1WMSA

High resolution crystal structure of human rab9 gtpase: a novel antiviral drug target
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
174
structure length
170
Chain Sequence
AGKSSLFKVILLGDGGVGKSSLMNRYVTNKFDTTIGVEFLNKDLEVDGHFVTMQIWDTAGQERFRSLRTPFYRGSDCCLLTFSVDDSQSFQNLSNWKKEFIYYADVKEPESFPFVILGNKIDISERQVSTEEAQAWCRDNGDYPYFETSAKDATNVAAAFEEAVRRVLAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ras-related protein Rab-9A
publication title High resolution crystal structure of human Rab9 GTPase: A novel antiviral drug target
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 55
structure length 170
sequence length 174
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1wmsA00
2XTZA 3IHLA 1UKEA 1PUIA 1OIVA 4RKEA 4QGFA 5IK2D 2J5XA 2GXAA 4YMSA 3UMRA 1CEEA 1RKBA 1Q22A 3CH5A 3TSZA 5JS7A 3C8UA 1U0JA 3C7KA 3EWSA 4Q66C 1U8AA 4URXR 4CEJA 2BBSA 2R6FA 1W4BA 3C41J 1CR2A 1YQTA 2Z4SA 1DEKA 2DYKA 2RCNA 4PHTA 4QGAA 4UNNA 2XGJA 2WAXA 1GRQA 4UNPA 4DLYA 4PC7A 3LD9A 1T3SA 5TMPA 1XPRA 1NVVR 1T3HA 3AF1A 4BLPA 1P7CA 2C9CA 3TR5A 4PFSA 3NHBA 4B3FX 4IEIA 2WAYA 2IA5A 1L2TA 2IYYA 2JLQA 3ZZ0A 5JI2E 1GITA 1GILA 2QMOA 3VAAA 4D26A 2BEKA 1KI6B 3N2EA 2WJGA 3B13B 4PZLA 2YINC 3SBDA 4G5SA 4X8LA 2ZPTX 1JQJC 3SHFA 4E03A 1FNNA 1KSJA 1TADA 3GFTA 1OXVA 4TWZA 2X8AA 3IEUA 1NL3A 4FMDB 3LLUA 5HCIA 2CDNA 1COWD 4B35A 2VL7A 3LBIA 2GK6A 4L9SA 1OB2A 4ILEA 1WQ1R 3NKVA 1E2QA 1G16A 3PCRB 2QL6A 4N0DA 3KFXA 4JVMA 2FDCA 1IHUA 4MUBA 4YQFA 4AK9A 5KDDA 4BLTA 1XWIA 3AF2A 4DUGD 1TL7C 2N1BA 2QP9X 1TNDA 1VG0B 4RY2A 4PO1A 4K8OA 4QHYA 2FFAA 4JIMA 1QG4A 4QBFA 4BGDA 3CPJB 3CPHA 3B85A 2VP9A 1TQ4A 2YC4C 2FEOA 3FMOB 5DISB 2BBWA 1JPJA 2ATXA 2F6RA 3WNDA 3T06B 3SJZA 4LV8B 2QPOA 4LJ5A 2PLRA 4XVUA 1DAHA 4LYAA 5L3QB 4KYIB 4I1SA 3LW8A 4JJKA 1S9DA 3U3MA 3O8RA 2NO1A 1XBTA 4KO8A 4TQUS 4XVQA 2F9LA 3SC3A 5DI3A 3QBTA 3BK7A 2ECKA 2EFGA 2HDNB 4ITRC 3UXMA 1MKYA 5E3HA 4UKDA 4IOKA 1A2KC 4V0LA 5E7JA 3MWJA 5AJYA 3WXMA 4YMVA 1J90A 2GCOA 4NBSA 1UDWA 3EASA 3B60A 3D6TB 4L16A 1SKQA 1TQDA 1DPFA 3I1FA 4Q00A 2C96A 4PQYA 2ZAMA 2YZ2A 1U0LA 3R8CA 1WP9A 2J0UA 3BERA 4DT1A 2WTUA 1J99A 3W6OA 3PV0A 4PC1A 1F48A 3C4JA 1U0HC 1QRAA 5AJZA 1OLOA 4TYNA 3EARA 3A4NA 3KQUA 3PEYA 4LJ9A 4CRWB 3WMGA 4KSCA 1VKJA 1EFCA 3NVAA 4HAYA 4LDJA 2B8WA 1DBSA 4BECA 5C4MA 3AVUA 4RZXA 4E07A 2CHVA 3GJ5A 5B64A 2PMKA 5JECA 1R5OA 3IBGA 2FSHA 1OH7A 2IXGA 2O8FA 3L43A 2D74A 2E1RA 1OKKD 3R7WB 3A8TA 3VR5A 3LXRA 5FUWA 4QFMA 1OFTA 3QNUA 3A1VA 4TZ0A 2W2TA 4IXNA 1HA3A 1JR6A 3RC8A 3TE6A 1JB1A 3K8YA 4HUQA 5D3QA 2H16A 3GLIB 1JR3E 2F1RA 3QIAA 3PEWA 2XB4A 2H7VA 3U7GA 1NVXQ 1G3RA 3I8XA 3QBVA 3QVUA 4EFNA 3BH6A 1UBCA 3B9PA 3VMFA 3RDPA 1XEWX 4BLSA 2O0KA 1B0UA 1J2JA 1AZTA 1T8UA 5DIFA 5DYIA 3EX7C 3TAHA 3LXXA 2OESA 1R0XA 3VKHA 1MO4A 2QN6A 1S3SA 3QEOA 2ZETA 2FFHA 3REFA 2ZM5A 4NE2A 1W36C 5A0FA 1O87A 3HWSA 1NN1A 4F4CA 2VQSA 2R6GA 4HI0E 3SU8A 4PSAA 4TMXA 2CXXA 3OIYA 1W0KA 4RZ3A 3RS5A 4AKIA 4QNRA 1KAOA 1UKZA 2HCJB 3DMNA 4H1VA 2WJYA 1GTVA 2AN9A 4BASA 2GJAA 3LBHA 3EPJA 3GLFB 3FWYA 1J8MF 3QY0A 2HUPA 2CL7X 1FP6A 2YOFA 3H84A 2ZJ8A 3AVQA 1E9FA 2OSBA 5FBVB 4QHTA 4KVAA 5KO2A 1L4YA 3RLFA 4AYXA 3BB4A 2ODEA 4XD7A 4TT3D 2Q0HA 4C0BA 2NZ8A 5A5GA 1G7SA 2HYIC 2ZS9A 3I32A 4M1TA 1S0UA 4QBHA 3CRQA 2YYZA 3B7GA 5C1BA 2FGKA 3GMTA 3LFUA 2WIBA 5G41A 2C04A 1MRSA 2J45A 2VLIA 1GVNB 3PEVA 4RJLA 2J46A 3ZS8A 5DSZA 3HR7A 4EQ6A 3A4MA 5EZ6B 3ZYCA 3TLXA 1G291 1SQ5A 4BWYA 1GP2A 2X19A 4XSHA 1XP8A 2CBZA 1Z06A 2GEVA 3LAWA 2RGAA 2FF7A 3IQWA 3T35A 4Q9IA 1T5LA 4IRUB 2QRZA 2XZLA 3ZH9B 5CDFE 2PJRA 3QKRB 3BB3A 1R0YA 3ZD7A 1JQLB 2AD1A 5JHGB 1E3MA 2ZQ5A 4BEBA 2CJWB 4URUR 3K09A 4UXIA 3EIEA 4HB4A 3PUYA 4ZDWA 2A5JA 3KFVA 2CHQA 3Q7PA 1E6CA 4Q4HA 3GJ4A 4BLOA 4RFSA 2A30A 2C95A 1T91A 4L15A 1W48A 4NYMR 3B1VA 2B92A 1D2EA 1ZVQA 2P2LA 4JMPA 2XSZA 3TSWA 2YWHA 4NONA 1RYHA 4D0GA 1N6OA 4V0ME 4RD3A 4BZXA 4RVCA 2QRNA 4C7OB 1E0JA 3MLEA 4QBGB 3UIEA 5J4VA 1T6NA 1AZSC 2WBLC 3QKSB 1FUUA 2B8TA 2BJWA 5JJKA 3T1TA 4A8JB 5DYGA 4DHEA 1Z63A 5CLLA 4Z8XA 4YXWA 3RS0A 3TW8B 5FI0B 3TNFA 5FL7D 4G5RA 2RKOA 1FOEB 2GK7A 3RS7A 2CLDX 4AI6A 3KB2A 1DS6A 5L8VA 3P26A 4D4KA 4LJ8A 1LF5A 4ZI2A 5FR1A 3OFNA 1HH4A 2Q9AA 1E96A 2J87A 1C4OA 1ZJ6A 1P73A 2Q9CA 1P75A 4B47A 4DIEA 5TARA 3PXGA 5LPNA 1C9KA 3DZ8A 5J40A 1LVGA 4GT1A 1IAQA 2Q9BA 4WOPA 2F43B 3NHAA 3QXCA 1KK3A 4AKEA 2F9MA 5EE5B 3MWYW 4JYBA 4NYIQ 5CITA 2WWYA 1M1YE 3THXA 1DAMA 2ERYA 4PAMA 4RFVA 1H8EA 3GLGB 4CEIA 2IYWA 1OPXA 3QOFA 3QF7A 4JVSB 2YV5A 4R98A 5J47A 5FTJA 2V6JA 4TTRA 1E2NA 1II8A 2FSFA 1E0AA 4URYR 2GNOA 3CF0A 1OW3B 1DAFA 1NLFA 3QPVA 3VR1A 4KI0A 4OHVA 4PAQA 4A0GA 4JL5A 2RB4A 3OEED 2QAJA 2YWEA 1R4AA 3DKPA 5HKKA 2Y8EA 1ZUHA 3PG5A 4NL4H 721PA 4DJTA 3JVVA 1NVVQ 4D2IA 2XZOA 4DDTA 3QJYA 3FHOA 1RRGA 4MDFA 1I2DA 1F2UB 3QVVA 4Y0VA 1NSTA 2P65A 4MA4A 5FOUA 3ZZUA 4XH9B 5GVRA 4Q02A 1KTVA 2XNDD 3HYTA 1M7BA 3U4QB 4JLKA 3KTAB 5FOXA 4O3MA 1XEWY 1A2BA 1C1YA 4TL9A 2PT5A 1S4QA 3FDIA 1D9XA 3M1IA 1OIWA 3D7MA 2OBMA 3GEEA 4KXFB 2GILA 2J7PD 2QU8A 1MABA 3LQRA 2VSFA 2FZ4A 2VA8A 1WXQA 5JI3E 3CW2A 4OQNA 4J0QA 1AN0A 1EFHA 1G64A 2GKSA 3EW9A 4C30A 2WKQA 1T8TA 3ZIAD 