4GLS C;  2GBN A;  4LNI A;  3NVY A;  1YMH E;  3B08 A;  1XF5 L;  5E6J A;  2Z0D B;  1IGC A;  1TS4 A;  2IGH A;  1FEH A;  2C7M B;  4P6V F;  3V62 A;  4N58 A;  4MT5 A;  1CZP A;  2LUM A;  1PQS A;  1ZDV A;  2LMC A;  2JT4 B;  5G5H A;  4L1B A;  3RUI B;  4HVB A;  4MGK E;  1S1Q B;  2K8C A;  2KMA A;  2KX3 A;  4NQK E;  2W55 A;  1YD8 U;  4TUU A;  2CJN A;  4HPL B;  2WXJ A;  2MJ3 A;  4LJP B;  1V1O A;  4JL9 A;  1VCB A;  2KWC A;  5D94 A;  3MC0 B;  3HRD D;  4G11 A;  3B0A A;  3DHG C;  3DPD A;  2YLM A;  1IUE A;  1BUI C;  1QOB A;  3RCZ A;  3NVZ A;  2KD0 A;  1IYF A;  1L5P A;  1E0Z A;  1C4C A;  1P1A A;  3SDL C;  2N9K A;  3DVG X;  1MHX A;  1E5W A;  3BYY B;  3CF6 E;  3H7P A;  4HLE A;  1KM7 A;  1Q1O A;  5HG2 A;  1E8Y A;  3RN9 C;  2JZ3 B;  1MFW A;  1E6E B;  2WX0 A;  1C78 A;  1TTN A;  2K0P A;  3FC4 A;  2IPK D;  1QLB B;  5IN7 A;  5EE9 A;  1N63 A;  2PJH A;  1KRH A;  5TSS A;  2HD5 B;  4K1R B;  2I1K A;  1ZXH A;  3P4Q B;  3LYY A;  2GLS A;  4M8M A;  4ZYS A;  4WWO A;  4CYE A;  2QEJ C;  3EC8 A;  2HJ8 A;  1PGA A;  3ZDM C;  2OOB B;  3KYC D;  3AV8 A;  3DBR I;  3RD2 A;  2H88 B;  3PS6 A;  2WDQ B;  3APF A;  2BB6 A;  4JWU C;  1F1H A;  1PUT A;  5MPO A;  2RDG A;  1Z5S B;  2LAS A;  1E8W A;  3EHV A;  5C23 A;  1KFY B;  2BT6 A;  1NI3 A;  2MA9 B;  2MSE D;  5TR5 A;  1ENF A;  2M17 A;  1YN4 A;  2N9E B;  4KKI A;  3KWV A;  4TSS A;  2KTR B;  4B6W A;  3Q8F A;  5C1Z A;  3BVM A;  1WX7 A;  2B3A A;  2N4F A;  1WI0 A;  2M1M A;  4ICU A;  3PHX B;  1KJT A;  2FCQ A;  2KLG A;  4LDT B;  3V60 A;  2RDH A;  2AQ3 B;  4L23 A;  2AL6 A;  3H7P B;  2J7Q B;  2KHW B;  4HPP A;  2JSV X;  5J18 A;  4AWJ A;  3L16 A;  3BVG A;  4JGH B;  2L83 A;  2CHW A;  1FCC C;  3OJ4 B;  3M62 B;  1PDX A;  1T0S C;  2NS5 A;  1GNU A;  3A33 B;  2KO3 A;  3UQA A;  2BYV E;  1TY2 A;  2W82 A;  3VQI A;  2D2Q A;  3JVZ X;  2IND C;  2DX5 B;  3AUL A;  2KN4 A;  3VVW B;  2MQJ A;  2IJ0 A;  1ET9 A;  4ARI A;  4HJG E;  2L05 A;  3ZNG C;  1EF1 A;  1OTR B;  1TZO A;  3CST A;  4P7I A;  3UI3 A;  2NR2 A;  3DWG C;  2LVQ A;  1I35 A;  1VZ6 A;  2PKO A;  2PE9 A;  2L52 A;  4ANX A;  3AEF B;  3MC9 A;  1FXI A;  1SIJ A;  4ITK A;  1KH0 A;  1OQR A;  2LJI A;  1T0Y A;  1QOA A;  3P4P B;  3U7Z A;  2HE7 A;  2YVC A;  4KSK C;  