1WMSA

High resolution crystal structure of human rab9 gtpase: a novel antiviral drug target
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
174
structure length
170
Chain Sequence
AGKSSLFKVILLGDGGVGKSSLMNRYVTNKFDTTIGVEFLNKDLEVDGHFVTMQIWDTAGQERFRSLRTPFYRGSDCCLLTFSVDDSQSFQNLSNWKKEFIYYADVKEPESFPFVILGNKIDISERQVSTEEAQAWCRDNGDYPYFETSAKDATNVAAAFEEAVRRVLAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High resolution crystal structure of human Rab9 GTPase: A novel antiviral drug target
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
molecule keywords Ras-related protein Rab-9A
total genus 55
structure length 170
sequence length 174
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1wmsA00
1XMVA 2EQBA 4LYJA 4Q1BA 3CR8A 2ZI4A 1E2DA 3WY9A 3D8BA 4AIIA 4A1FA 4EFLA 2QGZA 1RKBA 2JAQA 4D26A 3I62A 2DFKB 1IJFA 1D2NA 3GJ5A 1CR0A 3QG5A 1XB2A 3CRMA 3GLHE 1QVRA 4JYCA 2WIAA 1GG2A 4Q9KA 1OFHA 1NVUQ 4E09A 3W9YA 2CK3A 2QU8A 3PENA 2AK2A 4FINA 4YMVA 1G3UA 4A8JA 4DJTA 1JECA 1TTTA 4AKIA 3U7EB 3WP1B 1G8FA 1JJVA 521PA 1A2KC 1CTQA 1P3JA 1FMLA 2QORA 4TLCA 3R8CA 2RGGA 4PQRA 5FTNA 3SHFA 4YONB 5BW8A 1DAHA 4NH0A 4DRZA 3B1ZA 4B3XA 2OLJA 1YR7A 3U44A 1COWA 4TL9A 4NL4H 2EWVA 1LFDB 1MV5A 2ZROA 3R7WA 2KBFA 1MO6A 2JGNA 4QGAA 3K9LA 4C2TA 4R2IA 4DIEA 3LVRE 4C0SA 4I1OA 5FOXA 3IHLA 1BIFA 3C4JA 3UPUA 3LD9A 3QBVA 3NVAA 2WSSA 2GJ8A 2IXFA 4C0QC 2IYZA 5H68A 2JLUA 1KI2A 2ZE6A 2EYQA 4V0OA 2FFHA 4EPXA 5HCNA 2D4HA 1ZP6A 5E7MA 2D06A 2MSEB 4ZO4A 2RGCA 3L0SA 5B58C 1OLOA 1EWRA 1X8JA 2EW1A 3FVQA 5G3ZA 4OI1A 1EFRD 1ETUA 2UZIR 3TSZA 1M34E 2WAYA 1RJ9A 5HR5A 3D6TB 1G9XA 1BYUA 3SI7A 4OQLA 5L3VA 4UXJA 4BLQA 4CW7A 1WBDA 1WDTA 3WBJA 4HAWA 1CXZA 2B8WA 3NBYC 3I3SR 3OE7D 2QROA 4OQMA 2ORIA 2Z5FA 4NDZA 3SYNA 3WNDA 2G0TA 3BOSA 1XBTA 4DLXA 1NKTA 3ZVNA 3FMOB 2HYIC 2QEQA 2I4IA 3BGWA 4Q7KA 1R10A 3AF2A 3EIHA 4O0MA 4DLTA 5LDDC 5KDDA 4DSUA 4MYCA 5EP2A 1G5PA 3IEUA 2KWIA 3VX4A 3M6AA 3THOA 3UWKA 3TSWA 3SBEA 5EQTA 1ESNA 3A36A 4LHYA 3KKPA 1T8TA 1G19A 1X6VA 2YINC 5GJCA 3B8HA 3BRWD 5TY0A 5JEDA 3TR0A 3B7GA 4C0BA 4UNRA 2JLZA 4TT3A 1EFCA 1NIJA 3OEEA 4I1UA 5JBQA 4BQSA 4DHEA 1LTQA 1SHKA 4XWAA 1WB9A 1IXRC 4DWJA 2KB0A 1H8HA 2E87A 2D3WA 2KBEA 4MUBA 4JLMA 2GDJA 2NIPA 4F4CA 1T3HA 3KUCA 4NKRA 5DHFA 1GRQA 3BAFA 3CWZA 2P67A 4JL5A 2A5FA 4W5HA 4AKHA 4P4SB 1Z28A 2O8BB 1HEIA 2ZYTX 3VR2A 5IDVA 5A0FA 4KCGA 4PSAA 2FEOA 3P4YA 4P4TA 2QTVB 4DDVA 4BECA 2FFQA 1WRBA 5KSZA 2WKPA 3Q72A 4XVQA 5E7IA 4PHFA 2BEKA 2F43A 2WIBA 1UJ2A 3ZZTA 1K5GA 3W6OA 5CB6A 4DCTA 5GJWC 2F6RA 5KYKA 1U9IC 4GZLA 1E0SA 3NBFA 5E3HA 1E3MA 2YHSA 1G8PA 2HUPA 3LX8A 2ORVA 2ZE5A 3QXSA 1UDWA 4JJKA 4OBEA 3TK1A 3WP0A 4AD8A 3K8YA 3L0PA 4TYNA 1TU3A 3BH7A 4LC0A 1VDZA 1UKYA 2R6DA 1G5TA 2PL3A 2QA5A 5EXPA 2WICA 3TJZA 2A30A 2QMUA 3FHCB 3WXMA 2FFAA 2PJRA 1P4SA 2K5UA 1PLLA 3DMDA 2IWHA 3U3KA 5JSZB 5CYPA 4CEHA 1UKEA 4N3NA 4U5XA 4F93B 4MGZR 1JR3D 2ZVQX 3MRSA 1N6PA 4LZZA 3BXZA 4HLUA 1XTIA 4IJMA 4WOPA 3I72A 1Z6AA 2CLCX 2GXQA 4RD2A 1QHGA 3SJZA 4S35A 4LJ6A 1D2MA 1X8LA 1P2VA 3C16C 3CZQA 1R8QA 5KNBA 3FTQA 2QZ4A 3MLEA 1P9NA 3TUJC 4B2IA 2ZR7A 2QBYB 4QHYA 5FBVB 3B1VA 2HDNB 2OCAA 2ZRAA 3P1JA 4OK3A 3W90A 3THYA 3TQFA 3ZIAD 4MKGA 2VSFA 1E79A 1T5LA 4M8NE 3FHOA 1E6CA 4YXWA 1N2CE 2FV8A 2HJGA 3WYAA 4C4PA 4CEIB 3ADBA 1XD2A 1ZIOA 1T6NA 1KK2A 4LYHA 2IS4A 4H1VA 1TQ6A 2ZI7A 2UVQA 1GKIA 2OV2A 3NEYA 3CX7A 4V03A 2GZDA 4M1YA 3W8RA 4B3GA 1A1VA 1XMJA 4EPRA 1BYIA 1XU4A 2BC9A 3R9XA 1Z6GA 4PTLA 1KKLA 2O8EB 3OIWA 3E70C 4RKEA 1AN0A 1G8YA 1Q1EA 4TMVA 4CGZA 2IK8A 1D6JA 2WMOB 3L0OA 2RB4A 1JPNA 5DO9A 1E0KA 2JJ2D 1IY1A 3Q85A 5J40A 4NYIQ 4B44A 4EIWA 3GLIB 4TZ0A 3ETLA 5KSOA 3U4QB 2CK3D 4DSOA 1DO0A 1EX6A 3OZXA 3MWYW 1DAKA 1P9WA 1Y63A 5L3SB 1YJ5A 1I2DA 4RSGA 4YMSA 1EG7A 2NO6A 2ODEA 3EAQA 3EPLA 1IM2A 3MFYA 4F92B 3AKCA 1RRFA 2BJWA 1CR2A 5TB5A 4RFVA 2O0HA 2X19A 1E2EA 4XD7A 2FZ4A 3HU3A 4OHYA 2XAUA 2CHQA 4F4JA 4K8OA 3NG1A 1ZU4A 2J46A 5JS7A 3WMGA 1CJVC 2O8CB 1M1YE 1QDEA 3ADKA 4UQOA 5FI1B 5JCZA 2ZRLA 3GJ0A 3C41J 3OEHD 4CZ2A 1OB2A 1AQYA 1II0A 3MAAC 3C8UA 2AK3A 2XSZA 2GCOA 3KKNA 4DLVA 1U90A 3OEED 5FFMA 3U3MA 1OHHA 3ONWA 4JVSB 4AG5A 4HUTA 1KMQA 4JKIA 3MWLA 3KB2A 821PA 3CF2A 3TH5A 1Q1ZA 3SQXA 2WWXA 4PAQA 1NVXQ 2QI9C 3SFZA 3NDBB 1PZNA 5AJZA 2P65A 5DI9A 3GPLA 2GBLC 4CT5A 1KY2A 4D4KA 2FJUA 1GSIA 4KV9A 4V0NA 2G77B 3ADCA 2G9NA 2V6JA 2ZU6A 4Q1CA 1F60A 5UKDA 1XJ0A 1IN4A 3K1JA 4DLUA 3A37A 1R8SA 3C14C 1KOFA 4Q19A 1Q12A 1B23P 1Q1BA 1W47A 1NG1A 3OE7A 4JS0A 3QF4A 3RRMA 3KKOA 5CLLA 3R9IA 3IIKA 4JLJA 4G5OA 2CVHA 1E0AA 4Q4HA 1FQKA 1FTNA 4AC9A 1IONA 2FZLA 1DAIA 2XTZA 3NHAA 1NRJB 4PANA 2O8EA 3IQXA 3GQBA 2W6IA 4I81A 4LC1A 4D0GA 3AVYA 3LLUA 2AKYA 3AUXA 2PCLA 4HDQB 4NCHA 4RFSA 4EKDA 1TEVA 3PUYA 2BBTA 1XZQA 3GLFA 2W2XA 1G3RA 4TSFD 4C2UA 2VRWA 4EAQA 1OFIA 3W5IA 2VEDA 3QKUA 5L3QA 3FB4A 3U3OA 2PZGA 4A36A 4A2WA 1R0ZA 2YKGA 4JZKA 2QMEA 4C3ZA 3QY0A 3QENA 1W4BA 5CM8B 2ZR9A 3UMFA 3AQ4A 1CU1A 3PIRA 5HTKA 3I8SA 3QXCA 3E2IA 1NMZA 2YWEA 3D31A 4Q4LA 3VR4A 3EZFA 3FPAA 4HSEA 5GJBA 3HP1A 4JIMA 3AP3A 1AGPA 2F1HA 2GILA 2ZRPA 4LI0A 3GEIA 1SVOA 1G7TA 1TF7A 5BXQC 1KDPA 3H4MA 4YQFA 1XTKA 