1ZUNB 1KNXA 1NKTA 1XTRA 2QG6A 2J41A 2PL3A 2KSQA 1NBMD 4Q01A 3FKSA 3MMPA 3GLFE 1W7AA 1VHLA 1TUEA 2QPTA 5FFMA 4P33A 2J7KA 1ZBDA 3OAAD 4Z1MA 3FB4A 1TF5A 2P6UA 3RABA 3WP0A 2ZITA 4PC2A 3M6AA 3U3RA 1SHKA 3ICEA 1KY3A 1VPLA 3AQ4A 5FH9A 3NXSA 2PZGA 3NH6A 2FA9A 4L5BA 4OL0A 3R9IA 3OZXA 4CEHA 3EC2A 1VCNA 4D4LA 4OQLA 2N46A 1WRBA 3VR6A 1M6NA 3WYFA 1SXJB 2JA1A 1US8A 4KITB 4HAUA 4R7ZA 3LW7A 3CNNA 3VX4A 2JLZA 3ZGXA 4A2WA 2BM1A 1ANKA 2QORA 4ZDKA 2O5VA 4KAXA 1XXHB 5CLQA 1J7KA 2ODWA 5SZIA 2SHKA 3RANA 2VTKA 3AF0A 3VR3A 1ONBA 3KJEA 3QF4B 1PV4A 3WRXC 2GBLA 2ZRMA 1UPTA 2F3TA 4QHSA 4IVRA 2WSSD 2G1JA 2REXB 3EG5A 1GRRA 4RCZA 1N2CE 3B78A 3D8BA 3BFXA 3OESA 2WPDA 4IW3B 4CT5A 3FKQA 5FPKA 4L4UA 3KKQA 2Q6TA 5BYJA 1W44A 2XOKA 4P4SA 4PHGA 1M34E 3TQFA 2NO7A 2NO0A 1G3MA 3GJXC 3OEHA 4LV5B 1DO0A 4HATA 2ZRAA 4ZKEA 4Q9JA 2GRJA 5AR1A 3HP1A 2QPAA 4Y0AA 1YR8A 3E1SA 3P1JA 1GNQA 4IHQA 3X1ZA 1VTKA 2ZRNA 4QOSA 4TLDA 4DDUA 5LB2A 5DO9A 4PHFA 1VYUA 2VHQA 2BV3A 4WZBE 1TEVA 5EP3A 3HU3A 2Z43A 4PXAA 3CM0A 4KFRA 1CJKC 5AUOB 4EJSB 4Q4AA 4KBGA 3CRW1 2JJ1A 4I81A 3BFKA 4B3XA 5BW8A 3B6EA 3B9QA 1GOTA 2WWWA 4OJKA 3W90A 5DHAA 1XEXA 4KJZA 1OB5A 1CS4C 4G5OA 4O2RA 4YC7A 1NBME 2V7QD 1TTTA 2IWRA 3KKPA 2JJ2D 3ZD6A 4FCWA 2ORWA 3CH4B 1RIFA 1FX0A 2EWWA 3IEVA 5JS8A 3Q5EA 2ZUBA 3LLMA 3IKJA 4IOJA 1A4RA 2XJ4A 1DELA 1HE1C 1XEFA 1AS3A 1YU9A 2IL1A 3C16C 3T5DA 4EIWA 1SXJD 1DAKA 1E79D 1QHGA 2ZE5A 1OT3A 6Q21A 3FYHA 5H68A 5DNYB 1IN5A 1U9IC 5G3ZA 3O47A 2JIZA 2HV8A 3GJ8A 1UDXA 4ACAA 4US2R 1E2JA 1TF2A 1DOAA 3IQXA 4HLCA 1QHHB 4NMMA 1XNJA 4WA7A 4R71A 5G3YA 3H4MA 3GLHE 3I4LA 3QI2A 4TMKA 3U7EB 4D80A 4RD1A 3SI7A 1G5TA 2DPXA 1P2SA 2J9RA 4DVGA 1XD2A 2B21A 2DWQA 3K0CC 3WMEA 2JJ8A 2JAQA 5JEDA 1DG3A 5JLJA 3A6PC 3A58B 3A4LA 1L8QA 2BWJA 2OZEA 3FFBA 1ZCBA 2DFKB 1Z47A 1W2GA 4B32A 2C9YA 4KFSA 1D5CA 4XVRA 4CYMA 5DH9A 1VG1A 4IXMA 1IY2A 4LYFA 1R6BX 4K46A 1K8RA 2BMDA 1E9RA 1E2MA 4YMWA 3T1OA 2PLFA 3AKEA 3D3QA 3ZQ6A 4Q4JA 1EK0A 5G53C 3B2EA 4TMZA 4EUNA 2ZI3A 1JI0A 3CIOA 1QDEA 1E94E 1RRFA 3Q5DA 2V55B 1GZSA 5HE9A 1VCOA 1U2RA 4RD6A 2W83A 2KBFA 3K9NA 1TPZA 3QG1A 4WZ6A 2GHIA 1WCV1 2VPPA 2KI5A 3SFZA 1DO2A 4MGKR 1P2VA 1XJ0A 3SZRA 4TMWA 4NCIA 2FJUA 4NYMQ 3WY9A 5CB8A 3L8YA 1Z08A 2CCGA 5CK5A 2ZRJA 1YZQA 3K0AB 2DCUA 3T1QA 4LV6A 4B48A 3X1YA 4EAQA 4PO9A 1E9SA 2P5SA 3CUEF 3GP8A 1E2PA 4IFEA 4JLVA 3N5CA 1RVDA 2P3SA 2OAP1 1GAJA 4G1UC 3I61A 1QF9A 4KV9A 1DAIA 3L0SA 4HYYA 3KQLA 3SJAA 1G6OA 4RCYA 5JWOA 2PX0A 4C0HA 4F7WA 3IIMA 3GEHA 1SXJE 1ELOA 3CNLA 3X1DA 1H65A 2ZS7A 3OIVA 4GDFA 4AKHA 1WF3A 3NBYC 2NMVA 5L3VA 5IHPA 2NPFA 3KXLA 2A5DA 2P6RA 1CBUA 2DWPA 4NCKA 1XXHE 2XAUA 2DHRA 1NVUQ 5KU1A 2CK3A 1K5DA 3WMFA 5KSYA 4U5XA 3DO6A 4XTRA 1OFHA 2XNSA 2QM8A 5TV2A 1EX7A 3CR8A 3GD7A 3BOSA 3RRYA 2OHFA 3TGPA 2B6HA 1BMFA 3CF2A 3PJRA 3ND8A 221PA 1IQPA 1NMYA 2FPLA 2OV2A 2FEMA 2P67A 3B1ZA 4AG5A 1WMSA 3K53A 4LJAA 1NY6A 1GSIA 1NJGA 2WIAA 5CJ2A 1FQJA 1AKYA 2ZI7A 4LHVA 4QL3A 2NOAA 4HB3A 3BC1A 5SZHB 2YNMA 5L3SA 1IXSB 1UAAA 5FR2A 3AH8A 3FGNA 2CNWA 2ZXUA 4PPGA 4M9QA 2ZU0C 3K0CA 4GI7A 5BN4A 2ATVA 1HV8A 2RGNA 5JSZA 1EFRA 2AL7A 4JZKA 2PCJA 3PIRA 4BFZA 4GPTA 2BCGY 1U8ZA 1DVRA 1GRNA 4MYUA 2VP4A 4NYJR 2J1LA 4DDVA 2ZYUX 4LBVA 2ZRKA 1PUJA 3P4XA 1G7TA 1N5LA 2FH5B 3U5ZB 1KIMA 5CYOA 1DAEA 5KUTA 3U3OA 2A7QA 2ZSDA 2QMEA 4UNQA 4LJYA 3W9YA 2HF8A 2XTMA 5FPYA 4FI3C 4LHWA 3F3YA 2OCYC 2UZ3A 3TMKA 4GL2A 3CB4A 2YC2C 2F55A 4LZZA 4TMVA 4GSYA 3F8TA 5JCZA 3BFVA 3EXAA 3O8BA 1SVMA 2O8EA 3EIHA 1R5NA 3RWMB 2H8KA 2QMHA 4ZV4A 2REOA 1Q44A 3L0IB 4A1FA 4L9WA 1G8HA 2QP4A 1ZC4A 1TAGA 3MRSA 3CPEA 3UPUA 1Z29A 5EUMA 1JR3D 4M22A 4Q4HB 4EPXA 3K0FA 3H1TA 2BVNA 8OHMA 4RFSB 4E22A 4LUCA 1CJUC 2OO7A 4OJQA 521PA 1HURA 2H57A 3WRYC 2C78A 1OFIA 2IYLD 2X77A 4C0SA 2QAGB 2I4IA 2WWHA 3T12A 3P20A 4HB2A 1HUQA 1Y3AA 5KTYA 4A82A 1VYVA 4B3CA 3EZ7A 4Q1DA 1KYIA 5C4GB 4PC6A 2ZS8A 1JJ7A 1Z0KA 4II7A 3Q72A 5KSPA 4JVLA 3UANA 1W46A 4PSVA 4L8GA 2VHTA 1I4LD 2VHUA 1KO8A 1R0WA 1W0KD 1XMIA 2CEAA 2QA5A 2QGZA 4RD0A 5C18A 2XEXA 1X1SA 2K5UA 2W6JA 5KPDA 1J70A 3ND9A 5AJVB 5F2EA 1ZU4A 4B43A 5LD2B 1GKUB 3GQBA 4JJZA 4MRSA 3EZ9A 3PUXA 3R20A 4ASUA 3KUDA 4D0LB 1Z8FA 2EQBA 3NTUA 1ZNWA 3BE4A 3L82B 4JBXA 4AC9A 4LCBA 3U2QA 1R10A 1OH8A 5E7IA 1CJTC 4NCNA 2WJHA 3P27A 4XD7D 4B2LA 4ZDJA 1LW7A 1RE0A 4OI4A 3A1UA 2ZEJA 1CR1A 4LJ6A 3TQCA 3SHWA 4JYCA 3AGQA 3U44A 3IIJA 5FBRB 1OHHA 3FFAA 1X3SA 1NIJA 1YE8A 4QG7A 3QG5A 5AUNB 4M4SA 1Q0UA 2C98A 4GP6A 2V6IA 1N0WA 4TLEA 2FGJA 1F6BA 1M8PA 2VHCA 3ZZTA 5GVSA 2J0QA 1PZNA 1G6HA 3DL0A 5CK4A 5AUQA 4PSKA 4LC1A 3VU9A 1QBKC 1F2TA 1XRJA 2IF0A 3BJIC 5EE3A 3SR0A 3MWKA 4DCVA 1KO1A 5J5CA 3EC1A 3U7HB 5HR5A 5B57C 1RFLA 4Z8YA 4LPSA 4EFMA 4YMUA 4M1KA 1E9DA 2D62A 3ADBA 1KMHA 4Q7JB 4FXPA 1SKYB 4C0AC 3A37A 1OH6A 1FTSA 4OI1A 2IWHA 5EJEA 1G4UR 1E2GA 2Q21A 3HYRA 2XSZD 1ESNA 2PX3A 4ZCMA 5G40A 4WXPA 3OF5A 1YR7A 1BH2A 2ZU6A 4LHZA 3BGWA 3SYLA 2O0JA 1P9WA 5JZVA 4HDCA 2ASEA 1BKDR 2IYRA 1YHNA 1KK0A 4QKQA 5F3WB 3L2OB 3RYTC 3TBKA 4YXWD 3W5JA 4KSBA 4X8OA 1IJFA 2V3CC 1B23P 1T5IA 2GJKA 4OK3A 4DLTA 3IPYA 3U3KA 4B76A 4POAA 2V1UA 2CE7A 2FNAA 2WMNB 3FVQA 4LBZA 3UG7A 3OFND 1VYTA 3IO5A 3U3JA 1SVWA 