1WMSA

High resolution crystal structure of human rab9 gtpase: a novel antiviral drug target
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
174
structure length
170
Chain Sequence
AGKSSLFKVILLGDGGVGKSSLMNRYVTNKFDTTIGVEFLNKDLEVDGHFVTMQIWDTAGQERFRSLRTPFYRGSDCCLLTFSVDDSQSFQNLSNWKKEFIYYADVKEPESFPFVILGNKIDISERQVSTEEAQAWCRDNGDYPYFETSAKDATNVAAAFEEAVRRVLAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High resolution crystal structure of human Rab9 GTPase: A novel antiviral drug target
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
molecule keywords Ras-related protein Rab-9A
total genus 55
structure length 170
sequence length 174
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1wmsA00
3I62A 2YV5A 1EWRA 4QJ4A 1CULC 4Q1CA 3UWOA 1Z6YA 2ZI9A 4Q9LA 1KY3A 2A5YB 1U0LA 1ZIOA 4OL0A 3UG7A 4KI0A 4MGZR 1XB2A 4L9WA 4Q4HA 4C4PA 1X8LA 2FMXA 2IXEA 2Q9AA 2G0TA 5SZJA 4CEHB 4RZXA 1KY2A 3RANA 2ZAOA 4FMDF 1N6IA 4DCNA 2OEPA 2O8CB 3CPJB 3CF2A 3KJEA 1AM4D 5CYOA 5IF9A 2GAOA 3WMFA 4FIDA 4EPTA 1SVIA 4XVRA 4G1UC 1EX7A 1GSIA 2OHFA 3ASYA 4TLCA 2GCNA 4F38A 2IF0A 1G3QA 2WPDA 1P2TA 4PZLA 3ICQB 1DO0A 1DS6A 2GZHA 1Z0AA 2QTHA 4FMCB 4D81A 4JLBA 4H1UA 2HXSA 2EFDB 2JDID 1R10A 4GT1A 4AG6A 1GDDA 1T3HA 4PR0A 1AS2A 1XJQA 2FDCA 5K8TA 4KFUA 2GVDC 3GFTA 4IOKA 1XZPA 3TLXA 2X2EA 2OFWA 4FCVA 2MSDB 1A7JA 2REOA 2GA8A 4JLPA 1OH7A 4NYIQ 4DDWA 4GL2A 1V5WA 2G3YA 3AF1A 1Y63A 2ZE5A 4GMXA 2XX3A 1KI2A 1A2KC 1MO4A 4UNQA 4PSKA 2HDNB 2JJ2D 5F3WB 3M1IA 3FKSA 1RRPA 3OEHD 4Q7LA 1HEIA 3HU3A 3GFOA 2QP4A 1MOZA 3K09A 1LS1A 3QKTA 1XD2B 5GVSA 2BBTA 3L0PA 1IN7A 4IDQA 2EWVA 1US8A 1VTKA 4HAXA 3N70A 1NLZA 5SZKB 2ONJA 4DLTA 4CEIB 1M8PA 2QL6A 4OK3A 4AK9A 1KI1A 2G77B 4ACAA 2BBOA 4K46A 4NKRA 1JQJC 3UKDA 1G6OA 1Z07A 4ZDIA 4DC9A 2YWEA 2QQ0A 2CE7A 3VMFA 4M9ZA 2XAUA 2PL3A 3IPXA 4TTQA 1H8ED 2AXNA 1R6BX 3PUZA 2G0NA 3DM5A 3TKLA 2C9YA 5JECA 2ZE7A 4BFXA 4JLJA 1N5KA 3BJIC 3EC2A 4GRAA 5IDVA 1LS6A 2FZLA 3TUZC 1MO6A 1XCGB 2PMKA 4P32A 2VO1A 2PLFA 3EARA 2J0VA 4B33A 3VR1A 1LTQA 2JDIA 4C0LA 4FWTA 4CEJA 3VKHA 4OYHA 2DFKB 1JR3A 2ZRHA 5CK4A 1VYTA 1MRNA 3AB3A 5KDLA 2JATA 4M1MA 1TEVA 4KFTA 5C1BA 4FW9A 1XPOA 4PHGA 4URZR 4KXFB 3IIKA 3QXJA 2AK2A 3BGWA 1Z2AA 3MGCA 2WZQA 3NWJA 1W46A 4GOJA 2ZYTX 5IRCD 4US1R 3DZ8A 3LAWA 1OHHD 3FVQA 5KOYA 1E4VA 2GF9A 2W2TA 3KTAB 3K9HA 1IY2A 3NBFA 3C5HA 1KJYA 1EFRD 3GPLA 3U3MA 2WWYA 4ZO4A 4Y0VA 4DZZA 2CEAA 1D8TA 2GVZC 1GZSA 2GAAA 4XTCS 2ORVA 2H17A 5EP2A 2ZAMA 3WYGA 4CW7A 1P6XA 3UMRA 3O8DA 2Q3HA 3X1XA 2DWPA 1NVVR 1G1MA 2IYTA 2R6DA 1KTVA 2D06A 5FR2A 5FBVB 2AD1A 4TMWA 1AS0A 3RRNA 3KXLA 5JRZA 3R7WA 3VR2A 2CXXA 1D2EA 1W4RA 2QPOA 4LPKA 3ADBA 3KQUA 3AVUA 3VX4A 3ZIAD 1MV5A 5JZVA 1HH4A 2C9OA 1PV4A 4AI6A 4PAMA 3I73A 1E98A 4JKIA 4MDEA 1K5DA 3E1SA 1IN8A 3U5ZB 3AGPA 3W34A 2JLQA 3G82C 1G3UA 3B2EA 1GKUB 4D80A 5H8WA 2W00A 5CLLA 3TSWA 3GLFE 2PZEA 4DDVA 2XSZA 1CXZA 3FMPB 1KK0A 2ZREA 3ZZ0A 4MYUA 4DLWA 5FUWA 3KZ1E 3A4MA 3CRVA 1NMXA 4Q7MB 3A6PC 4F4IA 1U8ZA 3DO6A 2V55B 1O87A 3A37A 1AIPA 3HYTA 1EFRA 1SVKA 2N46A 5JMTA 2C96A 4QNMA 4DB4A 1KK2A 2OSBA 2KE5A 1S2MA 2YWFA 2Z43A 3FWYA 4HAZA 4TQUS 1P4SA 4Q7KA 4YMUA 1G3MA 4QM6A 3Q5EA 1OXSC 3BH7A 4C0QC 1KSJA 4HDQB 2VSOA 1CJKC 4TMTA 4TMVA 3CONA 4B47A 4E03A 3CR8A 1YVDA 2IYSA 2NTYC 5L3RA 3T35A 5K8UA 1N6PA 1XJ0A 3LV8A 3O47A 1XBTA 2P6RA 4NPHA 5FTKA 5EXTA 1II8A 5LBIA 1A82A 1E96A 1AS3A 2GXQA 4JL6A 1Q12A 5J4LA 1GWNA 5CM9C 1BMFD 1QHXA 4RKEA 3CNOA 3WP0A 4DVGA 2ZU6A 4P33A 4ZIRA 1SXJE 2J45A 3K9LA 3Q7QA 1SULA 1T5LA 1X86B 3QQ5A 2IX3A 1NBMD 4JSYA 4LUCA 1XMSA 2ZIAA 1JB1A 1WCV1 1B23P 3AF4A 1EESA 1BKDR 1A2BA 2J1LA 4TLBA 5DI3B 1U9IA 5EE5B 5JSZA 1XTKA 2O8EB 5G3YA 3CX6A 3T34A 5JWHA 5FTNA 2B7BA 3S1AB 2ZR7A 3VAAA 5EZ5A 4KYUA 4UNNA 2AD5A 2Z6VA 1PUJA 4AKEA 1XZQA 1IJFA 2VSXA 4PHTA 3GLHB 1ZCBA 2R62A 5GJBA 1NP6A 2GK6A 4R7ZA 4IDHA 3SYNA 1VHLA 4MKFA 3AVOA 2ZI5A 1HT1E 4UNPA 1XWIA 2GK7A 3GJ8A 2O8EA 2I1VB 3B82A 1JAIA 3WRYC 3TJZA 1UBEA 3BRWD 3W3AA 2QM8A 1TX4B 2F1HA 1E2GA 4YXWA 1GL7A 3ETLA 4MITA 1YZKA 4AKIA 2PZGA 1YQTA 4D4LA 1II0A 3QJYA 5A0FA 4BZPA 2NOAA 4WOPA 2NGRA 3ZZTA 5KNDA 3EW9A 4DBLC 5FPKA 2O8DB 2OLKA 4V0MA 3GLIB 1SVOA 1S4QA 4O2LA 1UADA 1E2IA 3K53A 2J46A 1QHYA 4MRSA 5DYIA 1T4GA 1JPNA 4BECA 1TQDA 4HUQA 3AVVA 1KI6A 4FN5A 3A4LA 3CUEF 1CR0A 4LZZA 5L3QB 3LRPA 2QE7D 3W6OA 4M4SA 3SFZA 2W6JD 1VKJA 3JVUA 1DO2A 4FMBB 2QTFA 4PC7A 4ZPXA 3SBDA 3W8RA 1U94A 3EZ6A 1AKYA 2WBLC 1XEWX 1PZNA 4NCJA 3H84A 4A2PA 1E2QA 5FTJA 2WMOB 4Q66C 1Q3TA 1VDZA 3OIUA 5IK2A 2VF7A 1PLLA 4O2RA 3G5UA 1RPZA 3B7GA 2QAJA 3CWZA 3IHLA 3T61A 4B48A 5E3HA 5JWOA 2O8FB 1MABA 2FGKA 2GETA 1H8HD 4EJSA 4KODA 4DCUA 3CRW1 1P2SA 2Q3FA 5GJVC 2CE2X 1ZVQA 1EFCA 1IY1A 3QNUA 2AKAB 4NYJR 3ADDA 5H68A 1KSGA 2KBFA 1FZQA 1VCNA 1E2JA 1NN0A 2OXCA 4A8JC 2QT0A 3OAAD 5D3MB 2VYFA 2YJTD 4EFMA 5IHPA 2ZETA 3WYFA 2W58A 4M9QA 2YOFA 2WOJA 1GG2A 2VP0A 1FL9A 4BFWA 3F0TA 821PA 2NZ8A 3GLFB 3KQHA 1RZ3A 2ODEA 3KB1A 2PMDA 2LWIA 2W2VA 3F8TA 4P31A 4TL9A 3SBEA 3SOPA 3GLGA 1EX6A 2GJ8A 2R6AA 2ZRLA 3C4JA 1OT3A 3CF6R 5FOWA 1NN3A 1ZRHA 2FE4A 4XH9B 4XWKA 2QE7A 5HPYB 1NVWQ 1Q44A 3OEEA 3I72A 4TLAA 4G5SA 4UJ3A 4UNSA 