3NS1 A;  3U8Z A;  3FIL A;  4S17 A;  3GS2 A;  1SE3 A;  1HE8 A;  3ECI A;  3P1M A;  4ZRQ A;  1FD6 A;  1HQR D;  3ZO5 B;  1EUV B;  2DEN B;  2WNM A;  4M0W A;  1DGJ A;  1ZUD 2;  4YL8 A;  5C2T B;  2Q5W D;  1SF0 A;  3HUI A;  1TZ1 A;  3IAS 1;  2C5L C;  1SJH D;  3ZVV A;  4USA A;  2WXL A;  4YWG G;  2QDF A;  2N1V A;  1YQ3 B;  1JAL A;  2ZEQ A;  2WS3 B;  2ZW1 A;  1QQR A;  3N3K B;  4FJZ A;  3PO0 A;  2NBU A;  3Q8A A;  2J4X A;  3OG5 A;  2BKR B;  4HEA 1;  4BKS D;  2M0X A;  4KX6 B;  1GC6 A;  2K25 A;  3A4R A;  2NMQ A;  1Q0W B;  2WDR B;  2JRI B;  1UH6 A;  1FO4 A;  2KFK A;  1SIF A;  3RNA C;  2NVU I;  2MBO A;  2O6V D;  4L2Y A;  1WJ6 A;  3RPF C;  3Q8E A;  3E56 A;  1WFY A;  1UGJ A;  1RYJ A;  2QIE B;  3IBE A;  2CS4 A;  2KC1 A;  4PS7 A;  4M0W B;  2G45 B;  2EKI A;  4BFR A;  4K7S A;  1U4A A;  2BYF A;  4HRS A;  2C7H A;  1N61 A;  2MBQ A;  1RAX A;  3L0W B;  1E10 A;  1UUP A;  3ONS A;  1JRO A;  3ZKJ C;  4DDI D;  3AN1 A;  4XWT A;  3IT6 B;  1WJU A;  5LNK 1;  3BII D;  4M01 A;  3U30 A;  2ZVN A;  1T6B X;  1YJI A;  2XK5 A;  2L8J A;  4A3O A;  1F2R C;  1D5M C;  1GC7 A;  1WGK A;  2UWQ A;  4RGN A;  1P9D U;  2XN9 C;  1FXA A;  3OLM D;  4BZA A;  2I38 A;  1WGR A;  1PGB A;  1RFK A;  4B95 A;  5IKC M;  4LLG M;  4N59 A;  3QQ8 B;  4URK A;  4KVG B;  4G3X B;  3PSE B;  1WXQ A;  4LCD E;  1V9J A;  5L95 C;  2ZNV C;  5EE0 A;  3L08 A;  1QF6 A;  3SR6 A;  2ZZP B;  2L3Z A;  3ZTD A;  3KW5 B;  1FNU A;  4WJP A;  4FXC A;  1HA5 A;  1OFF A;  2LEK A;  2V3S A;  4OZC A;  3UIP B;  2WXQ A;  4MAC A;  4B9K A;  2MBB B;  3PHW B;  3BK1 A;  3DBL I;  3VH3 B;  1P3Q U;  5EDS A;  1VR9 A;  2KFJ A;  3AE6 B;  2KDF B;  2K39 A;  4JPS A;  3TEY A;  2JWU A;  1E9M A;  3P63 A;  2FCM A;  1AWD A;  1J8C A;  1WZ3 A;  2INN E;  1SE4 A;  2AQ2 B;  4J6I A;  2DAF A;  2WXP A;  4RF1 A;  4BVU C;  2KDE B;  3AEA B;  1P0R A;  2L00 B;  2JQR B;  2RPV A;  2NBW B;  1K53 A;  3ZRF A;  2QC8 A;  3VH4 B;  4Q2J A;  5DPW A;  2BKF A;  3VTU A;  4EUT A;  3H7S A;  1YIW A;  3AE2 B;  2XNA C;  1KLV A;  1WRD B;  4M00 A;  4YSZ B;  2VZK B;  1R4M I;  2LGD A;  3DOW A;  4BOZ B;  3R8B A;  2RGF A;  3RI7 C;  3V61 A;  5HI1 A;  1YJ1 A;  2J53 A;  1A5R A;  3NZU A;  2IDY A;  3TMP B;  1V8C A;  1SB3 C;  3PRZ A;  3O13 