5JJIA 5LD2C 1F3OA 1EGAA 4JBYA 3W8NA 4BEJA 2NZJA 2IT1A 4UQOA 2ZYWX 3BH0A 3NC1C 4Z54A 1Z0AA 2BMJA 1ZD8A 1ZM2A 5FUVA 1HT2E 1S1CA 2Z83A 3Q3JB 3CNOA 1UEIA 1ZMXA 2PEYA 1FNMA 3MSXA 4Q5IA 1ETUA 1H8ED 5KOYA 1U90A 3NC0C 4JLJA 4CEHB 3NWJA 1ZAKA 2ZVQX 4GFDA 4DLSA 3Q85A 1ZYUA 2AK2A 2GA8A 3RSLA 2WKRA 2ONKA 1A1VA 2G77B 2O8DB 1WB9A 2L0XA 2I1VB 4BFSA 2HCBA 1N6HA 3PR1A 3DM5A 3MG9A 4M1MA 1X8LA 4UNSA 1GM5A 1KO5A 2WMOB 1SVOA 4UXHA 4M21A 2EVWX 4UJ5A 1IY1A 2RH5A 3KX2A 3LX5A 3I5XA 5FTLA 5HKKD 2GF9A 3KDSE 3X1XA 5AJXA 2IUUA 2MMGA 3AM1A 1T3LA 4QGGA 2OCAA 1P6XA 3C5HA 4B75A 3LRPA 2FFQA 4PPFA 1JAIA 1ZM7A 1IBRA 2F1IA 1E2LA 3GJ7A 1QG2A 2FSGA 4ZKDA 1AM4D 3TIFA 1EESA 2HXSA 5KNDA 1BOFA 4P4UA 4B71A 3CX8A 2JLUA 2IYQA 2I1QA 3UK6A 4P4SB 2O52A 2BBOA 3C14C 3MFYA 5F98A 3EWAA 2AWNA 3UKDA 5DLQC 5FBQB 2ZTSA 2QQEA 1P4SA 2OFOA 3I8SA 4JL6A 4Q7MB 3V9PA 4FN5A 3X2SA 1XTJA 1Z6AA 2DY1A 2CVHA 4A4DA 4I1UA 4JS0A 1FUKA 4HSEA 3VTKA 4OI0A 2ZE7A 1NN5A 2PCLA 2EWVA 4R2HA 1ZRHA 1TF7A 2ZRCA 1M7HA 1YJ5A 2IHBA 3KZ1E 2WSMA 4Q9LA 4BUJA 2ODNA 2QNRA 4YONB 5A4JA 1AA9A 2AWOA 4HLUC 3EPKA 1CR0A 3FKSD 4I1OA 1KDOA 2GJSA 3GFPA 5EQTA 5FPSA 3CBQA 1NJFA 4KCGA 1NLZA 1DARA 1NSFA 4Z1MD 3AVWA 2H18A 4TLCA 4DC9A 2GEDA 2V9PA 3ADDA 4TLAA 4DSNA 1FX0B 2VIIA 4DEYA 2G0NA 3ECCA 1YZLA 2EFHB 5L3QA 2GXSA 4Q7LA 4EPRA 2Q3MA 1MOZA 2EW1A 2V54A 4PPNA 3AVVA 3M4YA 3CO5A 2B7CA 1LNZA 3PUWA 4OKSA 4FW9A 4B33A 2B7BA 2F1HA 5D3MB 3I92A 3NEYA 2MSCB 3FHCB 2VP0A 1R2QA 1GKIA 2WZQA 3QKUA 5AWFC 1K6MA 2IEYA 2ZSEA 3ZVRA 2XB2A 4PPQA 5CM8B 4DLUA 2CHGA 3BWDD 5JFGA 3B1XA 4MRRA 2ZROA 1M7GA 5LB4A 1N6NA 4HAZA 2G9NA 2ZI4A 1XU4A 5EE0A 4ABYA 1N6RA 3KXKA 1QVAA 1CU1A 5AJWA 4A0FA 2ZRPA 1G3QA 1CKEA 1YRAA 3GLHB 1Z83A 1Z2CA 5EXSA 1G8GA 3QE0A 4F91B 2ZJOA 4KFUA 2ANBA 2WPDD 3DMDA 1SKYE 1A82A 2NG1A 3TRFA 4NYJQ 4Q9KA 2XOKD 2XX3A 4PX9A 3U61B 2NPIA 4M9XA 2XXAB 4LSGA 3OEHD 1AIPA 3AUXA 4JKYA 1KI1A 2D2FA 1KI8A 3R9XA 3EPHA 1KI3A 1OJLA 1HT1E 2ZRFA 4IKEA 121PA 1H8HA 4UNRA 5DN6A 1QVRA 2H5EA 4MYHA 1NMZA 4XWKA 4N0EA 4EPWA 1AGPA 3R7WA 1LS1A 1XFAA 2DB3A 2Z0MA 3NIBA 4HDQB 4C3ZA 4EFLA 2BBTA 2VBCA 3RNLA 2JJ1D 1XPOA 2R6CA 4ZIRA 1ZUIA 2QMUA 2IEZA 4A8JC 5H8WA 4NTZA 4BLRA 3GLIA 3K0EA 3WYGA 4Q1BA 1KDPA 1DE0A 1F5NA 3B82A 3VKWA 1LV7A 1VIAA 2VF7A 4PQFA 4E09A 3THWB 2HT1A 3CF6R 3Q8XB 2AKYA 4CZ2A 5BYKA 2OBNA 1PLKA 2C5LA 2ZJZA 3T15A 1SVSA 1FMJA 2R6AA 1UEJA 1XCPA 4V02A 4EPTA 4NP6A 4P4TA 4DCNA 2BKEA 1HQYE 2ZI5A 4Q03A 5C46F 1FPMA 3LX8A 3RWOA 2UZIR 2WJJA 4QJ5A 2GETA 2PZEA 1WDTA 1QZXA 4URZR 3A1SA 3KXIA 2A5FA 1ZM4A 2CCKA 3F0TA 1N6IA 3SYNA 5FPTA 1TU3A 1GKYA 2VH5R 4JSTA 2G0TA 3CX7A 3RRMA 4N1AA 1VCMA 1ZU5A 4US0R 3A36A 4A2QA 2FN4A 2JIZD 4TL7A 5EXTA 5TDHA 1AK2A 5FTMA 2GESA 3TR0A 1VHTA 2JGNA 1W5TA 1ZD9A 3AP2A 4PO8A 2MSDB 4LY6A 1JXOA 2O8BB 3BAFA 1GL7A 1IJEA 1RJ9A 3KUCA 4TL6A 5FOTA 3AKDA 4BFTA 5KNCA 2HEIA 4D25A 1P9NA 3SYKA 5CM9C 4DLRA 1Z22A 2RGXA 3SQWA 3EAQA 4I1VA 1KI2A 1T0JB 2O8CA 2IS1A 2PBRA 3EA0A 2FE4A 3JZAA 4ZO4A 3SBEA 1RW4A 5JWRA 3IUYA 1KOFA 1E1RA 2FV8A 2QEQA 4A36A 2O0HA 4Q1EA 4ZPXA 4DIDA 4I99A 5EE9A 4Q7KA 3JZMA 1E9BA 2GCNA 4G0NA 4XWOA 2QUZA 3SOPA 4CEJB 4TSFA 1IN7A 2ZVPX 5L3SB 4DZZA 3FMPB 2XITA 2KWIA 4XTCS 2CLSA 2ERXA 1G4AE 3J81k 1W4CA 1G7CA 4N3NA 1S1MA 2FWRA 1GDDA 2OLKA 2QSZA 1ZIPA 5JSZB 2JLYA 4QBIA 3NBFA 3K9HA 3PFIA 1RYFA 4LGMA 4KODA 3QKRA 4ACBA 3N70A 4D82A 3I5YA 3K0SA 1M74A 1E9CA 2CJWA 3MUFA 1II9A 2HJGA 2GZHA 2Z4RA 4ESVA 5L3RA 1U99A 1CULC 1G18A 2W0MA 4NPHA 5FUXA 3ZDQA 1EXMA 1P5ZB 4MYTA 5SZJA 3TUZC 621PA 3NBZC 4AWXA 1HQCA 1XD9A 1KK2A 1G3UA 2BOVA 5FOVA 3DDCA 1P2TA 2IXEA 2G6BA 4WVFA 3KQKA 4C7OA 2ZREA 2CE2X 3QKSA 4GZMA 2GZDA 1U94A 2ZJ2A 3QEJA 3QSYA 4MRPA 1MO6A 4S2EA 2IBMA 3FHTA 4O0MA 4K81B 1G3IA 3QKTA 3F5FA 4JBWA 4OI2A 4WXRA 3FMFA 3BBPA 3MAAC 1TUIA 3PUVA 2YHSA 4RD4A 2GCPA 4IOLA 4UJ3A 5FTNA 4B2PA 3ZS9A 3GCGA 4Q18A 1VCIA 2V1XA 2CK3D 2W2XA 1FMLA 4PANA 4BQSA 3O8CA 1SXJC 1IN6A 4DEXA 2QE7A 2JASA 1MT0A 1OXUA 1Z5ZA 1TEXA 2GXQA 3GEIA 3TKLA 5FL3A 2LKCA 2ZR9A 4C0KA 4F92B 3S1AA 3SDZA 2F43A 3K70D 1BMFD 3OIUA 4FCVA 2OILA 1KDTA 2QTFA 4JSYA 4OYHA 1ZIOA 4H9GA 4D4MA 3KQHA 4NH0A 5BQ5A 3GLGA 4JLNA 5FBWB 5DI3B 5JCPA 3AB3A 2J3EA 2WWIA 1NIPA 1YR9A 4ARZA 2CNWD 3RHFA 4G01B 4LWZA 5IRCD 1D2MA 1E2FA 2RGGA 3LQQA 5EXXA 4NCJA 2GCOB 5LBIA 3BORA 4B44A 3NDBB 4Q1CA 3ZVNA 1MV5A 1XDBA 1E1QA 1EFRD 3MCAA 4X8HA 1Z07A 4A9AA 4BZQA 3WNCA 2OT3B 3A1WA 3CKLA 4Q1AA 2ZJ5A 2J0UB 4DT1B 2JATA 2JLSA 1Q20A 1QHIA 4NZYA 1P3JA 5FTKA 3RS4A 5JMTA 4TYPA 4CF7A 1UBGA 2JLXA 1F2UA 1KDRA 2A5GA 2OFWA 3ASYA 1U81A 4GMDA 3WP1B 4EJSC 3KTAA 4XOIA 5HCNA 4B6EA 1KO4A 1OH5A 1R0ZA 3NEJA 2Q3HA 5JRJA 1Z2AA 3REGA 2J0SA 4F38A 4URVR 4DLVA 5FUYA 3B1WA 3E5HA 1UKYA 2VHJA 3CRRA 1QHNA 3VU9B 3ETLA 4Q1FA 1GFIA 4M9SA 1F2TB 1TMKA 2O8FB 2IW3A 3NG1A 4FMDF 4A6XA 4FMCF 1IY0A 1SHZA 4FD2A 3PVSA 4IDHA 1XB2A 3P4YA 2MMCA 3OHMA 4MKFA 5GJBA 1G17A 4HZIA 2RAPA 4P3YA 2Q3FA 5CIQA 3WBKA 1E4VA 1F60A 2PMDA 1YRBA 4HUQB 4GZLA 3WBJA 1JAHA 1FQKA 1KJWA 5JBQA 1ESMA 5F9HA 2ZYTX 1I2MA 1QHYA 5EP4A 1PVOA 4MRVA 2P5TB 2VSOA 3OE7A 1O3YA 2IYSA 2PT7A 1XD8A 3UG6A 1CRQA 2OBLA 3DHWC 3HR8A 5DI9A 3VHLB 2QBYA 2IC5A 1XCMA 1Q12A 1DTSA 1IXZA 2ZI6A 