3U4QB 3WMEA 4RJLA 4MRRA 4US2R 2ERYA 2BMFA 1FFHA 5KDOA 1G21E 4LGMA 3ZYCA 1GRNA 2ATVA 3AF2A 3Q85A 4RZ2A 2ZSEA 1G64A 2QAGA 2JLWA 5EQTA 4NONA 3ASZA 3F3YA 4TTPA 4AKGA 2IL1A 3NHBA 4JYCA 4M9XA 2XJ9A 4A6XA 3B1VA 5FOTA 1Q0UA 2J0SA 4DLVA 5JS7A 1E2HA 1SVSA 3REFA 4LWZA 1DG3A 3R7WB 1CJTC 5KSPA 1Q1ZA 3V9PA 1UKEA 1GNQA 1M7GA 2IS2A 2YC2C 2QMHA 2RGXA 5D3QA 1XD9A 1E9RA 3IGFA 4DJTA 3R9IA 3CBQA 2NIPA 2QRZA 4HLUC 4URWR 4DSOA 4F91B 1YR6A 3A4NA 1II9A 2J7KA 4Q03A 5FR1A 4ZI3A 3I1FA 1W36D 4W5WA 4C30A 5GADl 4Q00A 4RD1A 1LVGA 2ODBA 2PJZA 3FKQA 1UBFA 1ZIPA 2BWJA 3TBKA 1NLYA 4BFUA 3LD9A 621PA 4A2QA 1XPRA 4URXR 3EZ7A 4RVCA 4YONB 1JNYA 1S3SA 4EKDA 4BFYA 3U6KA 4PAOA 3K1JA 2V6JA 4PAQA 4IVQA 3WHLA 4NH0A 2C5LA 3FKSD 1IQPA 5IK2D 3GEIA 2VHTA 3AF0A 3Q7PA 1XTRA 1Z3IX 3GCGA 4AG5A 4C0SA 4TYNA 4ZCMA 3LDAA 2X8AA 1GKYA 4M1YA 1ZU5A 1YZNA 1I4DD 4LHXA 4LJAA 4DLRA 1CKEA 5E7IA 4B32A 1BH2A 3T15A 5A5GA 2OCAA 1YZUA 1KI7A 5FFMA 3KKPA 3QG1A 5IT5A 4Z1MA 1P9WA 3OAAA 2CL7X 4D4KA 2UZ3A 2Z4SA 1QVAA 2VTKA 3WNBA 4IFBA 4BFSA 3GJ6A 4TSFA 4A82A 1YHNA 1G8HA 3LA6A 1LNZA 5C18A 3PEWA 4FXPA 4OI0A 1Z0FA 4TMZA 1OH5A 2JLVA 1H8EA 1GFIA 1ZU4A 1HT2E 3EWAA 3IBGA 4JBYA 2ZRIA 4D25A 4IOMA 3UPUA 3N5CA 1JI0A 2QNRA 2IW3A 1W5SA 2WJHA 1R0XA 2FZ4A 1JR3D 1XD2A 3NBZC 4PTLA 2ZM5A 3TAUA 1C9KA 1G4UR 2EVWX 2QTVB 2GBLA 3TIFA 2WMNB 4CEIA 4CEJB 2A3RA 3LLMA 2B92A 1ZNWA 2FPMA 1L8QA 1X8KA 4WW0A 1OSNA 4D4MA 3MWYW 4Q1DA 4XVUA 4ITRC 1XXHE 1KK3A 3RRZA 1TQ4A 1Z83A 2AK3A 1KMQA 1ZAKA 1I2MA 3P20A 4BZXA 2GZDA 1YZGA 2FEMA 1W1WA 4LPSA 5JSZB 2CNWD 4PXAA 2JLZA 1U98A 3GQBA 4G5OA 3ONWA 4KO8A 4FINA 1E32A 3ND9A 1FPMA 1TQ6A 2R65A 2XXAA 2FNAA 4BLQA 1LF0A 2ECKA 1Z22A 5KPJA 1JJVA 1CBUA 1G291 1W5TA 4V03A 4LJ4A 3UMFA 1DBSA 1DAGA 2O8FA 4EUNA 1G8FA 2VSFA 4LK2A 4TYYA 3E2IA 3FHTA 3HP1A 1AGRA 2QN6A 4OI1A 2GZAA 4Q1AA 1ZBDA 4NYMQ 3AEZA 5FUVA 1OFTA 1YZTA 1XTJA 2HXYA 1VPLA 3ZD6A 3B6EA 3GEEA 3KFXA 2FSFA 221PA 1U0HC 2GKSA 2FSIA 1XMVA 2GRJA 4DIEA 3RS5A 2J0QA 4US0R 3AKEA 5AJXA 1GP2A 3MCAA 4EQ6A 5JFGA 4FI3C 4IXNA 4AWXA 5TY0A 5BYJA 4NHOA 4JYBA 3RWMB 1UPTA 1Z2CA 5CDFA 3BOSA 1TUIA 4JLDA 2GDJA 2OE2A 4QHSA 1WRBA 4U02A 4U00A 4X8LA 3SEAA 3TUJC 2VP4A 2ANBA 4PO9A 4V0OA 3ECCA 5EE9A 4DUGD 1P2UA 4JLOA 2REXB 3CRRA 3QF4B 1G18A 2WTUA 2VP6A 2W2XA 4Z1MD 2LKCA 2PEYA 2QU8A 2G9NA 2O52A 4M9SA 2PX0A 1R2QA 1UM8A 2IUUA 3O8RA 4PO1A 4LHVA 1GL9B 4LHYA 2JLUA 5JWRA 3VKGA 1E2LA 4LHZA 3CM0A 2WWHA 2P6NA 1M6NA 1NBME 4TLDA 5CDFE 4WZBE 2AFIE 3P1JA 2A5GA 5EUMA 3T1VA 4RFVA 2GILA 1VIYA 1X1RA 2FF7A 1YJ5A 2NO6A 2GEDA 3IEUA 4Q9HA 4QOSA 4O0MA 2VHUA 1OYWA 2BHRA 3P26A 5CIQA 1WBBA 5EE1A 3U2QA 4IRUB 3K0AB 2ZYVX 3K9NA 3KKMA 2D7DA 1TU3A 2B21A 2HF9A 3D31A 4HATA 1ONBA 3MRSA 1ZC3A 1KO5A 1CJUC 1HQYE 1SHZA 4GOXA 1OV4A 1KZGB 4L4UA 2WKRA 4PPGA 3RRYA 3IUYA 2WIBA 5CLQA 3WP1B 1F2UA 1F6BA 1PJRA 1W47A 5DHAA 3UWKA 4O25A 1OFUX 3L0SA 2DYKA 4HAUA 1SXJC 2JASA 4DEXA 4G5QA 1P7CA 4HSEA 4MH0R 5FI0B 4JLMA 2O8BA 4HYYA 5C2JB 4FCWA 4DUGA 2RGDA 4TYWA 1US8B 1II8B 4OBEA 3U7FB 4IKEA 4OQMA 5EJEA 2ZI7A 4TL8A 4PZYA 2UVQA 1G6HA 2OBMA 2AXPA 1F2UB 2D4HA 3QEOA 3EA5A 4KCGA 3CPEA 4F4CA 3ICEA 2QGNA 1KOFA 2J59A 1DPFA 4BWYA 4JIMA 3RC8A 3JZMA 2MSEB 1SVMA 1WE2A 2H57A 2WIAA 4LJ5A 1TQ2A 1OXXK 2NG1A 3A8TA 1ZJ6A 2AX4A 5FBWB 4NL4H 1XP8A 4MGIR 1U0JA 2AWOA 1OFHA 3QVVA 4BRWA 2P5TB 5DI3A 4DLSA 4HLUA 5AUOB 4RZUA 2YKGA 1OH6A 1HV8A 1G17A 1FQJA 2QSYA 1WF3A 3KDSE 1PLJA 3FMOB 4DSTA 3EPKA 2QSZA 5SZHB 2C8VA 2R44A 3DHWC 2QMOA 1T9HA 1M74A 1YR7A 2KSQA 1X3SA 4NDZA 4NCHA 4PFSA 4Q19A 3G0HA 1UKVY 2XTZA 4PC6A 5P21A 2RGNC 4QBHA 4ZIRB 1CEEA 2ZJAA 3I8SA 2W6JA 1YR9A 3P4YA 4I1OA 5EP3A 2O8BB 1ZD1A 5J4KA 4N0DA 1E79D 3AQ4A 2BCGY 4D6PA 4N0EA 1ESNA 4DWJA 2CJWB 1DAIA 3IBYA 1Z6TA 1P61B 3NDPA 1CP2A 5JHGB 3LVRE 3SHWA 2FWRA 5KPDA 1H8HA 1S9DA 2WKQA 2WSMA 3A36A 1GL6A 3GFPA 3I5YA 3W6PA 1S3GA 1N6HA 2IXGA 1VHTA 2OBNA 1AQYA 1XJCA 2ZRCA 3TAHA 1R0YA 4DCSA 5KSYA 2OAQ1 1U2RA 2F9MA 2MMCA 1VYVA 4JLKA 1NY6A 3SYKA 2EFCB 5DIFA 1PVOA 2JLXA 2PZFA 3B8HA 2A78A 4UNRA 1DAKA 3LVQE 4AKHA 4YMSA 5M04A 4QNRA 2ZRNA 2OT3B 4Q4LA 1LV7A 5K8LA 1A4RA 1ZCAA 2D74A 3ZVNA 1Z08A 1Q3HA 4CEHA 1HTWA 1ZNYA 4B35A 4NCIA 2ZRAA 3U7HB 2HF8A 1E69A 2OCBA 4NCKA 3EPJA 1E0KA 5B2ZA 4H9GA 3KX2A 1QVRA 1XTSA 4XIGS 1ZM2A 2V54A 1R5BA 1SVLA 1GM5A 1DARA 2CDNA 2N1BA 2DY1A 2CBZA 1NVXQ 4MRNA 4PQYA 1IM2A 2BEJA 1DTSA 4RD2A 1QHSA 3C5CA 3CNLA 1KAGA 2E9SA 4OHZA 5TDHA 4HAVA 4MA4A 1VG0B 2XNSA 5DISB 2H8KA 4XWAA 1W4CA 3VKWA 2RGGA 1TF7A 3CF0A 4MQBA 4DKXA 4FMDB 2HJGA 5DHFA 4D4JA 2DPXA 1OF1A 1ZYUA 5KO2A 4RSGA 2PT7A 3P27A 5DH9A 3KQLA 3FYHA 2J87A 2WJGA 1Q1QA 1LFDB 4DCVA 3B78A 4F92B 1UKZA 2CLDX 3ADCA 4DXAA 4QXAA 3ZZUA 3IILA 2FEOA 4B2PA 2IYYA 2V8OA 2FFQA 4HLCA 1CRPA 1L4UA 3PJRA 4GDFA 1PLKA 2BIFA 1E94E 4HB0A 2NQ2C 1G7TA 2IEYA 1FNMA 4FWIB 1TL7C 4HDOB 4IFEA 4MUAA 2Y8EA 1C1YA 1RFLA 1SXJB 2A5DA 1QHHB 1U8AA 3NKVA 4HDCA 1NRJB 5AUPB 5KU1A 2FX3A 3EPLA 2YVUA 1R5OA 4B3GA 3KXKA 3OIWA 1E79A 3MJRA 1EFTA 3KL4A 1I4LD 2D7CA 4JKYA 2ZI3A 2RHDA 1TEXA 1W7AA 4GI7A 2ANCA 1KO8A 4HEJA 1TNDA 1FP7A 1KDPA 1G8YA 2OUKA 4DEYA 5BN5A 3EIEA 3BB4A 2GHIA 3LBNA 2BJWA 4B76A 3I61A 1ZD9A 3SJAA 1ZM7A 1ANKA 3ZVRA 4QC2A 2C98A 