A;  2JUO A;  1V5T A;  2GRI A;  2DYM A;  3B1L X;  4P1B C;  2BS2 B;  2FCN A;  4RNA A;  4HK2 A;  3NZS A;  3NVV A;  3IT4 B;  1IPG A;  2MBE A;  1K50 A;  4RF0 A;  3V6C B;  4MSM B;  1X1M A;  3BK2 A;  4RM9 A;  1JW9 D;  1XO3 A;  1RFA A;  3ML9 A;  1ACC A;  3E9S A;  3ETR A;  1HZ6 A;  1E7U A;  2IO0 B;  4OZA A;  2K6D B;  4DHZ E;  2KVZ A;  3VTW A;  1MVK A;  4B0M A;  4W9I A;  2DHZ A;  5KHO A;  3WAN A;  4JWS C;  2DZM A;  4WIP A;  2FID A;  3TL5 A;  2E6X A;  2C7N B;  2WXG A;  2FIF A;  4P16 A;  1TT5 B;  4GGQ A;  1YNT E;  5G55 A;  4E3C A;  2W3R A;  4GMV A;  2N9L A;  2ON8 A;  4FLH A;  4DHJ B;  2W54 A;  3QA8 A;  2FNJ B;  2KTF A;  4OZB A;  2CKH B;  3R2T A;  3B2G A;  3BVZ A;  4PT5 A;  3WAP A;  4R3D A;  1OQY A;  2PTL A;  3EA6 A;  1Y56 A;  2PMV A;  3ZLZ A;  3T8M A;  3PZD A;  2J0M A;  4FJV B;  1IP9 A;  3CMM B;  3BYT B;  3EEC A;  1K51 A;  3LXF A;  1UBI A;  2Z59 B;  1MG4 A;  4ZRK A;  2KDI A;  4IWO A;  2C9W B;  2RPQ A;  3ZQ4 A;  3H6N A;  5BMI A;  1MI0 A;  3PGE A;  3VUX A;  4RGT A;  1YX5 B;  4KV2 A;  1JQ4 A;  3QIJ A;  2WDV B;  2ICI A;  5BYQ A;  2WDT B;  3O65 B;  2KTR A;  4FHK A;  1UWX A;  4E71 A;  2PPH A;  4MEL A;  4NAW A;  2V3P A;  2L32 A;  1K8R B;  3DBH I;  2DZI A;  3MC8 A;  1I7H A;  3DBS A;  4FHJ A;  3R66 C;  4KDL B;  4AP4 C;  3N1X C;  4HXD A;  2JZZ A;  1HEZ E;  2ONQ A;  2PW9 A;  2Y3A A;  3EUB 2;  1OGW A;  3ZW3 A;  4IUM B;  2KZR A;  1NI2 A;  5IAA C;  3VUW A;  4IM0 A;  1RLF A;  2D10 A;  4XWW A;  4HJK A;  2LGY A;  3IXS A;  1VDV A;  2CHX A;  2WP9 B;  2YEP F;  5AZG A;  1CMX B;  3PZ8 A;  1F52 A;  1D4B A;  3N1Y C;  3W9C B;  1FFU A;  1L2N A;  2JF5 A;  3SD5 A;  4A3P A;  3ZXV A;  4JX1 C;  1FNV A;  2G4D B;  2LJ5 A;  3OAW A;  3Q8C A;  3ZTC A;  2W9N A;  4ZDV A;  3T9L A;  3P2B A;  3Q3N C;  3WAO A;  5IP4 D;  2ZPY A;  1JWM D;  2L0F A;  2GI9 A;  1PFD A;  4GU2 A;  2OJW A;  4WJQ A;  3AB5 A;  2X38 A;  2W3S A;  3DBL B;  1UF0 A;  5I4D A;  4FUL A;  2KQ7 A;  4NAW B;  4XC2 A;  1GPX A;  3P4R B;  2BS3 B;  3C0R B;  4I6L B;  4G50 A;  3MJ5 A;  5AZH A;  3AED B;  1FPY A;  3VFK A;  2KN5 A;  3W1Y A;  4F7Z A;  4WQO B;  2K6Q A;  4RMA A;  4GSW A;  4DK5 A;  4OHJ A;  3A1Q B;  4OVV A;  1EU3 A;  3W5U B;  2JXT A;  1VZ8 A;  2WLB A;  4ZOH C;  1V2Y A;  2J0K A;  4S0R A;  3DWM A;  2INC C;  2L1A A;  4HDO A;  3W2D A;  4JLC A;  2AYO B;  3RNB C;  4DQO C;  5LLI A;  2D5G A;  4F8C B;  4FA6 A;  2KC2 A;  5JHB A; 