4TN1A 3TUIC 3TUJC 1NN0A 1KSHA 2BDTA 5P21A 2RHMA 5JEEA 4LI0A 4NCHA 2CMKA 2REBA 4Q19A 2W6JD 2WWFA 4E5UA 1JNYA 1S2MA 1ZNYA 3HU2A 1Y63A 2VO1A 2ZE8A 4MKHA 4NHOA 2J0VA 4G3XA 4DLWA 1E98A 2V4ZA 1DG1G 2V8OA 5KDOA 2BMFA 1I4TD 4ASUD 1E4YA 2VP6A 1OXTA 2ZSBA 3ONWA 3IBYA 1KSGA 2QQ0A 2YVUA 4MITA 1D6JA 3IHWA 3V4RA 3NBXX 4OHWA 1OV4A 1U9IA 3U6BA 1FW6A 3MD0A 2EFEB 4FINA 1Q1BA 3Q7QA 2OLJA 5H1YA 1ZM3A 2AR7A 1Z6YA 2YJTD 4BFUA 2HLDA 4B74A 1FFHA 4XJXA 3TH5A 3QXHA 1E9EA 2XZPA 1R5BA 1Q3TA 5FOSA 1YZTA 1W0JA 1A7JA 3BD9A 1OHHD 1Q3HA 2VSXA 3EIQA 5KYKA 2RMKA 5BWMA 1BYIA 2IXFA 4DB4A 4OHZA 4F4IA 4A92A 4HB0A 1NN3A 2IX3A 3RAPR 3MWLA 5HTKA 4LJ4A 1SVLA 2OXCA 3EZ2A 3DVLA 3QUSA 1Z0FA 3TW4A 3RS2A 3VFDA 4DB2A 2RGBA 1OE0A 1KI7A 2IUTA 5JWHA 3GFOA 4EQ6B 2W00A 3DM9B 4HLDA 1OXSC 4LJ7A 2EFCB 2E87A 4PHHA 4BFWA 1OYWA 2BJVA 4M1WA 2LWIA 1IN8A 1KMQA 1W4RA 1E0SA 4B73A 2QGNA 2QI9C 2WVJA 2G83A 3AVOA 1KKLA 4QNMA 1XMJA 3IGFA 4GP7A 3NH9A 3LNCA 4EJSA 4A0RA 1D9ZA 1N5KA 4JVNA 2VRWA 2GAOA 2MSEB 5B30A 2W6IA 4R9UC 1AS0A 2OE2A 2X1VA 1JALA 1XJQA 2D2EA 2ZR0A 3CWZA 4ZI3A 4S35A 1Z3IX 1NNEA 1KNQA 1T4GA 3R8FA 4KLZA 3IIKA 4OHYA 2C99A 4FMCB 1G21E 4DWJA 4LX0A 3BB1A 2G88A 4HZUA 2JDIA 1XJCA 1UKVY 3LVQE 4QGHA 1EX6A 4CVNA 3SN6A 1SVIA 2ZR7A 3FTQA 5BN5A 5J4KA 3EZ6A 4KYUA 3E70C 3K1JA 4KVGA 3TVTA 3PQCA 1KJYA 2QSYA 1E0KA 4M1OA 1NVWQ 4PTLA 3T1VA 4DBLC 3HPRA 3THYA 2AHOA 1IXRC 4C4PA 3WHLA 3UWKA 1NRJB 1CTQA 2D06A 4AURA 1Z28A 4D4JA 1P72A 3KL4A 1QHHA 1GWNA 3W5IA 4DCSA 2QROA 4G5QA 2WICA 2IYVA 4XIGS 4HAWA 1W36B 2QM7A 4OK5A 2GEUA 5H70A 5KSZA 3H86A 1W49A 1MRNA 5TXGA 3C5CA 5J4HA 1ZW6A 1NLYA 4IOMA 2IYXA 3THXB 1R8SA 1X86B 1HE8B 3FMIA 1UFQA 3AVYA 1G1MA 1NG1A 1L7VC 1LF0A 4CEIB 1VMAA 3B1YA 1AS2A 4LYHA 2ZJBA 1P62B 4DSOA 5TY0A 3MJHA 1E2IA 5IK2A 1XCGB 3AGPA 1II8B 5HE8A 2ZSFA 2Z5FA 3HPQA 4M2LA 3TSOA 5TB5A 4DLXA 4DDWA 4AG6A 3CRMA 2HF9A 3DOEA 2NTYC 3I3SR 1OYYA 2H92A 4GMXA 2IS6A 4QRHA 5KNBA 2ZRGA 2H1LA 2DWOA 3W34A 4LOAA 1G8YA 1ZD1A 5KDLA 4Z51A 2IS4A 4LBYA 1ZNXA 3UATA 1N5JA 4GBMA 4DXAA 4HLQB 3LVRE 2R44A 2A3RA 4MGYR 3K09C 4LPKA 4BFYA 3GJ6A 4OHXA 4RD2A 3EPLA 1R8QA 1GL9B 2GDJA 1HTWA 2GVZC 2UKDA 3LA6A 4TTPA 1HY3A 3CLVA 2QENA 1II0A 3MGCA 3W8RA 3B8HA 3AV0B 1LTQA 4P0TA 1HEIA 1YVDA 3K0AA 1GNPA 4QJ4A 2QAGC 2RHDA 1KSFX 5M04A 1EWRA 5J4YA 5DE3A 1G5RA 2GJ9A 4KLNA 5JHHB 1ODFA 2A2ZA 2AFHE 2ZUDA 1GNRA 2RGDA 4X8MA 1BS1A 5SZKB 1MABB 3KKNA 3EA5A 5IT5A 1COWA 4ERNA 3G0HA 3TVDA 4IFBA 4ZIRB 5DHFA 2P6NA 3THOA 3CZPA 4DSTA 1W5SA 1E69A 2ZRLA 1XTKA 2EYUA 3JVUA 2RGEA 1JR3A 3ICQB 4B3GA 821PA 4DUGA 1KO7A 4YLGA 2BHRA 1TX4B 4YDHB 4U00A 2HT6A 4CDGA 3ZJYA 3KJHA 2OXRA 2ZUCA 4V03A 1W36D 1SULA 3SJCA 3U60B 2ZRDA 4YMTA 1N6PA 1S96A 3RVBA 4H1UA 3ZVLA 4C2UA 1Q1EA 1CP2A 1EG7A 4FCTA 5E7MA 4ESHA 2ZANA 4ZDIA 1KHTA 2FPMA 4OQFA 3W6NA 1EWQA 5HPYB 4LYJA 1FTNA 4MGZR 4JL8A 1ZINA 3U7FB 2ZRHA 4BLQA 2W58A 3QXSA 1GL6A 3M0EA 4MQBA 1LB1B 4OBEA 1Z0IA 2NO9A 4W5JA 1KJZA 2P0EA 1US8B 1GIAA 1Z6GA 2OFXA 4I4LA 4PZYA 5EP2A 2KE5A 2JLWA 4CIDA 1RJ9B 2EFDB 3CX6A 4NDZA 1VECA 4KU4A 2YOGA 3VNUA 4FMBB 5E95A 1KZGB 4PZZA 1RZ3A 1KI4A 1GG2A 3LWNA 2AFIE 4V0OA 2J59A 2O8CB 3CONA 4F4JA 1SGWA 4BE7B 2ZJAA 3T34A 1S3GA 2WWXA 2DR3A 2FG5A 4B3DA 1BIFA 421PA 1N0VC 3FOZA 1Q57A 1OSNA 4IJMA 4DRZA 1G9XA 1KI6A 3QXXA 1JPNA 2BM0A 1SZPA 2A9KA 2ZJYA 3IDQA 4Q47A 1Z0DA 1H8HD 5DN6D 5HZHA 4B3BA 1JEEA 2AK3A 5LDDC 2CCJA 4TZ6A 5JJLA 3AVPA 1G8FA 2FU5C 4F93B 3QENA 4YDSA 4BFVA 1DADA 3QXJA 3N2IA 1WE2A 3V00A 1MH1A 3L8ZA 3LY5A 4LBWA 3H2YA 2F3RA 4AY2A 3SJBA 1OKKA 1KAGA 1FP7A 2R6DA 3AKCA 5CDFA 1D2NA 1KKMA 3BS4A 3RRZA 2D7DA 4PR0A 4Q4AB 3DPUA 3R9WA 4D6PA 5CJPA 1NMXA 1QHSA 3FPAA 1GUAA 2VYFA 1XEXB 2QAGA 4TQAA 2HYDA 4FWIB 2AX4A 1E2HA 2OCPA 2BKUA 4EPYA 4V0MA 4LHXA 4W5HA 2TMKA 4MRNA 4OQXA 3U6KA 2YWFA 2D3WA 4JLBA 2FFBA 3A1TA 2C03A 3AUYA 2KB0A 3LDAA 4PQRA 1XMVA 1YZUA 4A6PA 3Q9LA 1TQ2A 5IF9A 1MR3F 5ELXA 5AK0A 3LH5A 4P31A 2BCJQ 2WOJA 4C0LA 3BIFA 1CJMA 2JLVA 2ODBA 2PJZA 1ZM9A 1E32A 4WAUA 5ANRB 1X8KA 1HYQA 1XF9A 5IDVA 5CB6A 4TYYA 3V4FA 4Q4LA 3S1AB 2ANCA 4BFXA 5J4LA 1WBDA 2ZRBA 3IILA 4MKGA 5CYPA 1E1RD 2BMEA 4MUAA 2OG2A 3C15C 1XD2B 2GBLC 3WYAA 5EUQB 1JXMA 2IS2A 4KFTA 4TSFD 4TT3A 3BXZA 1WBBA 2OUKA 3ZVMA 1P2UA 2A78A 5FOWA 4ARZB 4BPBA 1W2HA 3KJGA 1XZPA 2FX3A 2KJQA 1JBKA 1IN4A 3AF3A 4V0NA 2DFNA 3CR7A 4XWAA 4JLOA 3K9GA 4JT4A 2F1JA 4Q4JB 1SVKA 4PAOA 4HEJA 1ZCAA 1R7RA 3VHXA 4KBFA 1XX6A 2G3YA 2NIPA 1BO6A 1CIPA 2E9SA 3GLIE 1IOZA 1W1WA 2JEOA 5EE1A 3AKYA 1EFUA 2ORVA 4US1R 2R65A 4IDQA 1J8YF 1L4UA 2ZIAA 4ZCLA 2QY9A 3PENA 1NF3A 3SFVA 1YZNA 3G5UA 3TJZA 3K9LA 4O2LA 1XTQA 3SS8A 1G7RA 2GF0A 4MYCA 2ZYVX 4QM7A 1X8JA 3AP3A 1D8TA 1E2EA 3GJ0A 1LY1A 4Q48A 1KI9A 1E9AA 4JKIA 2WKPA 1YKSA 4QJ3A 3ASZA 4FIDA 4C2TA 1UM8A 3UMFA 1OIXA 1LFDB 2CVFA 3FE2A 2DFTA 3VX3A 4GNKA 1OFUX 5BXQC 4TYQA 4B6FA 1IONA 1UJ2A 2ZSAA 4JLDA 3KQNA 3HDTA 4HLUA 4P32A 4U02A 4EKDA 3ZQJA 1PJRA 1XMSA 2KBEA 2ZI9A 5FBLB 4IEEA 5FL7A 2ZAOA 3ADCA 3L0OA 1E2KA 2QE7D 5HZKA 3I73A 1XTIA 2D4HA 4AIIA 4TTQA 2QBYB 4C0JA 2QT0A 2AD5A 4GRAA 3GLFA 4R2IA 1XZQA 1AQUA 1YR6A 4RSGA 5B58C 2YWGA 1P9RA 1JJVA 3G82C 2GXUA 3SNHA 3UMSA 3KJIA 3CZQA 2ONJA 3WHKA 1N5IA 2UVQA 