3VKGA 1NJGA 1HYQA 3DVLA 5KUTA 4AY2A 2QP4A 5FPHA 3IGFA 4WIAA 2QY9A 4IXMA 3PQCA 5J4VA 4KI0A 4CRWB 5BYKA 1NLYA 5CIWA 4XD7D 4GDFA 2R62A 2B7BA 1MO5A 3B78A 1KJZA 4LWZA 3GLFB 5KNCA 1P7CA 1ZU5A 3CRRA 4BFSA 1GL9B 2O8DB 3HU2A 2B7CA 3FKQA 1KI8A 2P6UA 5TV2A 3SNHA 4M0LA 4IXNA 4FMDF 1KO8A 4NZYA 2ZYVX 2WWYA 3N2EA 4FMCB 4BZPA 3H84A 3D7MA 1WA5A 2FGKA 2HCJB 4KVAA 2I3BA 5CIQA 1E1QA 4DUGA 1ZIPA 1Z83A 2GRJA 2OEPA 3Q7QA 2R6AA 5LD2B 3BORA 3A1UA 1CJKC 3LNCA 1GAJA 3I4LA 2IS6A 4HAVA 3EIEA 4C0KA 1BO6A 3RS3A 3EZ6A 4IOLA 4EPVA 4GOJA 4PFSA 4ZDJA 5KHOC 3ASZA 1U94A 4DLYA 4DT1A 2XITA 3H86A 1UBGA 5JWRA 3EW9A 1OJLA 3GCGA 4NYIR 2R6GA 4OK6A 1EK0A 1P2UA 3ZIAA 4EJSB 3A58B 1SVMA 1OXXK 2QMOA 1OKKA 2DCUA 1I4TD 3Q8XB 1YE8A 4GI7A 3QF4B 4NYJQ 1KSFX 3U4QA 3AM1A 4PSKA 1XXHA 4E03A 4M22A 1QHSA 5C4GB 1EESA 1G5RA 4LJ4A 2HJVA 2V6IA 1VYTA 1G8GA 3L43A 2QRNA 2CE7A 1E96A 4CEJA 5LB4A 1FZQA 1O3YA 2VP4A 3A1WA 1M7HA 3CBQA 3OAAA 4KODA 4UNPA 1YZQA 2BHRA 1P6XA 1ZJ6A 2GKSA 5KSYA 1SULA 1DBSA 2C2HA 5TVKA 4B75A 4V02A 1A4RA 3THYB 1AJEA 4LV8B 2ZUCA 3IDQA 2C99A 4PPFA 4WZAE 1N5JA 1QHYA 2RGNA 2OUKA 2SHKA 4YDHB 4URVR 1NBME 3HYTA 1Z6TA 2GEVA 4QXAA 2QAGC 4GP6A 1WF3A 2QAJA 2W83A 4FMCF 4PZLA 1YZUA 1Y3AA 3UKDA 1FUUA 3T15A 5BN4A 1EX7A 2G3YA 5JMTA 2V1XA 2OHFA 1W48A 3CF6R 2VP2A 4IDHA 1XF9A 4FW9A 5FTMA 3MGCA 4DIDA 1TX4B 3GFTA 1Z0IA 4QGHA 4JMPA 3BJIC 5BQ5A 1DELA 2F1JA 2RGNC 2ZRKA 3LFUA 4FD2A 3UG6A 4IHQA 4EQ6A 2XJ4A 4MKIA 1KDTA 1SXJA 2IYVA 1K8RA 1HT2E 2WWWA 2FN4A 3QPVA 1XCMA 4Z1MD 1UKVY 2F7SA 2GZHA 1O87A 1Q0UA 4M9QA 2ZRCA 2W2VA 5FL7D 1ZM3A 2OFXA 2CHGA 2XB4A 4JVNA 4BEBA 1RZ3A 2WJYA 4JL6A 1MO3A 4JJZA 1KKMA 4ZCIA 3GLGE 3THWB 4F4IA 2WPDA 5L3SA 2XXAA 2FGJA 4PC6A 3AKEA 2RH5A 1UDXA 2KI5A 2VO1A 2YJTD 4Y0AA 5FBLB 1II9A 1N3BA 2PT7A 2H5EA 4E07A 1R0YA 3AH8A 2FMXA 3K70C 1KO5A 2XSZD 2VL7A 4HUQB 4B2PA 3SR0A 1P61B 2X8AA 3DOFA 1KI4A 4B35A 4B3FX 4NCJA 4BRWA 2ODBA 1NSFA 1V43A 5CITA 1YZTA 3LX5A 1ZMXA 5D3MB 1ZNZA 4PO1A 4PX9A 5LBIA 4MDEA 4DXAA 3B1WA 5CM9C 2IYYA 5AUPB 5EE3A 2IT1A 4TQUS 2O8CA 2HLDA 2FF7A 1P2TA 4JLDA 3AUYA 5JFGA 1LVGA 2ZSBA 4P4SA 2D7CA 4DSTA 3OESA 3SE0A 1U98A 221PA 4JT2A 1KY3A 4CIDA 621PA 3KQHA 3RRNA 4TYWA 3MG9A 1OT3A 4HDCA 1DEKA 3BFKA 1JXMA 4CF7A 2IA5A 1QHNA 2A2ZA 5EZ6B 1LY1A 1FNMA 4ON9A 1G3MA 3ZDQA 2QT1A 2ZRHA 3CRW1 2ECKA 1XZPA 5AJYA 2ODWA 4G0NA 2BMEA 5HZKA 3GEHA 2C9OA 5JZVA 3LA6A 2CCKA 5JRJA 2GXAA 3B6EA 1G291 2OT3B 1HA3A 4QJ5A 3QKRB 5B2ZA 3AKYA 1BMFD 3BFVA 5G40A 5DYIA 1E4YA 3AVXA 4D6PA 4GOXA 2H18A 3VR1A 1EWQA 3FGNA 2ZM5A 4JLKA 3UANA 1S96A 1VMAA 4WBSA 3U6BA 3O8BA 3GLGB 2GBLA 2ZQ5A 1KDRA 3RANA 4R71A 1RFLA 4TMWA 3PXGA 3FFBA 1OKKD 4M2LA 4B32A 1OH7A 5EJEA 3TQCA 3EC1A 2F1RA 2R6FA 4I1SA 3KZ1E 2ZUBA 1NJFA 1NVWQ 4V0LA 2R9VA 1W49A 3X1YA 3WHKA 3MUFA 3HYRA 2EWWA 5JCPA 2BEJA 1AIPA 3DEFA 1W1WA 1F48A 3SC3A 4KBGA 3ZS9A 5FR2A 5G53C 5EP3A 2VHTA 1US8A 1Z0AA 2ZSAA 4RZXA 3R20A 3X2SA 3RS0A 4DEXA 1EXMA 1JBKA 4B3DA 4RD3A 4GT1A 3VKWA 5KDOA 1KJYA 1EFUA 2GWHA 2Q9BA 1D2EA 1G8HA 2OO7A 1Q57A 5AJWA 4Q4JA 2J7KA 1V5WA 2P5TB 2LKCA 2QE7A 4ESVA 4QM6A 1G64A 4YLGA 2NGRA 3HPRA 4LOAA 421PA 1SKYE 3GLGA 2ERXA 3GJ4A 4RZ3A 3ADDA 4KSCA 4P32A 2FG5A 1TPZA 1EFTA 1H65A 4TSFA 5FTJA 4Q66C 4GSYA 1XD8A 1MH1A 1U9IA 3LAWA 3SQWA 4QJ4A 5ELXA 2NG1A 4Q4AB 1UF9A 3PVSA 3L82B 5IHPA 3SYLA 1Z08A 3K70B 4LJYA 1GITA 1XJCA 2GJKA 3IIMA 1KAGA 4A9AA 3UK6A 3VNUA 3IQWA 3W6PA 3DKVA 3JVUA 4XOIA 4LX0A 1HE8B 2RKOA 3NKVA 3QKSA 2A5YB 3EX7C 3AV0B 2BMDA 2GCOB 1VHLA 4DVGA 4G5RA 4A6XA 5EXTA 2YOGA 4EPTA 3X1DA 3MJHA 4Q02A 1TF5A 3U6KA 4QC2A 2CNWD 2WWGA 2V55B 1N0UA 2AR7A 1KMHB 1E9DA 5E95A 1JALA 2IYLD 3SS8A 4DLRA 1J7KA 2EFHB 1XPUA 3UWOA 1RW4A 3RVBA 1Z0FA 4TT3D 2KSQA 3EA0A 2ZEJA 4A15A 4F7WA 1KK3A 1NBMD 3IBGA 4HATA 4B74A 4A0HA 2CXXA 5FR1A 4GMDA 1GKYA 3PEVA 3T1VA 4BPBA 8OHMA 3T34A 4PC2A 2WJIA 3IO5A 4DDWA 2WWFA 5DGXA 3VFDA 3NBZC 3CZPA 4GOKA 2DPXA 2GF0A 3IBYA 3QUSA 2J7PA 4I99A 2V8OA 1ZUNB 2ZI5A 3SJAA 1DVRA 1E9SA 4QNRA 2JASA 3JVVA 4XTCS 3WNBA 3IPYA 4D4JA 1E2JA 3QJYA 2NZ8A 3ND9A 4LBWA 1AQUA 1KI6B 2QPAA 1ZM2A 1CJUC 2VP9A 5AJVB 1DO2A 4QHSA 4RCYA 3AVVA 3QG1A 3FOZA 1KNXA 3THXB 4OKSA 1DTSA 1HE1C 1XEXA 4OYHA 4TZ6A 2UKDA 2WKRA 3ZVMA 5FBRB 4PO9A 2VBCA 3TVTA 2AWNA 3ASYA 3PUZA 1NL3A 4E22A 2DR3A 1SVLA 5CJ2A 2D2EA 5JSZA 4MRPA 2FEMA 721PA 3LH5A 1GRNA 2QQEA 4N0EA 1R0WA 1RC8A 1Z6XA 2J0SA 1E94E 2X2EA 4HLCA 3GLIE 1JR6A 4AYWA 3B85A 2OSBA 2WMNB 5E7JA 1YZGA 3BFXA 1ZUHA 1KIMA 1WP9A 3KJGA 4RZ2A 2H1LA 3LVQE 3VAAA 5C46F 3J81k 1RYFA 1Z0KA 2ZS8A 1LV7A 4M1SA 5EE1A 2DWPA 2JJ8A 4KSBA 1Z63A 3IILA 4U7DA 1KZGB 2WSMA 2OLKA 4BLTA 1ZCAA 1ZINA 2FPKA 3P32A 4K46A 3L0IB 2PLFA 2GESA 1KO1A 3SDZA 1KAOA 4Q01A 1E9CA 1XD2B 1XTSA 3A1TA 2P2LA 3CW2A 2GAAA 3NC1C 3FKSA 4PXAA 4QBFA 4M1OA 2IWRA 3MWKA 5G41A 4CEJB 1ODFA 2PCJA 3ZJYA 4Q4HB 2XNDA 2F43B 4BFWA 1XTQA 3PJRA 4HAZA 1F2TB 1VECA 4QKQA 2IUUA 1YZKA 5AUNB 4FWIB 2CLSA 5JHHB 2GJ9A 3QIAA 2NPFA 2RGBA 2W58A 1GNPA 1JQJC 3B5JA 4O3MA 4LUCA 3DZDA 4XIGS 3NH6A 4MUAA 2ORWA 1PVOA 1HV8A 5HKKA 2NO9A 2V4ZA 5IK2D 4DB2A 3K09A 2BIFA 4MRVA 3AB3A 4URYR 2QGNA 1VCIA 1S1CA 4PR0A 2W6JD 1VG1A 5GVSA 5LD2C 3KTAB 1YVDA 4M1TA 3RS2A 2J0QA 1QG4A 1P5ZB 1Q44A 