#chains in the Genus database with same CATH homology
 4ANW A;  3QCA A;  1TGZ B;  2G4S A;  2CS4 A;  2KC1 A;  3IBE A;  2LRU A;  2LZ6 A;  4IM2 A;  4PS7 A;  3ZNI D;  3DQV A;  1WM3 A;  4M0W B;  1QZE A;  2G45 B;  3PT2 B;  4MGY E;  2KXJ A;  4BOS C;  3UF8 A;  4BFR A;  4K7S A;  1U4A A;  2BYF A;  3L54 A;  5G2N A;  3H9D A;  1XD3 B;  1LFD A;  2C7H A;  2K8H A;  2MBQ A;  2KWV B;  1ZKH A;  3QX1 A;  2IBI B;  1MG8 A;  1RAX A;  2DAJ A;  4II2 B;  2O6V B;  4K7W A;  3ZNZ B;  3VTV A;  1BT0 A;  2AEH A;  3L0W B;  3LDZ E;  2FCS A;  3X23 A;  4ICV A;  3ONS A;  3QAQ A;  4LJO B;  2JY6 A;  3ZKJ C;  1SGH A;  3A1Q A;  3R7Q A;  2KJR A;  4DDI D;  4IW0 A;  3GOE A;  1V49 A;  1WXA A;  4MDK E;  4M8N A;  4GIV A;  2L7R A;  1V86 A;  4BBN F;  1WJU A;  1WX9 A;  1YX6 B;  2ZNV B;  3U30 A;  2ZVN A;  3PPA A;  1H8C A;  4CO7 A;  2AWT A;  3TBL D;  2XK5 A;  2L8J A;  1J19 A;  2L76 A;  4A3O A;  3DVN V;  2O2V A;  4JIO U;  1FXT B;  2KWU B;  4GDL B;  2RR9 A;  3AXC A;  2LRW A;  3HIZ A;  4JQW C;  1C3T A;  3DDC B;  1GC7 A;  1WXM A;  3VUY A;  3ALB A;  3AU4 A;  4KDI C;  5AEK B;  2UWQ A;  1ISN A;  1C1Y B;  3K9P B;  4BKS A;  1P9D U;  1WXV A;  3TCA A;  4N9F 4;  1H4R A;  1LQB A;  4EZJ A;  4HDQ A;  3PV1 A;  4MEM A;  3OLM D;  2JPH A;  3IVF A;  2N7D A;  3IG3 A;  2WX1 A;  1D3Z A;  3PTF C;  2DYB A;  1WGR A;  2V4L A;  3U7D A;  2ASQ A;  4B95 A;  5CHW A;  5KHQ A;  2O6V A;  4EEW A;  3HHM A;  3NOB A;  5JH5 C;  1WGD A;  5LXI B;  1GJZ A;  3QQ8 B;  4URK A;  4EZL A;  4KVG B;  4G3X B;  3VDZ A;  3PSE B;  2WYQ A;  2IY0 B;  2J0J A;  4ZRJ A;  3KUD B;  2JRH A;  2DZJ A;  1WR6 E;  4LCD E;  4W9D A;  3WAM A;  1V9J A;  3MJW A;  3A9J A;  5L95 C;  2IYD B;  2ZNV C;  4WJN A;  3L08 A;  3ENE A;  3AI5 A;  1R4N I;  1XT9 B;  3RUL A;  4GB9 A;  1LXD A;  2ZZP B;  4W9H A;  3OJ3 A;  4DDG D;  2L3Z A;  3ZTD A;  3KW5 B;  3L17 A;  3ZRC A;  2LGX A;  1WZ0 A;  3MTN B;  4WJP A;  1L7Y A;  5CTR C;  2V3S A;  2KMC A;  4GDL A;  2EMT A;  2KKC A;  3UIP B;  4TV3 A;  4B9K A;  2MBB B;  2ZPN A;  3PHW B;  2GOW A;  1WJ4 A;  1UZX B;  3DBL I;  3VH3 