4JLAA 4NYIR 3GJ7A 3LWNA 4LBVA 3U7EB 3VNVA 2EW1A 3GMTA 2F3TA 3BORA 3IQWA 3K0CC 2CHQA 5B30A 3CIOA 2QQEA 4S35A 3CRMA 4A1FA 2GJAA 3Q8XB 5EXSA 3QKRB 5JHHB 1T3SA 1Z06A 2VP5A 1GRQA 1T3LA 1KZ7B 2DR3A 3EC1A 5DO9A 1HYQA 4Q4JA 4TQ9A 3L82B 1FUKA 1X6VA 2XB2A 5JS8A 1RYHA 4JL8A 3T06B 2H7VA 1D2NA 2P67A 1IJEA 2ZRJA 3L0IB 3VU9B 1E9FA 1KI4A 1P9RA 2R6CA 3LX8A 3W5IA 3ZQJA 2BKUA 1SZPA 1G41A 4RY2A 2IYRA 1G7CA 121PA 2ZU0C 3LLUA 1XU4A 3PITA 4B3DA 1FW6A 1RW4A 1TF2A 3BB1A 1N6KA 2H92A 3BFVA 3KTAA 2GJ9A 2OILA 1T91A 1ZW6A 2BM0A 2FH5B 4QRHA 5AJWA 1N2CE 3CPHA 4A9AA 5J47A 5KNBA 5LD2C 3KKOA 3QOFA 5JJIA 4QHTA 3I32A 3AGQA 4EPYA 2CNWA 3J81k 3LBHA 3PV0A 1E4YA 2FGJA 2FA9A 1NMZA 1VIAA 1MT0A 1R8SA 4M53A 5JEDA 4MRVA 3NVAA 2I4IA 4HI0E 3PG5A 4QBFA 4BQSA 5BYKA 3W6NA 1EWQA 2VHCA 1IY0A 4L5BA 2C03A 3K0EA 4B2IA 3THWA 1R8QA 4EQ6B 4AY2A 4N1AA 4TT3D 4BE7B 1E1RD 1R4AA 3N2EA 2ORIA 3WNDA 4KLZA 1EGAA 3CR7A 4Q1FA 4TWZA 1KYIA 4DCTA 2JCSA 2ORWA 3A1SA 5F9FA 4LX0A 1R0WA 1T6NA 2K5UA 3NEJA 1DAFA 2ZRKA 4MRPA 4P3YA 2D3WA 2VF8A 4NCNA 4I4LA 4KFRA 1KI3A 3C8UA 3GLHA 4PO8A 2B8WA 4YDSA 5BN4A 4UXIA 1P9NA 1Q22A 3X2SA 3TRFA 3OIVA 1AKEA 3CRQA 4Z54A 2AN9A 4YC7A 2P5SA 5LB4A 1WDTA 4OHWA 4EFNA 1E2NA 4U5XA 2LCFA 2Z5FA 3OEED 2ZQ5A 2YNMA 4LDJA 2F1IA 1L2TA 1KIMA 2W0MA 2EFHB 1D5CA 2IUTA 2IYLD 1K8RA 3L0OA 2CCJA 2ZRMA 4TN1A 1XF9A 2ZRGA 4Z51A 1RJ9A 2O0JA 4IDPA 2ZJ2A 2V3CC 4C0BA 1Q1EA 2EU8A 3N2IA 1D9XA 2I3BA 1GRRA 1XXHA 2QT1A 2DFTA 2NO0A 1KDRA 3HPRA 4B71A 5BWMA 2GEVA 1P72A 3GD7A 1R0ZA 3B9QA 3GJ3A 4IW3B 3VR5A 2JGNA 3MSXA 721PA 2FSGA 1XX6A 3TH5A 2RGCA 3D8BA 5E4FA 1E2MA 3A58B 3QXXA 1HA3A 2ZXUA 4MKHA 4IOLA 3EIQA 4M1OA 3KKQA 4TT3A 4ZDKA 1P60A 3K9GA 1KHTA 4DT1A 4N3NA 1HE8B 2BEKA 2WWFA 4ARZB 3BD9A 1XFAA 2OLJA 5CJ2A 1M7BA 2DCUA 2HCJB 3U61B 1P75A 4Y0AA 4D26A 4V0LA 1TADA 2ZYUX 4GZLA 4ZDJA 2VL7A 2ZJBA 1YE8A 2NO9A 4M22A 2FFHA 2ZE6A 2IHYA 4I1SA 3SJBA 4EJSB 3NDBB 4NE2A 5E95A 3D3QA 4E09A 3BFXA 3BS4A 3I4LA 4L16A 4MYTA 2G88A 2RGAA 3RABA 3QSYA 1N5JA 1T0HB 3RWOA 1W48A 1D6JA 5L3SB 5C4MA 4TMKA 3K70D 2ZUDA 1L7VC 4QJ5A 2HLDA 1KKMA 4RFSB 1EXMA 1NIJA 1G16A 3DKPA 3MWKA 2QPAA 3UATA 5EZ6B 3TR0A 1N3BA 1RRGA 4ERNA 2RHMA 5DI9A 2BMDA 3VR4A 5HTKA 4RCYA 3PEVA 5DNYB 1F48A 3DOFA 4DDTA 4PPQA 1DG1G 2IXFA 2QEQA 4UQOA 2O8CA 1JPJA 2XJ4A 2FOLA 3W5JA 2V9PA 4M2LA 1Z6GA 3SI7A 3RS2A 4Q9KA 1IXRC 1NNEA 1Z0JA 3KFVA 3DL0A 4KITB 3PUVA 1U99A 4JS0A 1E9SA 1UDXA 5LB2A 4DLXA 1Z8FA 3KUDA 4GP6A 2RH5A 4RKFA 2KBEA 2FFAA 4V0NA 3QEJA 4ON9A 3ZH9B 1SKYE 1Z5ZA 4Q4AB 2ZSBA 3QPVA 5EUQB 4B3CA 1DAEA 2FV8A 2ZRFA 3RS7A 4Q02A 2HEIA 3RDPA 4BLPA 3GEHA 4C0KA 2G6BA 3C41J 4Q7JB 2RMKA 1BYIA 3SE0A 3HJNA 4PQFA 1SKYB 1D2MA 4CDGA 1W2GA 3TGPA 4U7DA 4ESVA 3DEFA 3K0AA 1LW7A 1DAHA 1BO6A 1HQCA 1F3OA 2XITA 4A36A 5AR1A 2Z83A 1IN6A 4CT5A 2R2AA 1JEDA 4BEJA 4TYPA 4PSVA 4BFZA 4P0TA 4P4TA 4HUTA 1NG1A 1CF4A 1LY1A 2O8DA 3OE7D 1KGDA 3VNUA 5FL7A 3DPUA 2HT6A 3AP3A 1VG1A 2IWHA 2NPFA 1VG8A 3QXHA 3RNLA 1E0JA 2F3RA 1IOZA 4II7A 2D2FA 4LC0A 1FUUA 2QRNA 4LRWA 3WNCA 2RGBA 1U81A 2OCPA 4CYMA 3RC3A 5FUXA 3HPQA 3UXMA 2ZSFA 4YMVA 1CS4C 1G9XA 2F43B 4R2IA 2Q6TA 2YOGA 4HZUB 4Q9IA 4R2HA 4OHYA 1AK2A 5KNCA 4NP6A 5DSZA 2R6FA 3AVPA 5EP4A 3W90A 1MABB 1SGWA 2GXAA 2WWWA 1KSFX 5TMPA 2YYZA 1TF5A 2VPPA 4LJ7A 1Z63A 1HE1C 3K0FA 4TTRA 1YR8A 4URVR 3GP8A 5G41A 4EJSC 4EIWA 2XTMA 1ZNXA 1G7SA 3EAQA 3F5FA 1NN5A 4QFMA 1WB9A 1YKSA 2FJUA 2HLDD 1OH8A 3MWJA 2J0UB 4YMWA 3ZVLA 1N5LA 4IXMA 4Q1BA 3T12A 3QPWA 1S1MA 1O3YA 2WWIA 5TB5A 3FFAA 2ZJYA 4TLEA 4C2TA 1RC8A 1FMLA 2YHSA 4MYHA 4TYQA 3THYB 1YU9A 1AZTA 5L3VA 5G53C 5H1YA 4BLTA 4KBGA 4MDFA 2ZEJA 3OE7A 2RGEA 1GOTA 5FL7D 5LPNA 2EWWA 4H1VA 2IF2A 1N6RA 1KJWA 2XTNA 3H4MA 1Z6XA 1F5NA 2ZRBA 4GZMA 4OJQA 5CK5A 5BXQC 5L3QA 2E1RA 1FX0A 1BS1A 2BJVA 3AVYA 3RSOA 4QGFA 1OIXA 5B58C 2QROA 4ASUD 1OIWA 1SKQA 3IIJA 4J0QA 3CKLA 1GITA 1U90A 3ND8A 2JA1A 2A30A 3K70C 3EZFA 1DAMA 4LCBA 2WJVA 4Q01A 5KTYA 3BERA 3SHFA 4OKSA 1KI6B 4LBYA 4IHQA 1PUIA 3E5HA 4A2WA 3L8ZA 4DLZA 3IDQA 2ZSDA 3T5DA 3DMNA 1T0JB 3I8XA 4E22A 2CJWA 4RD6A 3W8NA 1EG7A 3REGA 3SR0A 3B1ZA 4JT4A 4BLSA 2YC4C 4JSTA 2VLIA 3BE4A 3GJ0A 2ASEA 5FOVA 3T5GA 1T5IA 1WP9A 2BV3A 1KNXA 2V4ZA 2Z4RA 1W4AA 1S9HA 2ZUBA 1NL3A 4TZ0A 1Y3AA 3I92A 3MFYA 4LBWA 4LYFA 5DGXA 2WV9A 2GF0A 3SU8A 3BK7A 2YINC 4MGKR 4B6EA 1M1YE 3EASA 2W83A 2KWIA 4G5GA 2ZITA 1UDWA 3KJHA 1OXTA 4EAQA 2W6IA 2DWQA 4NZYA 1CJMA 3L2OB 2D62A 2ZR0A 2AFHE 1X1SA 5CM8B 3CH5A 3OHMA 4Q4AA 5FUYA 2F9LA 2QMUA 2IYWA 2OAP1 2GJKA 3VU9A 1NKTA 2C99A 5J4HA 3LXXA 1FTSA 1G4AE 2V1UA 5FOXA 2ZROA 2JJ8A 4Z8XA 3RYTC 5F9HA 1E2KA 4PX9A 1ZM9A 1AJEA 4S2EA 1AGPA 4KFSA 5JI2E 2ZJ5A 2EYUA 5AK0A 2WJYA 4TL7A 3KUCA 1NN1A 3LW8A 4GFDA 3VFDA 1VECA 2IUSA 521PA 4TL6A 2AR7A 5EXXA 2ZSAA 1E2DA 1QZXA 4KV9A 2QP3A 2ZANA 3B5JA 3TSOA 3QPUA 4C3ZA 2QGZA 2I1QA 1E9AA 3K09C 2DFLA 4K81B 3HWSA 3TVDA 4W5JA 4BRUA 1RKBA 2BMEA 3SNHA 4LOAA 5C4GB 3QKSA 4ZDWA 2NO7A 1KO7A 3QE0A 1S0UA 2YZ2A 3LFUA 5JEEA 1RE0A 3FHCB 3QBTA 4IOJA 5J4VA 4KJZA 4V0KA 2BOVA 3HU2A 2F55A 5FPTA 3NHAA 4RFSA 2NMVA 3D6TB 1XEFA 5CB8A 4ASUA 1KSHA 2ZJOA 1UEIA 4OHVA 2ZR9A 1UF9A 3BB3A 4R98A 1P3JA 4QKQA 2C04A 3TNFA 2HUPA 2QPTA 3A1TA 1E6CA 4QM7A 1JAHA 