3RS3A 3HJNA 4M1YA 3RC3A 1BYUA 1MO3A 3VKGA 3PEUA 3W3ZB 5GJCA 3K70B 5K8IA 1DAGA 4JLAA 4DCUA 3LBNA 4LK2A 3AF4A 4Q9HA 1ZP6A 2FPKA 2O8DA 2F7SA 4O25A 5K8UA 2C8VA 2OM2A 1ZNZA 3CWQA 2X2EA 1E1QD 3QQ5A 4TMTA 4U7DA 3AEZA 4V0KA 1G20E 4LRWA 2R8RA 2XTNA 5EXPA 2QZ4A 4IVPA 2NGRA 2R9VA 2YKGA 1CR4A 1S9HA 1U98A 4B34A 2OCBA 1RC8A 1NY5A 4HDOB 2PH1A 3AVXA 3LV8A 1TQ6A 1KZ7B 3OEEA 4QC2A 1LS6A 4M1SA 3VNVA 5GJWC 4PC3A 1MO5A 1Z6TA 2W0SA 1P60A 1E2DA 4IDNA 3TK1A 1KY2A 2HXYA 3W6PA 1VDZA 2HJVA 1G19A 2QP3A 2PEZA 4W5WA 1OXXK 4C9BA 4ZCIA 1QHXA 2XNDA 1X6VA 2GZAA 2WOOA 4TLBA 1N6KA 1KGDA 2OEPA 1G8PA 2VF8A 3OIWA 4EPVA 4DLZA 4GOXA 2VP2A 1I4DD 4QXAA 4M53A 1PLLA 5KSOA 4UXJA 2AXNA 2O8EB 4CGZA 3BH7A 3DZDA 1RRPA 4MH0R 3PITA 3I62A 1FL9A 4A8JA 4URWR 1XTSA 3BRWD 2J7PA 3RRNA 4BRUA 2FOLA 1VG8A 4IDPA 1Z0JA 4WBSA 1M2OB 4CT4B 3GPLA 2DBYA 3VQTA 3K0FB 3OE7D 2GJ8A 1A5TA 1V5WA 1UBEA 5DGXA 1W4AA 2G1KA 3IO3A 4RZUA 3SE0A 3KKMA 2QTVB 3ZIAA 1X1RA 5GJVC 4A0HA 2CL6X 4OK6A 1NBMA 2C9OA 1S8FA 2GAAA 4HZUB 4AYTA 2D7CA 4GOKA 5UKDA 1N6LA 3WNBA 2I3BA 2JCSA 1AGRA 4RKFA 4B2IA 4M0LA 2IK8A 5K8LA 1P61B 3OAAA 2R2AA 2WM9B 3AVTA 3DEFA 2AXPA 3RSOA 2QT1A 1CF4A 3VR2A 3DOFA 3O8DA 4GOJA 4MGIR 3GLGE 4BRWA 1NG9A 5D3MA 3E2IA 3K70C 5GADl 4JLPA 2JLRA 4WIAA 1NP6A 1CLUA 3THYB 1Q1ZA 4FWTA 2CLCX 5JRZA 4TL8A 2HLDD 5E4FA 2GTPA 2FZLA 3X1WA 2C2HA 3I72A 2PZFA 5BN3A 2N42A 1W0JD 1OF1A 2XJ9A 2GWHA 3HU1A 4AD8A 5KPJA 3QPUA 1Q21A 3GLHA 3VR4A 5C2JB 2Z6VA 2VEDA 4HAXA 1EFTA 2IHYA 4LC0A 4M8NE 1JEDA 4HUTA 2GVDC 2RGNC 2QTHA 3B5JA 1Z6XA 3PUZA 5K8TA 4IVQA 2BC9A 2FSIA 1CXZA 3U44B 4W9MC 5EP1A 4BZPA 2XXAA 3IPXA 1E99A 2WSSA 4EDHA 4IDOA 4WW0A 1YZKA 1FZQA 4C0QC 5AUPB 3U4QA 3T61A 1UADA 2C77A 4Q21A 3LO5A 2LCFA 1N0UA 5F9FA 2WWGA 4A15A 4DSUA 1V43A 3H0KA 1RPZA 2ZRIA 1PLJA 1NKSA 2NQ2C 1T0HB 3NDPA 5KHOC 5FPHA 4HAVA 3KKOA 1G41A 4JLMA 4NU0A 2ORIA 2IYTA 4TYWA 4TQ9A 2W6ID 2X2FA 1KMHB 4OQMA 2IYUA 4D0NA 5B2ZA 1N3BA 3ZLJA 4KHZA 3THWA 1ZC3A 4NKRA 3W3AA 4AYWA 1CJVC 2YOHA 4LHYA 2LKDA 2OAQ1 3SEAA 3GJ3A 1Q1QA 3DKVA 1JECA 1NI3A 2IUSA 2W2VA 3SQXA 4DCTA 2JDID 3D31A 1N25A 1UF9A 2WV9A 3QPWA 2BIFA 1IM2A 3ADKA 4MKIA 4WZAE 3AP1A 3MJRA 2IYZA 1AKEA 2V7QA 4G5GA 2EU8A 1TU4A 2JJ2A 1G5PA 2A5YB 4AKGA 5FI1B 1UBFA 1KK1A 4XSGA 3UWOA 1RRCA 2H17A 1XPUA 2R62A 3T5GA 3KB1A 1U8YA 4W7SA 3TAUA 1WA5A 2CL0X 4JT2A 2IF2A 4A2PA 3EZFA 1AJEA 5TVKA 1AQYA 2ZE6A 1SXJA 2RGCA 3P32A 1E79A 2DFLA 2WHXA 4CW7A 2O8BA 2VP5A 2WJIA 4M9ZA 4RZ2A 4QM6A 2WJVA 3L0PA 2AKAB 2FMXA 5EZ5A 2EYQA 1YZGA 3CRVA 1XXHA 5CIWA 4DKXA 1CRPA 3QF4A 2BEJA 4D81A 4MDEA 1T9HA 2NO6A 4NYIR 4ON9A 1VG9B 1W47A 1VIYA 1K5GA
chains in the Genus database with same CATH superfamily
3ZI7A 3D4LA 1CDEA 1WO8A 2VHYA 1D0VA 3LCVB 3AEQA 4AO7A 1YACA 2HU2A 4YMSA 1CEEA 3HCRA 5CDYA 3ZNOA 1Q22A 2JARA 2V98A 3CH5A 3HA2A 1P4HA 1YDHA 1U0JA 3C7KA 4JC4A 3TSZA 3UAWA 2D2XA 4IY1A 3IVXA 1MJFA 1CQZA 4L02A 3MUEA 5TR9A 4AFNA 2BBSA 3LY8A 4WLFA 1NVMB 4EW6A 4URXR 1W4BA 2VDNB 4O59O 4X7MA 1QLJA 1YQTA 2Z4SA 3OMXA 1CDZA 4UNNA 5G0TA 1EJ2A 1VL8A 1XOIA 1L0BA 3UY4A 2ALJA 5E6RA 5B1YA 2GM3A 3FM9A 1QU3A 1CFJA 2Y1OA 3MUNA 3ZHCA 4CIYA 4U3JB 1L7EA 1XPRA 1T3SA 4MUGA 1T3HA 3DOHA 3NHMA 5FHQA 1K5PA 2OQVA 1AUQA 4H6XA 3RH0A 3WGMA 4BLPA 4MWBA 2JCXA 3LE8A 4PFSA 3PDIA 4B3FX 4IEIA 3UCEA 5JQWA 2BI8A 1QG6A 1JV2B 1KGSA 1L2TA 1T26A 2IA5A 3NIGB 5JI2E 5IDWA 1GITA 2EF1A 2J08A 1E7MA 2BEKA 2XCUA 1KI6B 1XDZA 1EG2A 3B13B 4TUYB 4IJ6A 2O05A 2G36A 4XX0A 1FP4B 2JC3A 3SBDA 2X8WA 4G5SA 3DEYX 4I36A 1Z3CA 1VHQA 1GGNA 3QVKA 1BX1A 1S8OA 3TYXA 4E03A 4QEDA 1TADA 2NU8B 4DA0A 3BTUA 1PBNA 3I52A 3U3DA 2GA9A 5IH7A 5D51S 4CF4A 1WDMA 2JAWA 2FWMX 4YRAA 3TWOA 2PRKA 4FOSA 3R41A 1ULSA 2C20A 1GTG1 3LBIA 3PYXA 4L9SA 4FYJA 1IRXA 4XIJA 1NNLA 4CJXA 2PMWB 1E2QA 1T1EA 1QB8A 4N0DA 4JVMA 3T3OA 2FDCA 2C94A 1UAGA 3MJ4A 4YQFA 5CYGA 3SSMA 3W8EA 1XWIA 4HYEA 3AF2A 2P68A 3S55A 2NP7A 4DC1A 1RYDA 1P1FA 1K1EA 1TNDA 1VG0B 1X3LA 2BFCA 4J2HA 1GPBA 4RY2A 5EPUA 2MSWA 1P0MA 3EJ6A 4K8OA 1O94A 4QHYA 4I1PA 3BWEA 3B1KA 3H2ZA 4HWRA 2HFJA 5CVEA 3B85A 4UEOA 4Z4GA 1U7PA 2R5WA 3FMOB 5DISB 1C9YA 3VMMA 3GWZA 4OTZA 3MWFA 3T9DA 5A1JA 5JZMA 1ORVA 1RI5A 3AINA 3QNMA 4KYVA 2G1AA 2W42A 2NNWB 3CW9A 3L0YA 4LJ5A 4PRYA 2XQJA 2ZCJA 3GIWA 1FXWF 5LN1A 3G0IA 4KYIB 4I1SA 4ZVKA 5IN4A 5BNWA 3Q15C 2XCSB 1S9DA 3ZWVA 3O8RA 2NO1A 2A84A 1XBTA 1G8SA 4KO8A 1GFWA 4J07A 4O5AA 4P82A 4YI3A 1SOVA 1JMVA 2Z8YM 1NJSA 3E84A 4N18A 3BK7A 3NUQA 4ZYXA 1MZPA 1SA0B 1JFSA 5JISA 5E3HA 4LDPA 1B4DA 5EWJB 4OD0A 2R7LA 3GFBA 1ATZA 1KOGA 5AJYA 5DVZA 4OIFA 5C9ZA 4E1BA 3COZA 1BQ3A 1P33A 1SKQA 1AX9A 1EXDA 5B37A 3PJDA 2AG6A 2YFKA 4I4NA 3QVSA 1NQUA 3MWEB 1CR6A 5LQSA 2W37A 3KOZA 3IAAA 4PC1A 3BHJA 1VKOA 1ZRNA 2F2TA 1AVTA 3O3CA 3B5EA 3BRQA 3VVLA 1RBZA 4BO8A 3F6YA 3R7AA 5KMGB 3DDWA 4LJLA 2Z6QA 3DZIA 2I67A 3KZNA 4LDJA 4GOLD 4OB8A 2DERA 4UBIA 4XUEA 1A2OA 4YT8A 5FP0A 3QK7A 5B64A 4TZKA 2ZWAA 4GYWA 1NMSA 1FFAA 5K3EA 2GN1A 3ACBA 4YV7A 5KC9A 1OH7A 1VMIA 1M0TA 1O6ZA 4M0FA 5KYGA 3AL3A 3JAMA 2K2QB 1VL1A 3EYWA 2VEOA 4EX6A 3I0ZA 4FHCA 3W5DA 1ODIA 1H4TA 3A1VA 3AG5A 3WK9A 2H7CA 4HNSA 3ZU2A 4EX7A 3EG9B 3NIWA 4UULA 1UKAA 1XZHA 2CNKA 4PX3A 3LNTA 3GLIB 1MB2A 