1WMSA

High resolution crystal structure of human rab9 gtpase: a novel antiviral drug target
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
174
structure length
170
Chain Sequence
AGKSSLFKVILLGDGGVGKSSLMNRYVTNKFDTTIGVEFLNKDLEVDGHFVTMQIWDTAGQERFRSLRTPFYRGSDCCLLTFSVDDSQSFQNLSNWKKEFIYYADVKEPESFPFVILGNKIDISERQVSTEEAQAWCRDNGDYPYFETSAKDATNVAAAFEEAVRRVLAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High resolution crystal structure of human Rab9 GTPase: A novel antiviral drug target
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
molecule keywords Ras-related protein Rab-9A
total genus 55
structure length 170
sequence length 174
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1wmsA00
5KNDA 4LBWA 221PA 3B6EA 1KK3A 1P7CA 2CL0X 4XOIA 5J4YA 2ZJYA 3NDPA 1UEJA 1P5ZB 2YNMA 1EX6A 4Q02A 5HKKA 2VHCA 2IC5A 5EXSA 1KSGA 2QGNA 1SHZA 5L3RA 3CX7A 3ECCA 3RS3A 1U99A 1S1MA 1W0KA 2BM1A 2R65A 4C0KA 4EJSC 1DTSA 5EE0A 3IUYA 3GJ6A 4W7SA 2BEKA 4ZPXA 2ZSAA 4HAYA 4DC9A 2DFLA 4DSTA 1LFDB 5TB5A 3NC0C 821PA 2GF0A 5FBVB 1W1WA 4JJKA 5KSZA 1Z07A 4KODA 1GIAA 5GJWC 2ZJ5A 3CWZA 4K46A 4P32A 3WNDA 3FYHA 1VMAA 3REGA 4BEBA 3RNLA 1OH5A 3GJ5A 2FGKA 4TSFD 4QL3A 2XTNA 1E32A 1M7HA 4MRRA 4GZLA 2ZS7A 3T61A 4A1FA 1KHTA 4ZDWA 5JFGA 4LHVA 4Q18A 3U3MA 2REBA 3ONWA 1D2MA 4URXR 1V43A 1A4RA 1KMHB 3WNCA 4B3DA 2WWXA 3SR0A 2FSIA 2F1HA 4BFVA 2H17A 4XH9B 2IYUA 3VR5A 4F38A 3T1QA 4YMVA 3H86A 2FH5B 1P6XA 2JDID 4DLUA 3BAFA 2OZEA 4UXJA 1DS6A 2J7PD 1OIVA 1SVOA 2WWWA 4BECA 5J47A 2JLQA 1Z6YA 4Q9JA 1KGDA 1TF2A 2WPDA 4EPXA 1XEWY 4CRWB 3KKPA 4QJ3A 1UBCA 4PSAA 3I32A 1Z6XA 5HR5A 2IUTA 1G41A 1M7GA 3D8BA 2JIZA 3LD9A 3P20A 1GZSA 5CK5A 2O52A 4DB4A 2QN6A 4ESHA 4BWYA 4R7ZA 4FMDF 2VP4A 3LAWA 3QENA 1QF9A 2E1RA 1D9XA 2AFHE 4AY2A 4ZI3A 1ZCBA 3P26A 1T91A 2BCGY 2MMGA 2AX4A 2RGNA 2ZU0C 3LRPA 2VF7A 1IHUA 3ZVRA 3E5HA 2XSZA 3LBNA 4KJZA 4MYCA 4BFTA 5AJXA 4L8GA 5JS8A 3OF5A 3MUFA 5J4HA 1L4YA 5DLQC 4GOXA 1ZM7A 1QHXA 1UM8A 2VBCA 5FBWB 2P6RA 5FBLB 2NIPA 2PMDA 2JLXA 1E2JA 3DMDA 1T6NA 2J0QA 4XTCS 3HYTA 5FL7A 3PFIA 4LUCA 2V8OA 2DFNA 1QHSA 3PCRB 3SEAA 5J4VA 3K0SA 1SGWA 4WIAA 3TK1A 3WP1B 2WTUA 2IUUA 3GLFA 1JR3A 1ZNYA 3X1YA 2KB0A 2ERYA 2P6NA 4V02A 3TW4A 1YR9A 2O8FB 3TR5A 4B48A 2IS4A 1KMHA 1YVDA 3I62A 4TWZA 2CNWD 2J7PA 4LJAA 2HYIC 1Q57A 2C2HA 4KI0A 1KOFA 2F3TA 4M9ZA 2ZRPA 4A2WA 1FQKA 2WICA 4CEHA 4A2QA 2J46A 2ZM5A 1IXRC 1ZNZA 4ZI2A 2F1IA 2PL3A 3I72A 3U3OA 1G16A 4C7OA 3CB4A 4V0KA 1IY2A 3S1AA 1S1CA 3A8TA 2A2ZA 4G0NA 3QKSB 4L9SA 1LS6A 4LHYA 5DHFA 4B35A 1P9NA 2J1LA 1T0JB 5DI9A 3H0KA 2I3BA 3DOEA 4FMBB 1Q21A 1CRPA 5FTKA 1VPLA 4RCZA 4BRWA 4I4LA 2PEZA 1Y63A 1YR7A 4JKIA 3DHWC 2FEMA 3AP3A 2CJWA 4Q4JB 1OHHD 4P0TA 3ETLA 1SZPA 4JLAA 4EKDA 1XXHB 2FEOA 1Z0JA 2JEOA 4GZMA 3NVAA 1KJZA 2B7CA 1K8RA 2O0KA 3AV0B 2NG1A 2V6JA 4IRUB 2CL7X 3ADBA 3WYFA 4CEIB 1WDTA 2HJVA 3CONA 5FPTA 3U6BA 1ZNWA 4GI7A 2ZRFA 4OI4A 4HDCA 5BN4A 4PPGA 4NL4H 2HEIA 1II0A 3NEYA 4P4UA 1GRNA 4LOAA 4DLYA 4WA7A 5JRZA 1JR3E 4G3XA 4RSGA 5LPNA 3THXA 3P27A 2ODNA 4I1VA 3EZ2A 2IWHA 1FL9A 1Z83A 2OCBA 2QMOA 4DLTA 1CR0A 2V7QD 4C0AC 3ZIAD 2AHOA 4EJSA 2J45A 2IEZA 5AJYA 3OEEA 5EZ5A 2OCYC 1KI8A 5FBRB 4V0NA 3SJCA 1UFQA 2DHRA 2QGZA 2VP6A 3C14C 1COWA 2CCJA 2WIBA 3L8YA 2VSFA 4I99A 5FUWA 2FA9A 5FUXA 1XRJA 3ICQB 5AUOB 1Z22A 3VKWA 1VG8A 3RC8A 3QKTA 3EC2A 3B1XA 4QJ5A 3X2SA 2BDTA 3AVUA 5JJKA 3RRZA 3RSOA 2GEUA 1FOEB 4TMTA 2J59A 4U5XA 1UBEA 3AVPA 2IYSA 2ZEJA 4HZIA 3W5JA 4DDWA 3ZD7A 3P32A 2W2VA 1P73A 2NO7A 1W49A 3PITA 1YZGA 1U81A 1M34E 4HZUB 5SZHB 1G20E 2CBZA 2LKDA 4O3MA 3N2IA 3GLGB 2JJ1A 3LX8A 4AKIA 3IO5A 2ZUBA 4KXFB 1IN5A 1W46A 4LYFA 1KJYA 2LWIA 4O0MA 1G9XA 2J3EA 2PLFA 2VSOA 4YDSA 2GJKA 1F3OA 1JB1A 1ZM4A 4G5GA 4Q1BA 4A8JC 3BS4A 2QAJA 2GBLA 1TF7A 4NONA 4DLXA 1EESA 1X8KA 2DBYA 2OLKA 1R0WA 4HAVA 1LVGA 1ZM2A 2WHXA 5HZKA 1RRFA 1XP8A 2AFIE 3ZS8A 3VX3A 1E9DA 3ZVMA 2IXGA 2BKEA 1C9KA 4TTPA 3K70D 1ETUA 5AK0A 1E2GA 1ESMA 2FFQA 5FOSA 2ASEA 2PBRA 1CF4A 2PZFA 1FNMA 1E2IA 1JECA 2AD5A 2RGNC 3KDSE 2QE7A 1NJGA 3KKMA 3QXSA 3QUSA 3IILA 5CYPA 5DN6A 5KPJA 1AA9A 3K09A 3K53A 3MJRA 3CX8A 5LD2B 2H7VA 4C3ZA 1KJWA 2BM0A 3AF2A 2OE2A 2FDCA 1V5WA 4A4DA 3K9GA 4OQNA 1P72A 1VDZA 4MKIA 3IQWA 4NTZA 2ZSEA 3RRNA 2C99A 5DIFA 4M8NE 5AUNB 4AYWA 1XPOA 1DAIA 3BFVA 4B3GA 2H8KA 1E2NA 2OHFA 3CPEA 5FTNA 3KKQA 3NHAA 1XMIA 2JLVA 1WB9A 1WE2A 2WSSA 2GCOB 1W4CA 5FOTA 2WKPA 1XMSA 2BMJA 2ZE8A 2GJ8A 4C2UA 3HR8A 1KTVA 1L4UA 1IONA 1CJTC 4BUJA 3PQCA 1RRGA 3QKRA 1NKTA 2ODEA 2VTKA 4C7OB 1YZUA 1XWIA 1YQTA 1DG3A 2G88A 2PCLA 5H1YA 4RKEA 5FI0B 3SN6A 2D2EA 2VF8A 1E94E 2J9RA 2BOVA 2QEQA 2N1BA 4QBHA 4FD2A 4UNPA 4QBFA 2BVNA 4TT3D 4II7A 1E2FA 1GITA 3ASYA 5K8LA 2B7BA 1YRAA 3FMFA 3HWSA 5DI3A 3THXB 2RHDA 3BC1A 2XTMA 1W36D 3SHFA 4Q7LA 1QHGA 2ORIA 1CR1A 2FWRA 2TMKA 4OHZA 5EJEA 4XVRA 1E98A 1DAGA 2QG6A 2ZYTX 3VKHA 1NLYA 2ZRIA 4IOJA 2YOGA 4BFSA 3OHMA 4UKDA 1YZTA 3KQLA 3KJHA 4EQ6B 2OFWA 1OB5A 1KIMA 4O2RA 3FFAA 1IXZA 2F9MA 2VRWA 3HU3A 4KVGA 3V00A 2ZS9A 1U98A 2G83A 1RRPA 5SZKB 1P62B 4B2PA 1GL7A 3U61B 1H8HD 1N5IA 4JL8A 