1XTQA 5E7MA 4A8JB 4Z8YA 4D0NA 3LQRA 1DADA 2WJIA 2QUZA 4PZZA 4DIDA 2IS6A 2C78A 3BIFA 3K70B 3BC1A 3GLFA 4BASA 4DB2A 1MKYA 2QAGC 4PPNA 4E07A 1ELOA 2OXRA 1IBRA 4HAYA 2A2ZA 3SQXA 2OESA 1G20E 3QENA 2A5JA 3PIRA 1RJ9B 4YMTA 4URUR 5LDDC 1XDBA 2P3SA 2C2HA 2BC9A 3U6BA 1OXVA 5JLJA 1SVWA 2CVFA 3WBJA 1GIAA 3OIYA 4MGYR 2B6HA 2CLCX 3VX3A 3VQTA 2IK8A 2R9VA 2KB0A 1MO3A 5FL3A 4YDHB 4KU4A 2FPLA 2WM9B 4OQLA 3NC0C 4EFLA 1DEKA 1G3IA 3KKNA 2IYZA 1ZINA 1QF9A 3X1ZA 4PPFA 5FPSA 4MUBA 4KAXA 3ZLJA 4WA7A 4DHEA 4R9UC 3PVSA 4HUQB 2QENA 3B1WA 3RRMA 1U9IC 5FTLA 3EPHA 3AKCA 3UK6A 2A5FA 3L8YA 4XJXA 5AJYA 2D2EA 3M4YA 3ZS8A 1GUAA 3U4QA 3T1QA 5HKKA 4JLNA 2N42A 4WIAA 4TZ6A 1NLFA 2CCKA 1X8JA 3O8BA 4OI2A 3KQNA 3THXB 4W9MC 1I4TD 1I2DA 4E5UA 3B60A 1TU4A 2QP9X 3QF4A 1ZM3A 3KJGA 4B75A 1OLOA 3TW4A 3NTUA 4QBGB 5TV2A 2UZIR 5BN3A 5JBQA 3QY0A 1E9DA 2V1XA 2XEXA 4JJKA 4M21A 4NBSA 1N25A 4LJ6A 1UJ2A 1COWD 1KJZA 1QHNA 2ZYWX 2IYXA 1VG9B 2CL6X 4NYJQ 1P2VA 3TE6A 4DSNA 4XTRA 1UBGA 1SHKA 1WA5A 3FMIA 4D0LB 2EQBA 2ZJZA 4LSGA 4RD3A 1CRQA 4PHHA 3ZJYA 2OO7A 2C77A 2F1RA 5BQ5A 2BM1A 3QKRA 4GMDA 4XOIA 1E99A 2EFGA 3IIMA 4QBIA 4UKDA 4G01B 3DZDA 4DLYA 3Q5DA 2P0EA 3Q72A 1ESMA 1G19A 4LC1A 4XSHA 4ARZA 1KAOA 2IS4A 3GLGB 4O3MA 1ZNZA 3PFIA 1M7HA 3FFBA 4GBMA 4B3XA 1AQUA 3CH4B 1SQ5A 2FG5A 1G5TA 3HR7A 4CZ2A 1XXHB 2PCLA 3AP2A 3NG1A 4PHFA 1UEJA 2ZTSA 1NJGA 4M1KA 2RAPA 2YOHA 2Q9CA 4D2IA 4F7WA 2O5VA 2NZJA 2BCJQ 3CX7A 3FMFA 1J99A 3NXSA 5JJLA 2KJQA 1P73A 2MSCB 3TUIC 2AKYA 4HZUA 1NY5A 3C7KA 4NTZA 2Q21A 1NVVQ 1FTNA 3QKSB 1E0SA 4C0AC 4Q4JB 3UANA 4W5HA 1WBDA 4KBFA 4DLUA 4B74A 3CWQA 2VHQA 2MMGA 2QZ4A 1UFQA 2ZVQX 3WXMA 1N6LA 3LW7A 2FPKA 3U3JA 1E1QD 5CYPA 1Z47A 4KVGA 4FMCF 4ZKDA 2JEOA 2GCOB 5FI1B 3AP1A 1LF5A 2WOOA 3EIHA 4OQNA 4JBXA 2GWHA 3WHKA 5D3MA 5L3SA 1NF3A 1W4BA 3MG9A 3MUFA 3RSLA 1XTIA 2IA5A 2ZE8A 1XCMA 4KSCA 1U8YA 3DOEA 4LBZA 3M0EA 1RIFA 4WZAE 2Q0HA 2CL0X 3D7MA 3NC1C 4PC3A 1E9CA 3AKDA 5GJWC 3EA0A 2ZS7A 3U3KA 3DMDA 1UAAA 3L43A 4AIIA 5K8IA 3U3RA 4AYXA 4CVNA 1RYFA 4EPWA 3ZVMA 4CRWB 4HB4A 1P5ZB 1E1RA 3FE2A 2EFEB 3FDIA 1K5GA 3RS4A 2CVHA 4ABYA 2PCJA 2QY9A 1J8YF 1LB1B 1OJLA 3MD0A 2CK3A 2HT1A 2P2LA 4LYAA 3O8CA 3W9YA 4AD8A 3K0CA 2CCGA 2RB4A 4G5RA 1XPUA 5TARA 3EX7C 3P32A 1ZD8A 3FGNA 3THXA 2H16A 3NBXX 3A1WA 4NU0A 2ZJ8A 1E9EA 1TAGA 1WMSA 2QORA 3TSZA 1Z29A 3EXAA 2XZLA 3QG5A 1ZUIA 1S8FA 3QBVA 3QKUA 4EPRA 1E1QA 2WAXA 4Q4HB 5KDDA 4Q47A 2ZS9A 2IT1A 1OW3B 4LJYA 3GLIE 2RGNA 2GESA 5FBRB 1E2FA 2XZOA 2OV2A 1CIPA 1M2OB 1K6MA 4MKIA 2E87A 2JAQA 3B9PA 4BFTA 4YLGA 1W2HA 4AYTA 4CF7A 1KNQA 3OESA 5FOSA 5JJKA 4FCTA 3AKYA 1VMAA 1EK0A 2VRWA 4BGDA 2OBLA 3RS3A 1A1VA 2GCPA 1ODFA 4RD4A 1ZM4A 3DDCA 1NSFA 1BYUA 2AHOA 3S1AA 4Q18A 1OHHA 3X1YA 4Q5IA 1S1CA 4XWOA 2QAGB 1G5PA 2WAYA 3A1VA 5FBLB 4Q21A 1E3MA 4OK6A 3I5XA 3SFVA 5HZKA 1W36C 2CMKA 2YWGA 1OE0A 1W49A 1N6NA 2F43A 3OFNA 3PUYA 4G3XA 4R71A 2PJRA 4QGAA 3LXRA 3P4XA 2XNDA 2ZUCA 4G0NA 1IN5A 2ZRPA 1SXJA 2G83A 4A15A 8OHMA 1N6OA 2GNOA 3FPAA 3FTQA 1CU1A 3CZQA 1JECA 3MJHA 3WBKA 4A92A 1KK1A 1CR4A 2DWOA 4IDOA 3LNCA 4C7OB 1N5IA 1YZQA 2GJSA 3DM9B 4RCZA 1WXQA 1J90A 4GOKA 3FOZA 3OZXA 1QHGA 2CLSA 3KJIA 5HCIA 2QBYA 2F7SA 4JBWA 3ZIAA 2P6UA 2ERXA 3A1UA 3R9XA 5LD2B 3H1TA 3EWSA 1E9BA 4P4SA 2J41A 3AUXA 4JT2A 5FOUA 1RVDA 1OB2A 1N0UA 5C46F 1GKIA 2AL7A 2DB3A 2FN4A 5ANRB 4IVRA 3DKVA 1AZSC 1S96A 3SC3A 3K0SA 1DVRA 1CJVC 2OCYC 2WSSD 4JJZA 4KLNA 4X8OA 2VA8A 5FH9A 1Z28A 5FPHA 2XSZD 4D0GA 5CITA 2V7QD 5FBQB 4BZQA 1QBKC 1MH1A 5HCNA 1KI8A 4FD2A 1EFHA 1Z0DA 1IXZA 3EZ2A 1F2TB 3QI2A 2H18A 3PQCA 2VP2A 4I1VA 4M1WA 5AUNB 4JVSB 5EE3A 2G1KA 4F93B 1GAJA 2C95A 5KUTA 4QHYA 3BFKA 2XB4A 1HY3A 5HR5A 3OFND 3QXCA 3LO5A 4HB3A 1DELA 4RZ3A 2VP9A 5AJVB 2R8RA 3Q9LA 1A5TA 4CT4B 3V4RA 5F2EA 3GJ5A 5KSZA 5GVRA 3IQXA 3IEVA 3B1YA 5HZHA 1JJ7A 2ONKA 2X2FA 3HDTA 2PLRA 3THOA 3AVWA 4BLRA 2WHXA 1OB5A 2QM7A 1XNJA 4HB2A 1QRAA 4LYHA 3UMSA 4A0HA 4BEBA 2ODWA 3MMPA 4C0HA 1IN4A 5B64A 2QG6A 2X19A 3VHXA 3PR1A 2ZS8A 4DSUA 5AUQA 2HCBA 3TR5A 5JI3E 5CB6A 2HJVA 3U44B 4BFVA 3V00A 5DE3A 1ZP6A 3CLVA 4PC2A 2ZVPX 3R8CA 4L15A 2HV8A 4HZIA 1T8UA 4B6FA 2J3EA 1W0KD 2J9RA 3OEHA 4LYJA 4WZ6A 2IWRA 3RVBA 1R5NA 2DBYA 4MYCA 4LJ8A 3QIAA 2IS1A 1V43A 3GLHE 3RLFA 3NH9A 2J7PD 1G7RA 3IO5A 3T1OA 3AH8A 2IEZA 4QG7A 4A0GA 3LY5A 4JL5A 1YZLA 4DT1B 2Q3MA 2J5XA 1NVUQ 3CW2A 4QGGA 4WAUA 2GBLC 4QL3A 4ZKEA 1JR3E 4GSYA 4OHXA 2BDTA 4ZCIA 3H0KA 4B2LA 4Q9JA 3TVTA 1M34E 2R6GA 1GVNB 3AV0B 3B1XA 3SJZA 3NIBA 3QXSA 3T1TA 1HUQA 1NSTA 3B13B 2FSHA 2OG2A 4YQFA 1JR6A 4JZKA 1ZUNB 2JLYA 3AUYA 3SJCA 4KYIB 4B34A 4OJKA 2VQSA 4QJ3A 3BXZA 4I99A 4B3FX 3X1WA 2B8TA 2QI9C 1UKYA 2WSSA 2JIZA 3TQCA 2IBMA 4TQAA 2F6RA 2L0XA 3ZS9A 1W36B 3TQFA 4OQXA 2V7QA 3PEUA 5EP1A 1JBKA 1NMYA 3WY9A 4UXJA 2HYIC 2VHJA 4JMPA 3TK1A 4HLDA 4C9BA 3GLGE 4ACBA 1FQKA 4AC9A 1E2EA 4ZV4A 5HKKD 5BW8A 1GILA 2P65A 2IYUA 4UJ5A 2J7PA 2ZPTX 4A8JA 2VBCA 1KKLA 4DDUA 1GNPA 5JCPA 3BWDD 2IYQA 3PCRB 4V0ME 3B85A 4GP7A 1VCIA 2G1JA 4GPTA 2XXAB 4WBSA 1Z0IA 4NYMR 4A4DA 2EYQA 2PT5A 1XMJA 5DYGA 1MO5A 1NJFA 1GTVA 5FPYA 2AWNA 4ESHA 2XGJA 1TMKA 2DHRA 3FHOA 2PH1A 1WQ1R 3GJXC 3SZRA 3H2YA 1J70A 3EZ9A 4KVAA 2J0UA 1VCMA 