3PGLA 1KMNA 1A9ZA 3LGSA 2F1RA 1Z17A 3PEWA 1FXUA 3O8NA 3DTVA 2H7VA 1PJZA 1U8CB 4WMLA 1PL8A 2J6HA 3I8XA 1P7VA 4BUCA 3CCCA 1XZMA 4UFPA 5IEBA 5TGDA 5CBKA 3KEQA 4DV1B 1U0FA 1W88A 5CTJA 2P35A 2Y05A 1Y1PA 1SUDA 1KAMA 4WH0A 2HLPA 4QOIA 3EX7C 1YBMA 1Y9JA 2OESA 2RGUA 2NSHA 2LBPA 4J2TA 1R0XA 2AN5A 3N2KA 1JWLA 4EKYA 2H1RA 5IAJA 4IH1A 3HUFA 2C2MA 1W36C 5DTIA 5FWNA 5FCDA 3HWSA 1NN1A 3J81A 3CUVA 5CCXA 1FY2A 5JZOA 3WGZA 1REQA 2A6PA 1X2EA 1LDEA 3M6WA 3OU6A 3QX7A 4PSAA 4R1NA 2CXXA 3KRTA 4KVZA 3EODA 4RZ3A 3ZK8A 3IBCA 4ZOLF 2R25B 3AR7A 5D3KA 1XAJA 2PL5A 2PX4A 2JGKA 4KXVA 1T8PA 4I8XA 1VP3A 4UHEA 1GNVA 4KH0A 1L8XA 2PBFA 3W4JA 5I4BA 3U5TA 3EVTA 2HMUA 2W4QA 1V3QE 5GZ1A 2HZBA 3L06A 3QY0A 5F73A 4BMDA 1FP6A 2FWBA 2P9CA 2YOFA 1ZITA 2ZJ8A 3OURA 1CNMA 3T7TA 3PQ3A 3AB8A 4MR7A 4MWCA 1QP4A 4QHTA 3L1JA 1KZ1A 5KO2A 1O8CA 4W82A 4YMGA 2R86A 4KXXA 4XD7A 3VH4A 3WL7A 1ZWLA 3BGOS 4LXXA 3LMKA 3MAJA 1IPEA 2NZ8A 3ZDEA 1Z5GA 4UU8A 2AOUA 2FHSA 2HYIC 4YMIA 4EGSA 4W9NC 5C1BA 3AETA 4GWKA 2AYZA 3GMTA 2O5EA 4U9HS 2IOYA 2P5YA 1ST2A 1HZZA 3HDQA 3L6OO 3P0EA 4OP2A 5FNZA 2A92A 3PEVA 3UJAA 1UOOA 2W11A 1Q17A 3DQQA 2Y1GA 2G9UA 3A4MA 1DEAA 1TK3A 4MULA 5EZ6B 3ZYCA 4BGUA 3KOMA 5KKNB 3A6ZA 4M1ZA 3TINA 5HG0A 3GJTA 2GEVA 2LD4A 1T5LA 4H1HA 3H5TA 3W1EA 4XUCA 2PJRA 5A9RA 1R0YA 1R9GA 1XI2A 3IV7A 1ODLA 2FY8A 2ZQ5A 1UEXC 2CJWB 4RU1A 3C98A 4GECA 1AXEA 3PUYA 3BDAA 3NHKA 4N12A 5BSEA 1RXVA 1XYYA 2CHQA 4ZJZA 1E6CA 1E5VA 2YDXA 4BLOA 5G0UA 3T7RA 1W48A 3HCAA 4OFZA 3ORYA 2B92A 1UJMA 2P2LA 2V6MA 4NFHA 4ZAWA 3LDGA 3EOBI 3SKXA 3TSWA 2HHAA 3ETJA 3G88A 4LYEA 4MHTA 1D4FA 4I08A 1L4BA 4IMRA 3O2NA 1V7QA 2QMYA 4RD3A 4RVCA 3RU2A 5LOVA 1I01A 3ECAA 5I7OA 5J4VA 2QD1A 1IYZA 4MS3A 1AZSC 4D97A 2WBLC 4JWTA 3QKSB 3RB8A 5KNCH 5B1EA 4L75A 5TT1A 4WXYB 5BORA 1UKBA 3MGAA 4B6OA 1Z63A 2GAJA 4Z8XA 1GZ5A 2I4NA 1XVLA 3HB0A 3HG7A 3M89A 1CUCA 4NK5A 5FI0B 2ZYIA 3TNFA 1B93A 1Y48E 1FVHA 2RKOA 1FOEB 1DKRA 2CYBA 3M5CA 3QLEA 4DPKA 5KJFA 1AXGA 3KB2A 3BSYA 5FJJA 2DUMA 3B9RA 4HDMB 4TZTA 2HA6A 3P26A 4D4KA 4D9FA 4CKZA 4LJ8A 1G98A 3DAGA 1E96A 5DOVA 4UZEA 4DXDA 1ZJ6A 5BUZA 4HNVA 1P75A 1Y6QA 3UGJA 4RE6A 2PRJA 1Z73A 3QA9A 4XYEA 3AMVA 3VTFA 1JIXA 1I10A 2CY0A 3TFQA 3ZK9A 1MTZA 1T24A 1NXSA 4DY6A 2R7AA 2F43B 2YYYA 4U9UA 3QXCA 2C4WA 3A2NA 2I80A 3E3LA 3MPUA 3MWYW 2HA4A 2VJNA 3DHEA 4JYBA 5T7BA 1NURA 2FJPA 4DR1B 4G2TA 3QUQA 1DAMA 3LK6A 4RFVA 4EGAA 3DSRA 2AQHA 3FDJA 3GLGB 4BVJA 4IDAA 2IYWA 1YB4A 3T9CA 1T3ZA 4JVSB 1CUDA 1FU4A 4DPLA 4X20A 5FTJA 2V6JA 1NQXA 3L84A 4PBSA 1R6TA 3ED1A 3FJ1A 1E0AA 4BMYA 1P7ZA 1OW3B 2CLFB 4AAYA 1NLFA 5BN3B 1OWNA 5DYYA 4OHVA 2QZZA 2VCEA 1MF7A 3U4HA 1NXWA 1Z36A 4IPTA 4TTAA 2PUEA 2RB4A 1SCDA 2GARA 2G5GX 3OEED 2Y8EA 4NL4H 4OXXA 3WYBA 3PDHA 5IG2A 1NPDA 1H3NA 1SC9A 3JVVA 4RPIA 3RAEC 2D5AA 1JIUA 2GMWA 3GZ4A 3AI2A 3NEPX 5I8ZA 4KQFA 2OCGA 3LUKA 4JR0A 3QJYA 5ILOA 5EZYA 2XZOA 4HXEB 1I2DA 4XJVA 4KR6A 2GAFA 3F7TA 2P65A 4MA4A 1TKAA 5FOUA 1XQ9A 2OXIA 4MNTA 1KTVA 4E5VA 1CUGA 4N3AA 1L1EA 5I3ZA 2P3LA 1YNSA 2BE7A 1Z4QA 2PVCA 1U3WA 3E0QA 3NHYA 4FSDA 4TL9A 4XM2A 4D9NA 1DQYA 5ICMA 1LEHA 4MJLA 1JIVA 3ZHBA 3KT0A 2ZIZA 3M1IA 3FCXA 1OIWA 3RT9A 1BTOA 1VXRA 3AQIA 2B34A 4E33A 2PKCA 3I5AA 1WMFA 4LNUB 3I6QA 3QE9Y 4EF6A 4HF7A 2GILA 5A71A 4IJKA 1JTFA 2VSFA 2Q7OE 4RIHA 2VA8A 5JDCA 5CA0A 5LSAA 1ICIA 1WXQA 2RH4A 2QLLA 5JNVA 4W63A 3ZE7A 4O2BF 5IJ0A 3CVUA 3UA3A 1HM5A 1QP0A 1IUOA 3PEEA 4L07A 4JYMA 4HDAA 3N2GA 1G64A 1AN9A 5DGCA 3RTEA 5E9AA 1H5UA 1JFFB 1ZUNB 2J3MA 4PGFA 4UMDA 4F3RA 2YRFA 3Q41A 1JFRA 4MR8B 1D07A 1FTWA 3GLQA 4PYNA 2V7EA 4ZQGA 1WNFA 1Y33E 3LT0A 5CCBA 2DHQA 5ALUA 3D5QA 4P33A 5FWXA 1V8OA 2J7KA 2VJPA 3GXOA 3JARB 4W1QA 3NT5A 1OXBB 1ZBDA 3OAAD 4QYXA 3FB4A 1JLLB 1TF5A 4CM9D 3NPMA 2ZITA 1CLEA 1R64A 4Z9XA 2IU0A 3S7TA 1CHNA 5LWHA 2YJ6A 1IXYA 4B7XA 3ICEA 1KY3A 3AQ4A 1YAHA 2I0FA 4C7BA 5FH9A 3NH6A 4L5BA 2AEEA 4JT9A 3ZHVA 1M72A 3IAFA 4ODIA 1VCNA 5EHQA 4CEHA 3MWDA 1T2FA 1CP3A 2P2SA 5A5DA 2HK7A 3OWOA 4RNDB 5JS1A 1HLDA 1QYVA 4QDKA 2YMPA 3WFJA 4XVHA 1ECPA 3A2KA 1JVSA 3DL2A 4OBXA 3M70A 2JA1A 4LAFA 4QUKA 4PGAA 3TKAA 4HAUA 5JS6A 5JZSA 4R7ZA 1I3CA 3LW7A 4UHCA 2JLZA 2BI7A 1Q2XA 2WU8A 2XVYA 3ZGXA 3SZOA 4CU2A 1LPOA 1CUWA 3DPIA 4ZQEA 1BW9B 1HFKA 1VMKA 3VR4D 4A2WA 4C1NA 2QORA 3WBBA 4ZDKA 4KAXA 1LWOA 1W94A 2PHZA 2SHKA 3FAZA 2Q4TA 2VTKA 3AF0A 3G5AA 3KBBA 3M6MD 2EKBA 4RVUA 2GBLA 1Y6JA 3JR3A 1E8NA 5IN5A 1WAMA 3GFGA 1CQIB 1DCFA 2EBWA 4IVRA 2OVBA 2XA1A 2XGGA 2REXB 2HB6A 4RCZA 3AEQB 1NHWA 3EPRA 4BTEA 1XJWA 3QFRA 3S68A 3TTXA 4GX5A 3C3KA 4IW3B 4RSMA 3SR3A 1TKCA 5B6IA 2QX6A 4ZZ0A 4JV5B 4P4SA 1N7JA 1M34E 3TQFA 2VK8A 4FILA 2YY7A 2YZMA 4EHKA 1SC1A 2NO0A 2NO7A 4LV5B 3VSCA 3SC6A 2WNIA 3DWIA 4Q9JA 5E0KB 5E6RB 2QPAA 1YR8A 4KDFA 2G5CA 3P1JA 1GNQA 3VO9A 2HQRA 3ICPA 2GFHA 1ZCFA 4WJZA 2X6RA 4JLSA 3WYCA 3T7EA 1DBRA 4ND8A 1PNVA 3ADOA 4V0RA 2QI9F 4EI2A 2ESRA 3V8QA 3HU3A 3NRJA 2CZQA 1C9JA 1PSZA 1Z4NA 2M6LA 3KPYA 4F04A 2ADOA 3CRW1 1S2LA 1EFVA 4BNKA 2V3VA 1I3LA 4AZ3B 2EJWA 1U1CA 2WG2A 1VSQA 4H3VA 5ELLA 1CQPA 5FLKA 4HPJB 5SYNA 5BW8A 3B6EA 3W90A 1GOTA 1K6EA 2J3HA 2OB2A 2WWWA 3PRJA 1XEXA 5A05A 3NQ41 5LP6C 3S4YA 2NVUB 5L40A 4PYMA 5K2OA 