1XCPA 2QRNA 4JLKA 5EE5B 1DEKA 3UK6A 2RGGA 3TNFA 1G7TA 1MH1A 1EGAA 2XTZA 4TMWA 5D3MA 4OK6A 4MYHA 1YR6A 5F3WB 1N0UA 3TH5A 3KFXA 5AWFC 1JR3D 5BYJA 2XGJA 3W34A 4MH0R 3HU2A 2VA8A 3UIEA 1OXSC 2WPDD 4W5HA 3RLFA 4CW7A 3AM1A 3GLHE 2FFAA 3M4YA 4POAA 1TU3A 4KFUA 3MFYA 4IDOA 4JSTA 3IBYA 4B6EA 1KY2A 4OYHA 4MKFA 3U7EB 1SVIA 3ND9A 4LPKA 3VQTA 2I1VB 2O5VA 1HUQA 1R8SA 3L0OA 3TUJC 3THOA 3X1DA 4NH0A 1XMVA 3WXMA 3TSOA 4JT2A 2BBTA 3EPLA 3LQRA 4PPNA 1ZMXA 4X8LA 1GSIA 2UKDA 3JVUA 1VCIA 2BWJA 1US8A 2O8EB 3U3JA 1OXUA 2W2TA 1GL6A 3VR3A 1DO0A 3K0CA 1L2TA 3LBHA 1IY0A 3N5CA 1JR6A 3D7MA 1RC8A 5FUYA 5JHGB 2O8EA 1TMKA 2Z4RA 4IDQA 1R0YA 2QU8A 2HXYA 5KSPA 3ZIAA 2X8AA 4HLDA 5TY0A 3U44B 2W2XA 3QG5A 5HCNA 2G1KA 1ZUNB 2C78A 5JLJA 4Q4AA 2X1VA 1KO4A 1HV8A 2AR7A 4D0NA 4DRZA 5CDFE 2OBLA 4CEJA 1BS1A 2HYDA 4B3FX 2HT1A 2A5DA 3HJNA 4Z8YA 3BXZA 1T9HA 4LV6A 5CJPA 5L3QA 1GP2A 4ON9A 3LLUA 3A1TA 3EA5A 4F92B 2FF7A 3SC3A 5CB8A 2OBMA 4CVNA 3CLVA 5G40A 2IYWA 3I1FA 3WBKA 3Q7PA 3KFVA 4U00A 1ZM3A 1KDOA 2Z4SA 3AB3A 4TL6A 3B5JA 4L16A 1ZAKA 3R9WA 1AS2A 4Q00A 3BB3A 4B32A 1A7JA 1WMSA 4TTRA 3W8RA 2VHUA 5DGXA 3GQBA 5F2EA 3TE6A 3O8DA 2MSCB 1S0UA 4KU4A 4G1UC 2QNRA 1XF9A 2EFEB 4OJKA 1F5NA 4NYJR 2PT5A 4LYHA 2ZVPX 2QP4A 3QEJA 2P2LA 4AWXA 4JYCA 3C5CA 4A0HA 3WYGA 8OHMA 1COWD 3FMPB 3EZ6A 4DCNA 2QY9A 1KAGA 3EIEA 4O2LA 3RRMA 2RGDA 2K5UA 1Z06A 1BOFA 4DEXA 3RSLA 4AG6A 1IN6A 2AD1A 2ZSFA 3L82B 1UDXA 1U8AA 1XZQA 2QL6A 2ZRNA 4Q9LA 1R4AA 5TMPA 3G0HA 4BFYA 2JA1A 5B64A 1VKJA 3RRYA 4RFSB 3NDBB 1EFTA 2GJ9A 5DH9A 3ZVLA 4M4SA 4ZCMA 1GKIA 5EP3A 1QHNA 4QJ4A 1E1QA 3PUYA 2CLDX 1NSTA 4URVR 4DCTA 1Q44A 4GOJA 2WJGA 2ZR0A 3T12A 3NBXX 1DADA 1EWRA 2GZHA 4Z1MD 4XTRA 3VAAA 4E22A 3CO5A 2EFDB 1U8ZA 3HPRA 4MITA 1P2VA 1Q0UA 1CXZA 1KYIA 2ZRDA 3I3SR 1TL7C 1ZC3A 3LV8A 3BD9A 4BZXA 4Q7KA 5B58C 3NBFA 4D0GA 3W6PA 5LB2A 4EQ6A 1X8JA 2BMFA 1HQYE 3SHWA 6Q21A 1ZD1A 3KJEA 2AK3A 4YMWA 1CBUA 3E70C 4DHEA 4OJQA 2VIIA 1GKYA 2QT0A 3UWKA 3C5HA 3DOFA 4MYTA 3IQXA 4KLNA 2ZUDA 1KKMA 2KBEA 4NHOA 1NIPA 3QVUA 5H70A 2CHGA 1DG1G 2QAGA 2J0UA 3NH6A 2ZJBA 3SYLA 4X8OA 1GAJA 3IIJA 3JZMA 3AUYA 2EFHB 1KI4A 3F0TA 1TADA 4PPQA 4Q1CA 3AKEA 4A0GA 1T8TA 5FPYA 5DISB 2EU8A 4URUR 4W9MC 1SULA 1OHHA 3OAAA 1G21E 3OIWA 3U44A 1KSHA 3W3AA 1C4OA 4S2EA 2D7DA 1E0AA 3AGQA 4Q7JB 1E2EA 4A0FA 1NBMA 3QBTA 3C15C 1P4SA 1RKBA 5LBIA 1LF5A 1E0KA 1EFRA 1AJEA 1E1QD 1ZD8A 2NTYC 4A92A 4B75A 3V9PA 4XWKA 3UPUA 1J2JA 2OCAA 3U4QA 4KLZA 5KDLA 4LBZA 4MRPA 2WV9A 3KJIA 4M1WA 4QHTA 1J8YF 5CJ2A 1JQLB 1E9EA 2PZEA 1TQDA 3GFPA 1K5GA 5DYGA 2AXPA 2ZROA 2ONKA 4KITB 1FPMA 1G291 2E9SA 2FGJA 2X77A 2WZQA 4L5BA 1R5NA 5JS7A 5IRCD 2REXB 3FE2A 3OIUA 3FWYA 2GVZC 4BQSA 5J4KA 4JLDA 2IYZA 3SYKA 3ZLJA 4UQOA 3GLHB 4GDFA 2CDNA 1R5OA 1RJ9B 3AVTA 1OE0A 2QPTA 5E7IA 1W48A 4HEJA 5HCIA 3U3KA 4BLRA 3CZQA 4EPRA 3LXRA 1F6BA 5DYIA 3LVQE 1G4UR 1A2BA 3AKDA 4EFNA 3FMIA 3CF0A 3QQ5A 4PC1A 2QAGC 3DM9B 4LHZA 5CM9C 3RAPR 2ZYVX 2BHRA 3PJRA 3GLGE 1VHTA 5AJZA 4AIIA 1NBMD 5JI2E 2NO9A 1D6JA 4UJ5A 2YV5A 2EWVA 3FHOA 1BMFD 1ZD9A 4TMKA 5KNCA 4A82A 4B6FA 4MGZR 5AJVB 4KYIB 2GA8A 4IOKA 3VR2A 1IBRA 1E79D 3ZH9B 3SBDA 1E9FA 1VYUA 5F9FA 3P1JA 2LKCA 3FHCB 3CKLA 5FL7D 1VHLA 4MA4A 4Q9KA 4O25A 4XWOA 3UG6A 4I1OA 5TDHA 4M21A 3I4LA 3FPAA 5CLQA 1RYHA 4XJXA 2JLWA 1D8TA 2DR3A 2IHBA 3TQCA 2CCKA 4AKHA 4LBYA 4PC2A 5FPHA 4Y0VA 2IK8A 3J81k 1D5CA 1JALA 1U0JA 3B9QA 3FDIA 3TQFA 3GLHA 5DE3A 1GRQA 1F2TA 1E2MA 1KO5A 1G8PA 1KO1A 1XJ0A 3BFKA 4QHYA 3QBVA 3I92A 1MRSA 2WWGA 1NN5A 4PANA 4D0LB 1Z0AA 5JRJA 3DKVA 5KSYA 4PC7A 2OFOA 1CULC 1U94A 4KSCA 3IPXA 2QSYA 4U02A 3ZS9A 4PZZA 3GLIE 4NYIQ 5TXGA 5JBQA 4BPBA 2XEXA 3H4MA 3Q7QA 4HLUC 5JWHA 1EWQA 4F93B 1Z6TA 1OXXK 3AGPA 2F43B 1FTSA 1G5TA 1Q3HA 1WP9A 4RD6A 4IKEA 3PVSA 2ZRAA 1G1MA 4QM7A 2JLSA 4AD8A 1DAFA 3R8CA 4DT1A 1VG9B 1NIJA 1M2OB 3W8NA 4UNNA 3U3RA 1YU9A 2GETA 4HB4A 4UJ3A 4JVSB 3U5ZB 4DUGA 4A6XA 1TX4B 1A5TA 5IF9A 2IYXA 1UEIA 4ZIRB 2CCGA 3FKSA 4EPYA 2J0UB 4Q03A 4DBLC 5CLLA 4XSGA 1P60A 1Q12A 4R2IA 1YKSA 1T3SA 3TMKA 4D81A 3L8ZA 2NO0A 4OK3A 1MO6A 1IN8A 1HT2E 2OEPA 1XCGB 1YR8A 1NVWQ 2V1XA 3IIKA 2OV2A 5KTYA 4ARZB 5K8TA 4HLCA 2A5GA 2QPAA 4PQRA 4A36A 1JXOA 3BH7A 2V7QA 4N1AA 4IFEA 2ZJZA 4KVAA 4PQFA 2H16A 2PMKA 2JJ2D 1TQ4A 3TRFA 4E5UA 1Q22A 1QBKC 4OI0A 4HLQB 4DDTA 2UZ3A 1I4TD 5JSZA 2RGAA 3QOFA 2QTHA 3QF7A 1NN1A 1Z6AA 2R9VA 3I73A 4PHHA 2XJ9A 1JNYA 3B82A 2P67A 2H1LA 2DY1A 3C4JA 3CWQA 1OFIA 4NE2A 4JLJA 1N6PA 2VP9A 4TN1A 3LW7A 2Z6VA 2JLYA 4IDNA 4CEIA 2J0SA 2O8BB 2AN9A 3EC1A 3LLMA 4LHWA 4Z8XA 1UJ2A 1BMFA 5UKDA 3TGPA 2WKRA 4IOMA 1XXHA 4PX9A 3HR7A 3SNHA 4HATA 1Z0IA 1T5LA 1J90A 2P0EA 3GPLA 3AF0A 3CH4B 1Q1BA 1SXJA 4JVMA 1U90A 4GL2A 1JI0A 1SXJD 4ZDJA 3SE0A 3WYAA 1E2LA 4XVUA 3PEUA 1ZRHA 1W4BA 2P5SA 3R9IA 1NG9A 1S2MA 2ANBA 2O8DB 3OEHD 3B2EA 1F2UB 1JPJA 3GEEA 4JBXA 4WZBE 4NYMQ 4BFZA 4CYMA 2QAGB 2ZJ2A 2GAAA 3R7WB 1SHKA 4AK9A 5BN3A 1DAEA 4PZYA 1PV4A 3QXXA 5K8IA 2VP5A 4MUAA 3B9PA 3KKNA 3KUDA 2W6IA 3F3YA 4D4KA 5HPYB 1W0JA 2IWRA 3KQHA 2JGNA 1AKEA 5FL3A 3EZ7A 3AKCA 4M1MA 4HI0E 1QRAA 2W58A 2DFKB 3QNUA 3ZVNA 4BFUA 2PX3A 