2G1KA 3BH0A 1QHHA 3QOFA 3NIBA 121PA 4LBVA 3SFVA 1LS6A 2QSYA 2OXRA 3OIVA 2DWOA 4EQ6B 5B57C 3GLHA 1W0JA 3WRYC 1Q1QA 2NOAA 4IW3B 1E1QD 4IDOA 3CLVA 3D3QA 3CPHA 1E99A 3IIJA 3QKRA 4G5GA 2JCSA 5AK0A 5TDHA 3TKLA 1TF2A 1N6LA 1T0HB 1GVNB 1HY3A 3RNLA 4QBIA 1JEEA 3BWDD 1N6HA 1GRRA 4JBXA 3LBHA 4IVPA 2ZRMA 2CDNA 2EFCB 4LYFA 4ZCMA 2AX4A 4TL7A 3CNOA 4MYUA 4ZDKA 1Q3HA 2R44A 1E79D 1WXQA 4KJZA 1W36B 1Z07A 1E2NA 3RS4A 3P4XA 1L2TA 2QENA 3QKTA 1U0HC 2JATA 5EP1A 1P2SA 1NY6A 2F1IA 1DAGA 3A1VA 4TL6A 1GKUB 4LHXA 2VHUA 2ZANA 4CEHB 3DZ8A 4B76A 2ZTSA 3B2EA 3VNVA 2WJHA 1NVVR 2ZRJA 4GFDA 3CKLA 3RDPA 3M4YA 5DE3A 3AKDA 2REBA 2J3EA 1XEWY 1G4UR 1D9ZA 1XXHE 2YYZA 3QI2A 1M74A 3T61A 4OHWA 4RZUA 2A7QA 2VIIA 4IOKA 4C0AC 3FFAA 4Q7LA 3GLIA 1OIVA 1U8AA 1N5IA 4NU0A 2JLRA 1MRSA 1VCOA 2O8DA 1NF3A 3I92A 3K09C 3L8ZA 4M9SA 3RSLA 4B73A 2ERYA 3GJ7A 2G6BA 2VPPA 1G7SA 4RY2A 1G21E 4V0ME 1QF9A 4EFMA 3BIFA 5CYOA 2XGJA 1CJMA 2OXCA 3RRZA 3GD7A 5JECA 5FPYA 1XEXB 2IYRA 4D4LA 1RRCA 2REXB 3T5DA 3DM9B 1KJWA 4JBWA 4LJAA 4NTZA 3P20A 3PCRB 5FUVA 3RWOA 4AI6A 4Q1EA 2EU8A 4URUR 2ZETA 2JLYA 4M21A 1PLKA 2GXSA 3LXXA 1OFUX 2ASEA 2DFTA 1ONBA 1N5LA 1L4YA 2FSGA 5E4FA 1NVVQ 1TL7C 2YNMA 3F8TA 3K0FA 3U5ZB 4L5BA 3FE2A 3CX8A 3VR3A 4A2PA 2QQ0A 1CP2A 4TLEA 1N6KA 2Q6TA 4FMBB 3NH9A 1M6NA 2GHIA 1G20E 4JLOA 4MGIR 1OYWA 3VMFA 2QN6A 4DKXA 4YMUA 2BOVA 2CMKA 4GRAA 3EARA 2V9PA 4LDJA 4UNSA 1Z6YA 3CX6A 3U3RA 1CJTC 4PQFA 4U02A 4NMMA 1IN5A 1CR1A 1YHNA 1ZNYA 2VQSA 1XDBA 4IOMA 2H92A 4BFZA 4RD6A 4AURA 1SGWA 4Y0VA 1PJRA 4D25A 1JJ7A 4M1MA 4TWZA 4LJ8A 4JVMA 3TNFA 2X2FA 3T12A 3ND8A 1TMKA 3GJ6A 4GZMA 4MKFA 4AKEA 2W0SA 2AD1A 4R98A 5AR1A 5F9HA 2AL7A 5ANRB 4X8LA 1X3SA 1YR6A 2HYDA 2Y8EA 5F3WB 1BKDR 1FUKA 2A78A 4ZPXA 1S8FA 2BWJA 3HJNA 2Z4RA 4HEJA 2B8TA 5DI3A 1KYIA 1EFHA 5FPSA 3FMFA 1E9AA 3N2IA 1FW6A 4DDUA 1CRPA 2AN9A 4L9WA 1KGDA 2EFEB 3VR5A 1YRBA 1ESMA 2IHYA 4QJ3A 3LV8A 5FTKA 2C04A 2GA8A 4OK5A 1M2OB 1SVKA 2XTMA 3CRQA 3TRFA 3L8YA 1SVSA 4ZKEA 3I5XA 2ZI3A 2QUZA 3FYHA 1VTKA 3VU9B 2CCJA 4D0NA 1OFTA 3FMIA 3UATA 4JVLA 1UKZA 4URXR 4BE7B 4NCIA 4OL0A 2OBMA 4AK9A 4LSGA 3K0EA 5IT5A 2IF0A 4C7OB 4RD4A 4FCTA 2B6HA 1A2BA 3OF5A 2CL0X 5BWMA 2XZOA 2WKQA 2F9MA 2ZRFA 5DHAA 1SVWA 3C5CA 5FL3A 3U60B 1XCPA 1JR3E 4ZDIA 3DL0A 1ZC3A 1I2MA 4CDGA 1NMXA 4TYPA 4OHVA 1JXOA 2JLWA 3I5YA 1ELOA 1F3OA 1G1MA 2ZS7A 3KXLA 1ZUIA 2XZLA 4MYTA 2ZAMA 3B9QA 5EUQB 1ZBDA 3EWAA 4FN5A 2CLDX 1MABB 1G3IA 2V1UA 1QG2A 1W2GA 3GMTA 1JEDA 1YKSA 4ESHA 4LCBA 3LXRA 4LJ7A 3GLHB 1TU4A 4PHTA 5CLQA 3EASA 1Z0JA 2J0UA 4M53A 2VH5R 1G7CA 4B3CA 4ARZA 2PX0A 4HUQA 5KNDA 4EPWA 1XNJA 4EFNA 4XVRA 1NP6A 4Z1MA 3AP1A 4WAUA 3GFPA 4ZIRB 2FPMA 3TVDA 5KSPA 5SZKB 1BS1A 5M04A 4GBMA 4Q9IA 3U2QA 2JLSA 3SU8A 2VF8A 2ZIAA 3NBXX 5AWFC 4P33A 2BBOA 1CS4C 1GZSA 3CUEF 5FOTA 1XD9A 3B1XA 2RGDA 2JLVA 4DB4A 5FH9A 4A0RA 3W8NA 2PMKA 4TMZA 2PLRA 4A82A 1GL6A 5FOWA 5KOYA 1KI9A 1QHHB 2YC4C 1ZVQA 4MITA 1HQCA 1WCV1 4AYXA 4TYQA 1AGRA 1IY2A 1L7VC 4GPTA 3W34A 3ZQJA 3LWNA 3RAPR 1C9KA 1JI0A 3RRYA 2FSIA 5KPJA 3PV0A 1Z3IX 2GCNA 5EE9A 1Q21A 1NN5A 4IRUB 3AVUA 1ZD9A 1SHZA 1NBMA 1GDDA 2BKUA 3T06B 2GETA 4ASUD 1GNRA 2FX3A 2VHQA 4JSYA 4V0KA 3V00A 1E2HA 1JPJA 3V4RA 1D5CA 3CWQA 4YDSA 2IYSA 5DNYB 2TMKA 2NO7A 1KMHA 2ZSEA 3KXKA 2QAGB 5L3RA 4ZV4A 4I4LA 2P5SA 3O8CA 2KE5A 1NKSA 2BCJQ 5P21A 3UXMA 5JI3E 2Q9CA 3OHMA 4M9ZA 2WOOA 1KNQA 4MGKR 5FL7A 1E2GA 1DAEA 3ZZ0A 3PEWA 3QKSB 3BBPA 1TQ2A 1YQTA 2OCPA 1ZYUA 1MO4A 2WTUA 3RSOA 1E2KA 2WWIA 4DDTA 4X8OA 1AKEA 5HPYB 4US2R 2AWOA 1YZNA 4KFUA 4W7SA 4XWKA 2BCGY 1LF5A 3QXXA 2J45A 1GL7A 2BM0A 1HH4A 3A1SA 3G82C 5F9FA 2IYXA 2JLQA 1E69A 2WWHA 4LHVA 1S0UA 3EPHA 2BBWA 5L8VA 4XJXA 5FTLA 2O8FB 1T91A 1UBEA 3KQLA 4OI4A 5KTYA 2IS1A 4OQNA 1N0VC 3GJ3A 4EJSA 1DADA 3RHFA 5FOUA 3X1ZA 2JJ2A 5F2EA 1R5NA 5AUQA 2DY1A 1ZNXA 3LQRA 1IY0A 1X1RA 2L0XA 1F2TA 1MOZA 1OW3B 5K8TA 1AS0A 4IKEA 3SJCA 4YMTA 1VG9B 4Q9JA 1D9XA 2FFBA 1CLUA 3TW8B 3WBKA 2AFIE 3Q5DA 3NEJA 3MMPA 3AP2A 1HQYE 5JHGB 1QHIA 3PFIA 2CBZA 4BLSA 4GL2A 2C78A 4BFUA 3IO3A 2ZRNA 2DBYA 4UKDA 2A5JA 2CCGA 2RMKA 4KFRA 2W00A 4P31A 4UNNA 1RE0A 1E9RA 4JLPA 1JAHA 1H8EA 2ANCA 1ZNWA 3ZLJA 1EFRA 4ARZB 4ZI3A 1HURA 2MMGA 3U7HB 3A6PC 1X8KA 2IXGA 2XOKA 2HF8A 2R65A 3LRPA 3KJHA 4JYBA 5J47A 2P3SA 1NLZA 3FKSD 3A4MA 2ONJA 5L3QB 2WSSD 3BERA 4WA7A 1IHUA 5EXXA 2GEUA 2CE2X 4XTRA 3DMNA 3TMKA 5HZHA 4POAA 2NQ2C 4GMXA 4D2IA 1W2HA 3LW8A 1U99A 1R7RA 4IFEA 3G0HA 1J8MF 1J99A 4Q5IA 4TLDA 4R9UC 1E9EA 2OCYC 3KX2A 3ZVLA 4ABYA 4A2QA 4OI0A 2O52A 3AVPA 2C96A 4JLBA 5D3QA 4HDOB 2AKAB 3A4NA 5KU1A 3M1IA 4L8GA 2RCNA 3VTKA 4HAXA 1KK0A 4ZI2A 1PUIA 3MD0A 2GTPA 1BMFA 1TQDA 3F0TA 4PPNA 4BFXA 3CM0A 4LY6A 3CH5A 3X1XA 2MSCB 5FPKA 1ZD1A 3GFOA 4A6PA 3RS7A 1XFAA 1L8QA 2IXEA 1OIXA 4JL8A 1XMIA 1XCGB 3U7GA 2CL7X 4NYJR 2RGXA 2ZJOA 4C0HA 2QMHA 4QG7A 5CB8A 3PITA 2IC5A 4M4SA 1U0LA 3U61B 5KO2A 1T3LA 2F3RA 4FXPA 2HLDD 2QPOA 2UZ3A 1UBFA 2VP6A 1GM5A 1SVIA 1R2QA 3WYGA 4P0TA 3KUDA 5HE9A 4NYMR 5IRCD 5J4YA 1GIAA 3KFVA 2QNRA 1FL9A 5JJKA 2PX3A 2RHMA 2FSFA 1CKEA 2EFDB 1KI3A 4MRSA 3O8DA 3THXA 1QHXA 2O0JA 1W36D 2XEXA 1D8TA 3FMPB 4IDPA 2QM8A 3DPUA 4U00A 1F6BA 4QBGB 1II8B 4TTRA 1RJ9B 3EXAA 3AVTA 