B;  1P3Q U;  2ZCC A;  4NJ6 A;  4WWP A;  4IWP A;  5EDS A;  5JHA A;  2KFJ A;  2KDF B;  2K39 A;  4DBG A;  3UGB B;  3ZDT A;  4MM3 A;  2FCM A;  3D32 A;  4W9K A;  3GZN I;  1J8C A;  1OEY A;  2D07 B;  1E7V A;  1WZ3 A;  2NBV B;  3R3M A;  2KX0 A;  1GUA B;  4IC7 B;  1EF5 A;  4HCP B;  2JVC A;  4J6I A;  2KVR A;  2DAF A;  2GBN A;  4BVU C;  2KDE B;  3L13 A;  3B08 A;  2HTH A;  1P0R A;  3ML8 A;  4E74 A;  2Z0D B;  2C7M B;  1WGY A;  3W1S A;  2L00 B;  3V62 A;  5LXH A;  4XX5 A;  2GBK A;  3M95 A;  4WAA A;  5FR6 A;  2NBW B;  4F1S A;  3ZRF A;  3VH4 B;  5DPW A;  1WGG A;  1PQS A;  2Z0E B;  4GN1 A;  2JT4 B;  2M4N A;  2FUH B;  3RUI B;  2BKF A;  3VTU A;  2A5U A;  2LXA A;  2N1W A;  4EUT A;  3H7S A;  4HVB A;  4MGK E;  1S1Q B;  2K8C A;  2KK8 A;  2KMA A;  2KX3 A;  2GBR A;  1YIW A;  4NQK E;  1YD8 U;  2QHO A;  3UIO B;  4TUU A;  1KLV A;  1WRD B;  4HPL B;  3PVL A;  4LJP B;  1R4M I;  4EZK A;  1V5O A;  2LGD A;  4ASW C;  3DOW A;  3IFW B;  4JL9 A;  3HM6 X;  1VCB A;  2NPT A;  4BOZ B;  2KWC A;  4IG7 B;  5D94 A;  4RM8 A;  3NS8 A;  1WR1 A;  3A9J B;  5CHV C;  1V6E A;  3CSF A;  2ZVO A;  1WYW B;  4G11 A;  4NPN A;  4MH0 E;  3B0A A;  3DPD A;  2UYZ B;  4PS8 A;  2YLM A;  3BY4 B;  3RCZ A;  2RGF A;  1Z2M A;  1UEL A;  2R2O A;  5J2R A;  2JXX A;  3V61 A;  2BWF A;  2KD0 A;  1IYF A;  1YJ1 A;  2FAZ A;  1P98 A;  3BIN A;  1A5R A;  1RRB A;  2PE6 B;  1P1A A;  1TBE A;  2KLC A;  3NZU A;  4IM3 A;  3ZNH B;  3SDL C;  2M8S A;  4NY0 A;  3QHT A;  3TMP B;  3A9K A;  4AJW A;  3DVG X;  1V80 A;  1Q5W B;  1E5W A;  2Y5B B;  3PRZ A;  2G3Q B;  4GOC A;  4BKG A;  3CF6 E;  2JUO A;  4II3 B;  1V5T A;  3H7P A;  5L83 A;  4K7U A;  2DYM A;  4HLE A;  3B1L X;  4WWN A;  4BKT A;  1KM7 A;  2FCN A;  4MGZ E;  1Q1O A;  4HK2 A;  2KQS A;  3NZS A;  1E8Y A;  1V81 A;  2JZ3 B;  2IO1 B;  2LUE A;  2K8B A;  3QJZ A;  1IPG A;  2KNB A;  2D3G A;  2MBE A;  2WX0 A;  2DYO A;  4K81 A;  1J0G A;  3V6C B;  4MSM B;  1TTN A;  1X1M A;  4RM9 A;  2MP2 B;  3QWZ B;  2XBB C;  2CU1 A;  1RFA A;  2BYE A;  3APD A;  3ML9 A;  3PLV A;  2PJH A;  5DCN A;  4DHJ D;  1WY8 A;  3Q3F A;  5JZE B;  4CHK A;  2HD5 B;  4K1R B;  2I1K A;  1E7U A;  4M8M A;  4W9G A;  1E90 A;  2IO0 B;  2K6D B;  4DHZ E;  1WX8 A;  4WWO A;  