1QHIA 3AM1A 5DN6A 1IXSB 2V6IA 4W7SA 1TTTA 1HURA 3LX5A 2W6ID 1VYUA 1OIVA 2H1LA 2BBSA 2LKDA 3HYRA 2NPIA 1W0KA 1XD8A 2Z0MA 3OF5A 3RHFA 5SZIA 3ZQ6A 2WICA 4BLOA 3VHLB 2NO1A 3BH0A 4B44A 4EPXA 3FB4A 4I1UA 3IPYA 3U44A 3AVXA 1FP6A 1JEEA 2C9CA 2JJ1D 2ZRDA 4L9SA 3EG5A 3IHWA 3R8FA 1NG9A 3UG6A 4F4JA 5J40A 1E2PA 3R20A 5FTMA 1Q20A 1G8GA 5KSOA 3JZAA 2YWHA 1XRJA 1W0JD 1TPZA 4QGHA 5AWFC 5JCZA 4LV6A 3GJ4A 4EDHA 4UXHA 2OFXA 3SYLA 1KMHA 4XVQA 2GXSA 2FFBA 1IHUA 1NI3A 3Q3JB 2OFOA 3CX8A 5F98A 1BIFA 1OXUA 4NMMA 5KYKA 1C4OA 1BOFA 1G5RA 1FMJA 2PBRA 3RS0A 2OZEA 3IO3A 2WVJA 3CZPA 4K8OA 5TVKA 4LHWA 1OPXA 2BVNA 4LY6A 2KI5A 1MR3F 1RRCA 1G8PA 1ETUA 1YRBA 2ZI6A 2XOKD 4KHZA 2BMJA 4C0JA 2JIZD 1ZUHA 2VIIA 4WXRA 1BMFA 3WRXC 2GTPA 3WMGA 1Z6AA 1CR1A 2HYDA 3HR8A 3NEYA 1NBMA 3KB2A 2A9KA 3ZGXA 3PUXA 1Q1BA 4LJ9A 5JRJA 2QBYB 2JLRA 3E70C 3V4FA 5CJPA 3H86A 3SDZA 4RD0A 5H70A 1CTQA 4JVLA 5E7JA 3K8YA 1NKSA 2ZI4A 3ADKA 5J4YA 4CIDA 1ZC4A 1F2TA 1Z0KA 3TMKA 3VR6A 3WYAA 1MRSA 4KSBA 4IDNA 2PEZA 1B0UA 4L8GA 1J2JA 2VEDA 4CGZA 1GNRA 2CK3D 4X8HA 3KXIA 4D82A 3BH6A 3CO5A 1QDEA 2GCOA 3C16C 3RAPR 4GNKA 3DVLA 3THYA 3PEYA 4XD7D 2UKDA 1JXOA 1P62B 4M1TA 1W44A 1XEXB 4OQFA 3VR3A 3PENA 4IVPA 1QG4A 3SQWA 2A7QA 1DOAA 3MAAC 4YXWD 4Q1EA 4TSFD 4ILEA 4P4SB 4LV8B 5A4JA 2RCNA 4PC1A 1G3RA 4IEEA 5J5CA 1FNNA 5DN6D 4PQRA 1JALA 2W0SA 4B73A 3SN6A 4LI0A 2WJJA 1XEWY 5GJCA 1UBCA 1OKKA 1YRAA 3CB4A 4I81A 4TMXA 5HE8A 4C7OA 3QUSA 1IONA 1DE0A 2ATXA 4POAA 2SHKA 3VTKA 2TMKA 3NBYC 2B7CA 4V02A 2XOKA 5G3ZA 4A0FA 1KDTA 4M8NE 5G40A 2OM2A 1Q21A 2IHBA 4WXPA 2WWXA 1H65A 3JVVA 1JQLB 2JJ1A 4JVMA 3X1DA 4B3BA 3K0FB 2Q9BA 3TW8B 5HE9A 4AURA 3W3ZB 3U7GA 2WKPA 2F1JA 2CHGA 2ODNA 2IYVA 1NIPA 4A0RA 1IAQA 5UKDA 4MKGA 4OI4A 1TUEA 3GLIA 1W0JA 1AA9A 3BAFA 3U60B 2GXUA 3ZD7A 1XEXA 3M6AA 3BBPA 4Q48A 5CIWA 5DLQC 3R9WA 4OK5A 1AN0A 1JXMA 1RRFA 3AVQA 4IJMA 1CLUA 1N0VC 2O0KA 2DFNA 1QHHA 2XZPA 4BPBA 4X8MA 3C15C 4URYR 4IEIA 5L8VA 3QVUA 2XNDD 3U3OA 4JVNA 3KQKA 1COWA 3AVTA 1KDOA 3LH5A 1SXJD 4XD7A 5EE0A 2WPDD 1KMHB 2VH5R 1OYYA 2GEUA 5B57C 4M0LA 2X1VA 4A6PA 2PX3A 1J7KA 1KO1A 1VCOA 5ELXA 3THWB 5EXPA 3UIEA 4C2UA 4PANA 1L4YA 3I3SR 1R7RA 3LBIA 4LV5B 1N0WA 2BKEA 5KHOC 1KI9A 3AF3A 4JLVA 2WWGA 4XSGA 3MWLA 1CR2A 4HAWA 2IC5A 2QMEA 3SS8A 2O0HA 1J8MF 1FOEB 1Q57A 4ZI2A 4M1SA 1F60A 1OKKD 1XMIA 1T8TA 1OFIA 2FU5C 3ZDQA 4B43A 4WVFA 1E0AA 3MLEA 3HU1A 2CHVA 1KO4A 4PSAA 3C14C 2JJ2A 2X77A 2H5EA 2REBA 3IKJA 3PUWA 5AJZA 4DRZA 2BBWA 1EFUA 3NH6A 6Q21A 4EPVA 3CNNA 4ZCLA 5TXGA 4AYWA 4P4UA 4BUJA 421PA 2QA5A 3QF7A 2JLSA 3LQQA 3PXGA 2RKOA 1XCPA 1QG2A 4HLQB 1D9ZA 1FX0B 1ZMXA
chains in the Genus database with same CATH superfamily
2WSIA 2YV5A 2WUVA 3BGIA 3O8OB 4KACA 2OHJA 3E5NA 4EENA 4B3MB 3ECSA 4QJ4A 4Q1CA 1E1LA 1KEPA 4MWBA 3A6ZA 3RIMA 4BU1A 2CDRA 1ZHOA 4ND4A 1ZIOA 3IP6A 3HEAA 3HH8A 1ACMA 1O95A 3INGA 2A9OA 4OL0A 1JU3A 1WETA 2ZBUA 3MAJA 2VUHB 1RXCA 1OUMA 1ZCFA 2IW1A 2FMXA 2Q9AA 1DDOA 4L9WA 4WERA 4YCDA 4CEHB 2YWRA 4F1KA 3RANA 2ZAOA 1W73A 2OCLA 1NM5A 4RV5A 5TR9A 2PS9A 4L5YA 3H8VA 2UAGA 2Z1DA 2QU7A 5IF9A 2A7XA 5TMEA 3WMFA 1K9VF 4FIDA 4I1RA 4H7FA 4IMPA 4F38A 2GCNA 3ZW9A 5JYEA 4ZCSA 4LXUA 5CFNA 5B3AA 1E61A 4BGUA 2VOJA 4TT8A 3I37X 4JLBA 4AG6A 2H4WA 2HXSA 4YCNA 2XNCA 4PR0A 3MW8A 1XJQA 4LXYA 4IXTA 2H63A 5K8TA 1WCXA 2WD9A 1A88A 1KQOA 4M1EA 3EDOA 4EMSA 2AR0A 3MINB 5ARBA 1Q11A 2UUAB 5B2EA 4FOOA 1Z88A 4X62B 1PNOA 3IJ5A 1Y6ZA 4YJ3B 1OX4A 2AEEA 5G1NA 3LDGA 4Z4GA 3AF1A 4XLZA 4GMXA 1BHJA 2ZVJA 1EEHA 1KI2A 1DBWA 1MO4A 2BLLA 4E5VA 3U49A 4C1NA 2WIFA 4MVJG 3N7AA 1HORA 4OHOA 4NG5A 2FR8A 3NTLA 3OEHD 4Q7LA 3QY9A 1PFKA 3WLJA 3HU3A 4EF6A 4CIWA 3SM9A 3QKTA 1LS1A 5JAMA 2BBTA 5HK8A 5I9NA 2OV1A 2QYTA 3QKWA 1K7XB 1SCUA 4ZOCA 5SZKB 4QDXA 1P4JA 2ONJA 3V9AA 2OZLB 1XLTC 4Q3AA 1QO7A 3JAKA 3IAS1 1K2VN 3L6CA 3I3OA 2KW5A 1KI1A 1CDOA 1NVDA 3KR9A 2G77B 3CEJA 2BBOA 1QVWA 4K46A 2AZ4A 4R2KA 4GICA 3WGTA 1NYTA 3UUWA 5ECDA 1E2BA 3ZJVA 1NJ8A 2WE8A 4DC9A 4GZ3A 1P91A 3C7DB 1L1RA 3EG9B 1U3FA 1QYVA 2QQ0A 3Q11A 4QDTA 2CEKA 4M9ZA 1JFRA 1N77A 2PL3A 5GP1A 1HT0A 1KH3A 4TTQA 3W9UA 4AXXA 2DCMA 4FE3A 4XGQA 3KYCB 1R6BX 1TRHA 3TKLA 4QOJA 2WLSA 2O2YA 4L6CA 5BR4A 3BJIC 1XZDA 4Z2YA 5FWNA 3CGGA 1MO6A 2H1SA 3TGWA 4P32A 2PLFA 3EARA 2RGYA 4B33A 3T7RA 3ZQ4A 4EWLA 4HDNB 3GP5A 4YAOA 4FOLA 2DFKB 2AOWA 2Y0EA 1QGUB 2OAGA 2DUWA 3L7KA 1BTOA 3Q7TA 3WJAA 4M8IA 1IWBB 1K68A 1VYTA 3AB3A 1NVAA 2AG8A 2PL1A 3I30X 5HFAA 3PEEA 2VPIA 2PT9A 3P9QA 3SCZA 1E7WA 4BCDA 4KFTA 1FJ2A 3HLTA 4PHGA 4URZR 1K2WA 2QV0A 1IL0A 3IIKA 1KMCA 3QXJA 2ZJ3A 3PYXA 4W8OA 3SY8A 1XA0A 2AK2A 2WJ6A 2FSVA 4YB8A 4DY4A 5LN1A 4GOJA 5BWBA 1W46A 3ANSA 2ZYTX 4IJQA 1APBA 1Y6RA 2CHFA 2OZVA 3DZ8A 3LAWA 2RH4A 1CEQA 4WCFB 2W4QA 4EZBA 1YO6A 1A4XA 5DYYA 4QIHA 3KTAB 2H2DA 5FWAA 4XUDA 1EXVA 2D54A 3HXPA 4X1YA 2EEZA 1KJYA 4ARBA 3RVOA 4M6WB 3O93A 4Z49A 2Y1CA 3K5IA 4ZO4A 4DZZA 1PG2A 3EGDB 3K35A 5KYTA 1GZSA 1J2YA 1XVTA 2L69A 1Y89A 1MHTA 2I6GA 4P2GA 1HYGA 5D86A 1DAOA 2X22A 1M5UA 2ZAMA 5DHQA 4Y2YA 4G0WA 3UMRA 3QPAA 4BV2A 1Z26A 3IUPA 3O8DA 1QS0B 1FLDA 3KNZA 1NVVR 2FPIB 4Q1VA 4LJLA 3AUKA 3H1AA 1B43A 1L5SA 4R5HA 2HTFA 5BR7A 5HOEA 1KY5A 1AS0A 2A1TR 3EXFB 