3MGCA 2WKQA 3QF4A 4PPFA 3FVQA 3B85A 1UKZA 1DELA 1NSFA 4GPTA 3E1SA 1G3RA 5FOVA 2ZRKA 1TAGA 1SKYE 3GEIA 1M6NA 5EE9A 4AG5A 4C9BA 2QT1A 1X1SA 2W83A 3FTQA 1XDBA 2FZ4A 3LNCA 3K9HA 3VKGA 4DT1B 3BH0A 5HTKA 1OXVA 1YHNA 2NMVA 1AGPA 3L0SA 1CJVC 4AC9A 2KSQA 1DO2A 3O8RA 1NN0A 3W6OA 2FV8A 4P4TA 2VO1A 4Q01A 2BEJA 5C46F 4DCVA 3DEFA 2IXFA 5ANRB 4TQ9A 4Q7MB 5K8UA 2X2EA 2IT1A 1UKVY 1N5JA 3GJ7A 4PFSA 4DSUA 4TYNA 2KBFA 2GRJA 3ZDQA 1TUEA 1OSNA 1U9IC 5JWRA 2XITA 1ZIOA 4QBIA 3LO5A 2QA5A 3IGFA 2FN4A 3K9NA 1F2UA 2NZJA 1NMZA 3IBGA 4NCNA 4LGMA 4B76A 1R10A 2RH5A 3PUZA 1Q20A 2HCJB 1E9CA 1G17A 1KNQA 3T1TA 4D4MA 3PEVA 5GJCA 4HB0A 1OKKA 2RGBA 4HB2A 2NGRA 3K0FB 1XCMA 3A1SA 3RYTC 4B34A 1U8YA 1SKYB 2IUSA 2ATXA 2O0JA 4Q9IA 3QPWA 3THWA 5FOXA 2PJZA 5EXXA 2YWEA 2PLRA 4OHVA 1Z5ZA 1W36B 1TEVA 2ZJ8A 4E07A 4DZZA 1NVVR 2KE5A 3NBZC 1MRNA 2PX0A 4PAOA 4ZIRA 3RS4A 1N6LA 2ONJA 1OF1A 1DPFA 1HTWA 3W5IA 4LK2A 4QC2A 4TYQA 1KDPA 4MYUA 2IA5A 4GT1A 4LJ7A 2C77A 3W3ZB 5D3MB 4Z54A 4A9AA 4DIEA 5EQTA 3EX7C 1HEIA 4XD7D 5D3QA 3NC1C 2BKUA 2ATVA 4LJ4A 1T0HB 3BK7A 4XD7A 5KO2A 5A5GA 4FWTA 5JJIA 3AVOA 4RZ3A 4QGFA 4AYTA 3Q5DA 1XTIA 3LDAA 3SI7A 1G8GA 3T06B 4FMCB 4EFMA 1KK2A 4IXNA 5AUQA 2R2AA 3GJ8A 2XZLA 3KX2A 1CP2A 3EG5A 3A58B 5KDOA 5L8VA 3MD0A 2XAUA 1LV7A 4F4CA 2RB4A 1JAHA 4YXWD 4C0SA 4F91B 1X86B 1EFCA 1FP6A 1EFRD 5LB4A 3VNVA 3WHLA 4GFDA 4MQBA 4X8HA 1W44A 3TLXA 2ZE6A 4V0ME 2VL7A 1XJCA 3ADDA 1FMJA 1W5SA 2XJ4A 3BFXA 3RWMB 4B47A 1SXJB 1FMLA 1Q1QA 4DKXA 1II8B 1C1YA 1WRBA 2I4IA 2ZETA 1HE8B 4OKSA 4N0DA 2IF0A 4QNRA 4WOPA 3WBJA 3CR8A 3NIBA 4TZ6A 5HE9A 2XNDD 3DDCA 2CK3A 1XD2B 2A5YB 1FUUA 1L8QA 1IM2A 2GWHA 1QDEA 5F9HA 1Z28A 1IJEA 1NVXQ 4OHYA 3WMGA 3NG1A 4V03A 3TUZC 3CPHA 3K0AB 3DKPA 1AKYA 4NZYA 3DZ8A 4L15A 1W4AA 4URYR 1E1RA 1BIFA 1P2TA 4QFMA 4M9XA 2QMUA 2CNWA 1RYFA 4OQMA 4KO8A 3OIYA 1N6IA 2D4HA 3IHWA 3H84A 1D9ZA 2WJJA 3SJZA 2VH5R 4RY2A 521PA 1XEWX 2BMEA 1TPZA 2GZDA 2YOHA 5FBQB 1R0ZA 3I8XA 2P5TB 4F4JA 4HDQB 3MWKA 1E4VA 1P9WA 4KAXA 4PHGA 2X19A 2YWFA 4NCKA 3KUCA 1MO5A 1ZINA 2BJVA 1BH2A 3BH6A 1OH8A 1E4YA 4PZLA 4US1R 2DFTA 4B2LA 4OQLA 1N5LA 4TL7A 2IEYA 2R6GA 4QG7A 1G7RA 2CK3D 2IYVA 1EX7A 2BBSA 2NQ2C 4KFTA 3VMFA 3GFOA 4Q4HA 5M04A 4HZUA 3OFNA 4V0MA 3K8YA 4GRAA 2C03A 2IYYA 2YYZA 4D82A 3UKDA 1R6BX 1AZSC 2QENA 4L4UA 4P33A 4I1SA 3ZZ0A 4G5SA 1WQ1R 4Q4LA 5FFMA 4LJ6A 1ZNXA 3UMFA 4QXAA 2Q3MA 2JAQA 4JLPA 5C4MA 4XSHA 2ZR9A 4FN5A 1OIXA 3D31A 1N6NA 1SKQA 1XEXB 4LJ9A 1SVWA 1G6OA 4Y0AA 2WMOB 1NJFA 4GP7A 2R6FA 1DE0A 2CVFA 1GFIA 1KY3A 3RWOA 3PEWA 1YZQA 1NN3A 4LC1A 3PENA 4NBSA 1T3HA 2FU5C 3LVRE 2WM9B 4YMSA 4PAQA 3SFZA 4PXAA 1FUKA 2GHIA 3BB1A 5G3YA 3D6TB 4BASA 3G82C 3B7GA 1GILA 2CE7A 2QZ4A 5DN6D 2ZXUA 2GEDA 4CGZA 1XEXA 4BLTA 2ZVQX 2ZRCA 1LF0A 3O8CA 1OYYA 4PHTA 2ZRMA 2R6AA 4Q21A 4BGDA 3ZD6A 5L3SB 2NOAA 4Z51A 1KSJA 1ZYUA 1FX0A 2FSFA 3T1VA 1AIPA 1Z8FA 1S4QA 1P75A 3HDTA 4NMMA 4AURA 3QE0A 4M22A 2A7QA 3L0PA 3DL0A 2W00A 4DB2A 1OW3B 3Q72A 2YKGA 1AN0A 2ZI5A 2QI9C 1TNDA 3I5YA 5IT5A 3IIMA 2Q0HA 2GJAA 1MT0A 2SHKA 1IN7A 3A1VA 3AF1A 4GSYA 4JVNA 3SOPA 2WVJA 4Q19A 2V54A 1KK0A 3SBEA 1G3QA 3CPJB 3R7WA 5J40A 1Z47A 3EPKA 1ZVQA 3RS5A 3PUVA 2CMKA 4RD2A 2WOJA 121PA 1N2CE 3A6PC 1CJUC 1SVMA 4LSGA 1Q1EA 2AL7A 3WMFA 3ZZTA 2YC4C 2ZE5A 1OH7A 4CEHB 5KYKA 3LBIA 2WJVA 4QHSA 5HE8A 2O0HA 3U4QB 2N46A 3AKYA 4OQXA 2DB3A 4D4JA 3ZQ6A 4M1TA 2GVDC 1SVKA 1VYTA 5JZVA 3IHLA 4DLVA 4E03A 1Z0KA 4D26A 3F5FA 2QROA 2N42A 4ASUA 3BERA 3EARA 2P3SA 3I61A 3K09C 4OHXA 1RPZA 3OFND 4WVFA 1TUIA 4Q4JA 2VYFA 1N0WA 1RE0A 4P31A 3UG7A 2OO7A 1VCOA 5IK2D 1A82A 2B8TA 4G5RA 4N0EA 5L3QB 1G19A 1HY3A 2ZE7A 3M0EA 4TT3A 1CJKC 2FMXA 2IBMA 4NYMR 2ZUCA 3NBYC 3UMRA 1JAIA 3B60A 4JLOA 5ELXA 4ILEA 1YE8A 2W0MA 5F98A 3DPUA 1ZBDA 2X2FA 4KSBA 1GUAA 1N6RA 1CS4C 4M1KA 4ZKEA 5P21A 4BLPA 4TSFA 1PLLA 2GK6A 1UF9A 1FFHA 1N3BA 1P2SA 1OKKD 4GNKA 4Q1AA 1R5BA 1CLUA 1EFHA 3PUXA 2AWNA 3MWYW 5KPDA 4OK5A 4A8JB 4XWAA 4JMPA 2WWYA 1D2EA 4ZO4A 1N6KA 2BMDA 4LJ5A 1AGRA 2QM8A 2GESA 2V3CC 1FNNA 5AR1A 1GNQA 3CRW1 3DVLA 4BLOA 4A15A 5KSOA 1XD2A 4FIDA 5JECA 2RGXA 3NEJA 4X8MA 2JLZA 2Q21A 2G1JA 1M74A 1E9BA 1VCMA 4B43A 3QEOA 1RIFA 3W9YA 1SXJC 1R8QA 2KI5A 4PO9A 1G3UA 5JCZA 3SS8A 2D3WA 4FINA 2ODWA 1KI1A 1NI3A 1NP6A 3RABA 3KZ1E 2F1JA 3KQNA 2ZR7A 5CYOA 4XVQA 2QBYA 4JYBA 1IXSB 4PQYA 3X1ZA 2PEYA 3KKOA 2C9YA 1DAHA 2VP0A 4H1UA 2PJRA 4LHXA 3IKJA 1IAQA 3VHXA 4MRSA 3KXKA 4LI0A 2CXXA 2C04A 4LYAA 2Q3FA 1H8HA 3MLEA 1KNXA 2RAPA 3L2OB 4PO1A 1E9RA 1KI7A 1N25A 4HB3A 1JJ7A 1QHHB 3Q3JB 1XMJA 4IEIA 2JJ2A 2BIFA 3VU9A 3BBPA 4JLVA 1NNEA 3KB1A 3CRQA 2FNAA 2XNDA 3KTAA 1YJ5A 2GBLC 3OESA 1RW4A 4A8JA 1W2GA 2F6RA 4JSYA 4DLSA 3EW9A 1QG4A 2J0VA 5IHPA 2WJIA 1UBFA 3U6KA 2HT6A 1GG2A 4KV9A 2WBLC 1E2QA 4Q4HB 3SDZA 3D3QA 4Q5IA 4EPVA 2ZI9A 4LZZA 4YONB 4B73A 1G18A 1S3GA 4JZKA 4KBFA 4ZCIA 1TU4A 4MGIR 4RVCA 1ZM9A 1WBBA 4BFXA 1S9HA 2ZI3A 4TMVA 3B78A 1A2KC 2ZRBA 1NLFA 3U7HB 4Q4AB 2ZRJA 3FB4A 3KB2A 3SJBA 3GLFB 2EW1A 3B1YA 2QQ0A 3PIRA 1CR2A 1TQ6A 3LXXA 3CH5A 1SXJE 3DMNA 2AWOA 4AI6A 2CEAA 1FX0B 2NPIA 2OXRA 3MMPA 5EXPA 5EE1A 2YJTD 3Q5EA 1KMQA 