1OB5A 1G0NA 4O2RA 4YC7A 5DTEA 1NBME 1M67A 2I5PO 1MCZA 2JJ2D 3E22A 2RHWA 4M8SA 4DILA 4FCWA 1GD1O 1PCXA 3OO1A 1C9DB 6NULA 1MORA 2EWWA 3IEVA 1JJFA 1QYXA 1ZESA 3QWIA 2ZUBA 1A77A 3SSNA 2PWPA 3HLYA 5A5FA 4MWSA 1A4RA 2H9IA 2XJ4A 5E38A 3EEQA 3RFCA 1SCBA 5JYBA 1AS3A 1TKRA 4U8HA 1G59A 2XYVA 1K9VF 2IL1A 2BFCB 5GMOA 4YV2A 3FZNA 3PA6A 3IURA 1HMPA 2WD7A 4W1SA 2NADA 4RIGA 6Q21A 5H68A 1AKUA 3TR6A 1V2GA 4LE1A 1RM5A 3ELDA 1MW9X 4UBJA 5FWYA 2BPOA 4F3CA 1EUZA 1SM4A 1UDXA 4UBOA 4ACAA 4US2R 4J16A 1ENPA 1A9XA 3IQXA 4HLCA 1R9NA 2G9VA 3KSRA 3TRKA 3GLHE 3ZV7A 2X0NA 4JR2A 4X1OA 4A8PA 1BA2A 2H63A 3EH2A 4D80A 4ZK2A 3NATA 3HABA 1DKOA 3KVNA 5IT9A 2JS7A 4A91A 2O2SA 1XD2A 4ID3A 4K9PA 3WMEA 4QDUA 3RFUA 5JEDA 3DZFA 1NUHA 4AJ1A 5HJ7A 2JFVA 4ROTA 4XDYA 1MMFB 3OT5A 3HSYA 3HO8A 4GBJA 4IQ4A 1WW8A 4RMIA 5FA6A 3H9CA 4BQFA 4EY8A 4B32A 5I48A 2NV2B 4Q3KA 3AF6A 2OV6A 3DBVO 5AM3A 5HQ3B 4JDPA 1GADO 2MSNA 4NECA 4G24A 4EW2A 3BDIA 4OM8A 3OOYA 4OH7A 5B3JC 4K46A 4AP9A 1JDSA 1K8RA 2BMDA 2I87A 2QLJA 3FCSB 3OX1A 4KR0A 4CQMD 5ALVA 4OYRA 2XCRB 3AKEA 3H5WA 3W5VA 3N0XA 3H1BA 3OZWA 3OSZA 4CFSA 2V6GA 1CUFA 1UT8A 1WU7A 1Z56C 1HL3A 2P6MA 2VDPB 3B2EA 2G7MC 5CLHA 4EUNA 8LDHA 1QDEA 1P4RA 1RQPA 1E5QA 1MLDA 1OLUA 3UNXA 1BS2A 1VCOA 1LGYA 2UV8A 3GELA 3K9NA 4R1MA 1FYEA 3RRFA 5HKOA 1DIRA 3U7QA 5L7TA 1U0BB 2I65A 3EXFB 3B89A 2QX9A 3D7NA 3VYVA 1U6KA 2EXXA 3R5FA 2O06A 4RUKA 3ZBUA 4N40A 3R3ZA 2ZVJA 2C5AA 2DKOA 2XTJA 3N2LA 4TMWA 4P0QB 1G60A 2FJUA 4R4JA 3FZEA 2QMQA 3KLMX 4YVFA 3S2SA 2IOHA 3LPLA 4QXQA 2I91A 4DIKA 3OY7A 4ZO6A 3A6GA 3RVMA 3N2YA 5EIOA 1HLGA 2DCUA 4H6WA 1ZN7A 3EGEA 3NALA 4EAQA 4E2YA 3GRVA 5FWDA 4EYEA 3VOAA 3CUEF 2XMRA 1JJIA 3U49A 1T2CA 1Z5NA 4IFEA 2PKEA 1UBRS 3G68A 3NUZA 1WVIA 2P3SA 1YK0A 3R75A 2A9FA 4WXEA 3TCXB 3RS9A 4ND2A 4P53A 4YAIA 2PM8A 4M89A 3QEMB 3C3CA 4HYYA 1B43A 3RTGA 1DOZA 3DTVB 4RCYA 4CIWA 3VU1A 3SHVA 4KTVE 4C0HA 4FFLA 4J9UE 2C4HA 1MPXA 2DLNA 3IB3A 1ELOA 1PJLA 3CNLA 3F5QA 4UHJA 4ZRMA 4UM5A 1SXPA 2QT9A 2ZB2A 2DC1A 2B8JA 5AVJA 2NPFA 1JEYB 3UWPA 2P0YA 1N1EA 2CD7A 2M9MA 2DWPA 4QELA 4ALJA 3HY6A 3QV2A 4GPZA 4IUCS 3FY4A 4W1PA 4IIFA 3WMFA 4F96A 4YV0A 3N2KB 3IJ5A 4QXOA 4U5XA 1SUSA 2E5FA 4PRKA 5CLJA 1T5BA 5JAIA 1X7WA 2V7VA 3DV0A 5U1PA 3CNQS 3GUZA 3RRYA 1M6WA 3CR8A 8ADHA 2PWBA 3UW3A 3TGPA 3E9EA 3ND6A 4OXQA 1REQB 3CF2A 4DQVA 3ND8A 1IQPA 4ZMBA 2Z6UA 2FEMA 3B1ZA 3C5EA 4QQ8A 4JJ8A 5J2UA 2IU6A 4AG5A 2D0IA 1XO1A 4J0DA 3R7BA 5CDTA 1YCDA 1QRRA 1NJGA 1WXDA 4P08A 1W5AA 3ZW8A 2VYNA 1XZBA 3KLPX 5ALRA 1JEQA 3HRKA 1UAAA 2DTXA 2FFJA 3D4OA 1JTVA 4X1KA 3ROXA 1ZEMA 3ZHQA 2ZXUA 4KQ6A 3RTDA 4M9QA 3Q0EA 4MR7B 4UD6A 5IARA 4GI7A 2XH8A 5JSZA 2W4IA 4BFZA 4O4LA 4YAGA 1U04A 2PZKA 4GPTA 5EVJA 3ISTA 5ARDA 1U8ZA 2QNIA 3L0CA 2EP7A 4K03A 3NANA 2ZYUX 3O1LA 4AECA 2ZRKA 4N47A 5L51A 1G7TA 2JF0A 4LG1A 4Y9RA 5G2OA 3AETB 3OQBA 4BAUA 2H31A 5LMCA 2RAUA 5I01A 1F7UA 1Z8NA 1MP0A 3OQIA 2AUMA 4N8DA 1GTL1 3SICE 1SPBS 1DAEA 5KVCA 2WUEA 5KUTA 3EIWA 4KQ1A 2QMEA 4KMOA 5GTDA 3W9YA 1QMPA 3LKDA 4IIEA 4LHWA 3VDXA 2MTBA 3GWGA 4UOEA 3CKKA 3C24A 3FNEA 2AMLA 4RM2A 5AI0A 5ALGA 4FDMA 3VR5D 5SY6A 3ELWA 3K0KA 2JFOA 4JJGA 1Y8QA 4TMVA 4OXYA 5AW3A 3HS3A 2P2DA 1SVMA 3O8BA 2Q99A 3JWHA 2WQZA 1X7GA 2YHIA 1MUUA 2H8KA 3QPAA 3RWMB 4D9HA 1Q44A 1P3DA 4EBFA 1IWOA 1N2JA 4L9WA 4TVSA 4YT4A 1G8HA 4R54A 4FKMA 4EJ0A 1I1QB 4X6UA 1M2OA 1Z16A 4W1RA 5ED4A 5EUMA 2R96A 2JL1A 1C7EA 4FHZA 3I9LA 2H1CA 4R9VA 8OHMA 5A7HA 2Q5FA 1TKBA 2NUAA 3ZKAA 4LUCA 2CC2A 1YRHA 1CF2O 1Y37A 1BX0A 2JVJA 2DMRA 3OM0A 5C8YA 5JUWA 2FMTA 1KVUA 2QTVA 4MQEA 4R1PA 3WRYC 2VSYA 3CJQA 2HQ1A 2AN4A 4R8VA 1WDKA 2GBCA 5EMJA 1IATA 2ZK7A 3T12A 3DONA 3L8FA 1HUQA 3OIDA 4TLLB 2ID7A 2GKGA 2OPBA 2WSIA 1VYVA 2BELA 3OTGA 4E3ZA 5EHXA 1W5BA 1VHDA 4PC6A 4I2NA 1UINA 1Y7HA 5KSPA 1QJ4A 3OE1A 3L5OA 3MILA 1R0WA 1Z4LA 1U1GA 3QVXA 3SQLA 3BTVA 3REQB 2XEXA 1X1SA 5KPDA 3IE0A 2NX2A 2HNBA 1N57A 2GASA 4IUDS 4W5RA 1E1NA 4E4TA 1SH7A 3HCNA 2XBUA 3GQBA 4BGIA 2OB1A 3DULA 4PZUA 5B7PA 5CM2Z 3EZ9A 3PUXA 4CV2A 1YS4A 1TCUA 4J7UA 4UTPA 5JQGA 2QN7A 1Z8FA 3NTUA 4JBXA 3L82B 5FFFA 1QPBA 3GEBA 3DDNA 1U2GA 1XZFA 3AW8A 3NHJA 5BMVA 1Z75A 4UATA 1I7NA 1OBCA 2X3UA 5E7IA 4ZU3A 1CJTC 2LXNA 3VH2A 3G9ZA 5KWSA 2AH5A 3HUDA 4JUIA 1H94A 1HE4A 1VE7A 2IV7A 1GAQA 4RM3A 3OF3A 4YUZA 5I4KA 2R8YA 3SHWA 4DUZB 5KI6A 4I5GA 5CG2A 3MGKA 3ZHYA 3U44A 1J9EA 2IYNA 1M0SA 4Z9AA 4D57A 4RULA 2XCTB 4M83A 3ZTWA 4LFBB 2O2JA 3OJOA 4ZPJA 2OO5C 1XKLA 2R1UA 3ZHZA 3QG5A 2WNHA 1SU8A 4X20B 3VZQA 1Q0PA 1NR7A 4ADSG 2HF7A 1SK9A 1MOSA 2V6IA 4TLEA 2VTEA 2P4QA 3GAFA 2VHCA 4R2WA 5C80A 2WDPA 3MT8A 1D8AA 2ERCA 1CEQA 3LOPA 5D00A 3TW0A 5ADUS 4L78A 5CK4A 5CX4A 1Y9EA 3OJLA 4LC1A 3L8EA 4OH1A 2HJRA 2ZWVA 1O4WA 3VOBA 1F2TA 1B1AA 2IF0A 2OGSA 3L0BA 2ECPA 5HF5A 1XMXA 1KO1A 2J4CA 4GBGA 3SR0A 4AY3A 4BNDB 4ESEA 4ESOA 3MT0A 1YS6A 3MJFA 2NO4A 4P7KA 3VHXB 4EGFA 4YMUA 1PWXA 2WJZB 3C8DA 3DL4A 3JQFC 4NOMA 2Z2IA 1UZMA 4Q7JB 2IYEA 3BRSA 3X2EA 3HCDA 1OQAA 4OI1A 5EJEA 3VHQA 1OH6A 3DE0X 3IR5A 1G4UR 1E2GA 4CMAA 2Q21A 3HYRA 1RMQA 2XSZD 3OLXA 3HMKA 3KKLA 2C2WA 4WXPA 2BUBA 1YR7A 3G1WA 3KOXA 5A7GA 5TQ2B 1U1FA 1B00A 2V4UA 1TIKA 2X13A 3DDZX 3QHPA 5JZVA 4Q3OA 3QOWA 