5FWDA 4MO9A 4WJLA 1YCDA 3CNQS 2CXSA 4NCXA 2O54A 4E2WA 1AG9A 2QXTA 1A9PA 3R7WA 2QPOA 3EGCA 4LPKA 5KAMA 4PG5A 4BGVA 3VX4A 3ZIAD 3TQQA 3PPXA 1RIIA 2E5WA 2EIHA 3AR4A 4AI6A 5K0EA 3Q9UA 1TCVA 1GQYA 1XYYA 2C20A 1IN8A 1HDRA 4CF3A 2ODTX 2JLQA 2YY6A 2AQKA 1JN0A 1G3UA 4ZPJA 2WSYB 3B2EA 1JH8A 3QWBA 5FAXA 3H4VA 1K5PA 2R25B 2JBHA 2XI4A 2C57A 3K5PA 3NT2A 4GXNA 4NMXB 3UGKA 3TQHA 5A6SB 1KBQA 4FKZA 3X3HA 4D56A 1EK1A 4YX9A 3E6AA 5CLLA 2B94A 3PPYA 5BOSA 2XSZA 1CXZA 3ETCA 1NLUA 2ZREA 2E37A 3H65A 4B4OA 1CVIA 1RJWA 4HH0A 1E1CA 4RH1A 3SIXA 3NORA 4Q7EA 3UFBA 1BX3A 4UBIA 2VYCA 1QIIA 3A3NA 1U8ZA 3DO6A 4WK6A 3T4UA 2M6LA 3QQPA 1O2DA 3GXBA 3VU1A 1MTOA 2N46A 3IFSA 3MRVA 1P9OA 4RIEA 4KVFA 4PFJA 3HXMA 2Z43A 2KE5A 3H2SA 1TAQA 4OP2A 1SBNE 3W2FA 5ABPA 3V32A 1FXWA 1F0KA 3IVXA 4QRIA 2IHVA 2XMGA 3GW8A 4H35A 1KSJA 4HDQB 1T13A 4TMTA 3OKCA 3CONA 1WQ3A 5DM60 4B47A 2NM0A 3EMBA 1JSXA 4ZU3A 3A26A 2JAHA 1NI4A 1Z2OX 2I2DA 5L3RA 1N6PA 1XJ0A 1EBUA 2VNAA 1XBTA 2V6FA 3T7CA 5FTKA 1RXEA 4RTKA 1Q6YA 1XNGA 2D13A 4H7PA 5LBIA 1GWNA 1YIAA 4RKEA 5C8XA 4IDAA 1XAIA 5F1YA 3S4YA 5EIHA 3K9LA 1G4HA 2DQSA 4L4ZA 1AQJA 1T5LA 2P62A 3E4DA 2IX3A 1D1QA 4JSYA 1QNFA 3T7IA 1QH0A 1JIUA 2XLBA 4B1FA 1OR8A 1VL6A 5HA5A 2R87A 3S2UA 1XMSA 5INTA 1JB1A 1WCV1 4Q6BA 3QI7A 3UUFA 3WL7A 1EESA 2J1LA 1JGTA 3O4JA 5EE5B 1E7MA 2B2NA 4MI6A 5G3YA 3CX6A 4HRVA 8MHTA 2B7BA 2B61A 4V0RA 2ZR7A 1PQUA 5CCDA 3S1AB 4EB6B 4BMPB 4TS9A 1S4MA 4UNNA 4DNFA 2Z6VA 4AKEA 3PEFA 4PHTA 5BWNA 1VLZA 2R62A 1KVTA 1SXHA 5E9WA 1CT9A 2GK6A 3DEJA 2RIPA 5DTMA 3SYNA 4MKFA 3KAKA 3AVOA 4DIFA 1XWIA 4N5MA 1XRNA 3B82A 1SG9A 2IU6A 1SWWA 2QMZA 1R5JA 3F6BX 3NC4A 1V7QA 5B4VA 1A97A 1K4KA 2GH1A 1JAIA 1OX5A 3TJZA 3WRYC 3NYRA 2ZQZA 1TX4B 1ESDA 3HC7A 1E2GA 2ILTA 3ZY6A 2IOHA 4YXWA 3UJPA 2XODA 2UZ4A 3E27A 4MITA 3BTVA 1ODIA 4NPAA 4XLLA 3W9BA 3NTQA 4AKSA 4P2BA 5A0FA 2ALJA 1N9GA 1PO7A 3PJEA 1PZHA 3HVIA 3LBFA 4K8RB 1VE3A 1SJ9A 3KUXA 3EW9A 5KNDA 3VPCA 1L6IA 4YRZA 4V0MA 4CG3A 3GLIB 1Q7GA 1SVOA 3AB7A 4CM9D 1UAGA 1M1YB 4JIGA 1N1GA 1UH5A 4K3UA 1T4GA 1RYBA 4QO8A 3W7VA 2E5FA 2XNJA 3CQ9A 4GZ5A 4J16C 4WOKA 3F96A 1Y5NA 4JBGA 2O14A 5IM4A 1CR0A 4LZZA 4JB2A 2WVGA 1L8AA 2QE7D 4OKIA 3H5NA 4GR5A 2QXYA 4M4SA 5CAEB 1VKJA 4P84A 3GLRA 4X00A 4CV0A 3Q8LA 2QTFA 1VA4A 3A6LA 1F7VA 5IG2A 3SBDA 1ONPA 1AKYA 2OB2A 4GEGA 1XC7A 1PZNA 3GVCA 4NCJA 5KIAA 1T36A 1TPYA 2A35A 1VDZA 5GGYA 4DQVA 1XMOB 1SBHA 2VUUA 5IK2A 2VF7A 4XKJA 2C4VA 3B7GA 1R8JA 1F8XA 5JWOA 1J00A 1YFJA 1GGJA 2XQVA 3O3NB 4F2WA 4WEOA 1EZ4A 2GETA 3U1VA 1EFDN 4KODA 3IB3A 1HWYA 3PXXA 1FDWA 3WHPA 3ZWVA 2FW7A 3UAGA 2Q3FA 1MX1A 2CE2X 3W4JA 1LX6A 3F8SA 4WNIA 4N5HX 1XTTA 1IY1A 3DZCA 2XA9A 3I2JA 3ZWNA 2X6TA 3WGGA 1HK7A 1VCNA 1KYTA 3OHPA 2FP4B 1AZLA 1USIA 3O82A 2M1XA 2OXCA 2QT0A 3OAAD 3WTBA 2VYFA 4LRXA 2ZTMA 5IHPA 1G8AA 1L8XA 2CLEB 5DYTA 4L0QA 2ACEA 4EI7A 3T5CA 1RT9A 1N7JA 3F0TA 3VYSB 3WIVA 2XDAA 2WA1A 5CA1F 3PWTA 3GAZA 5CLJA 3DXYA 1VSQA 3GLFB 1YU6A 3KQHA 2G4VA 5IUKC 2P7IA 3KB1A 4G8CA 2LWIA 2W2VA 2NXEA 2VG8A 1EDOA 1DX9A 3GLGA 3BXEA 1VXRA 4HQ0A 3IQIX 4I5EA 2GJ8A 3KWLA 1K4YA 2A0YA 7REQA 5A3JA 2YZ7A 1QQ5A 2B4TO 2VPQA 3CF6R 1OT3A 4GX0A 4RZHA 4BX9A 1J0EA 3BGVA 4J7CA 3EIXA 4PS1A 2A8YA 2FE4A 4XWKA 4D98A 1AGYA 3IOEA 3UA3A 2LE0A 5BN1A 2A84A 3WMEA 4DEVA 3D2CA 4US2R 5KDOA 2G9VA 4S1NA 5JAIA 4XJTA 4P5PA 3CTMA 1WXGA 3SLKA 4LMBA 2ZSEA 3A3PA 3DF7A 1RPTA 4NONA 3WB1A 4A8HA 2H5JA 2F00A 1QRRA 3ANTA 2G72A 3B1VA 1PT7A 3FOAA 5E8JA 1Q0UA 3A1DA 5JS7A 4MGHA 1P3DA 3R7FA 4DS3A 1N7IA 2O7SA 3BGSA 4G84A 2ZZMA 1GNQA 4LHSA 4XARA 4Y6QA 2QMHA 2RGXA 4M0KA 4KZKA 5D3QA 3I53A 3EMDA 1GARA 3W5BA 4DR1B 3HVJA 5EVCA 1N2ZA 1DUIA 3CBGA 2NIPA 2VAPA 3MNFA 3N1UA 4JEHA 3WDLA 4DSOA 4EHBA 2GTHA 4F91B 1RHQA 3COWA 3LQ4A 4B6OA 1XT6A 1PDVA 1LBSA 5DEIA 5FR1A 5JSHA 4PZPA 4MWDA 2W70A 5GADl 1R9NA 2WKWA 2VCEA 2P9GA 1MN6A 1W5BA 1YL5A 1MDFA 1VLJA 2PFGA 3RJ5A 1XDWA 3A1FA 4WPGA 4CFYA 1E60A 1ZN7A 3SSAA 2VA9A 1NLYA 1Q0ZA 3H5TA 4MQLA 4QEKA 1JSLA 3EZ7A 3LG2A 1JJFA 4MW0A 1XPRA 1VPEA 4KR9A 4EKDA 2DE0X 3RYCA 1C9NA 3C74A 4PAQA 1KJ9A 4DMHA 4HGPA 2C5LA 1AXGA 1IQPA 1VLQA 3FKSD 1I3OA 4I9GA 4K26A 3MQ4A 4B4UA 5IK2D 1SIBE 1GYRA 2O3TA 1WOYA 3LKZA 4L5JA 3NANA 4FQ5A 1JLRA 3GCGA 4LISA 5C32A 1UWKA 2XADA 4C0SA 1N2JA 4PFQA 4TYNA 1YJBA 3TO5A 5EZSA 3CKYA 1GKYA 4EZEA 4YLYA 4P8RA 2YCLA 4IIBA 3O4GA 5K0TA 1ZU5A 1XVIA 4EHJA 4LHXA 4P6VF 3EQ9A 3VZQA 1IATA 4ARCA 3PGA1 4X90A 4AO8A 1CKEA 3FBWA 4ZVKA 3HLKA 1X7ZB 4Y6PA 4B17A 4B32A 2OCAA 2PKWA 5K3CA 1C0LA 3I4FA 2HL6A 2ZJ4A 3Q3VA 1NMQA 2Y05A 3P5SA 3SZUA 4Z1MA 5KYUB 4GKVA 3GJ6A 5FBKA 1WU8A 2C94A 2RDMA 2O2SA 4HNHA 5C18A 2BFEA 4JXZA 1H9BA 3C3EA 3PEWA 2OFPA 3PHCA 4OI0A 3V4SA 4UDOA 2H0RA 2R8YA 1OH5A 1GFIA 3DFMA 1K06A 3FWPA 3J7AC 4M9UA 1P7YA 3ITKA 1OPRA 3B6ZA 4AKTA 1V8ZA 1I30A 4D25A 3GWZA 2ZBRA 4W5TA 3EVNA 1FC0A 5I4KA 5ES3A 2IW3A 2Q4OA 3I83A 2Z3VA 4RWZA 5JNRA 3ET5A 4XD2A 2EKQA 2K7ZA 5CT8A 4FB5A 3ROPA 3WB0A 1R0XA 5FIUA 2WE7A 3NBZC 4EL5A 5ALWA 4PTLA 3ZTTA 1JT9A 3PS9A 4XCVA 5PNTA 2LIVA 1G4UR 3TIFA 3LPMA 4MZDA 1WKVA 4UUBA 4ZAVA 2VUSA 4H7JA 4YWJA 2WMNB 1C1XA 1WM1A 3AERA 3JQ9A 5DHRA 3LLMA 2FPMA 2E2WA 4XDHA 5C53B 4PY2A 2Q2NA 1A8HA 2EJBA 