1T4GA 4HAZA 3OIVA 3HYRA 1EFUA 1EG7A 2CHQA 1BKDR 4RZ2A 2QTVB 2C96A 1P9RA 2GDJA 2PT7A 2G3YA 4C0LA 3GLFE 4P4SA 2ZTSA 5LDDC 2G0TA 3GP8A 5KOYA 2QMEA 4RFSA 2XOKD 5JWOA 3AP1A 4ABYA 2VSXA 3GEHA 4EPWA 1LW7A 1XTQA 5IDVA 2D06A 2QBYB 4QGGA 1QHHA 2D2FA 5G53C 2XB2A 2W6JD 1M8PA 3QI2A 2HCBA 2UZIR 3UXMA 1IJFA 3U7GA 1HA3A 4LYJA 3WRXC 2JJ8A 4YMUA 2V1UA 2GKSA 3DZDA 1OIWA 2Q6TA 3AVYA 1KKLA 1II8A 1UPTA 2P6UA 2WWFA 4LPSA 4C2TA 4ZDKA 1K6MA 5CM8B 4TLCA 1MABB 1J70A 2A5FA 1VIYA 1XTSA 3HU1A 3LW8A 4OHWA 4CEJB 4Q1FA 5BN5A 1T8UA 3LQQA 5EUQB 1JJVA 1W0KD 1XB2A 4CDGA 1YZKA 4IEEA 1S8FA 3U60B 1UAAA 4QNMA 5EZ6B 3ZGXA 2NO1A 2ZAOA 3OAAD 3CF6R 3QG1A 3LY5A 3MWJA 3AVVA 1ZUHA 4AKEA 4NU0A 2QQEA 3LFUA 4OI2A 4C0JA 4BEJA 3QVVA 5SZIA 4TLEA 4YXWA 1W5TA 3PUWA 2IX3A 2GCOA 2WMNB 1GVNB 1ZW6A 2EWWA 3R20A 1PZNA 5JEDA 3LWNA 1YZNA 1VTKA 1XD9A 4NYIR 4ASUD 2IL1A 1W7AA 3A1UA 4K8OA 5FOUA 4ZDIA 2GNOA 1B0UA 2W6ID 4YDHB 2WWIA 1U0HC 3UATA 2H5EA 1GNRA 3A4LA 4MKGA 4ZV4A 4F7WA 4UXIA 3BORA 3B13B 3P4XA 4UXHA 5A0FA 4A0RA 1R7RA 3EZ9A 4ACBA 2Y8EA 1GNPA 1E1RD 1LNZA 4YMTA 2WSSD 2DCUA 1E2HA 2G0NA 3T15A 3VX4A 1G8YA 3ZZUA 5KDDA 4LX0A 4FCVA 4MKHA 5FPSA 4EPTA 3PEYA 2AKAB 1DARA 1GL9B 2ODBA 5FTLA 4A2PA 2JJ1D 4IDHA 1MOZA 2J5XA 2KWIA 1DAKA 4NP6A 4OQFA 4DUGD 2PZGA 3ZQJA 2OM2A 2IHYA 1KI2A 3FGNA 1XPUA 2A3RA 2RGEA 3TKLA 3TSZA 3R9XA 4PR0A 1ZU4A 4F4IA 4KCGA 1F2TB 1CJMA 2VPPA 1EXMA 3MJHA 1XTJA 2ZAMA 3REFA 2O8BA 3U2QA 5C18A 4Q1EA 1P2UA 4B71A 4DLWA 1G4AE 2ZSBA 1WBDA 3C8UA 3ZJYA 3RVBA 2GXQA 3VFDA 4DLRA 1F60A 4M1YA 3QSYA 1JXMA 4JBWA 4HYYA 2IW3A 3G5UA 2ZITA 3QKRB 4QOSA 2QMHA 1HH4A 4Q66C 5JMTA 2ERXA 2XXAA 2FSGA 3CBQA 2O8CB 2PH1A 3IEUA 5A4JA 5EP1A 3WMEA 1W4RA 3A4NA 1E96A 1QHYA 3CR7A 4LJ8A 4DCUA 3QJYA 721PA 1KAOA 2QPOA 1Z0DA 3A1WA 4TMZA 4D25A 1E0SA 1KDTA 4FI3C 3FKQA 1E6CA 3GLGA 1ANKA 4N3NA 4MGYR 1WXQA 1FTNA 3UMSA 4EFLA 1NRJB 2ZI7A 2JDIA 3EA0A 1CRQA 5FOWA 2VLIA 1K5DA 3ND8A 2REOA 2ORWA 3EWSA 5SZJA 3VHLB 1X3SA 4DDUA 3VR6A 2VP2A 1N6HA 621PA 1NKSA 4DDVA 2GF9A 2G9NA 1HT1E 1IN4A 2FJUA 3H2YA 3LA6A 1PLJA 3P4YA 3CNOA 1X6VA 4TL8A 1H8ED 2VHJA 5EP2A 1QVRA 3CIOA 1VG0B 5BXQC 1TTTA 2QUZA 4IXMA 2C8VA 3THWB 4I1UA 4QKQA 3HP1A 1OT3A 2XNSA 3K0CC 2WIAA 4P4SB 5TVKA 4AYXA 4ERNA 1ZCAA 2G6BA 2R6DA 4WBSA 4DCSA 2EYUA 2DYKA 1XNJA 4WAUA 5HZHA 2Q9BA 2W0SA 2ZREA 4LRWA 4M53A 4Q48A 2Z43A 4US0R 2RGCA 5DO9A 4LJYA 2QTFA 4JLMA 3B8HA 3E2IA 2JLRA 4B44A 1M1YE 3TVDA 1G3MA 5E7MA 4RD3A 2EFGA 2GTPA 2JLUA 3FHTA 1KO8A 3OE7D 3RANA 3AVQA 2BV3A 2GCNA 1NY5A 2CLCX 3GCGA 1OYWA 1WF3A 4W5JA 3BJIC 4HUQB 3JVVA 5LD2C 4UNRA 1U9IA 2V4ZA 2XB4A 4HAWA 4TLAA 4TQUS 1X8LA 4M0LA 4Z1MA 1AS3A 5J4LA 1KZGB 2C9CA 5BQ5A 2GXAA 2IS1A 1E0JA 4P3YA 4B3CA 2C98A 4JT4A 4YQFA 1E2DA 1KI6A 5EE3A 1NMYA 2WJHA 1W47A 2CJWB 1N5KA 1P61B 1SVSA 1S3SA 1ZUIA 2YWGA 5TV2A 5JHHB 3KQKA 5C1BA 3THYA 5FR2A 1KI9A 2F3RA 3TSWA 5B30A 4D80A 4R2HA 3EXAA 4PSKA 2OCPA 2ZI6A 2HXSA 3QXCA 4K81B 5DI3B 3TBKA 4ESVA 1GOTA 1NY6A 1XEFA 3FMOB 3N2EA 1YRBA 2ZPTX 4FMCF 1NVVQ 1VCNA 2R6CA 3NWJA 3QKSA 3QPUA 4GP6A 2NO6A 5FH9A 4FWIB 1R2QA 4BFWA 5H8WA 5E3HA 2MMCA 1F48A 4KYUA 5EP4A 5GJVC 1CKEA 2EQBA 2BBOA 3SJAA 3PV0A 4IFBA 3K70C 4MUBA 2QRZA 5FTMA 1E2KA 2F7SA 2BJWA 4XIGS 4AKGA 4JLNA 4JS0A 2OSBA 4LDJA 1X1RA 5DHAA 3TVTA 4C0BA 2A30A 5CB6A 1XTRA 1BO6A 1UKEA 1T3LA 2AXNA 3FOZA 1I2MA 3A37A 4KFSA 4TLBA 1VIAA 1LB1B 4ZCLA 1VECA 3RDPA 2IYQA 3CUEF 4CT5A 3T35A 1Y3AA 2CHVA 1E99A 2WOOA 3CX6A 2FE4A 1AS0A 5FTJA 2O8DA 2LCFA 1GWNA 4JL5A 3A4MA 2CE2X 4TZ0A 3ADCA 421PA 2B6HA 3T34A 3KJGA 2D7CA 4PTLA 3C7KA 4WXRA 4DJTA 1ZU5A 4HSEA 1DVRA 1H8EA 2HDNB 3CM0A 2IF2A 4TYYA 4CIDA 4IDPA 4JBYA 3QXJA 3W90A 4TYPA 4JL6A 3CRRA 1ELOA 1XXHE 4C0HA 3QY0A 1KO7A 5IK2A 2IYRA 4TMXA 1RFLA 3CRMA 4Q9HA 2HF8A 2WSMA 3TIFA 3SQWA 2A9KA 4NKRA 3MAAC 1OH6A 2GJSA 3GJ4A 4WZAE 2BC9A 2EYQA 2D62A 3DO6A 4IJMA 3OEED 5BW8A 1OFTA 3I8SA 3VNUA 2DWQA 3I5XA 1W0JD 2G77B 1E3MA 3EPJA 1CR4A 2XSZD 3CRVA 2ZYUX 4QM6A 3GJXC 1I4LD 1LY1A 2VHTA 4WW0A 4DWJA 1R0XA 1D2NA 2NZ8A 4FCTA 2PCJA 2W6JA 3X1XA 3GFTA 3PR1A 1JPNA 2ECKA 3GJ3A 4HDOB 1KZ7B 3V4RA 1HQCA 2GXUA 2VHQA 2FSHA 4PHFA 1UKYA 1PVOA 3F8TA 2GEVA 1G5PA 1CIPA 5GJBA 3SZRA 2YVUA 3MCAA 4M1OA 1XU4A 1NG1A 1HURA 1FP7A 3BRWD 1J7KA 1G8FA 3IPYA 1SVLA 2OLJA 4EUNA 1E79A 3K1JA 3QPVA 4J0QA 3CW2A 1W2HA 5KU1A 1RRCA 4FCWA 4B2IA 2FG5A 4PC6A 1AM4D 4EJSB 4U7DA 4URZR 5DNYB 1PJRA 2FPKA 4PAMA 3TUIC 3GMTA 3BE4A 5JEEA 2P65A 2JCSA 5FI1B 3K70B 1XJQA 4MDEA 3KQUA 1BYIA 4NDZA 1OFHA 4R9UC 1MO3A 3SYNA 3NTUA 4JVLA 2I1QA 2R44A 3KTAB 5B57C 1RVDA 2FFBA 3AUXA 3BB4A 1G6HA 2OFXA 4LC0A 4CZ2A 1H65A 1WA5A 1HE1C 3ASZA 4M1SA 4V0LA 1ODFA 2AK2A 2BCJQ 3CNLA 1M7BA 2CL6X 3NKVA 3B1WA 2Q9CA 2HLDA 2V9PA 1FW6A 3NHBA 3VR1A 5J5CA 4A6PA 4TYWA 1QVAA 4NCIA 2VQSA 2ORVA 2Z5FA 1TEXA 4RZUA 2FPMA 5G41A 3Q8XB 1ZIPA 3H1TA 1ZP6A 3OE7A 5BWMA 2WJYA 2QP9X 2HJGA 3JZAA 1G8HA 4BE7B 2XZOA 2Q9AA 1IY1A 5L3VA 1NMXA 1A1VA 3SFVA 4Q1DA 3CZPA 5FUVA 4GMDA 1QG2A 1TQ2A 4EAQA 1OV4A 4JJZA 4TLDA 4BLSA 2O8CA 2Z0MA 5B2ZA 3QXHA 2QP3A 1GRRA 2L0XA 1SQ5A 1Z2AA 3MWLA 4C30A 2A5JA 2QM7A 4LY6A 4TQAA 1LTQA 5G3ZA 3AEZA 4TL9A 