4M9UA 2Q1XA 2J9YB 4DLPA 1KK0A 1WSBA 2HRBA 2GX6A 4KPYA 3TBKA 1LH0A 5JFOA 4KSBA 1TZCA 3TPCA 5CA0B 4NY1A 3UN1A 5FLYA 1WCWA 1AF7A 3IPYA 4N3CA 5I9BA 4HX9A 2L18A 3U3KA 4B76A 4IO0A 4IIDA 5IJ0B 5J43A 3AJEA 1JDJA 2HSZA 4JA0A 2WMNB 4ZI7B 3FVQA 5IAGA 1BJTA 3GLSA 1T5TA 3R7FA 1YF3A 3OFND 3RJ9A 2CFSA 3WNQA 3Q8KA 3OQHA 3IP1A 4KDCA 5JJIA 1E6UA 4JBYA 3TD6A 1Z0ZA 3HZOA 2BLLA 2O57A 1AKRA 4NOJA 3A9RA 3BH0A 3QKWA 3NC1C 4C3VA 4NZPA 2BMJA 3HYSA 3A4VA 3R2JA 3HBJA 3O8LA 3ZHRA 2FPOA 3EIFA 2YXNA 3NTLA 2PEYA 1Z88A 2BTQA 4KKXB 4X3PA 2FE1A 5D84A 3V4SA 5BNTA 1SD1A 4CEHB 3Q85A 3MWDB 4Q05A 3TOXA 4MLCA 1YSCA 4C88A 5HJ5A 4MP3A 2WAMA 1JIQA 3FYCA 2H5IA 1XZIA 2ONKA 4XA8A 5G1NA 3CLKA 2G77B 3OM9A 2XE6A 4HWKA 4QEZA 5BNFA 1BJRE 1UM9A 4BO0A 4M1MA 1XPJA 1E77A 1D0IA 3ENNA 4UNSA 4YCSA 5A4FS 2PFGA 2WMOB 2O2XA 1NT2A 4Z53A 3C97A 4HFRA 2EVWX 2IELA 3Q6NA 4QU5A 2C42A 2VJQA 4BV8A 1N2BA 4RQAA 3R7SA 1QBGA 5HKKD 1AK1A 3KDSE 1WPQA 3N0WA 3ESXA 2B4QA 1CG6A 2JIMA 1WVMA 2XNCA 3FTCA 4HDKA 1AKMA 4NZOA 4UUMA 3AM1A 1IUKA 1NUUA 4ER3A 4MK4A 1X92A 3C5HA 2AFIA 2RE8A 5IDYA 1LLFA 2FFQA 2R60A 3FNBA 3QVGA 4PSCA 4W9RA 5TEWA 6REQA 2W2MA 2QOEA 5J2TB 5IUJC 2BFBA 4BNUA 1Z4JA 4KQ2A 1M1ZA 2FSGA 5DWVA 4ZKDA 4JUCA 1DKNA 2C7PA 3LUPA 1PX2A 2EDCA 3ENVA 1Z0UA 3H75A 3PWKA 4KRXA 5K8IA 5J9FA 1RCTE 2I1QA 4V24A 4P4SB 3SKYA 1EJBA 2HM7A 3UJ3X 2VK1A 4FGLA 2GUWA 4D3XA 3UKDA 1QX3A 5AFSA 3O94A 5FBQB 3GDFA 3RW9A 2B83A 3WR5A 1GFSA 2QQEA 3AZOA 4Q7MB 2BM8A 2O2GA 3DBLA 4FN5A 3RG2A 5HZGA 3X2SA 1Z6AA 3AERA 2CVHA 2JAHA 4A4DA 1E1YA 4JS0A 1OC2A 3GLUA 1BSVA 4FS3A 4YNBA 1YDMA 2OXFA 3AI1A 2QW8A 3QU4A 4R2HA 5E8JA 1G1AA 1UT5A 1ZZEA 4BYMA 3PRKE 4MW5A 1M7HA 2O2EA 4X54A 1OZFA 3E7PA 4FR5A 3QUAA 4JMLA 4HOYA 4FX2A 4NPAA 4UDOA 1A7KA 4YONB 1C9MA 3UV6A 3EPKA 4HLUC 2VDWA 3FKSD 3PFHA 2GJSA 4QYIA 4Y6PA 3IALA 3KZCA 3OOJA 4CR8A 4EKEA 1QWOA 5BXYA 5L7YA 4DF3A 4OMFG 5EJAA 2IHKA 3AVWA 2B1RA 3A9SA 3ZX4A 3E22B 1X7ZB 2FPGA 4YMLA 1ACMA 4PU0A 3VTAA 1S5PA 5HTOA 4TLAA 4G9EA 2FTKE 1HR0B 2VJBA 2G0NA 3ZWPA 3T4XA 2EFHB 3T3GA 4EPRA 1EVQA 2G04A 1WSDA 2P4HX 5DNCA 1MOZA 4QYWA 3DCJA 2BY4A 4TS3A 3M4YA 1JQAA 4DBVO 4B81A 4G07A 3HJTA 3VR6D 2IZ5A 4CM6A 4NBNA 1LBHA 5IANA 1RJWA 1PS9A 4ZYYA 4FWBA 3L5KA 1KR5A 4G84A 1C3JA 2F1HA 4CKBB 3TX6A 4IIJA 2WD7B 2H2FA 1N5MA 5HUQA 1YDFA 1ZK3A 5KQGA 1LLQA 4AICA 3ZNPA 5CFZA 5D5QA 1LPAB 4KXUA 5AWFC 2GO1A 1JGTA 2IEYA 2ZSEA 1XTVA 2OV3A 2IHTA 5DN9A 3KOWA 2CHGA 2DJ5A 1A9XB 4YP7A 5HMLA 2ZROA 2G9NA 3UB4A 1XRQA 3NAZA 3FZYA 1KDZA 3ZCTA 1LTHR 2ZQYA 3PF9A 1M2FA 1N6RA 2NXWA 4FN4A 3SIWA 3KXKA 1V1RA 1CU1A 3FNFA 5AJWA 2ZRPA 1G3QA 3TG2A 1ISPA 4HWGA 2JLBA 4MV7A 1Z2CA 1ULTA 1G8GA 3QE0A 3EXHB 3BVPA 1E3TA 3BIXA 3MTDA 1MFPA 3N2ZB 2G40A 1ZD3A 2EZUA 3IB6A 3P2IA 4FXOA 4M0PA 3RIEA 4EB3A 2ST1A 4ZN6A 4DR3B 1NOJA 3WL8A 3DP9A 4NLLA 2XX3A 1CW2B 4Q9KA 4Z99A 4JGBA 3GRCA 3LC7O 4ZGWA 3VBCA 5DTQA 4UTRA 5BSUA 4H6PA 1XNQB 4BMZA 1EUCB 1R1DA 3S3TA 1SCIA 2VWQA 1WABA 2GZ2A 1Z35A 4JKYA 4QPDA 1PGQA 2A0WA 4NCXA 1KI1A 3I12A 1KI8A 4NR0A 1YQQA 4DG9A 1X39A 3PUHA 1QPZA 2NTEA 3TTVA 4F5YA 1HT1E 2IZZA 3C3PA 3N75A 3O0TA 4IKEA 4WJKB 1QVRA 2H5EA 3IAS6 4KMRA 3T38A 1PX0A 4KN8A 4JC8A 3R3HA 5IC4A 3FPJA 5C3MA 3HFGA 1KMIY 4C3ZA 4EZBA 4ER0A 1EFPA 5IBRA 2CLIB 4L5JA 1TJNA 2H1WA 1YIAA 2A9JA 4MTLA 1FSGA 2E0IA 4YCDA 5AW4A 5EG5A 4KTTE 3QA3E 1F5NA 3VKWA 2N1MA 1LV7A 2W8ZA 1VIAA 2XMDA 3HADA 2A59A 3THWB 3BMNB 5C8VA 2UU9B 4DARA 1XYGA 3DHNA 4ZANA 4P80A 2AQ8A 4CZ2A 1XLWA 5HHTA 4DR4B 1QTQA 1PE0A 2C5LA 3T15A 1FMJA 2H1IA 5IUKC 1XCPA 4CQMB 4V02A 2IUYA 4P4TA 3RVJA 1VRVA 3HDYA 5C46F 4QSHA 3EZLA 2J4FA 3TZEA 3PUJA 2L82A 2WJJA 3I23A 3PF8A 4KPUA 1KZHA 3VNRA 3OP4A 3BQNB 1QZXA 3A1SA 5F7JA 1QFSA 3QMPA 3G8DA 3BILA 2PA3A 2XEDA 2CCKA 3F0TA 1N6IA 1USIA 5HRCA 1OFVA 2Q5QA 2BF4A 3TL3A 1R0LA 4JSTA 2G0TA 2VUSA 5CNJA 1V48A 3HI4A 1VCMA 1ZU5A 2GEKA 3CF4G 4US0R 1T6XA 5LJLA 1CUSA 4DUYB 2H2HA 5TDHA 3SCZA 4MO2A 3O8QA 3JZIA 1VHTA 5AIBA 5DK6A 3RU9A 1GQ2A 4YUVA 3HLTA 4UUQA 2QKYA 4G97A 5EEGA 5BSMA 1JXOA 1BG6A 3BAFA 2OVFA 1GL7A 1MB4A 3C6XA 4TL6A 5HKLA 1PZGA 1SCKA 2HEIA 1FU7A 1OZAA 2IOFK 4ETWA 3SYKA 4FONA 1V4BA 3D8NA 1O7JA 5CM9C 4DLRA 4UM9B 3SQWA 3EAQA 4I1VA 4X60A 1XRMA 4MUJA 3DV0B 1V25A 1BGWA 1EAYA 1GFZA 1PJ3A 2D7JA 3GV0A 3S8EA 4XI9A 3F3MA 3SBEA 3EDYA 3IUYA 2PS3A 1INLA 1E1RA 2FV8A 1ZH4A 2I29A 2QEQA 3O31A 4ZVUA 4YIHA 3CX3A 3I2FA 3DYVA 3GVXA 5DM1A 5ER6A 3P8ZA 1QIJA 1RKVA 1ZUWA 1E9BA 1QRUA 4FHFA 2FCRA 4P4NA 3S2FA 1RPNA 3N8HA 4OA5A 3GNTA 2QUZA 4XWOA 3W2GA 1ETHA 1JDTA 1SQ6A 3W78A 5LFAA 1WUHS 4DZZA 5LQCA 1XDWA 1IDOA 4Y2RA 5EJ5A 4X1KB 4XTCS 1G20A 2CHEA 4JOSA 1G4AE 4YCAA 3J81k 3P2MA 3WK4A 2WTXA 1S1MA 3EGCA 2FWRA 1GDDA 4OMDA 5JSZB 3G9XA 3K9HA 3PFIA 4M86A 4QQRA 4LGMA 4F3NA 3N70A 3K0SA 4XPZA 1M74A 1J21A 5ALKA 2GZHA 4ESVA 1QIDA 3K16A 4RLSA 1ZZGA 3S99A 3IDOA 5J23A 4MYTA 5SZJA 1CY7A 4MW2A 2R1TB 4R5HA 5DT2A 4FGZA 1NBWB 2BFOA 2Q27A 1K9SA 1PK9A 3CZMA 1SAYA 1T6YA 3G17A 1HQCA 2BFDA 3TQIA 3OCVA 2B25A 4Q15A 4R05A 2Q50A 4AKTA 2R1ZA 2V8BA 2ZCVA 3BSWA 1RAEA 1Y8QB 4UE2A 3JAWB 1K92A 5DJ5A 2G6BA 1SN7A 3T6KA 4C7OA 2ZREA 4R40A 3RC2A 2VZEA 4EPTA 2YHIB 3HKDA 3L7LA 4I55F 2JVKA 3T7IA 3HGTA 2OCIA 5A04A