2QM7A 1LS1A 1XTRA 3KXIA 1TNDA 4WW0A 2GZAA 5DN6A 1JNYA 3RS5A 4IEIA 4BGDA 1CRQA 4HAUA 4KYIB 4KVGA 2WPDD 5JS8A 3TSOA 1JAIA 1FX0B 1ANKA 1W5SA 4TL8A 2XB2A 5JRZA 2G1JA 4CYMA 5JI2E 3TAUA 3ICQB 4ZDWA 1M8PA 4DCNA 4M1WA 4QNMA 2CJWA 2ZR0A 3TLXA 5J4HA 5H8WA 2GJAA 5JJIA 2ZJZA 1PV4A 4MH0R 2JEOA 1YR9A 3SEAA 5BN3A 4HB3A 4MGYR 3X1WA 3OIUA 3K9NA 5SZJA 1DARA 4L16A 2RGAA 4PZZA 2VSOA 1RVDA 3EA5A 1UM8A 3G5UA 3TW4A 4L15A 3ZGXA 5B30A 4US0R 1E98A 2W0MA 3GJ8A 1JQLB 4Q1FA 3WYFA 3ZYCA 2NPIA 2IHBA 2J1LA 1IAQA 2ZJYA 2I1VB 1VCMA 2HT6A 2YVUA 3OIYA 3QNUA 2PBRA 1MR3F 2QG6A 3NHBA 3OFNA 1Z5ZA 2ZU0C 2AXNA 1SZPA 2ZRBA 4AKGA 1A7JA 4BLOA 3PEUA 1TUIA 3ZH9B 1GOTA 2LKDA 3QPWA 4KITB 2ZRGA 4JLAA 3SHWA 3WMFA 2F55A 2W2TA 4LHZA 4HZIA 2IUTA 3QXJA 1OH6A 2QE7D 3IPXA 3EZ7A 3SBDA 2VHCA 2XJ9A 1XJQA 4D0LB 2ZI6A 2XXAB 1VPLA 4ZCLA 3H2YA 4DEYA 4ILEA 3ECCA 2GNOA 3V9PA 1CULC 3HDTA 1R4AA 2F3TA 5F98A 4US1R 1F2UA 1XXHB 2VP0A 4TMTA 4X8MA 2N46A 6Q21A 2WV9A 4E5UA 2H7VA 5HCIA 3NTUA 4NHOA 2R2AA 3Q5EA 3LLMA 1OV4A 5HE8A 2HXSA 2JIZA 3HU1A 4PC7A 4DLSA 2Q3HA 3BH6A 1S9DA 3M0EA 2YOFA 2XTNA 4QOSA 3I32A 4TLAA 2C95A 4W9MC 3QXHA 4WXRA 1RPZA 1EGAA 4Q48A 1T5IA 2VSXA 1VHTA 1KHTA 2EVWX 2GK7A 1Z47A 4IFBA 2Z6VA 2CJWB 1E9BA 2FU5C 2WJVA 5GJVC 4M1KA 4ERNA 1VIAA 2HCBA 2CVFA 2RGEA 3VKHA 1IBRA 4Z8XA 1SXJE 3FHTA 3TE6A 2G83A 1E2IA 2OAQ1 4FWTA 1MABA 1E2PA 2IYWA 3HR7A 4Z8YA 4WVFA 3VU9A 3EPKA 1II8A 3EZ9A 3WRXC 3ZVRA 3QPUA 3KQUA 4K81B 1US8B 3AGQA 4G3XA 3KQKA 2ZPTX 4RD0A 1N6RA 2IX3A 2O8BA 1QVAA 3QEOA 1LNZA 1YRAA 1X86B 4KAXA 1U8ZA 4RKFA 4C30A 3TUZC 4IEEA 1OXUA 1G7RA 1WBBA 3V4FA 1FP6A 5DI3B 4C7OA 1E1RD 5JEEA 3TIFA 3TAHA 3DDCA 4YXWD 2NO0A 1N25A 2JIZD 3RYTC 4LV5B 3W6NA 4DC9A 1W4AA 5BN5A 2XOKD 3C15C 4UJ3A 5FBQB 2IYTA 2O5VA 4M9XA 2OZEA 1XX6A 3WMEA 3EIQA 4B34A 3S1AA 2H17A 1H8ED 4OJKA 4LHWA 4Q9HA 4KO8A 2J9RA 3CONA 1GILA 1DS6A 4TQ9A 5C1BA 3B9PA 4QHTA 4DT1B 1AK2A 2YOHA 1E0JA 3I8XA 1AM4D 1JR3A 2WAXA 4KXFB 4NBSA 4F91B 5FUWA 3I61A 1TADA 3PG5A 2BJVA 4HLQB 1XRJA 4KFTA 1KK1A 4Z54A 1HUQA 2ZSDA 3KQNA 3WNCA 1P75A 4IDNA 3S1AB 2WJGA 4G01B 4XWOA 1CEEA 2C9CA 3W5JA 2OILA 3AVOA 3KFXA 1OB5A 4ZIRA 2GVDC 3B60A 4A0FA 4PZYA 1OF1A 2BKEA 2ODNA 2GVZC 1I4DD 1TUEA 2FPLA 3SJBA 1G6HA 3I1FA 2ZRDA 4O25A 4NYMQ 2J59A 3FDIA 1LW7A 4KBFA 4C0JA 2B92A 3RC8A 1E2FA 1M7GA 3KJEA 4IDQA 2D62A 5D3MA 1S4QA 2Z4SA 3IKJA 1NY5A 3E1SA 4Q03A 1ZCBA 4Q1DA 4QM7A 2PMDA 1FX0A 4AWXA 3AEZA 3EWSA 4Q00A 1NN1A 1T0JB 2J5XA 5FBWB 2X77A 5JLJA 1ZD8A 4Q47A 3UMRA 4B48A 1MKYA 3K0AB 1HT1E 2BMFA 4BFYA 3N5CA 1A5TA 4BFTA 4MKHA 5EE5B 2ZJBA 4W5WA 4JBYA 3CPJB 1Q22A 5J4KA 3BC1A 4BZQA 4A92A 1FMJA 4IVQA 1YR8A 2PT5A 3OAAD 5CK4A 3BB4A 1W46A 1OH5A 2NTYC 4PHHA 5CK5A 2ZE7A 3R8FA 4Q1AA 1CR4A 1RRGA 2X1VA 4C0LA 2DYKA 1IN6A 2ANBA 2GCPA 3GP8A 1KO7A 2C03A 4RVCA 1TAGA 2JDIA 4Q7MB 3DO6A 4L4UA 4CT4B 4Q4JB 3T5GA 4KLNA 4J0QA 4FCWA 3ICEA 1ZAKA 2YC2C 1R5OA 4IVRA 1W7AA 1LF0A 4HZUB 1UAAA 5KDLA 1PLJA 1Z2AA 2OE2A 2YV5A 2CNWA 3BB3A 3U3JA 2QAGA 1WQ1R 4JSTA 4O2RA 1J90A 4URWR 3OEHA 4BRUA 4D4MA 3W3AA 3HPQA 4RD1A 3K0SA 4PPQA 1KTVA 2W6JA 4QGGA 2F9LA 1R6BX 4FIDA 3F5FA 1DAFA 1KDOA 3A4LA 3AVWA 4TLBA 2YWGA 1YU9A 3KKMA 2KJQA 2REOA 1MT0A 2WZQA 2WJJA 4PC1A 1OXTA 1DE0A 4QFMA 2BVNA 3H1TA 1ZW6A 4UXHA 4FMDB 5JJLA 4LYAA 2IEYA 3CNLA 4BZXA 5CDFE 2PJZA 3O8RA 4DUGD 2HF9A 4NP6A 3ZD6A 3NDPA 4Q9LA 4EPYA 4FCVA 4KYUA 3DM5A 3CO5A 4G1UC 4PAOA 3REGA 3BD9A 4EDHA 3PEYA 2OFOA 2BMJA 5EP4A 2ZUDA 4B33A 4ITRC 2WHXA 4FI3C 3SZRA 4B43A 1VYUA 1DPFA 2WM9B 1FNNA 4DCSA 1COWD 2AD5A 4CVNA 4II7A 1ZRHA 2MMCA 5EUMA 1TEXA 1OE0A 1Q3TA 1Z06A 1TQ4A 2J0UB 3AVQA 5A5GA 2PEYA 3WHLA 3HWSA 4O2LA 1NI3A 4OI2A 4Q7JB 2P6RA 4PHGA 2OM2A 2H8KA 3FWYA 1VYVA 1E9FA 1I4LD 3H0KA 1RRPA 1W44A 3GLFE 1M7BA 2MSDB 3ZD7A 2G88A 1SXJC 3BK7A 1N6IA 3R9WA 2PZFA 4NCKA 3SYKA 1XPOA 1A82A 1GWNA 2NO1A 4QRHA 2V7QD 2ATVA 3RWMB 1P60A 3TUIC 2DWQA 3DHWC 3B1YA 2CL6X 2JJ1A 4HAYA 3QBTA 5G3YA 2OCBA 2ZRIA 5KPDA 2HV8A 4JLVA 5FUXA 4A8JC 2FDCA 4OJQA 4B6FA 1Z2CA 3NXSA 1DOAA 1WE2A 1AZSC 5JWHA 1E4VA 4DLWA 2E9SA 3U7FB 1JB1A 2QSZA 2G0NA 4BUJA 2IYUA 2JA1A 2FH5B 2EFGA 3CRVA 1KSHA 1DG3A 1G18A 2ZSFA 1OXVA 1K6MA 2HEIA 1VIYA 4P4UA 2IBMA 2VF7A 2NMVA 3QSYA 3QF7A 1SKYB 1ZC4A 3KJIA 3RABA 4Q18A 3OFND 1OH8A 2V3CC 1CBUA 2NZJA 1LB1B 2A5DA 2PZEA 1NNEA 4OQFA 3E5HA 1B0UA 4MRNA 5AUOB 3CIOA 3AF4A 3P26A 1SXJB 2IUSA 1RIFA 2YZ2A 2ZJAA 3NWJA 1G6OA 2ZS9A 5DSZA 1FOEB 2H57A 2QTHA 4AYTA 1S1MA 3CNNA 2ZYWX 1FQJA 2HXYA 5DYGA 2BM1A 4R2HA 5SZIA 2FA9A 1GUAA 2QL6A 1IXSB 2FSHA 5EXSA 1H8HD 1E2QA 2GK6A 1P72A 2ZE8A 2OBNA 2ZREA 2N42A 4B3BA 4TMKA 5LB2A 2O0KA 1P9RA 3T1OA 3BS4A 5B64A 2C5LA 1AA9A 1P73A 4X8HA 5H70A 3B82A 5GADl 2IS2A 2YWFA 4I1VA 4A0GA 2IYQA 4HB2A 4DCVA 1IJEA 2JDID 3UMSA 1KI6A 2BDTA 2WBLC 1NLFA 1UEJA 2LWIA 4DBLC 1U81A 4LBZA 4HZUA 2EYUA 1SQ5A 3P27A 5EZ5A 1Z8FA 3QVVA 1OPXA 5DLQC 5BYJA 1T8UA 3W3ZB 3MWJA 3Q9LA 4LBYA 2ZXUA 4HB4A 1XWIA 3LBNA 5DIFA 1QRAA 2VP5A 4NE2A 4S2EA 1W36C 1IQPA 4TQAA 2W6ID 2ZVPX 4QGFA 1VCNA 2V54A 1W0JD 3BE4A 2PH1A 4TTQA 3ZS8A 5TMPA 4B6EA 1W0KA 3ZZUA 1SXJD 2XZPA 3T1QA 3VQTA 4PC3A 4A4DA 4B71A 1N6NA 2H16A 2Q3MA 4RFSB 5AJXA 4G5SA 1E2MA 2N1BA 2Z0MA 2JJ1D 1UADA 5FI0B 3VX3A 