3ONNA 4ITRC 1XXHE 5ADWA 4D9KA 1QP8A 1LK7A 1KK3A 1U5AA 1K27A 3TECE 3KLOA 3OP4A 2AK3A 1M2WA 1KMQA 3H9JA 5L3ZA 1I2MA 3AONB 4RA9A 3P20A 3T1YB 2RI1A 2FRDC 4LXQA 4ZO9A 1VQ1A 1LI7A 1YZGA 1D4FA 2AEJA 3QK7A 5LDGA 5IDWA 2QRVA 3DEKA 4LPSA 5IDYA 3BYZA 4YCAA 1W88B 3G8DA 2HAEA 4NRDA 3ZV3A 4KO8A 1GCOA 3JWEA 3P7MA 4DUPA 4EHLA 4X8HA 2FNAA 4D74A 1ORDA 1Z22A 1P1RA 1W5TA 2VT6A 3C4QA 3WWZA 4G0VA 1ES9A 4LJ4A 3LSYA 4TTIA 4HNSA 5AKYA 3HY4A 4H60A 3QFSA 1DAGA 1SEVA 3DOIA 5ADUS 3MGBA 3VU3A 5DOVA 1MC1A 3O6VA 3VBEA 2JI6A 3RCBA 2E0IA 2OC4A 3TINA 3CKKA 3OZIA 4OI1A 5JYBA 4DUZB 3FHTA 1WCIB 3AEZA 3W9SA 1NR1A 3OWXA 4KGXA 3A25A 1WTAA 4I4NA 5CVJA 3RUDA 1YZTA 1OU4A 1XTJA 1RPNA 4LZLA 2VCYA 1U9ZA 1L5VA 3GG9A 5IVHA 3ULKA 1DFIA 1M54A 2FZGA 2GAIA 3PTZA 4V1CB 5A4IS 2ILVA 1U0HC 3Q10A 4IDFA 1JFVA 2J0QA 2RGUA 1H94A 5AESA 2WM2A 4YAGA 4EQ6A 1GGVA 4NI5A 3U9LA 5IN5A 5ITZB 2XE6A 3AEKB 1O8BA 3ROXA 1K5HA 1GEGA 1A2QA 1PV1A 3H4IA 2N9UA 4NHOA 4AWXA 3FH0A 3LX6A 2W93A 3I2FA 1ZVJA 1MW8X 1J1UA 4YPOA 1WZNA 3P71T 1WUYA 3LDFA 2CBXA 1TUIA 2HD4A 1R6VA 3BOSA 2OE2A 1KF0A 3EHDA 3MOSA 3KSZO 1BHQ1 3SEAA 3WG9A 1OWPA 2IEDA 2HQSA 3D7SA 4PO9A 3ECCA 4V0OA 4ZT7A 3KPWA 5TGTA 2OFFA 3TSYA 4JYPA 1ACJA 1GRCA 1KVUA 3OMXA 4IP0A 4KQKA 5EE9A 4DUGD 2NACA 2Z1MA 1T2FA 3CRRA 3N39C 3M3DA 1SC1A 2VP6A 4Z1MD 1QJCA 4MMZB 4ND8A 4R1PA 4DR6B 2VZLA 2PEYA 3HYLA 1VA5A 1H2AS 1HDGO 1JG7A 1R2QA 3M6MD 1VB5A 3ZEIA 4M37A 3EVBA 4BTVA 3ZX4A 1JFSA 3O8RA 4RTNA 2ZWOA 2JANA 5BSWA 1YQUA 4ETMA 4LHYA 3ZHOA 3AZQA 4UBNA 5K2OA 2JLUA 3C3KA 2BI8A 3D54D 1CUWA 3VKGA 1E2LA 4LHZA 2B1JA 1G21A 4FNOA 2GHRA 4J3JA 1M75A 5LMNB 2P6NA 2WSBA 4D3SA 1G2IA 2XWBF 3Q6NA 2WYIA 2AFIE 1QAOA 1L3IA 1Y80A 3A28A 2ARKA 2GILA 4RFVA 3QW4B 4A0QA 2AZMA 4KPFC 4CETA 1X1RA 2HWKA 1VRCA 4BJHB 4B3RB 3HKCB 3WLPA 1C7EA 1IBLB 1UK9A 3K73O 4MZXA 4G5XA 4Z7JA 4UASA 3OZEA 3A1NA 3P26A 2P78A 4HH1A 1QGUA 5EE1A 5J3JA 1PJQA 4IRUB 4J6EA 3ZDXB 4CV3A 1BJKA 4TWBA 4F6CA 4OEHA 2PUDA 1U6KA 4KPUA 2B21A 2JGDA 4Y6SA 5CJJA 2XKJE 3ZHSA 4B85A 4E5MA 5BXYA 1LW6E 2W6OA 2OHXA 1ZCZA 1FS4A 1CZUA 1LSUA 3ZE6A 3MRSA 4QOGA 5KOIA 5MF6A 1CIJA 1HQYE 5H3CA 3IT3A 4J4HA 2V6GA 3RRYA 1XOIA 4EVQA 2FDRA 3IUYA 3QMMA 3G59A 4C2BA 2WIBA 3HB0A 1U3GA 3L05A 3GFQA 4O25A 4TWAA 4YCLA 1EE9A 3WO1A 2I4NA 3H75A 4MW1A 4MH0R 4WESB 4J90A 3TNJA 2O8BA 2PNJA 4HYYA 3BXFA 4X1IB 3IOYA 1L4GA 4ZAYA 4UQLA 4TYWA 2B2CA 3AU9A 2XUAA 5CXSA 2EF1A 1WP4A 4OQMA 2BRUA 2QMYA 1RWPA 4DQDA 1L5QA 2ZI7A 3HJBA 4PZYA 2WTBA 4RPKA 4RESA 1U0TA 4OIFA 4KCGA 2HBQA 3CPEA 1QLJA 3CZRA 1JWLA 3SEQA 5KYNA 1WNTA 4INAA 4BWYA 3BMNB 2IPOA 2XAAA 3JZMA 1UWVA 4HWTA 5FEMA 5KYGA 3LL7A 1OA1A 2NG1A 1BFDA 2XT0A 3THRA 3TMYA 1A50B 4ENRA 2HF7A 1NF8A 3S2IA 4BEVA 5FOSA 5IZCC 5DULA 5LU9A 2P5TB 2PX6A 4UEOA 1OH6A 2YKGA 1HV8A 1JAYA 1OWLA 2AXEA 1R4MA 2R6JA 1KVSA 1WF3A 4L7QA 4Y98A 2XA1A 4DSTA 1X3LA 1SHJA 5SZHB 3VHRA 3WV5A 5MFPA 2WP0A 3FCSB 4JLWA 1H0KA 3ETJA 2KSQA 3FPBA 4NDZA 3G0HA 4NCHA 3L4EA 4ND5A 4PC6A 5P21A 3AY3A 4ZIRB 3EZLA 3N2KB 1SBIA 5AVZA 3DS8A 3UY4A 5AK5A 2N3ZA 2IBSA 2NYRA 2O8BB 4B7XA 1UC9A 2IZ6A 2O2IA 4U7TB 5JNLA 1QE0A 3AIKA 2YXEA 1EVJA 1ZD1A 1P80A 2HNAA 3BCUA 5DXJA 3W77A 3VZPA 4BWGA 3GFVA 1T0IA 1E79D 1V9SA 2HU5A 3AQ4A 4L95C 4QUAA 4YP9A 3UPTA 1AV7A 3NHJA 4N0EA 3VDQA 2PLAA 1QORA 2EIXA 4RF3A 1AO3A 1DAIA 2Q5IA 3IBYA 5I7AA 3NDPA 1J8VA 1CP2A 4JASB 2PRJA 3D8TA 5A1JA 3NTOA 3P9YA 1M2KA 2H9YA 2JFQA 4P3XA 3VNAA 1UDBA 4N40A 2D7JA 1GL6A 1O95C 4QGSA 2AQHA 3GFPA 4L78A 1I13A 4YYZA 1AQYA 3R5XA 4OGFA 4S1VA 1RTKA 1R0YA 4H08A 1AUOA 2OOSA 5AW5A 4DCSA 4QLBA 4FDMA 3P0EA 2MMCA 2XRMA 3IP3A 3PUHA 4DQ0A 3DWGA 3CVVA 1YL7A 1E62A 5DIFA 3LX4A 1PFGA 1R6TA 3L06A 3ROTA 5EYPA 5JW6A 1MB0A 2QDXA 4UNRA 1DAKA 2AFRA 2BDEA 2J9FA 2QRUA 1NJ6A 1JDNA 3DOHA 1RCTE 2W8BB 4QNRA 2FZEA 3LYHA 2ZRNA 3NM6B 4U9IS 4KWEA 2Q3BA 1KVQA 3FA2A 2GUGA 2D74A 3ZVNA 2AR9A 3NT4A 4CEHA 1ZK3A 1R3UA 3AEUA 1I6KA 1QKJA 2OD7A 2Y93A 2BGJA 2ERCA 4PX3A 4NCIA 4TUYF 2VDOB 3E5RA 3F49S 4KMOA 4OHCA 3SSMA 4B35A 2AXQA 2OCBA 1OAOA 3VTZA 4E32A 3PC3A 1V5FA 3WLFA 1GQOA 1V8BA 1QVRA 1ZLYA 1T24A 1VLMA 2V54A 2N1BA 1XA3A 2DY1A 2CBZA 2RKWA 4G5FA 4IH9A 4UQPA 4HNUA 4BIMA 2QTZA 4G89A 3QX3A 1DTSA 1EQAA 1ONOA 2PD4A 2P4EA 1KFBB 4RD2A 5FLXA 2FEWB 1KAGA 2E9SA 2X4IA 3CUYA 2OKGA 1YAHA 5EOVA 5LQRA 4HAVA 1PR5A 1VG0B 2XNSA 2I2BA 4P1ZA 5AHKA 5BSEA 4L5AA 3U9TA 1W4CA 2F8SA 5CA1B 1VGQA 1OWOA 1VHWA 1U31A 2RGGA 4ZI7A 7GPBA 5IH7A 3QFRA 4FMDB 1D6NA 4XFDA 3NP7A 5DHFA 3D81A 3LK6A 4KQEA 2HJRA 4X3PA 2RK3A 4C6TA 3PC2A 2TSYB 2E4VA 1RACA 3DR3A 3OCYA 1BHSA 1Q1QA 2HMYB 1DBRA 1GZVA 1IY9A 5T4EA 4F92B 3FNRA 3X1MA 5CEFA 1ZKDA 5AVJA 2HV9A 3PFKA 4BMNA 4YUWA 1DRVA 3EEYA 5SY4A 3K94A 2V8OA 3NPMA 1SZDA 4FUQA 2C5SA 4PAMA 3WLAA 2FPGA 4HLCA 5KU7A 1AXRA 3BICA 4HNRA 4HVAA 3IAFA 1T6BY 1NF9A 1E94E 2I99A 2YY7A 4CXMA 1FNMA 1OQAA 1TW2A 1TL7C 2G28A 5TF0A 5IS2A 3HDJA 3IQGX 4JQZA 4BQQA 3NKVA 3ZQUA 1QHHB 1U8AA 1SUEA 2GT1A 3EPLA 3AHHA 2GPSA 4F9TA 4F45A 1JE1A 4BYGA 4B5KA 4M88A 1D09A 4A1OA 3MJRA 3BZWA 4LYEA 2ZI3A 4UW9A 4GI7A 4MDHA 4HWOA 3TCXB 4OCZA 3TQIA 3GL9A 3ZC3A 3G9TA 3I39X 2V98A 3NYWA 4EUKA 4OQYA 5CXXA 5A9SA 1TNDA 2OYCA 1RZRA 4DOMA 4ALMA 1N3IA 1YE5A 4CM4A 3L0BA 