4CYE A;  3EC8 A;  3VTW A;  4HWI B;  1OEY J;  2HJ8 A;  5DPT A;  5E6P A;  2MWS B;  4W9I A;  3ZDM C;  2DHZ A;  2OOB B;  3KYC D;  3DBR I;  4WJO A;  3RD2 A;  5KHO A;  3RT3 B;  3PS6 A;  1S3S G;  4LDT D;  3WAN A;  1NDD A;  3APF A;  2DZM A;  2LXC A;  1AAR A;  2FID A;  4DHZ B;  3TL5 A;  4A20 A;  1Z5S B;  2LAS A;  2C7N B;  1E8W A;  3EHV A;  2FIF A;  3PLU A;  5C23 A;  1WJN A;  3L10 B;  2IY1 B;  3X0W A;  2V1Y A;  4GGQ A;  5G55 A;  4E3C A;  2MA9 B;  4GMV A;  2MSE D;  4DHJ B;  2NPT B;  4FLH A;  5TR5 A;  3K9O B;  3QA8 A;  4AJY B;  2M17 A;  2N9E B;  1NBF C;  2FNJ B;  3I3T B;  4FN2 A;  1E8Z A;  4AUQ C;  3AU5 A;  2KTF A;  4W9F A;  3RYT A;  2CKH B;  4DXA B;  2KTR B;  4B6W A;  3PRP B;  3WAP A;  5C1Z A;  1OQY A;  2MP2 A;  1WX7 A;  3QC8 B;  2B3A A;  2N4F A;  1WI0 A;  2M1M A;  1G6J A;  3ZLZ A;  3T8M A;  4ICU A;  3PHX B;  1KJT A;  2FCQ A;  1WIA A;  1WMH A;  2MW5 A;  1ZGU B;  1E8X A;  3PZD A;  2J0M A;  2KLG A;  2VRR B;  4FJV B;  4GXB A;  4LDT B;  3W1S C;  1IP9 A;  3CMM B;  3JYU A;  3V60 A;  3A9K B;  3H1U A;  1LM8 B;  5GMV A;  4XZ4 A;  2PEA A;  4ANU A;  1SE9 A;  3EEC A;  2AL6 A;  2JWZ A;  2MCN B;  3H7P B;  2J7Q B;  2LVP A;  5D7G A;  3V6E B;  2N9P C;  2KHW B;  4IWQ A;  3WA0 A;  2KDB A;  5J18 A;  4AWJ A;  2ZJD A;  3L16 A;  1UBI A;  4W9J A;  4JGH B;  2Z59 B;  2CHW A;  4ZRK A;  2KDI A;  2RSU A;  3OJ4 B;  2C9W B;  3NHE B;  4IWO A;  3M62 B;  2NS5 A;  1GNU A;  2KAN A;  2RPQ A;  3UQB A;  3A33 B;  2K1F A;  3H6N A;  2IZV B;  1GG3 A;  4TQ0 A;  2KO3 A;  3UQA A;  1WM2 A;  2BYV E;  3PGE A;  4GDK A;  4X57 B;  3VUX A;  3VQI A;  2D2Q A;  2CHZ A;  1YX5 B;  2BGF A;  3JVZ X;  3ZIM A;  2DX5 B;  1UD7 A;  4KV2 A;  5D6J B;  3HK0 A;  3QIJ A;  3AUL A;  3VVW B;  3KYD D;  2MQJ A;  3RZW C;  4MSQ B;  1XQQ A;  2BPS A;  2L0T A;  1KOT A;  3VAW A;  2WDT B;  3O65 B;  2KTR A;  3SHQ A;  2KOX A;  4FHK A;  4MJS A;  2L05 A;  4E71 A;  2PPH A;  4MEL A;  4NAW A;  3ZNG C;  1EF1 A;  5BO4 B;  3JSV B;  1OTR B;  1WGH A;  2R2Q A;  3QK0 A;  2CR5 A;  3VHT C;  2MRP A;  1K8R B;  3DBH I;  2DZI A;  3SU8 X;  4FBJ B;  3CST A;  4KZC A;  4TQ1 A;  4P7I A;  3DBS A;  3HM3 A;  2MLB A;  2NR2 A;  3M3J A;  5HKH A;  5AZF A;  2LVQ A;  4FJY A;  4FHJ A;  2RD0 A;  4KIK A;  