4LCBA 4NPHA 3TAHA 1U2RA 4WZ6A 2ZRHA 1KK1A 2Z83A 5EUMA 1S96A 4M9QA 3T1OA 1WCV1 1PLKA 4QGAA 4NYJQ 1VYVA 1E9AA 2B21A 4RCYA 4EDHA 3O8BA 5L3SA 2HUPA 4URWR 1FZQA 3B1VA 4MRNA 2D74A 3AVWA 4KHZA 2IYTA 1MV5A 2OXCA 3S1AB 1JEEA 4FMDB 2ZQ5A 5CIWA 2OAP1 3VTKA 1GM5A 1ZC4A 4KBGA 5CK4A 1KI3A 1Q1ZA 1NBME 3EAQA 3RS7A 4LWZA 3BOSA 2BBWA 5H68A 3EPHA 2ZSDA 4GOKA 1IQPA 3QF4B 3QKUA 4KFRA 1Z29A 5C2JB 2F43A 5E95A 4RD1A 3VU9B 5DSZA 4DVGA 4JKYA 1CU1A 1J8MF 3RHFA 2IS2A 3QIAA 4CF7A 2DWOA 2WWHA 2R8RA 4DLZA 1G7SA 1KI6B 3EASA 3PXGA 2YOFA 3MG9A 5CITA 4JIMA 2CLSA 2XOKA 1OXTA 2ZJAA 1AQUA 2FX3A 4I81A 4RFVA 1DBSA 2GILA 3UWOA 2AKYA 4CT4B 2OESA 3M6AA 1E2PA 3LH5A 3BGWA 3IDQA 4MRVA 2GCPA 4IVQA 4LV5B 4D6PA 1G3IA 5FPKA 3B1ZA 3V4FA 1DOAA 1TF5A 1XZPA 3A36A 3TW8B 2IS6A 1II9A 3FKSD 1OJLA 3L0IB 4QGHA 4RJLA 5JSZB 1L7VC 4BRUA 1OPXA 1EK0A 1RZ3A 2H57A 3CF2A 2C9OA 4UNSA 2OT3B 5C4GB 2GK7A 3GJ0A 2OBNA 4OI1A 3WP0A 2ZS8A 1PUJA 1GDDA 1U0LA 2E87A 2HLDD 1KDRA 2IYLD 1NLZA 1GTVA 1XD8A 1Z6GA 3OZXA 3Q85A 4V0OA 2O8FA 1GKUB 2UVQA 2RCNA 1Z63A 2V55B 2V6IA 1Z0FA 2H92A 2B92A 2KJQA 2OAQ1 3C16C 4FW9A 1XPRA 4E09A 4G01B 4RD4A 1LS1A 4YLGA 1FQJA 5BYKA 3AH8A 3SU8A 4MDFA 2XXAB 1YZLA 2QSZA 2MSDB 1ONBA 3THYB 4BLQA 2JIZD 3GLIB 4DSNA 5JI3E 2WAYA 2B8WA 2FPLA 4BZQA 3R8FA 1O87A 2IXEA 2J87A 1Q3TA 4YC7A 3K0FA 3AF3A 4R71A 3RS0A 5JJLA 4IHQA 4ZKDA 2ZIAA 1DAMA 3K9LA 3SQXA 1Z08A 2FFHA 2JATA 4PO8A 3IEVA 4M2LA 5AUPB 4DSOA 4QRHA 4UNQA 1QHIA 2ANCA 3L43A 4C0QC 2F9LA 2XZPA 2YINC 2EFCB 2XX3A 3GD7A 3EIHA 5GVSA 3M1IA 4PC3A 1BYUA 1OFUX 5FR1A 3ZYCA 1NVUQ 4HUTA 3IO3A 1CTQA 3K0AA 1I2DA 2ZYWX 5CDFA 4W5WA 1NL3A 1S9DA 4GMXA 1JBKA 3X1WA 1RJ9A 1MR3F 2FOLA 4H9GA 1Z2CA 2GZAA 4TTQA 3MRSA 4OBEA 3DM5A 2Q3HA 4EIWA 1VG1A 3AVXA 5KNBA 4LV8B 3EZFA 2GXSA 4QBGB 4ACAA 1KSFX 2DWPA 4HAUA 1IOZA 1B23P 1J99A 3C41J 3TAUA 4GBMA 2JASA 4B3BA 2DPXA 5E7JA 1N6OA 3KL4A 3Q9LA 1JEDA 3NH9A 1MKYA 4OL0A 4HLUA 4US2R 1Z3IX 4DIDA 2RMKA 1XTKA 2YWHA 2EVWX 1G7CA 4R98A 5CIQA 1HYQA 4NCHA 4BZPA 2ZANA 1QZXA 1OLOA 1CEEA 2OILA 3WRYC 3BIFA 2A78A 2R62A 1G64A 4WXPA 1AQYA 4G5OA 5HKKD 1JQJC 3WY9A 2HF9A 4IOLA 2NPFA 3ICEA 2ZJOA 3WNBA 1AZTA 1O3YA 3UANA 4D2IA 3LX5A 4LBVA 5TARA 3CNNA 2J7KA 5GADl 1P3JA 4ARZA 2QORA 2CVHA 1T5IA 1I4DD 5KHOC 4ITRC 1XBTA 4FXPA 5KUTA 3AQ4A 4RZXA 2F1RA 1UBGA 1UDWA 3T5DA 4G5QA 4IW3B 4PSVA 1E69A 4RKFA 2J41A 5JCPA 2QE7D 3OEHA 2YC2C 2GAOA 2MSEB 3KXIA 4JLBA 2YZ2A 3W6NA 3U7FB 3MSXA 2RKOA 3T5GA 1OB2A 1MO4A 1ZJ6A 4MGKR 1ESNA 3AP2A 1UADA 3HPQA 3FFBA 4L9WA 2ZI4A 3ADKA 2YHSA 4RD0A 1E9SA 3VR4A 4B74A 2C95A 4DEYA 2F55A 1W36C 2ZRGA 1PUIA 3WHKA 1G5RA 2WAXA 4B33A 3GLIA 2FZLA 3K0EA 4IVPA 2RHMA 5EXTA 1NF3A 4H1VA 4S35A 4M9SA 2HV8A 3NXSA 3RC3A 3EWAA 4Q47A 1XX6A 3TJZA 3KXLA 1MABA 2ZRLA 2C5LA 3TR0A 4IVRA 2VEDA 5AJWA 5GVRA 4D4LA 1XFAA 3BWDD 2OUKA 2ZU6A 2OG2A 3O47A 4C4PA 1US8B 4HAXA 4DXAA 3AF4A 2H18A 1N0VC 3EIQA 4NCJA 5E4FA 1AK2A 3PG5A 3RS2A 4HUQA 3N70A 4B3XA
chains in the Genus database with same CATH superfamily
221PA 3QE3A 1Y1QA 2XUKA 2ZWMA 3AETB 4WXYB 3NDPA 1UEJA 4BDTA 1TM4E 3DCIA 4NK5A 2JFQA 4YQYA 5DYNA 4RTMA 3ZWAA 2C8JA 1PU2A 3C6BA 1YBAA 2VP3A 4IIUA 1UOOA 2QGNA 2DQSA 4D3SA 3ECCA 3VTFA 1S1MA 1SC9A 3RRXA 5FLYA 2BM1A 3RIGA 3HXKA 3NHFA 3JV7A 1XNQB 4CG1A 4ZPXA 4H7DA 1ENYA 5A9RA 1G9TA 1MW9X 3PJEA 4TKUA 1DJLA 4GP9A 2R8OA 1LFDB 4P84A 5TLSA 5FWXB 1YS4A 3HLTA 4DGQA 1G6KA 4GVPA 1W1WA 4I50B 5FBVB 1Z07A 4E1AA 5KSZA 3KPUA 4P32A 5I7WA 1BCRA 3W04A 3G5AA 4AB1A 4BEBA 1CY6A 3N07A 4MAAA 4R5MA 3FOFC 3MHTA 2AIRA 2LNDA 3FGOA 4A1FA 2R68A 3AJEA 1KHTA 2A9OA 4G0ZA 4K9OA 3A3PA 3WNQA 3FCXA 3IMFA 2PU5A 4K2HA 1Q74A 4HDSB 4XJSA 4CMBA 3GVPA 2M1ZA 3P9IA 4MICA 2I3ZA 3SR0A 3P0JA 3RV3A 1W5BA 4FNGA 4NEQA 2WT8A 3BGDA 3UPDA 1ZFNA 3BMNB 2D54A 2BT4A 2FH5B 3QK7A 5TQJA 2YNMC 3BTSA 5CLIA 3OZFA 1VSBA 5EESA 3W2GA 1W19A 4UXJA 4XCVA 4EEZA 1HTTA 4RBNA 4Z2YA 2J7PD 5J47A 1SVOA 2WWWA 4XJTA 4Z5XA 4MRMA 1S3IA 2JLQA 3DFIA 1JB9A 2YVKA 4PHCA 5KC8A 2PLAA 2QXUA 2J4FA 4PSAA 3I32A 3E8MA 4O2BF 5C8DA 3EQZA 2IUTA 4G36A 1FFDA 4RK4A 1M7GA 1CZUA 4DIMA 4CTJA 3AQIA 3PT5A 3O0TA 4D9JA 1M1ZA 4UOZA 2O52A 3A6ZA 4RY9A 1UAGA 5EJ6A 3I09A 4DB4A 2A59A 2QN6A 4ESHA 2YRFA 2NADA 5EWMA 5TIIA 4Q6WA 1QF9A 5C9ZA 1D9XA 1YUNA 3FGZA 4X3OA 4A26A 4CQLB 5JAQA 1VL8A 4CLXA 2CBXA 3BQMB 5B4TA 1IY9A 2A57A 1T91A 1TIKA 1ZH8A 1GJRA 2FMHA 2DHDA 2AX4A 2ZU0C 2Y1EA 3LL4A 3CSSA 3LE8A 4ZI7F 2E48A 3IODA 1IHUA 5DWVA 3TECE 1DC8A 1NMEA 3CKYA 3ZVRA 3TB6A 5IHXA 4DMLA 4G8DA 3FOCA 4KJZA 2I4TA 1NLUA 1SC6A 5K8JB 5JS8A 1PJCA 1BWRA 1V8BA 3LOPA 1EJ6A 3G49A 1X7HA 3NX4A 2V45A 5IM4F 3K20A 5DLQC 2RHWA 4B17A 1ZM7A 2AF3C 1UM8A 2VBCA 2Q1SA 3N8IA 2IBTA 1HZZC 4EENA 2JLXA 4WN3A 2UUAB 3VYTB 1T6NA 4L1KA 4CR8A 2RAVA 4FCCA 3PFIA 3G9TA 1G2PA 3ROTA 3RFFA 4CWAA 2W5UA 3EVTA 2WQ7A 3SEAA 3ZX5A 3V7NA 5KNCH 4RCVA 4BGIA 1U5BA 3AWDA 1Z7WA 4YRCA 3S7TA 3NTRA 1JR3A 1ZNYA 2QSUA 2I6QA 3DBHA 3JQCA 4MA5A 5AXBA 5T4EA 3WKEA 3X1YA 4DCPA 5I4CA 3C6MA 1O95A 5ER6A 1KU0A 3C3XA 1NJ5A 1YVDA 4DE5A 4EKGA 3E0XA 2Z4TA 1GZHB 4TWZA 4ZYTA 1H2EA 4JFAA 4LJAA 3GMSA 1CUDA 2C2HA 3G2NA 2F8MA 1KOFA 4BNWA 