1H4TA 5IT4A 5KCMA 3L7AA 1PDOA 1N5MA 3H1GA 1EH5A 2FXIA 3RTEA 3H5WA 1QGAA 3LBNA 1CQJA 1T10A 2PZBA 4PYRA 4CT0A 1ZD9A 1TEHA 3SJAA 1MORA 1ANKA 3DHYA 3ZVRA 4EO7A 2C98A 4JLAA 3LWNA 2CVZA 4LBVA 2JD0A 1YDHA 3RD5A 4EM6A 1QS0A 1SPXA 3BORA 1Y6GA 4MA0A 2YZGA 2C31A 2QQEA 4FFDA 1LJUA 4A23A 1LTHR 2HDHA 3NGXA 1Y8ZA 1U3WA 4M49A 4NJMA 4D45A 4G4GA 1M0SA 5CHEA 5LZ9A 1HDZA 3I9LA 5ILQA 4IXWA 4G24A 2HLHA 3VYUB 3EC1A 4TGLA 1GV0A 1W5FA 1HYQA 1KFEB 1EK5A 3PNSA 1YK0A 5AICA 2ISSD 2XKKA 3L7BA 2LD4A 1ZEJA 3I9KA 1BE8A 4O4HA 1GUBA 1QYCA 4RO0A 5D6NA 3ZBPA 4BVEA 1RYHA 2H11A 2GN8A 1GNVA 4IMRA 4JL8A 1IJEA 1R9MA 3DZHA 3A6EA 4OBXA 1E9FA 1ZSNA 2HQOA 3VU9B 3WLRA 2R6CA 2PX4A 2Q8QA 2OYSA 3TI9A 1YR2A 3P8ZA 4HQLA 2BKUA 1SZPA 4N03A 5SY9A 1I8TA 1GA6A 1TJ4A 4L3WA 5FO1A 2YNMD 1AF4A 3M3PA 2J9YB 3T7EA 4C78A 5ELMA 3KQOA 3G1WA 121PA 2C5HA 3WSWA 1P5RA 1ZIYA 3EH2A 2XWQA 1FW6A 3OCWA 1RW4A 1TF2A 1VSBA 1N6KA 4BYMA 5KC8A 2GJ9A 1GZ5A 2OZPA 1T1IA 1T91A 2Z2ZA 2G36A 4IIJA 2XYRA 4K88A 4BV3A 5CA1A 2Q7OE 1N2CE 5J47A 4X60A 1SXQA 3MTBA 3RFTA 1Y0BA 1H66A 3AGQA 1BEZA 1D7OA 3C6QA 3JWHA 3JTMA 3N86A 3ZZMA 5JVDA 5AVWA 3Q0TA 2TRSB 3HKBB 5EWLB 1S6YA 2FA9A 2C2GA 4J1NA 4JT8A 4FKBA 2O7RA 3VR5D 4A6EA 1R8SA 2AMFA 4M53A 1QCZA 5AM3A 3PG5A 5I3CA 1NNSA 4O5OA 4GMHA 3QFHA 3KPUA 2M6RA 3B7PA 1RKQA 1KDVA 3A7EA 1WSAA 3EDMA 1A9RA 4N1AA 3R5TA 5HIAA 1WDWB 4CLHA 5JD5A 2XVAA 4ZZ3A 3R3UA 2I8AA 3FVVA 4Y2GA 1D1TA 4KLZA 5EHNA 1EGAA 1JG3A 2IOQA 3F5QA 1WXEA 2O2JA 3F74A 3HFJA 3M6IA 3L6EA 4H7IA 1X1DA 3HCWA 4FLEA 4OU4A 4QYIB 3TCNA 2K5UA 4WL0A 3R7SA 1E6UA 1L9XA 4J0DA 1RXYA 1FNDA 1JYEA 2O50A 1GXSA 1MJGA 3HE3A 4PO8A 4G1MB 5JNTA 4W63A 1AKUA 5BN4A 1BHO1 1ZONA 3DBLA 4Z9YA 1Q22A 3MUEA 4H7EA 3W06A 1NXOA 3OIVA 1E7SA 1AKEA 3CRQA 3X2SA 1Z5UA 4C5AA 4D8VA 4L72A 3UWPA 3NWBA 4AY5A 4E6PA 4DR3B 2P5SA 1P9LA 4L2IB 1E2NA 1JQBA 2FWAA 1T8RA 2LGJA 2Y6VA 4MW6A 1MZVA 2ZQ5A 4LOJA 5TQ2A 1LZLA 4ATNA 2DSTA 4K6HA 1OGIA 1DIHA 1SCQA 4UUAA 1HDIA 2EFHB 2IUTA 3DG9A 2CCJA 2AOVA 2ZRMA 4TN1A 4Z51A 1I36A 1LQUA 2ZRGA 4WY5A 5E1MA 4EA9A 2O0JA 1CNEA 3NZEA 5I9TA 3I1IA 1X77A 3KQTA 1VCHA 4C0BA 3DLHA 1YA4A 5ARDA 1D9XA 3RT7A 5K09A 1YCHA 1XXHA 4ZVRA 4B71A 4QXPA 3V2HA 3WR5A 2H4FA 2I76A 5F1OA 1MX3A 1R0ZA 1C4KA 4IW3B 3W6ZA 4RUKA 1FJGB 4WXMA 2JGNA 4I3HA 3QZUA 1WUIS 2FSGA 721PA 1EM8B 1KRHA 3D8BA 5E4FA 1E2MA 3QEMA 4MDYA 4PGMA 5E6UA 5A3RA 4J43A 4DJAA 1JSZA 1LK5A 3OZCA 3PRYA 1U6JA 1HA3A 2ZXUA 2EX4A 4H3HB 4YALA 1GN8A 3G7NA 4B09A 2VHWA 4IIUA 2BFBB 2I29A 3IVAA 2WINI 1ZI8A 3SLGA 3BD9A 3CEHA 1MNQA 1XFAA 4EGQA 2DCUA 3MGKA 4JJ6A 5IAOA 3G9ZA 4IHJA 4BNVA 3GDGA 1QSGA 1KPIA 2ZWIA 2V7VA 2VL7A 3I52A 2WYHA 2D1YA 4RSMA 1BCRA 5DSTA 1RYNA 4F21A 3NDBB 1NUUA 2EZ8A 1NMSA 4F72A 4Z86A 4GLJA 3JQBC 4K6GA 2J8ZA 4YO7A 3BFXA 5FWXB 1Q17A 2ZSIA 3I4LA 2O5EA 2WYUA 2RGAA 1SA0B 2I1LA 1N5JA 1T0HB 2Z5GA 1W48A 2OB1A 3AINA 3IERA 4WOCA 4G81A 3B3QA 3GT7A 4JQYA 3IOMA 4OPMA 4QJ5A 4RGQA 1T2UA 4RFSB 1IVSA 1NIJA 4R3WA 1M2OA 5K0BA 2D6FA 3SF0A 1Y9EA 1YBMA 1G16A 3JASB 1SZJG 3WYCA 1RMQA 2SCUB 3CMCO 4CBVA 1N3BA 5LOVA 2RHMA 4BQEA 3CUKA 2CNBA 1CHNA 4G1FA 1K7YA 3CG4A 2GASA 2E89A 3B3GA 3A27A 3OKAA 5TJHA 1Q15A 4M98A 4IIYA 4PPQA 2QEQA 1RYDA 2RIRA 2MR5A 3ICVA 4I2NA 2FG6C 2FUEA 4QAQA 1P1FA 1UZNA 1Z6GA 2WHPA 2YHIB 4DREA 4RS3A 1G98A 4RF4A 2H7CA 4KITB 2P5UA 2JGDB 4JS0A 3CSDA 4DLXA 1DLIA 4Y2UA 3KUDA 1FDOA 3I1YA 1WY5A 4GP6A 3KYDB 2OL4A 2RH5A 3STWA 4BNDA 1CZNA 4Q12A 3JRWA 5EIOA 2RHJA 3KV3O 3QEJA 4FVTA 1C7FA 4U2BA 3K6RA 4Y2QA 3ZGOA 1Z5ZA 1YGPA 4ND7A 2JAUA 4Q4AB 4DWWA 3JD3A 4B3CA 5ICEA 3OQMA 3DDWA 5LC1A 1GTG1 5EFOA 1UPXA 2ZRFA 2WU1A 4QATA 4DMRA 4Q02A 4Y9TA 2HEIA 3RDPA 1J9EA 1F12A 1IMOA 1SD1A 3AFMA 4AJ4A 3JQEA 5DP1A 4II2A 1QV7A 2G6BA 3C41J 4O1IA 4Q7JB 2BMAA 1K3TA 2K2QB 2NAPA 1XLWA 5E38A 1BYIA 5L7YA 1IPHA 3SE0A 3U0BA 4HF7A 1D2MA 2PQ2A 3TGPA 1W2GA 1Q1GA 3C6BA 4C5BA 1BVYF 5BQ3A 3SJ7A 1FPQA 3LT2A 1LW7A 5JO9A 4F0JA 7MHTA 4IX9A 1RKXA 1USGA 4GE3A 1CWUA 1S2LA 3M8KA 4MUMA 4TYPA 3DULA 3E5MA 2YV2A 5ILGA 9LDTA 1FLVA 2BFDB 3IUEA 1RPAA 4MW2A 4OB6A 1CF4A 2O8DA 3I28A 1E3SA 3VNUA 4Z99A 5FL7A 1GD1O 1T8PA 2IZ0A 3KXPA 5E7QA 4DR5B 1C1DB 5KTSA 2IWHA 3Q2KA 2ZT7A 1VG8A 4E0BA 3BFPA 2ZBEA 2PLWA 2JAXA 3OD5A 4NJMB 3GQBB 3RFXA 4LC9A 4C4AA 3O4RA 4CCYA 4II7A 2ONYA 2PQ0A 3G0IA 2FUKA 1C30B 1RKUA 2PRKA 3ACBA 2VPWA 1FUUA 4LRWA 2RGBA 4QDZA 4YV7A 1NOIA 1LX7A 3FWHA 1MJNA 2O2DA 2VJOA 5CXQA 4GC5A 1WHSA 1U8UA 3OX1A 4CMBA 3DO5A 1RS0A 4CGYA 4JI3B 4UU0A 5AQEA 4ODIA 5ERYA 2IPNA 3N9IA 3QNMA 3LYAA 1AK2A 1N9ZA 5BSGA 3CCCA 3VDMA 4NP6A 4JFAA 1RD4A 3AVPA 4QTTB 1VB3A 5EP4A 3ASVA 1MABB 3W90A 5IXSA 5JH7F 1X9GA 1SGWA 4R1TA 2WWWA 5KCZA 1F4LA 2J3KA 4KNVA 2Q8NA 4DBVO 4YQZA 2VRBA 3BPSA 3GP8A 2RH8A 3BX1A 4PYKA 4ZVTA 1L8OA 3S2GA 4DADA 3P2EA 3EAQA 1L7EA 1NN5A 2XCOA 3F5FA 4RANA 3L9WA 3N0RA 4YAEA 3WMRA 4MJLA 5BOSB 1TA0A 3MWJA 4UD6A 5EIEA 3R2JA 2P9EA 3TYXA 3WL8A 1DQZA 4Y8VA 3T12A 2PMWB 3QPWA 2CMGA 1OZGA 3KRTA 4Y1FA 1QDLB 3HU5A 3VGPA 2UV8A 5JISA 2ZJYA 1EGQA 4TLEA 1V3TA 1FMLA 1QOPB 1NULA 2PR7A 3C98A 3PWKA 1AZTA 1RU3A 1LQTA 4ML3A 3LU1A 4BE4A 4F8EA 4BLTA 5EIXA 3GD5A 8AT1A 3DE1X 1W9HA 3KHKA 3O31A 1P39A 2GPBA 3A9UA 4PYOA 5IVDA 5EJ8A 3QEAZ <