2Q21A 2P6NA 4B47A 1FPMA 4WZBE 2J87A 5K8IA 3MSXA 5K8UA 2XNSA 1AKYA 3ZQ6A 1S3GA 3TBKA 2DB3A 1E2LA 4CEIA 1X1SA 3Q3JB 2ZAOA 4OQXA 1VKJA 1XPRA 4LV6A 4RCZA 3DKPA 1AZTA 3N70A 4WZ6A 4DZZA 3KB1A 3THWA 3K0FB 2XNDD 2B21A 3QVUA 5DN6D 2VYFA 2A9KA 2QBYA 1CIPA 1UFQA 1NG9A 3R7WB 1OHHD 3LQQA 3NC0C 4LPSA 4DLZA 1F5NA 4JT4A 2OFWA 2RHDA 2AHOA 2R8RA 2GXUA 1XP8A 2A5GA 2ZJ2A 1R5BA 3REFA 2BBSA 5J5CA 3KDSE 3L2OB 2Z43A 3AF1A 1T9HA 2OESA 2Q9AA 4KFSA 3EPJA 4TTPA 1C1YA 1G17A 4A8JB 4KLZA 4UXIA 1OXSC 1N6OA 3K70D 1ZM7A 2D7DA 1NN3A 3Q7PA 1U0JA 4D81A 1R0XA 1ZM9A 2QP3A 5DISB 4XVUA 2A3RA 3UG7A 2DHRA 4HI0E 4EUNA 4NCNA 3LDAA 1IN8A 3B13B 2ZI9A 3K0CC 2O8FA 1UPTA 5CJPA 1E1RA 1G41A 1ZM4A 3HR8A 4PSVA 2IW3A 3QEJA 5IK2A 4Q21A 5HKKD 1NIPA 2J41A 3DOEA 3CB4A 4BWYA 1S9HA 1T3SA 2BV3A 2IEZA 1NMYA 4DSNA 1IXZA 4ACBA 1J8YF 4GP7A 4HYYA 4R7ZA 2QP9X 4TMXA 1KSGA 5IF9A 2DFLA 1W0KD 1G4AE 4NONA 1J2JA 2QTFA 3C7KA 3VHLB 1F2UB 2QPTA 3K0CA 4LJ5A 2DFNA 4TN1A 5CDFA 3PUWA 4G5QA 2JLXA 4GNKA 3LO5A 4LPKA 5C18A 1Z29A 3PUVA 1N0WA 2C9YA 1Q20A 2ZYUX 3PUXA 2IF2A 2J7PD 3A8TA 3MCAA 1IN7A 2QRZA 1QBKC 2LCFA 4HLUC 1MRNA 2FOLA 4OHXA 4XH9B 2VTKA 2ZJ5A 5C2JB 1U8YA 3F3YA 4QL3A 5H1YA 3O47A 5FOSA 1U2RA 4V0MA 1W4RA 2QT0A 2VLIA 4ACAA 1KZ7B 2ZJ8A 4Z51A 4LGMA 2I1QA 5TARA 1P62B 1HTWA 4BEJA 3EG5A 1Z22A 2Q0HA 3PR1A 2Q3FA 3GJXC 4UNQA 2D74A 4LRWA 4MRRA 1GTVA 1NN0A 1GFIA 4P3YA 1G3QA 1FTSA 1OIWA 1OSNA 4H1UA 1UBCA 4MA4A 1AS3A 5SZHB 4EJSC 4LJ9A 2WVJA 2GEDA 3BB1A 3VHXA 2OAP1 1YZLA 2P0EA 1BH2A 3QE0A 4PO8A 3T1TA 1QZXA 3LW7A 2VA8A 1XEFA 3CH4B 4N0DA 3K9GA 1BOFA 1VG8A 3JZMA 3CF0A 3MJRA 4QBHA 4BLPA 1W4CA 1Z0DA 4XSGA 3EC2A 1T4GA 1WMSA 4PAMA 2PEZA 4JLNA 4URZR 5FPTA 3EZ2A 2ONKA 2FWRA 4LK2A 2OG2A 3I73A 3SN6A 1KI7A 2VHJA 4WXPA 2FE4A 4BLRA 1FP7A 1DAMA 3QQ5A 4N1AA 5C4MA 2FNAA 1XEWX 3KTAA 4OHZA 5K8LA 3U44B 4Q4AA 4PQYA 3KKQA 1KSJA 1N5KA 1IOZA 5A4JA 1S3SA 1KI1A 1NSTA 1SKQA 3K0AA 2AFHE 4KU4A 2C77A 2XX3A 4RJLA 3UIEA 1RYHA 3GEEA 3JZAA 4MDFA 3IEVA 3K53A 4PPGA 1AS2A 2GAOA 3AGPA 3CPEA 2D2FA 5JWOA 4B2LA 4BFVA 2OBLA 1K5DA 3CR7A 1XMSA 4D80A 4IOJA 2GJSA 2WOJA 4C9BA 3VR6A 1GP2A 2CHVA 2V7QA 2RAPA 3AF3A 2ZITA 2IL1A 2C98A 4KHZA 1VG0B 5GVRA 3AF0A 1L4UA 3KL4A 5J4LA 3LY5A 5LPNA 1GNQA 3TR5A 3SOPA 3K9HA 3LBIA 4JKYA 5TXGA 2E1RA 1FFHA 3RLFA 4XSHA 2ATXA 1KO4A 4ASUA 1C4OA 2Z83A 5DH9A 2YWHA 5FOVA 4MQBA 4F38A 2J0VA 1W5TA 1J70A 2CEAA 1XTJA 4HLDA 4YMWA 3C5HA 1DG1G 5FUYA 1CF4A 4MYHA 3IUYA 1UEIA 4L9SA 1OYYA 1S2MA 2GF9A 4H9GA 3RC3A 3TGPA 4DCUA 4HB0A 2C8VA 4ZKDA 1PUJA 2HT1A 5EE0A 4BASA 1G16A 4NPHA 3IHWA 4AG6A 1E32A 4UJ5A 2AXPA 2R6CA 4W5JA 4D82A 4TYYA 4YC7A 3T35A
chains in the Genus database with same CATH superfamily
3H97A 5IYZB 2EQBA 2GBFA 1K4YA 5AD1A 4F3KA 3VA7A 1ZQ9A 2PXXA 1JFVA 1SPBS 4M83A 4KYTA 3T7KA 2QGZA 2JAQA 3NHRA 3HMQA 1BX3A 1NBAA 2DFKB 2C3UA 2ETXA 2Q1TA 5CB4F 1GPMA 5EMNA 3QG5A 3ITNA 3NRCA 3QUBA 3CRMA 4P4NA 2H59A 1QVRA 4JX8A 3LHDA 2WIAA 1OTHA 2OP0A 2XT6A 3FCAA 5HQJA 1EIWA 3DOJA 4Q34A 2CK3A 2WVGA 2AK2A 3PENA 3LSTA 4L6CA 4ZQIA 4CFSA 4YMVA 1JECA 4AKIA 1V39A 1AURA 3G2MA 4W9RA 3WP1B 4RULA 1JJVA 1BFUA 1A2OA 1NR7A 2I7VA 3D7RA 3HP4A 4IILA 3RK4A 3NUZA 3A27A 4Q3OA 2RGGA 5FTNA 3SHFA 2BEWA 4KKVA 3NC4A 4YONB 1E3TA 1DAHA 4HBGA 4DRZA 4P5DA 4M36A 1A96A 1YR7A 3JQCA 3QLUA 1KJNA 5I9NA 3ROTA 2QRPA 2FWNA 3KB6A 4YJ2F 5DOZA 4IP0A 1CUUA 4CFZA 1H85A 3GPCA 1ZH8A 4QA9A 2OBYA 4C0SA 2Q3BA 1Z7BA 4WZBA 2C20A 1C9YA 4BC0A 2W70A 3DEAA 1VRVA 4FFLA 4ATNA 2JBWA 5EYPA 3NVAA 4AF6A 3AB8A 1VFNA 1IJBA 2WSSA 1AF7A 4OGFA 4C0XA 4C0QC 1CQIA 4NNPA 3QFFA 1RI5A 1EDZA 1NUPA 2RG7A 3WQQA 2EYQA 4G0MA 3VPSA 3TQHA 4X6YA 4R9VA 2FFHA 1F0KA 4G8CA 2RKBA 2JGJA 3IEMA 4AN4A 3HCRA 5E7MA 5HSGA 5IVPA 3P0RA 1EHIA 1B2LA 2EW1A 1GPAA 4TWIA 2A5LA 3NTQA 4EENA 1WHTA 2UZIR 4IKPA 4QQ8A 3TSZA 2WAYA 1Q16A 3AEXA 4JITA 1XZLA 1RJ9A 2GZRA 3JWEA 4DIMA 4GWLA 3SI7A 2YR0A 1VP3A 4J6EA 4OQLA 5L3VA 3OD1A 4BLQA 3HXKA 3PDWA 1WBDA 3WBJA 2BTEA 1IJKA 1CXZA 3S44A 3I3SR 5JH7B 2V6MA 3V1YA 1ATZA 1O9HA 1U3GA 4WECA 5F7OA 4NDZA 5KC8A 4QUDA 1NI4A 1U2EA 1NKTA 2YASA 1Z4LA 3LQ2A 5BWBA 1V1MB 2HPZA 2HIHA 2YDXA 2QEQA 5E4TA 1XELA 3BGWA 5GZ1A 1L7XA 1R10A 2FPUA 3EIHA 4DLTA 4UCFA 3ZLTA 4CE6A 5KDDA 1GDTA 1R8JA 5EP2A 2UUCB 3PNMA 4QVKA 3E9EA 3M6AA 3T3IA 3WV4A 1TT5A 5EQTA 3Q98A 5AVZA 2VDRB 4IG9A 3NB0A 4C4ZA 1WUKS 4L76A 4PAWA 4TTJA 3RRXA 1K2WA 2YINC 3UAGA 3B8HA 4OH1A 3BRWD 5TY0A 1FFYA 4EHIA 2ZB4A 4IHAA 4LTMA 4N9WA 5JEDA 5FTWA 4IDAA 4DF3A 2P2SA 2EJBA 3RT7A 3H13A 3LLCA 3Q10A 5TS2A 3AEKA 4BQSA 1JSRA 1Z9BA 5EEHA 1M0EA 2X5JO 2HO4A 1PFWA 1TLLA 2XMQA 2Z2ZA 3ZOZA 1Z56C 2XV1A 1H8HA 3OIFA 5JANA 3VOBA 2ZLBA 2NIPA 1Q83A 2G6TA 1I5OA 3KUCA 4NKRA 4FHCA 3BAFA 3CWZA 2P67A 2FPPA 3LL7A 3KR1A 2PJUA 4P4SB 1Z28A 1S6YA 3G2HA 3VR2A 4HQOA 5A0FA 4KCGA 5HF8A 3ZGVA 1V95A 2O4CA 3P4YA 1BHSA 4P4TA 1B43A 2XUQA 1JQ3A 3OQNA 4WZBB 3INGA 1I5EA 4L9AA 5BNFA 1T4DA 5E7IA 4PHFA 2WIBA 2F43A 4DGSA 3ZZTA 1BQ4A 4E1VA 1BEZA 4WKPA 2IW1A 1S02A 2VWHA 3WB1A 1G38A 4Z7NB 2AUNA 5DLDA 5GJWC 4JI6B 4G1CA 3D0OA 3H1FA 1UFKA 3NBFA 4KX5A 4OHOA 5E3HA 2JCYA 4NBTA 2OLEA 2VXCA 3EYWA 4TM8A 3AR9A 3ZLUA 1G8PA 4QYIA 5IJWA 4ARBA 3FNEA 3K8YA 1X70A 3Q6NA 4TYNA 3VVCA 1Y33E 