3IRVA 3NM4A 4PGGA 2OPHA 2RE8A 4E2ZA 3K15A 1IK4A 1JEQA 4PW0A 3RK1A 5GMOA 2ZATA 2ZM5A 4M55A 1ZVKA 2NTVA 3OMWA 1M0SA 1WW3A 3H9EO 5DEIA 2PL3A 4AMUA 3I72A 3U3OA 1EUCB 3NPAA 2CVOA 4MVXA 3PSAA 1O6BA 3F9CA 5A4KA 3UT5A 3O5AA 4I1YA 1S1CA 4E5PA 6GPBA 3A8TA 2A2ZA 4G0NA 5B58T 4BMSA 5I7FA 1M76A 3FH0A 2YVLA 1ODLA 1G9SA 5DHFA 3UH1A 1A3CA 3SDSA 2I3BA 1A8SA 2WIDA 5FTKA 2QUIA 1O5TA 3P9ZA 1VIVA 1VPLA 3MGBA 3USZA 3FLBA 3ELYA 4BP9A 4MVYA 1Y6GA 3DHWC 2FEMA 4BNUA 3IHKA 1ZD2P 2PX2A 3HJAA 4QYTA 1OBHA 2CJWA 2O59A 3EPRA 1TRHA 1HLPA 1YAJA 4LS3A 4JASB 4C4YA 2QL7A 2YFYA 2GBPA 3ZDRA 1T1RA 4RJ2A 2D00A 1TKRA 2YIVX 5AI0A 5T57A 5ABPA 1KKUA 2DQKA 2GD6A 2FEOA 2NZYA 2P35A 2JFNA 3GUHA 3MOSA 5IJAA 4TKLA 1SBZA 1A72A 1EJ0A 1KJZA 4W99A 1K8RA 3WGGA 1U3WA 1TTPB 1JDZA 2PBFA 3I05A 4RS3A 4IRUB 2RHOA 1WDTA 2EJBA 5G4KA 5ITSA 4DPLA 5FRDA 1ZNWA 1UZMA 3DAYA 1CUZA 4GI7A 4IJWA 1UJ4A 4UE6A 1DTEA 1K7XB 5JSZB 1Z73A 4RMHA 4P4UA 4P7GA 5CCDA 1V6SA 3PDIB 4KNVA 2H06A 4PCVA 4X3PA 1M54A 1ZOSA 2M6KA 5IU6A 5AW4A 10MHA 3EG9A 2VNAA 3LCVB 4BCBA 1BXKA 1X7GA 1XWFA 3O38A 4RSGA 4WKCA 3RS9A 3THXA 3P27A 1FNBA 2IWHA 3KTDA 1XRQA 2QMOA 4Z99A 5KU7A 3QFFA 3UHFA 4Z4FA 3MFQA 4EHDA 3ZDDA 1SVUA 1TLTA 1MC8A 3CBGA 2OCYC 4C1NA 2PH7A 2V7XA 5HFJA 2X9GA 3W5SA 4DM4A 3C14C 3MEQA 4C5CA 4DV6B 1LLFA 4N3AA 1DUIA 4I99A 2FA9A 3IAAA 1PGQA 1XL1A 3KR2A 5FUXA 1NVKA 4ZCRA 1XC7A 3Q40A 1ABBA 1TO1E 2NUPA 4C6TA 1PNRA 3QKTA 3KU1A 1PYDA 3P9SA 4INPA 2BDTA 4PM4A 4QVKA 1PJAA 2ZIFA 2PGLA 4CTKA 1XRSB 1QFYA 1FOEB 2YJ4A 4Q3EA 2VDWB 1LH0A 4MPDA 3P32A 2NO7A 1ADBA 3U19A 3NHMA 4BVHA 3IBTA 1Z4LA 2OECA 1ECPA 1Z4MA 2ALJA 3GCWA 4P34A 2LKDA 3QYJA 3TGLA 1Z4KA 3VPXA 2JJ1A 3RARA 4NECA 4LFBB 1PWXA 2YV1A 1ISIA 2ZUBA 2CB9A 2HA2A 2WUVA 3GNLA 2NYAA 2IIVA 1NW8A 1GM5A 5ARCA 4FXOA 5HG0A 3WYBA 4O0MA 4P93A 4K1XA 4NMWA 5IVPA 1OFUA 4IGIA 2GJKA 3JAWA 4G5GA 1JB1A 3RU9A 1Y7PA 5DCYA 4PPYA 1EVLA 1QKJA 4GC9A 4DIKA 1T9GR 2D4AA 4QPPA 2DBYA 4XDYA 4YPFA 4HAVA 1NXPA 2NZXA 5LOVA 1ZNQO 4A0SA 1GGKA 3AFOA 3WLNA 4W6QA 2BKEA 4A16A 5AJHA 2PH5A 3VR4D 5AK0A 4ZTZB 4BU0A 4ALMA 1E2GA 1FBNA 4AO7A 1YRWA 2ASEA 2PBRA 1J25A 4P9NA 5FOSA 5IWCA 1FJXA 2HH9A 4YV1A 2VRNA 4KMSA 4OUDA 5AJTA 2AD5A 3THSA 3HK2A 1NJGA 1HKHA 3C1UA 3COWA 3ZW8A 3RUEA 4EUEA 1AQ6A 1EM8A 3I23A 3K09A 1CK4A 1YI8A 1VLZA 3L7DA 2H7VA 4OXYA 4ZMBA 1X42A 4YXFA 2P4EA 3A31A 3D0QA 4HDNB 1WBJB 1CUFA 4K26A 1L4GA 4Z1OA 4ZI7B 3HBAA 1P72A 1NUHA 1AB5A 3CLRD 3BULA 4R1LA 2VK4A 3DMHA 4ZGWA 2FZWA 2FRDC 4MTLA 5MFZA 5T7BA 2XQJA 5TPZA 3BA1A 3RRNA 1FJ2A 4NZ9A 2DU8A 3VZQA 2XOEA 1MVLA 3HLYA 4GI5A 4AYWA 1ZSVA 3GZJA 1K3FA 1DAIA 3NC4A 3ZX4A 4YRNA 3EIWA 2EDAA 1E2NA 3C87A 1GCIA 2OD9A 3CPEA 3D4LA 2YV2A 4UHCA 2GLXA 2I62A 3H1EA 3LUBA 1XMIA 3U1VA 1WB9A 4E31A 4E4YA 5KWVA 1JG2A 1GFSA 1V9CA 3HZHA 2WKPA 1EGHA 3OICA 2BMJA 4K40A 2HA6A 1R18A 4KIGA 4Q39A 4QTTB 4ZRDA 3TXAA 2X3YA 5ESDA 1PAUA 1LBHA 1KTVA 3FPFA 1IONA 1CJTC 3COPA 3EGDB 4GWGA 4HWRA 4L8FA 1JYEA 3DH0A 4LWOA 4TTIA 2OBFA 5EZQA 3IAM1 3E1KA 2JA2A 5C31A 4BO3A 1JWLA 1YQTA 2VEOA 5JATA 5F1KA 2NU7A 5FI0B 4F6LA 1G38A 2QEQA 4X93A 4AZWA 4Z7QB 5LQCA 4OBXA 2GBCA 3VO8A 3U16A 4WQMA 5DHPA 4DR6B 3DEJA 3ASYA 1JTFA 2X0NA 2VPIA 3PYXA 3QLVC 4B84A 4IWYA 3BC1A 1FSZA 4Q7LA 4JC4A 1P8AA 5AT1A 3VPGA 4XVRA 2BLNA 2Z5GA 1DAGA 5JCJA 3DBHB 2QV0A 4V3BA 2ZYTX 3AL0C 1BVHA 1E3LA 2ZRIA 3F1LA 2PVSA 1XP5A 5CLGA 1UC9A 1UJNA 3OHMA 4UKDA 3S29A 3VOBA 4BFSA 5BVHA 5LM3A 1OB5A 2PX6A 5BORA 2UZ1A 4YAUA 3VNBA 5TSDA 3M6LA 3L0CA 2ISQA 3CINA 2VRWA 1AHNA 3OD1A 2ZS9A 3UUFA 4OYYA 4RESA 4B2PA 2BJHA 3WIBA 1GL7A 4PYQA 3U61B 1RAGA 4JLKA 3FG9A 3UK6A 1DEKA 1I7LA 1S8NA 1XN4A 3BZBA 5DK6A 3SGLA 2XTZA 4QUJA 2XLCA 2ZUUA 4MYHA 3DNPA 4F2WA 1WLYA 1FP2A 1C9YA 5F3WB 5AWFC 1JR3D 3ESBA 1O9HA 1QOPB 2PU7A 1S2LA 4PZUA 2BY4A 3TTTA 3UIEA 2WPDD 3EVEA 4W5HA 3RLFA 3AM1A 1EBBA 1BXRA 1NOJA 3OSUA 1TU3A 3IFSA 1C4KA 3BD6A 4JBLA 3GGSA 4IDOA 3HY3A 4JSTA 1KY2A 4ZC8A 1PFGA 1GGMA 4GKAA 3T3HA 5IVKA 4MKRA 3V1KA 4LPKA 2JLBA 3SHQA 3VQTA 1ZGZA 2O5VA 1BQEA 1R8SA 4IKPA 4Q3KA 1QG6A 2OCXA 5HF6A 1C41A 3X1DA 7MDHA 1U3TA 1RXSA 4YR7A 2R6ZA 1OWNA 3BTVA 4E0BA 3EJWA 4JT2A 2PSHA 2OB1A 3DFUA 4IIXA 3A1DA 1KZHA 3OIDA 4X8LA 5CTJA 3FTPA 3JVUA 2ZTVA 2I2XB 3JPWA 4LCJA 3UC5A 5DBIA 3S2ZA 3Q7IA 2O8EB 5DHUA 5H9WA 4KI7A 1DB3A 2A1TR 4S04A 2Q1WA 3UAGA 2AG1A 1T15A 3VR3A 2VYVA 3DBIA 5ICSA 1L2TA 1T9DA 4QICA 3OQBA 3LBHA 2VCYA 2Z95A 3SMVA 5GIPE 5FUYA 5AI8A 3VKVA 5JHGB 2Z4RA 2VJBA 1R0YA 2QU8A 2HXYA 4IDQA 2EC5A 2VYND 1KVSA 2X8AA 3KT8A 4HLDA 2P4SA 5L40A 2AZ4A 2FR1A 4HEA6 3CUSA 2NXNA 1KAMA 1Q92A 4Q4AA 4N76A 3AI2A 1C3LA 5A4IS 1OLXA 3PVZA 4E08A 3ZE6A 5CDFE 2OWDA 2W42A 1NXOA 3GGGA 1U2SA 4B3FX 2HT1A 3R5TA 4AT1A 8ATCA 1K7CA 1IHPA 3Q11A 5L4SA 5L3QA 1WU8A 4ON9A 3A1TA 5MFPA 3AHGA 2L69A 4Q16A 3CLVA 4IUCS 2LGJA 3N28A 2RI1A 5G40A 3I1FA 3Q7PA 4GICA 1V7CA 4MI1A 2Q0QA 1KDOA 2R6HA 2Z4SA 4U00A 4Y6GB 3RI3A 4U0KA 1VE3A 1I5OA 2IOQA 2OORC 3R3UA 4L16A 3TNLA 4WVLA 3R9WA 1AS2A 4Q00A 3Q6MA 4EGSA 3N39C 4QGSA 3ZLUA 3T3OA 1NYRA 2Q1YA 1YONA 1K7FB 2VHUA 3W8RA 1N32B 2MSWA 4Q12A 3TE6A 2P9HA 5EVCA 3IHTA 4F46A 1NAHA 2QNRA 2W22A 