1I35 A;  3R66 C;  2PE9 A;  4KDL B;  2GBJ A;  4ANV A;  3R7R A;  4AP4 C;  4ANX A;  3A4S C;  4HXD A;  4ZRI A;  2IO2 B;  3M63 B;  4NQL B;  1UGM A;  5CX3 A;  2JZZ A;  4FAD A;  2KJ6 A;  1OGW A;  1WF9 A;  3ZW3 A;  1T0Y A;  3RZF A;  1WE7 A;  2GMI C;  2N9X A;  5DPS A;  2HE7 A;  2YVC A;  4KSK C;  5CHF A;  3U8Z A;  4OVU A;  4IUM B;  2KZR A;  3KUZ A;  1NI2 A;  4EFO A;  1ZW7 A;  5IAA C;  3VUW A;  3ECI A;  1HE8 A;  4IM0 A;  1RLF A;  1YQB A;  2D10 A;  3KUC B;  5IA7 A;  3TIX A;  4BBN C;  1WMH B;  2BWE S;  2LI5 A;  4G0N B;  2ZCB A;  4KZ0 A;  3ZO5 B;  3IHP C;  3N30 A;  1EUV B;  4AOF A;  2DEN B;  4HJK A;  2LGY A;  2KFK B;  2MBH A;  2CHX A;  5AZG A;  2I1J A;  1CMX B;  4PYZ A;  4YL8 A;  3LJ3 A;  1L2N A;  1VD2 A;  1TZ1 A;  2A4Z A;  2JF5 A;  3SD5 A;  3ZUN A;  4A3P A;  2C5L C;  3JSV A;  2G4D B;  2N7E A;  5D2M B;  2LJ5 A;  3UIN B;  3ZVV A;  4HPM B;  4ZYN A;  1UBQ A;  2LWP A;  3OAW A;  3ZTC A;  1WXS A;  2N1V A;  2W9N A;  4ZDV A;  2EKE C;  5E6N A;  3T9L A;  3WIM A;  3P2B A;  4GDK B;  3EFU A;  3WAO A;  3S2A A;  2ZEQ A;  2ZPY A;  2L0F A;  2C60 A;  4GU2 A;  1I42 A;  3N3K B;  4FJZ A;  4WJQ A;  5J17 A;  2NCN A;  2OJR A;  4MGI E;  2KJH B;  2NBU A;  4FUL A;  4KSL C;  4MJS B;  2BF8 B;  2KQ7 A;  4NAW B;  4XC2 A;  2BKR B;  3JW0 X;  4I6N B;  4BKS D;  4NNJ B;  4I6P A;  2XEW A;  4W9L A;  3N32 A;  1EO6 A;  3C0R B;  2M0X A;  3MHS D;  4G50 A;  4I6L B;  5AZH A;  1GC6 A;  4PYU A;  2D11 A;  3PRE A;  3WAL A;  3VFK A;  1WH3 A;  1F9J A;  2KN5 A;  2K25 A;  3W1Y A;  4F7Z A;  4WQO B;  2K6Q A;  4RMA A;  3A4R A;  2AL3 A;  2DZK A;  1Q0W B;  4GSW A;  2JRI B;  4W9E A;  4DK5 A;  2LD9 A;  3A1Q B;  1UH6 A;  4KIK B;  2REX A;  2KFK A;  2GBM A;  3QAR A;  4OVV A;  1SIF A;  1WE6 A;  5E6O A;  3VXW A;  3TJP A;  3KH0 A;  4EKU A;  3KVF B;  4PS3 A;  4W9C A;  2EMS A;  2NVU I;  2MBO A;  2O6V D;  1V2Y A;  2WWZ A;  1WJ6 A;  2J0K A;  3DVN U;  5DPR A;  3PRM B;  4EOY A;  1Y8R C;  2XK5 B;  4DWF A;  4HDO A;  3NY5 A;  2O2V B;  2LVO A;  4JLC A;  3DVG Y;  4NJ7 A;  2AYO B;  3DCG A;  3APC A;  2IO3 B;  5LLI A;  1JRU A;  4F8C B;  4FA6 A;  2MX2 A;  1M94 A;  3Q3J A;  2KC2 A;  4TKN A;  5JHB A;  1WFY A;  4HCN B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...