3KZOA 4QREA 4DCCA 3ILHA 1VDZA 1UKYA 2PL3A 2Q1UA 1M2FA 2XIQA 2Y76A 5EXPA 3WLLA 2OENG 2FN3A 1A5ZA 1Q74A 4CUZA 1QYRA 1FSPA 3EJWA 2Q9UA 2HLPA 2OCXA 3K5PA 3R7AA 3TO5A 1TFRA 1G2IA 4C5AA 1YA8A 1M2HA 1NVEA 2PJRA 2K5UA 3FJ1A 3DMDA 1PWEA 1JVSA 2AMFA 2NXCA 5CYPA 1UKEA 2Z8ZA 2PQ0A 2C5GA 5I7WA 5GM1A 3M5WA 3QFCA 4N5DA 4INJA 2R8OA 2CNOA 1U4NA 2ZVQX 1N6PA 4LGVA 4QASA 2QRLA 2O5RA 3DCNA 3OQOA 4M6WA 3FVVA 1FUEA 3BCSA 4ZAXA 1E5VA 4GBJA 2GXQA 5AI6A 3WWZA 1V8FA 3SJZA 4PTZA 1Y6ZA 4GWGA 3CW9A 4LJ6A 1D2MA 1H93A 5CFNA 1JB9A 1P2VA 4Q12A 3C16C 3DBVO 4H18A 2G8LA 1QS0A 3C3DA 3MLEA 4I3GA 4C3VA 3ZLBA 2HCRA 1FU7A 5J2UA 2IXAA 3P2MA 3B1VA 2HDNB 2ZRAA 3DF7A 3SSNA 5IEJA 3ZHYA 3R4VA 3AUUA 4P3OA 1XALA 4V2UA 1B8OA 2NUAB 2JAPA 1Z8NA 4YP5A 5JCXA 2QD4A 1CQJB 5HMMA 1PFQA 1JHVA 1RWXA 3G7UA 1XD2A 2XF2A 2XY4A 4JUCA 4NOMA 4EF4A 4LYHA 4H1VA 4Z3KA 16PKA 3LZCA 3NEYA 4NCBA 1ECFA 5ALGA 1HNWB 4F3RA 1WCYA 1YR1A 3JARB 4QPNA 4B3GA 1PW5A 3TIGA 2AN5A 1K88A 3E7PA 1XMJA 2P6OA 4Q39A 1CUCA 5ALKA 2AFHA 2AMLA 2E5LB 4MUJA 1UOPA 1Q0ZA 5J23A 5C1DA 2VQ6A 1RDFA 1N1EA 2O48X 4Z9YA 1L1EA 3F1LA 4MWTA 4RVFA 3NIWA 2DF8A 5DO9A 1KP2A 1FFCA 4KX3A 2PM8A 3T7CA 4TOIA 4J2HA 3B1FA 3P0JA 4EIWA 3WAGA 1MIOB 4UNIA 1G5IA 2IOFA 3DF9A 2CK3D 5KSOA 2R0QC 1EX6A 2MTBA 2Q7DA 3EUFA 4QPZA 4RSGA 4J9UE 1AC5A 1E2BA 1Y9DA 2NO6A 4P38A 2CYAA 1ZICA 1VXOA 2NW6A 3EPLA 2VAWA 3BCHA 3GUCA 3MFYA 3NWPA 3O4HA 3PUHA 1EWKA 1RJFA 3N2KB 4LNUA 1D6SA 5C31A 3F5MA 3K72B 1CR2A 3R9KA 3UJ3X 2R1ZA 3UB4A 2O2SA 2AW5A 1NDHA 3EEIA 3GO4A 1E89A 2F90A 1IG0A 3W5VA 3HU3A 3IPCA 2Y0PA 4K8OA 3F6PA 2R3SA 3IJ5A 5JS7A 4BO4A 3OI7A 3IP6A 1CJVC 4L22A 4Y2UA 3SXJA 2VQFB 4ALIA 4ZC8A 4M89A 2R4TA 2ZRLA 2Z1MA 4EB6B 5LU9A 1ZWLA 3IELA 1FYDA 2HFKA 3UKOA 3W2FA 1PR1A 4BWGA 2DHEA 3WNVA 1PQYA 2H31A 4O63O 2GCOA 3PSHA 3WZMA 4YQEA 2PWZA 2A67A 2E1PA 1TPYA 4I9NA 4DLVA 1GLNA 3FJYA 3TPCA 1GHTA 1UJ4A 3N87A 1KMQA 1Q1GA 2GHTA 2I33A 4U1RA 4WOCA 2CXNA 2WILA 2Z2KA 3ULKA 3VV3A 1QH0A 4XGKA 4Y0NA 4MR8B 3IFSA 2AXEA 2XWSA 2YQ4A 3HKEB 3QV1A 4II2A 3V4ZA 4E33A 1Q1ZA 2RC6A 2WWXA 3RIXA 4PAQA 4WVLA 1JMVA 1F7UA 2QI9C 3VV2A 3NDBB 3L77A 1L8XA 4L4ZA 4EUEA 5DI9A 1QP4A 2C4KA 3Q15C 4Q05A 4BO6A 5AP9A 4D4KA 2FJUA 1GSIA 3W3AH 1T2AA 1KIAA 3PLRA 5ESRA 4IIEA 3UA3A 4DLUA 1WHSA 1R8SA 3D1VA 1VL1A 4Q19A 5ELLA 1JWAB 2FLKA 4DMFA 2J67A 5KVQA 5IBCA 4TTTS 3KKOA 4HLNA 5BOSB 1OTYA 2RE8A 5ECDA 4N47A 5FUMA 5LQNA 4HG2A 1JF8A 2Q0QA 2I7DA 1FQKA 4K2HA 1EE9A 2XTZA 4HQLA 2YHBA 5KVAA 1GSAA 1VSVA 4PANA 4PYLA 3H75A 4DY4A 2HIMA 4LC1A 1YVEI 3G7SA 3LLUA 4HNGA 2AKYA 3AUXA 1FSZA 2PCLA 1Z63A 1QQBA 3ZE7A 2BBTA 1XZQA 2HMAA 2Y4OA 1V9CA 4IXDA 4XQCA 1LTHR 1EFPA 2PZ8A 3QKUA 4OIMA 3U3OA 1FLNA 1Y4DE 3WK8A 4RH0A 4A36A 4AS1A 1NNI1 1WY5A 3BD7A 3ODGA 2YKGA 4JZKA 2QMEA 2Y67A 1Y8RA 3M6IA 1E92A 4KQHA 4MS3B 1M34A 4XIIA 5JAPA 1Z4PX 3I8OA 1YIOA 3DB2A 3EIFA 2YICA 3QENA 3SD7A 3UMFA 6NULA 4LCEA 1I36A 1PG2A 1YBAA 2IEAA 2XKKA 4A0SA 5MHTA 4NXMB 3VR4A 3BJMA 4M88A 3DLAA 1VSBA 3FPAA 3U26A 3UGTA 5GJBA 2YJNA 3FI0A 3K92A 1P3DA 2DKOA 4JIMA 3AP3A 5F2NA 2F1HA 1YZ3A 2GILA 2QLMA 1Y3CE 1K0UA 2WAAA 2ZRPA 3C7DB 3GEIA 3KM0A 3F49S 4YGXB 3RASA 4AX8A 5BXQC 3DZBA 3WMWA 1DC3A 3EEYA 1PBNA 2GAIA 4JHLA 4KQ2A 3AEYA 1GADO 5E4JA 3VYWA 1NHWA 2B94A 4J8PA 1HYQA 2EKDA 4YMIA 3IGFA 3QU5A 5HFJA 3VXKA 1Y1KE 3ZQUA 5J4VA 2Z1DA 3A4TA 3UXEA 4MWOA 4JX9A 3M5CA 3KT8A 4GC9A 4BBAA 3UH0A 4CRWB 1NR1A 2GKGA 1PK7A 4XD7D 3RB8A 2B7BA 1A71A 2RHTA 2VRNA 3OZUA 1ZU5A 4EKEA 4LI3X 5KNCA 1GL9B 2IE8A 5U9CA 2J3QA 2B7CA 5CAEA 2GGSA 1KI8A 3C2QA 5LUBA 2P6UA 1EUQA 3MRVA 4B7UA 4M0LA 4NMHA 5JCOA 2IYPA 2PA3A 2DR2A 2JRCA 2N3ZA 2VDOB 2ZYVX 3OG9A 3VO8A 1NXQA 3ZTYA 1SURA 2NWQA 3N2EA 3UPTA 2WWYA 2Q50A 4YP1A 2LVBA 1M5RA 3ZWPA 3EEBA 1XLVA 4BZPA 4PGGA 3TWOA 4YTEA 5ENZA 5BR8B 3DDHA 3L92A 3CKMA 2XYRA 1E1QA 2XMDA 4D9FA 4HWTA 2V7XA 1G2OA 3E61A 1BC5A 2GRJA 2A9QA 3GUYA 3M2TA 2ZT5A 1JEOA 1P1BA 1CJKC 3PGXA 1HTTA 4EHKA 1M2WA 1XCJA 3H8SA 5EMLA 1QCZA 4HRVA 3E7WA 4IRXA 3WOVA 3I5AA 5B3KA 4MV8A 1XKXA 3C5EA 2BGWA 1ZI6A 3QHAA 4QODA 4EX7A 1R5JA 1CE8A 5DRYA 3M3DA 4F5ZA 4U2DA 4LOJA 4X3CA 3RS3A 4IOLA 3DNPA 4GOJA 3ASZA 1AO3A 5CLIA 2H4FA 1U2QA 4FOTA 3AETA 5BR7A 1JKMA 1YDWA 3EW9A 5FDFA 1GN8A 5JWRA 1OJLA 3BL8A 4NYIR 2QG4A 2MWMA 5T3UA 3SIPA 3ZE2B 2BEVB 2XW6A 3I0MA 3L06A 4CDRA 1BDIA 1EK0A 5DNEA 3FMGA 4GM0A 3EUWA 4EBBA 1HE3A 3KL2A 1RXIA 1FRNA 4BB0A 3O8OA 2DCUA 3LU1A 5A62A 4BDSA 2AI1A 1HE2A 3GVCA 3QF4B 4KAFA 1IEQA 4KTVE 3SOZA 3AM1A 4PSKA 1GGEA 4BNXA 1ULUA 2ROQA 4QYSA 1ZRMA 1LBIA 3KHSA 4ZI5A 1TQHA 4DTIA 1C30B 1QHSA 3QYFA 1EESA 2JIBA 1VYTA 3ZX4A 5EG5A 1NJ5A 2CE7A 3NQ41 1N5DA 3IOEA 4PE5B 4CEJA 3WFJA 1RJDA 2DPLA 4FC6A 4E14A 1HEYA 1RHKA 1O3YA 2QMQA 3CBQA 4IWYA 2C7PA 1K63A 4QDUA 3HFJA 4C22A 1ZX1A 3VPHA 4DMUB 5KSYA 2PE5A 4B75A 4B3RB 1GAEO 1L5RA 3ONNA 1FXWF 1NBHA 3H9UA 4ZT5A 2ZUCA 4MCJA 2C99A 2CDAA 2PL5A 1NQVA 3RGGA 1I2ZA 2Y1DA 1PNTA 4YDHB 2R1VA 1WMBA 1NBME 2BFCB 3SK0A 1TLTA 2BGLA 5EZYA 2DFDA 2BTOA 2YWBA 1XRPA 3LHFA 1C3XA 1N75A 1ADGA 2JRLA 1KZ9A 4GUAA 4Q9AA 1OA1A 1YZUA 2FX5A 2ZBPA 4OHFA 4P4LA 5K0SA 2WIGA 2WKWA 1KXZA 4MVCA 5EWJA 2DC1A 5FNVF 5JMTA 1C2TA 2V1XA 3HI6A 3I9FA 1NE2A 2C61A 3WQBA 1TKCA 