3U80A 2EFEB 3G2JA 3QRWA 5FB3A 2VSQA 3SICE 1XZGA 2PT5A 3DT6A 3IERA 2W2QA 1YBFA 2DHEA 4GF5A 2NLOA 4JYCA 4A0HA 8OHMA 3FMPB 1TZJA 1AOXA 1T4MA 2BEVB 3O82A 5F77A 4KXXA 2P5UA 2QY9A 3T7SA 4JYAB 5KNDH 4JQCA 1SB8A 5DHQA 3RRMA 3WB2A 2OC4A 3ZV4A 4LJSA 4EW6A 4DF3A 4G0YA 4XIFA 3EULA 5T4HA 1AGYA 1BOFA 3R2JA 1PJ8A 3UAVA 4F2DA 4A5SA 3P71T 3DPSA 4C4RA 2J3HA 5GM2A 4OAPA 5HIJA 2JNWA 3IJRA 1XZQA 5HGXA 1SKUA 3P19A 3RYHA 5B64A 1VKJA 1C7EA 4EYKA 1SA0B 2GEJA 3RRYA 3WWPA 3NDBB 5DH9A 3HDHA 2CXOA 4M4SA 2C1XA 4C78A 1Y1SA 1QHEA 4KHPB 1ODSA 1FFBA 3PUYA 4MDYA 4EHIA 1NSTA 2BFFB 3AR2A 2GHRA 5DHSA 1NWHA 1EWRA 3KLBA 4XE5A 3VAAA 3R6LA 1OBOA 3CO5A 2B4AA 5H82A 3N0RA 1LRJA 1Q0UA 1RXWA 1AJEA 4EK9A 4HBGA 4X9XA 3HYSA 3U4CA 2XUIA 3PIIA 3TKAA 3CLTD 4D0GA 3HB7A 1QPGA 3ANMA 1ECLA 5CT4A 2H1OA 3HB5X 4UHEA 4FC6A 5FOUA 1ZMTA 5CD9A 4NCAA 3BQ9A 5A1JA 2ESRA 2AK3A 4QECA 4R9NA 1M5UA 5KYVA 3R75A 1CBUA 1K6EA 3E70C 3TDKA 2QT0A 3GA7A 3AZOA 3AK4A 3C5HA 3IYLW 1GLNA 3KYJB 4CIAA 4D57A 1NIPA 1WDMA 2CHGA 1DG1G 3BWEA 3IIJA 3MTGA 1IDN1 4J7CA 1L1QA 4ZEWA 3VU8A 4ARSA 2FHSA 3GRVA 3ZD8A 4CLDA 3J81k 1U8FO 3F0TA 4HQOA 3B7WA 3H4TA 1SKAA 1QV6A 1T8TA 5L6LB 1WL8A 2OYCA 1SULA 3QLEA 1NV8A 3U5TA 3OAAA 2C57A 1E5TA 2XH8A 1KSHA 3PQ4A 1NAIA 1R0SA 4HFNA 1C4OA 4NV0A 2X0FA 2D7DA 4LZOA 1I7NA 5IDQA 2JHGA 1SVNA 3AGQA 3ORQA 4Q7JB 4M38A 4RYLA 4RK5A 3GCXA 2A58A 1XRNA 5D1HA 1MFPA 3RYHB 1NBEA 1JWAB 1RKBA 3PYLA 4OH1A 3CVUA 4MYDA 4A92A 2D2XA 4L07A 3A6KA 3V9PA 3L49A 4XWKA 2G07A 4NAHA 2C42A 3BF8A 2EJUA 4J2OA 4NLLA 3VM6A 1AKVA 1B0AA 2XNHA 3ZBPA 4LBZA 3GGCA 4UDXX 5B4VA 4IMJB 3KJIA 3UJ9A 1DQPA 2J85A 4LA4A 4RXTA 2NAFA 1E9EA 3GFPA 2FP4B 3L4JA 1ZOIA 3OQ1A 3M3HA 3AY7A 5BV2P 5KOJA 3WK4A 3H6KA 3AINA 5HKAA 3TS1A 1CUIA 1FPMA 4LRYA 2WZQA 5JS7A 3P2JA 3FWKA 3FDXA 4XQGA 5IRCD 1W85B 4O4LB 1ZW1A 5J4KA 4MR9B 4LHEA 1KP3A 1ZMBA 2GRAA 1XFDA 3SYKA 3N59A 1Y4AE 2NV6A 3CCFA 2ZT5A 1E1KA 4PLCA 4KLCA 2WJ6A 4HEJA 2XRYA 1I80A 2B1GA 4BLRA 4OHFA 4QOEA 3KP1A 1R3UA 3SX4A 3U48A 1G4UR 3QOYA 4URFA 3T9EA 3CF0A 1VHJA 2GKGA 2FPIB 1GQ2A 1EQ2A 1E3QA 2QAGC 2ZR8A 3DM9B 3OOJA 3IUBA 2YWDA 4C6RA 5I01A 3DYVA 3FRHA 1GV0A 4LHZA 3MNFA 4YP0A 1T24A 1N7IA 2Z5VA 3F5QA 3ZK9A 2QZPA 3RAPR 4DQVA 3AJRA 3HGMA 1JE1A 2BHRA 3PJRA 5ILOA 2CKDA 4OOFA 3JYPA 5AJZA 3R6WA 1X0VA 3CEPB 4OUKX 4Z0NA 3TX2A 2H2AA 2EWVA 4XIYA 4WEOA 3UT5B 1ZD9A 4D8UA 5IH7A 4KDFA 5KNCA 4HH1A 1PS8A 1ATIA 1EE9A 4XIIA 5AJVB 2ZW9A 1Q6ZA 1V1MB 2V7EA 3PLNA 1IBRA 3K6KA 3MT0A 4RJJA 4RETA 2YZ7A 4FLMA 4Y2JA 5BR8B 5AI5A 2QVXX 1NQWA 2LKCA 2Y1LA 1JA0A 3CKLA 3P1JA 3N2KA 4TXMA 4JWTA 4XWOA 4NOJA 3PNBA 5AHWA 3TRDA 1JIKA 1PJTA 4M21A 2Q5HA 1T1GA 4XJXA 4PX5A 4BBJA 1I24A 2O14A 4L3VA 1WXWA 2Z8YA 3HKBA 2IPXA 3UJ7A 1OI3A 2XZTA 4CV3A 1XTTA 3ET5A 3IT3A 4H4CA 5KWIA 3GJQA 4OLJA 3WK9A 2PSDA 1WV1A 2B4TO 2QKYA 4J0JA 4X1YA 4LBYA 3JR3A 3V8NA 5EJ5A 2CB0A 1WHTB 3IE0A 1AUVA 2X41A 3JATB 1J0EA 1DKPA 2Y1DA 2DFDA 1L5KA 3WRXA 4LZJA 3ZYZA 5LZ8A 3B9QA 3D0OA 4WADA 5BW4A 3A32A 1IZZA 3E6AA 4OEHA 1F8XA 3HUTA 1F2TA 1E2MA 2IY8A 1G8PA 1Y9AA 3RF7A 2PG3A 2WB2A 4IIEA 1GFWA 2A9VA 2FJPA 2CZCA 2GBFA 4ZTUB 3F6SA 5KTTA 1YS7A 4PANA 4CM4B 3CO0S 4BQRA 5JRJA 4EYGA 3EGWA 4OHPA 3M89A 3C6KA 2Q6IA 1P29A 3IKMB 3PX7A 4QTXA 3FN4A 3I83A 4BNTA 4NYIQ 2QLNA 4RVHA 1CP3A 3H7AA 3EBLA 2QYSA 5ADWA 3IT1A 2C82A 1N78A 2XEXA 3Q7QA 2RJ3A 1VIMA 1OXXK 4FR5A 3GQBB 1Q3HA 1G5TA 4IKEA 2FMFA 4KIFA 3TNYA 2O2EA 2PGDA 5CFOA 5JJBA 1T2VA 4GC5A 4I3FA 3OQIA 1FQOA 2GTHA 5F5XA 3ZHYA 2H9YA 3AERB 3RH0A 3L4BC 1YVEI 3RUPA 1V1MA 2ECOA 4AD8A 4IFIA 5KMGA 5LJLA 4DT1A 1VG9B 5D5PA 4ZZ2A 5KHAA 4C20A 2WA2A 3W8NA 2X0JA 4A27A 4BNGA 3U3RA 2C8KA 2ETVA 2M6LA 5I47A 3SY8A 4X95A 1X1TA 1SFRA 4A6XA 1XV5A 1NXXA 1YQEA 4IGAA 1USIA 4IJVA 5MN6A 2IYXA 5SYAA 1SZCA 4I4TA 1DKNA 1UWVA 5CVDA 1DGQA 5A02A 1P60A 1DCFA 5F5LA 3CLHA 3R3YA 3PS9A 4KN6A 5D6OA 2XWBF 1ZGJA 1CQZA 3L8ZA 5DYYA 2NO0A 4OK3A 1ZK3A 3T4UA 3TMKA 3O3CA 4IH9A 3GF4A 4DR3B 1HT2E 4GVXA 1VOTA 4AAYA 1CUJA 1VBMA 1CD5A 2NNLD 2OV2A 2PSSA 4B3HA 4HXYA 5JBNA 1G5HA 2RONA 4R8KA 4PQRA 3VJLA 1IEQA 1NW6A 4PLFA 2V7QA 3EDRA 2H1IA 2YHIB 5A2QA 1U0FA 1NBOA 5HFAA 1GNSA 3DE3X 3JQRA 1SCDA 1F8FA 3WV5A 1E7MA 1Q0SA 2HNKA 4N8SA 2IU6A 3C3CA 4KAFA 1Y3HA 2HBQA 5I8WA 1BCSA 1SIOA 3RC9A 4CMEA 2ZDQA 3MW8A 2ZSUA 1WUIS 5AVTA 2BGUA 5I3ZA 3H4VA 1YH3A 3QF7A 1Z6AA 2R9VA 3I73A 4Y2SA 3TZLA 1JNYA 3QWAA 3UUWA 1PVVA 3B82A 5LBUA 3GVCA 4QXOA 5M7EA 1WOYA 2DY1A 1CUEA 3C4JA 5JQWA 1H1LA 1VJ0A 4NE2A 4M1ZA 1SG6A 3IAM6 4JLJA 4ZYYA 1Z6QA 2R25B 2J0SA 3NBUA 3ETCA 5CA0A 1EXDA 3V8QA 3LLMA 1GCOA 1J7JA 4Z8XA 3SF0A 3O6VA 4Y98A 1EVJA 1ILWA 1PTJA 3O21A 5UKDA 3BWCA 1K88A 5GONF 2WKRA 1BW9B 3PQFA 1JKXA 3TGPA 5CBKA 2FWNA 5BWNA 2FTKE 4PX9A 2X1LA 3HO8A 3HR7A 1XDZA 3C74A 4HATA 5DTJA 3SCZA 3A2LA 3SNHA 1AU9A 4GM0A 4GRDA 2P0EA 3B6IA 3AF0A 1RHUA 2WR8A 3BIOA 4HC4A 1NF2A 3D1VA 2D5CA 1Q1BA 4G9GA 1R16A 1DIHA 1DZ3A 1JI0A 3FPKA 1EP2B 1O97D 1S2DA 3SE0A 3U1TA 1QGDA 5CNIA 1ZRHA 5ICFA 3W06A 2OKCA 1ZOLA 2P5SA 5DM60 2HA3A 2NV0A 1HDZA 3GA5A 2H5IA 2WFZA 3WXBA 4B0OA 1T35A 4BFZA 5KKAA 4WZBE 3AL3A 2MYPA 2QAGB 3D7SA 4DLAA 3GZNA 