2D1RA 3L6DA 2DTXA 3IUSA 2M6RA 3WJ1A 1DBIA 5B37A 1C29B 4RY9A 2XNCA 4IIYA 3SEFA 3LFUA 2FN9A 1P5HA 4FD2A 3UG6A 4CT0A 5EHXA 4MKIA 5E4YA 3T9AA 5ICFA 4ZRNA 1K8RA 1HT2E 3D4NA 4WADA 5IG2A 4C4YA 3JQ7A 3NBKA 3ZBTA 1HETA 1O87A 1LQUA 2X7HA 4KWCA 2QLBA 1F06A 1YASA 3MWEA 4BEBA 1RAIA 5HJ7A 1MO3A 3GRZA 4JJZA 3GLGE 4JV5B 4TM7A 3FBWA 3JCZA 1MQ9A 2WPDA 3N86A 4F4IA 2AN3A 4RK0A 5L3SA 1VB3A 1JKFA 3OSUA 3S40A 1F8GA 3CNEA 1JTEA 1ISIA 2KI5A 1A9OA 1VI2A 2Z2IA 1Y1PA 1PIWA 2XQIA 4FGKA 3A32A 3HHEA 4J0GA 1N3BA 3HC7A 2H5EA 2RIRA 2WUGA 1DJNA 2YCLA 4YRPA 3V46A 3AH8A 1Z39A 3N8IA 1YB4A 1RWOA 4NZNA 4FOSA 4YRAA 1P61B 2C84A 3O91A 4PNEA 2X8AA 1EX9A 3DOFA 3BWXA 4B35A 2XUKA 2EKQA 4NCJA 4CR6A 3V4PB 1V43A 3DKRA 3S1LA 2EATA 2W48A 5DP2A 5GIOE 5D3MB 4PO1A 3H0EA 1YJXA 4G63A 4M86A 3ZNOA 4HPWA 5CM9C 1DLJA 2X6TA 2ZIGA 4CGYA 3U4GA 4F0JA 2E18A 5AUPB 4TQUS 2BR5A 3R5KA 1NTOA 4WNYA 2VJCA 2I4RA 4FFRA 4X1KB 3T3OA 3PIIA 3WL3A 2ZSBA 3RC1A 3OESA 2GX6A 5JUWA 2G09A 3SE0A 2GBGA 4HQ6A 3BF7A 3BIOA 1MT3A 4MSUA 5J3JA 3NGMA 4OKIA 2ZULA 1OT3A 3IBCA 4YRFA 4ZK6A 4J3NA 1FP1D 5CFMA 5L7WA 1JYFA 1SPXA 1LY1A 2OWDA 1W35A 1UK9A 1GG5A 1W96A 2QT1A 3VTZA 3CRW1 5C3MA 1XHEA 1BDJA 3FUVA 1PX0A 1XZPA 1O96A 2ZK7A 3L7DA 3P9XA 4J3FA 4NY1A 4TKUB 2VUHB 2YX1A 4G0NA 4UCWA 5HZKA 2J30A 3G9QA 5DB4A 1J5XA 1NA5A 3GT7A 3LA6A 5FD8A 2CCKA 1B3RA 5JRJA 2GXAA 4MV7A 4S1NA 1ZLYA 3O7MA 4QECA 3QKRB 4QJ5A 1SNYA 1BMFD 5G40A 3WAJA 1QORA 5DYIA 3VPBA 3AVXA 3EFBA 3OHPA 1VGQA 4Z2AA 1PWHA 2A8YA 4I36A 4MVJP 1LEHA 1JLLA 3GLQA 4ZANA 1EWQA 1S7GA 4QELA 5LQSA 3TE7A 3I09A 3VKVA 2RH4A 3JQQA 2QXTA 1VMAA 3ORYA 1FMFA 5KTNA 5C81A 2GBLA 4AT1A 2QSJA 2YXBA 3HBAA 2VZ9A 4BNZA 4YPVA 4DV6B 1BU8A 1AUQA 2OHXA 3RANA 4R71A 2O8FA 4JJ8A 4G4SP 1RFLA 4F9TA 2HXGA 3AW8A 4JLUA 4NH4A 3V42A 4YJ2A 1VJTA 2PUEA 1YZHA 3TQCA 1YGYA 3H83A 4TKZA 4DA6A 4V0LA 4KGDA 1DIRA 1CY7A 1W49A 4M37A 4MVWA 3MUFA 4FOPA 1E4EA 3DUWA 2BEJA 3SC3A 2DEUA 5C5IA 5CU7A 2QS9A 1KQPA 2CXRA 3GHHA 1JSXA 3ISJA 1V1RB 2DKFA 5AKXA 2VHTA 2ZSAA 1Z0AA 3WHPA 3WJ7A 2CVQA 4RZXA 4G6ZA 4ZOLA 4AJOA 3P9ZA 2WUFA 5LZ7A 5IARA 4AL4A 5T4HA 1IVSA 1JBKA 4DIKA 4QJBA 1QF6A 3BIWA 5A5DA 1DFGA 2I2BA 2JLAA 4HYTA 4MVJH 3HP7A 3HYCA 5TJ9A 5EOVA 4HKTA 4JI5B 4AKSA 2Q9BA 4POOA 2OO7A 1IOWA 1UCFA 1FDRA 4Q4JA 1JHZA 5DWDA 4ZYTA 1JZQA 4FOLA 1V5WA 3HY6A 5LYJF 2LKCA 3KYBA 3RUPA 2QE7A 5A9SB 1GEGA 2BSXA 3I5MA 4ESVA 4YLGA 3TMAA 5EJ2A 1X1EA 3AM4A 3OIDA 5EIHA 2Y2UA 1U0OC 2NGRA 3B9BA 1B6RA 1WHTB 1SKYE 3M9XA 1EVQA 4FIZA 4OQPA 3RREA 2HSEA 4BYGA 5I4IA 2NQ8A 3BG5A 1F4VA 4ZHQA 3GUUA 5FTJA 2OTCA 1V1MA 1XD8A 5HW0A 3SVTA 4MRAA 5FBKA 4AVYA 4Q4AB 1OFUA 2Q5HA 4KQGA 2OZPA 2I4LA 3EVBA 3KQTA 3O8LA 4FNAA 5JH7A 1Z08A 2HMWA 1PL8A 1GITA 4F8JA 3P9SA 2GRAA 3BWVA 4LY3A 1O89A 1MO2A 4RAOA 5HDQA 1ZXLA 2Z9CA 4EWLA 3FNGA 2D5AA 1QANA 1UBOS 1YI0A 1H94A 3DKVA 1V2HE 4RO0A 4M7OA 3FM9A 1C7QA 4RQAA 3EWNA 2RKOA 5LNK1 5JARA 4MR9A 5AK3A 3EX7C 3E9NA 1GZDA 3N2KA 4E15A 1K2VN 4BTLA 4A6XA 4R41A 1J42A 2YOGA 2UZ0A 3D02A 1EVKA 2H85A 3VJKA 1L8OA 3MJHA 2LE0A 3X1DA 5FUQA 1B3BA 4Q02A 2QUKA 2WWGA 3TVTA 2O8VA 1N0UA 1G5HA 3DTVA 3JQGA 2GN2A 3KQLA 1H2RS 2BMVA 1I1NA 4I6GA 1XPUA 3HXPA 3MBOA 3PI7A 1KJIA 4HWPA 3UWOA 5B3JC 5C80A 4TT3D 3H8VA 3LY8A 5E2IA 2XCRB 1KZ6A 2YRFA 4WCFB 3RV4A 1NBMD 1VQ1A 3IBGA 1C30A 4YV7A 4GMDA 3VJRA 2GRUA 1GKYA 4NPCA 3R75A 4TXNA 2FWMX 2Y6VA 3T1VA 4WSOA 3GGCA 3AZOA 2WWFA 3M33A 5DGXA 4N6NA 2W2PA 3RYHB 3IBYA 2IEBA 2OPBA 2J7PA 1DFIA 3BXOA 3ZYZA 4I99A 4NEQA 4XIJA 1ZUNB 3EF0A 3ORQA 1BVYF 3D8HA 1DVRA 1E9SA 3SJAA 3TZLA 3JVVA 3KG2A 4DTCA 3IPYA 5CCEA 3M34A 2NYUA 4G85A 4M8KA 5A4FS 2RHOA 5ADUS 2NZ8A 1I9GA 3ISVA 3GRAA 4YRDA 3V7NA 4G09A 1KZ4A 2AX3A 4QVGA 5FIUA 1WNFA 4A23A 3CNQS 3T3NA 3HBLA 4OLHA 4IHJF 4Q3CA 4N5HX 2JVJA 4HRYA 3KOXA 3T8YA 2CLEB 1K92A 4D9IA 4EUFA 3EC7A 2Y93A 1DTSA 1HE1C 3QWIA 3FR8A 4ID9A 4CMIA 4W5OA 1I10A 2D5LA 2X8BA 5FBRB 2JBHA 3UOWA 3VYUB 4Q3KA 5CJ2A 4LHSA 3DXZA 4BQRA 1CQXA 2YHIB 3W1EA 1BHJA 1GRNA 3EXIB 3GJSA 4N0EA 5FCDA 5IYZF 4ZXFA 2NSLA 3E9YA 1V11A 2FN7A 3HCAA 3IAM6 3R23A 1RC8A 5EFOA 1E94E 2X2EA 3NUGA 4R6WA 1JR6A 3EMBA 1MC1A 4QVIA 5DGHA 4Q1VA 1J7JA 4GQBA 3S5UA 4UEJA 1MNAA 1E9VA 1ZRSA 2ID8A 1WP9A 4NE7A 1E5LA 4RZ2A 1W85B 3K1AA 2ZS8A 3J81k 3RG8A 4BP8A 1L7NA 3MMZA 1IUNA 4KSBA 4BMOB 2IHUA 3TOCA 3M2PA 4BLTA 3VSBA 2ZOSA 4K46A 2J3JA 4AMVA 3PLAE 3DV9A 3KUUA 3L0IB 4NBRA 3WIEA 3USCS 2O1EA 5ABPA 4X6XA 3A05A 4GR5A 5FPPA 2HA2A 1DQPA 1ZJYA 1XTSA 1NWCA 1SIOA 3EGOA 4C08A 2HPAA 3I12A 3NC1C 3FKSA 4ZO7A 2GN6A 4HQRA 4QBFA 5G41A 3MINA 3PFBA 3UGKA 3ZJYA 3HK2A 4QTYA 6CHYA 2XNDA 3PQEA 1LI5A 1MU0A 1JKXA 1F2TB 1RD4A 1W8DA 2HEGA 3I1YA 4HAZA 4NOLA 3UMCA 4QKQA 1Y8QB 2GJ9A 3QIAA 2O3RA 2MR5A 1SBHA 3COPA 4LAFA 2XE7A 2EKBA 4WE3A 4Y30A 5C4IA 1CYDA 3D7LA 3B5JA 4NAHA 2FFJA 3QFTA 4LUCA 3W2TA 2OGUA 3N2YA 3DZDA 4XIGS 5AIAA 2YY7A 4MUAA 1U7OA 2Q2QA 2VYND 3IT3A 4P34A 1Y6RA 3ZG6A 2RBGA 5HKKA 2NO9A 3U56A 2LW7A 2X7JA 3CT6A 3TJMA 1DUIA 2XWBF 4URYR 4BNHA 1Y6FA 2A7XA 4Y2QA 1IL0A 5JR3A 2OECA 5GVSA 4P82A 4GLBA 3ZJTA 1XDUA 1YVDA 1QIMA 3CEMA 3OQBA 1YQUA 2H7YA 1ZBQA 2OORA 2BJHA 4LBVA 3BH0A 3KT3A 3CUYA 4ZD6A 2AQIA 3K5HA 3NIBA 4OGGA 3RC2A 4C6TA 2QSYA 1T29A 2DWOA 4FSDA 3EY9A 3GLHA 2QVYX 5AH0A 4H60A 3D3QA 3PQDA 4G0WA 3E3AA 4UHBA 2C8LA 2PLNA 4CFYA 3VDMA 2ZB7A 4TKLA 1SQ6A 4G5GA 2JCSA 2Q6OA 2WU4A 2GM9A 1N6LA 4I8XA 1GVNB 3U7QB 4D41A 2PD3A 3RNLA 1GNTA 1B00A 3EGVA 5TNXA 2OPHA 1T2UA 1RYZA 4KLCA 1DUVG 4JBHA 1USIA 4DIOA 3SR3A 2OCDA 3T0FA 3AHJA 3S55A 3RJMA 4DG5A 4DV1B 3NVKI 1Q3HA 3KCQA 5JNWA 1V3VA 1AG9A 3P4XA 2QENA 2NACA 3QKTA 3LUGA 5EP1A 1UOEA 2WQ6A 4EB6A 2IU6A 5FWNA 4V1CA 3I76A 4LHXA 4XPIA 4CEHB 1TC2A 3EDYA 2JVIA 2OBFA 2XE6A 4J0HA 2ZTSA 3GVPA 4RSHA 1MN6A 2PO7A 5ECWA 4F4UA 1I6WA 2E4WA 4D1YA 3VNVA 2HJ9A 1QIGA 2WJHA 1NVVR 2VKTA 4GFDA 1M1UA 4PZ9A 1ADJA 3OJOA 1LLQA 3I64A 4P7JA 2YYYA 4ZEXA 1PNQA 2YHAA 3REOA 4CQLB 1B7GO 3BMQB 3M4YA 1SHUX 2GARA 1G4UR 1XXHE 1IBMB 3WRYA 4AP5A 1M74A 2C5EA 2EL7A 3EB9A 4RTLA 1GKLA 4HL6A 3RIYA 1QG0A 1Y5NA 4EG4A 4WDRA 1THGA 4RK5A 2C2KA 2M32A 2VIIA 3GFGA 3KOWA 4HVAA 4O4IB 1UC8A 3GMIA 5IVHA 2OCGA 3FBGA 3UV3A 4H6VA 2QIOA 4Q7LA 3GLIA 4C7KA 1M5TA 4NESA 4FEEA 4DPKA 2C2ZA 1QQ7A 2JLRA 1ZFNA 1MRSA 1QXSA 1ZN7A 3P2EA 3L8ZA 3I92A 4M9SA 4QWMA 5EJGA 3RSLA 2YWRA 1CR6A 4D79A 2ZBVA 3RF6A 1ZAYA 4V0ME 5C53B 1M33A 1JSZA 3EGEA 1I13A 3KKLA 5AQEA 4CMGA 3A3OA 3ICWA 4MULA 4AJ9A 5CFRA 5AHKA 3HCPA 5G4LA 2DG2A 1T10A 3GD7A 3RRZA 4KMOA 3IEIA 4H1TA 2AJTA 5TMEA 1XEXB 3B1JA 3LTNC 2REXB 1ML4A 4CMBA 3DB1A 2D1FA 4RGYA 4X95A 5B6PA 4KZPA 4LJAA 1HT0A 4NTZA 1P5JA 5DM2A 5FUVA 3RWOA 5JDIA 1WXEA 1URPA 2MOKA 1EJ6A 2VZEA 2WU0A 4DRXB 2ZETA 3PNSA 2JLYA 3ZHZA 4JA0A 3MB8A 3OOHA 2YCBA 3UPDA 5IXYA 5H5JA 4B84A 2ASEA 2QIPA 3S2SA 1ONBA 4Z5XA 2H5JA 2P2ZA 1D8AA 1PJLA 1T9DA 2QX7A 4K9QA 4X0EA 4LYYA 2JZOA 4IXTA 5BMOA 1JH8A 4CIWA 2YNMA 4H7DA 5IAJA 3DLIA 4RS4A 3K0FA 4DYVA 3QU9A 1JFLA 2ZBGA 3ETNA 4ZOLF 5HRAA 3SS9X 1CP2A 1N6KA 5EGSA 3VMFA 4NHEA 3JXEA 1VGRA 2R7KA 3IVRA 3OPQA 2BFFA 1GU0A 4S24A 4YMUA 1GQOA 3AERA 3EARA 2V9PA 3JAKB 2QRJA 3ORHA 4FZVA 4LDJA 4UNSA 1XSEA 1Z6YA 2A0WA 1CJTC 2XUZA 2W4QA 2R11A 5DFAA 2WZBA 5IX8A 4U02A 2ZIWB 3N3AC 2GS9A 3ZU5A 4AMZA 5HBRA 1YHNA 2VQSA 1XDBA 1PJ3A 2IU4A 2FQ1A 1HI9A 2Q1WA 4G0XA 1JHMA 3HUEA 1XN4A 3EDCA 4E30A 1K3FA 1L7QA 4URHA 1E60A 1JJ7A 4M1MA 3CUVA 3KWJA 1NSYA 4UM8B 4LJ8A 4DBLE 3ZHXA 3TNFA 1EVJA 1WMDA 4NZMA 4KKXB 1AKWA 3T12A 3PNKA 4CN8A 5J2UB 3OZBA 4V2IA 5U1PA 1WW2A 1UXGA 3FZEA 3G9ZA 3A11A 1PT6A 5JJCA 4O33A 4YCBA 4KO2S 2WWRA 1J2TA 3ER6A 2HUNA 1SR8A 3SX4A 1UZAA 1OX4A 4QBKA 5E1DA 5DULA 5B1EA 4LOIA 3O03A 5F9HA 2Y8EA 1YR6A 5HM6A 2VT2A 4ZPXA 1FUKA 3B51X 1S8FA 3OJWA 4ERXA 2Z4RA 2H4ZA 3JWPA 5HVNA 1C9JA 2NNLD 3FMFA 4KGXA 1TA4A 1XCOA 2NO5A 5JOQA 1ZK1A 4H17A 2EFEB 2RBEA 4AUNA 1JTFA 1CRLA 2J3LA 1XLWA 2JFYA 2GA8A 4OK5A 1SVKA 3ZK8A 1N2CA 1SK9A 3HBMA 1H5NA 3M6MD 4ZKEA 3I5XA 5EA2A 1DG9A 3NDRA 3R5FA 1A1SA 2IDKA 1TU0A 2YXEA 2FHPA 4F2WA 4D0NA 1OFTA 2BN4A 3FMIA 3VYTB 1UKZA 2ZBDA 2TMGA 4N7BA 4F97A 4OL0A 2OBMA 4GSKA 4BXOA 1X7YB 5BN1A 5LZ4A 5CLFA 5IT5A 3OVMA 1VBKA 2EDCA 4FCTA 4GI5A 4II3A 4RD4A 1A2BA 4F71A 3ZEIA 2AF3C 1EVYA 2BL4A 2F9MA 2ZRFA 4KP7A 5LXTF 3USES 1YQQA 4LEIA 1QOQB 2IY9A 3L6EA 6ADHA 3IR7A 2PMWB 3PX2A 1I2MA 4C87A 4CDGA 4KQIA 3IYLW 2W8BB 2DJIA 3E3LA 4TYPA 1HXHA 5CNIA 2VPTA 1YQWA 1ZEMA 2F67A 3R44A 5FADA 1T3GA 5DGTA 1G1MA 4U3JB 2XEDA 5ERGB 5DYWA 1T5OA 3B9QA 1S5PA 5EUQB 3DDNA 2AOTA 4PG6A 1SN7A 2Z3VA 3EWAA 4FN5A 3ELBA 4R1MA 1D0IA 5JBIA 3ZWKA 2FP4A 1EYZA 1YKSA 4GNRA 4TVSA 5JJ5A 3ZY5A 4FN4A 4ESHA 3QOXA 3LXRA 4LCBA 4TMYA 5CLQA 3DBIA 1EMDA 1G7CA 3SS7X 2XQKA 3IP7A 1PL6A 1ZHHA 1Y1TA 3PXUA 1JR4A 2B25A 1WB5A 1R9MA 1EUCA 1PZGA 1UQRA 2QZPA 3DHEA 3V34A 3GAZA 3PFCA 1KU0A 2VRCD 5JS6A 4UCQA 5KB3A 3RRFA 3MQ4A 3SCZA 4RENA 2OXEA 4HYQA 2ZYAA 1N1GA 1JHYA 4GBMA 4ZT6A 3PXXA 1TVKB 4D0SA 1RBMA 3U2QA 2OM6A 1D7OA 4LNUB 1ZI9A 1QH1B 1IDOA 1YQEA 1CS4C 1GZSA 4F3TA 5DSTA 4IHKA 5FOTA 1GYPA 1KRXA 1XD9A 3WK7A 4LXYA 1OI3A 1JG3A 1XP5A 3LA8A 4A0RA 2RJNA 2PMKA 2PLRA 3L07A 1GL6A 5DM4A 1QP0A 1XL1A 3M6LA 1XO1A 4TRRA 1NM5A 3PI6A 4PV7A 4PFJA 1U9YA 1HL7A 4GPTA 1OX4B 2BFMA 2I6UA 3ABZA 5L6MB 4EUHA 2P2GA 1SB8A 2X0NA 4EYGA 5KPJA 3PV0A 4XDYA 2Q0XA 1VL0A 4IRUB 4L7QA 5KYGA 1ZD9A 1B15A 1M2VB 3EODA 5G4KA 1I3LA 3ZU4A 3T06B 2GETA 4UOEA 1NXWA 5DTQA 2FX3A 2VHQA 4OI0A 2GPBA 1QF7A 4FS8A 2IHJA 4YDSA 1JHAA 3GH1A 3RF7A 1IPEA 2TMKA 1QK3A 2I03A 3N8HA 5T8KC 4Z4FA 3B5IA 3TXXA 3KXKA 1EVZA 1IB6A 2OD9A 3IUJA 5L3RA 4ZV4A 2PR7A 2HMYB 3G5LA 4I4LA 2KE5A 1JR2A 1T9GS 1PZHA 4M9ZA 2WV7A 2H7CA 3DD1A 1GAQA 1J8FA 4F9GA 3SXUA 1DAEA 1QYWA 4B7ZA 1Q0HA 4NJOA 1L4HA 2PKRA 1BE1A 1A8QA 1PKEA 1TQ2A 3MGBA 3LHIA 1L4GA 4BNTA 2HA6A 1E2KA 2XE8A 3LCCA 3LPNA 4NAVA 3IKVA 1IUKA 2G28A 4Y2SA 2WIFA 3Q9SA 2BCGY 2B0JA 5BMVF 2BGKA 4Y1RA 1Q0LA 3FUCA 5KQRA 1Y4UA 2R8ZA 5F9FA 3S8EA 1IRXA 2CKMA 4HWOA 2JLQA 3HZZA 3ZCUA 3AFOA 4LFBB 4LHVA 3SE7A 4DR1B 1T9CA 2BBWA 3EPHA 3W5HA 2DVMA 4EM6A 5L8VA 1CQZA 5FTLA 2O8FB 4CM7A 3G8CA 3VDQA 2PRKA 1T91A 3TSYA 1TMOA 4OI4A 4D9NA 2IS1A 3LCRA 2Q49A 4UFNA 1N0VC 1N34B 3BGOS 1DADA 1Y7PA 3X1ZA 1ZDMA 2JJ2A 3EXIA 5IS2A 1JW9B 1R5NA 2P7HA 3IKMB 5AUQA 1K89A 2V5AA 3ROEA 4BVKA 5LIRA 1MOZA 1U8UA 4ZGWA 5DM1A 2ZW9A 3EOAI 1Y98A 4RPHA 1TUGA 2ZIXB 3GWZA 1V8OA 1D9XA 1JG4A 2PX8A 3R5TA 3ZY3A 4MS3A 2AYXA 3DZGA 4BVAA 3Q5DA 1W5EA 3ORSA 4KN8A <