4H0CA 4AK9A 3PT9A 2DPLA 2QTCA 5AI4A 2FW6A 3QXGA 1WP4A 2YZKA 2YCLA 3B9PA 3DE5X 5K8VA 1WMBA 2EX1A 1UMDB 5ALYA 1AKEA 1WD7A 3A6EA 4MO9A 4DR7B 5HX7A 3AUJB 3EOBI 4BQPA 2B7LA 3ZVNA 3QF4A 5CX1B 1NI5A 3OCYA 1UKZA 1Y5NA 5CU7A 1JG1A 4YRKA 1RACA 1U9ZA 3PFGA 3MJCA 1VFNA 4UAVA 7ABPA 5ED4A 4EVQA 3G2HA 1TAGA 5L7YA 2CNLA 1F8YA 4GR5A 3MM4A 4RJTA 1M6NA 2QYHA 3GG9A 4DA8A 4JXJA 2FZ4A 4DA6A 3VKGA 4EVRA 3L0DA 1OXVA 1YHNA 4TYYA 1IC6A 2Q6KA 4GMFA 3NHLA 2I65A 1CJVC 2OOSA 1RBZA 5CX1A 4D42A 1UODA 3EZNA 2WU4A 3VO2A 4PGHA 3G2OA 3WKDA 2VO1A 4I55B 4MUYA 1KBZA 1Q19A 5AFSA 1ECJA 1I2BA 2ZTLA 4DQUA 4EI7A 1N2IA 4WZZA 1S6YA 4AN1A 1LGYA 3FR7A 1VJGA 4UZFA 3IRUA 1SPBS 2ACEA 2K7ZA 1UKVY 3JYHA 4PRYA 2C7GA 3UV6A 4BKMA 2ZWIA 1V71A 4WN9B 2NSYA 1DCKA 2R96A 1UFOA 2E5WA 3CLUD 1ZY2A 3FRJA 1C1HA 4J49A 1OSNA 1U9IC 4HYTA 4FBLA 3T7AA 1ZIOA 4DNFA 5IANA 3L92A 2VTBA 1FIUA 4G09A 2VDRB 1E3WA 3T7RA 1MH9A 2P9YA 3MWEA 1HQKA 3K9NA 1DIGA 2CZGA 4GSLA 4QFDA 3ETJA 2QX9A 2VDUE 3E7XA 4NCNA 3QA9A 1AKNA 1A5ZA 4LGMA 4B76A 3H18A 1Q95A 4YDQA 1Q20A 1BHJA 3PEVA 3VZCA 3FOAA 1YC2A 2ZAYA 2NGRA 3K0FB 3RYTC 3UQYS 4B34A 1CUVA 4IL5A 1WXGA 3AB8A 5BUZA 2GK4A 2X8WA 2QVZX 5AOVA 3T9FA 1DMSA 3ZNQA 1CQIB 1RC0A 2EW8A 1KIAA 1DBWA 3RROA 3L5KA 1Z5ZA 2ACVA 3EGXA 1PNVA 1V4BA 1J8FA 1DV1A 1XZNA 1ZGCA 4MHSA 3UWSA 1HE3A 3NBZC 4JC5A 1ECFA 4Z9BA 4ZIRA 4IWXA 1K66A 5B7QA 1RWPA 3PRKE 2GFHA 2HK8A 2UYYA 3ZOZA 4CKBA 5IAOA 2PXXA 3WK7A 3KKZA 2H59A 3BMNA 2FP3A 3CN9A 4COOA 5CA1F 3ABOB 4JB3A 3REQB 3ENWA 4LJ7A 1C7IA 1CVLA 4DMRA 1YTUA 3O1LA 2BE7A 4Z54A 3UAOA 3MMSA 3EX7C 3H16A 2Z98A 5I9NA 3A2KA 5BQFA 2BKUA 4BVFA 1WNFA 5TJHA 5IDWA 4GWKA 5CIYA 4L9RA 4LQDA 5HSGA 1NJSA 3AVOA 4RZ3A 3Q5DA 5G1PA 4G4SO 4CL2A 1WPQA 2F3PA 1KQGA 1XTIA 2VJPA 4IXTA 721PA 3LDAA 2HRBA 4D45A 2WM3A 3JPYA 1FMFA 1T2EA 3LY7A 2ZYRA 2YR0A 4IXNA 2NT3A 2Y67A 1PBTA 2B37A 4J0DA 2RK6A 1EVEA 2LDBA 3DHEA 3DUFB 1DPGA 3A58B 1QWOA 1XROA 1NQTA 2HJHA 3F78A 4UREA 2XXBA 1BTOA 4MVJE 4D46A 1C4WA 4PYNA 1SXHA 2EL9A 3TLGA 1B76A 3NIFB 2DAPA 4IXDA 3UJCA 1X86B 3KEQA 3WA6A 4B3JA 3EA4A 4P7FA 1FP6A 3JR7A 1ZJWA 1D2HA 1EX1A 2I8AA 2GASA 2JJMA 2ZE6A 3N1UA 2AJDA 2UVDA 3D43A 4XUCA 2XJ4A 4ZFNA 2Z5LA 1J39A 3LCUA 4DKXA 3O0DA 3CV3A 3IBCA 4KQKA 1QWSA 4IHAA 1WRBA 2HQOA 3PNKA 1P80A 4OKSA 4KQWA 3C8HA 3BMOB 4N0DA 2IF0A 4A1OA 4ALIA 3BT7A 4QNRA 2PWAA 3PHGA 4RY0A 3CR8A 1FX1A 1EM6A 4KN8A 2QN2A 4WTOA 2PS0A 1G8AA 3W1VA 3DE1X 3N74A 4KKVA 4MVJA 1HNXB 4TZ6A 1KYQA 3A9UA 4KNWA 2XKJE 1XD2B 3TLMA 4TTTS 1FUUA 1KFCB 4MWZA 4NZNA 4BFLA 1L8QA 2XUHA 3VOSA 2GWHA 3KG2A 5JAMA 5F9HA 4UEQA 3LM8A 5L4LA 3E3MA 1IJEA 3HDGA 3ZNPA 4TMYA 4JOSA 2H0QA 3PWSA 1C8KA 4BMVA 4EY5A 5HA5A 4ENQA 3TUZC 2QMYA 3CPHA 4NQRA 3DZ8A 2PS3A 4URYR 3TLJA 4AQ7A 4QFMA 2XT6A 2ZT7A 2DTDA 2JJYA 2QMUA 2HU2A 3HVHA 1EPUA 3M33A 3K4PA 1N6IA 1RHJA 4V24A 1Y9DA 1FVFA 4TKZA 5LMZA 4UZSA 4RY2A 1NVAA 4OVKA 5ECGC 4C7VA 4Z7NB 3I76A 3NJ8A 5JOQA 1SC3A 2DBVO 3G8YA 4NXMB 2EEPA 1V16B 1ZL0A 3O95A 5COAA 3T3GA 2X4GA 3VOAA 4F4JA 3SXUA 4HDQB 4YCCA 3H9GA 2VZ0A 5KC9A 1JF8A 2BGTA 3MWKA 1E4VA 4O8CA 3VH2A 4D4GA 3MINA 4X20B 3KRTA 2ZSIA 4D6XA 4C7BA 4QDTA 5HRAA 1P9WA 5KQLA 4LGCA 4O1HA 1HDOA 3KKLA 4I6GA 2NT4A 3QFSA 1N2CB 1FLDA 2XYPA 5DV9A 5IAJA 5I3CA 1FJHA 4B2LA 1V96A 1VDMA 3PDHA 1J0DA 2UYOA 4V2UA 5IWAB 2CK3D 1Q14A 4ZVTA 1QIEA 2YJZA 4WMLA 2BBSA 5TT0A 3OU6A 3ZV6A 5GZ3A 2FX5A 4DMUB 1UFRA 4KO1S 4MVJG 1C4XA 1YZ3A 3RW9A 3O7MA 5M04A 4HZUA 4V0MA 4H27A 4IIGA 3PFWO 4DW8A 3HB0A 4LK3A 1B7GO 1R4MB 3P2OA 2YYZA 1DBIA 1X7XA 3ISJA 3WDSA 1EBUA 1R6BX 1AZSC 2AG8A 5G4KB 3KL2A 2E5FA 3RKUA 4BJ5A 4MARA 1I4EB 2QENA 3HRHA 2PIAA 4JEMA 1N92A 3LWZA 4G5SA 1WQ1R 4I1SA 4UU8A 4EZIA 4G0WA 4BO0A 3L79A 1U7HA 3UMFA 1RWMA 1U63A 2G5PA 1GXSB 1R9JA 3CLTC 1L5YA 3UGJA 3VJMA 4ZZ1A 5KYWB 1W8DA 1PX2A 1ZUNA 4L3OA 1SKQA 1RZUA 2CXHA 1SVWA 1G6OA 4JLWA 1NJFA 4FFBB 3HSYA 1DE0A 4NNOA 3WB0A 4R2LA 1Y4UA 4AO8A 5D85A 2V6BA 3G8DA 4KXWA 4ZOQI 1U2GC 3KPVA 1NN3A 1BCSB 3U17A 1HE4A 2XPCA 4GGOA 4J8PA 4QPDA 3STYA 2YASA 4F2PA 1GEGA 4S3MA 1D1SA 3SIXA 7ADHA 2VDQB 1GARA 4MPPA 5G3YA 2YIJA 3L7JA 4LDNA 2F59A 1AMNA 3G0DA 5DN6D 2CE7A 1Y6JA 4GG1A 2GEDA 4H77A 4KQGA 4AM8A 3ERCA 2ZVQX 4YPVA 3QZUA 3L8MA 3MD9A 3TZHA 3I4FA 3FIUA 4OCZA 1GUFA 2ZRMA 2EFJA 2JGEA 4N3CA 3EGEA 1JH8A 2IHVA 3NEAA 4AZVA 4YJKA 2PUCA 2L42A 3ZD6A 3R0ZA 1M33A 1Z39A 2H2GA 1L5HB 3EAFA 4OJYA 3A3YA 1ZYUA 3DD5A 5SY6A 3VTAA 1VLLA 4U7WA 1AIPA 4UTNA 1P75A 3HDTA 5JROA 4INJA 4YHBA 4B7XA 1DT3A 4INZA 3OUTA 3KBBA 3DL0A 1Z4JA 4XRRA 1YQUA 1DUVG 1V25A 3ESQA 2IHJA 4L8YA 4PSDA 3T3PB 4UM7A 4TKVA 2JB9A 2QI9C 1TNDA 3I5YA 3QVMA 3WLQA 5IT5A 3LPDA 2Q27A 4AJKA 3A1VA 5BW5A 1N2GA 1VSTA 3BN3A 2EZ9A 1TT5A 4QPJC 1KK0A 1H3EA 5DDIP 3I5MA 4YRJA 1V48A 3G1WA 3WIUA 4MI9A 2J6IA 4R51A 5EKTA 4OGKA 4IGFA 1ZMOA 2CMKA 4D6YA 1N2CE 1QAOA 1TCAA 3A4YA 1CJUC 1O7JA 3ANXA 3GA0A 3P2IA 4DILA 1GKKA 5H4GA 1SXGA 3QMPA 1ODCA 2HA7A 5EKDA 4DANA 1FPQA 2XY4A 2YC4C 5E0OA 1EE2A 2DT8A 2ZE5A 1G66A 1WUKS 3W9SA 4DUYB 4CEHB 2UZAA 3LBIA 2PR7A 5HE8A 4AL4A 1P2DA 2O0HA 4EQZA 1KXJA 2P1DA 3JYQA 4UM9B 3W5CA 4HUJA 3ELDA 2ZJFA 5IBQA 1SU4A 4IICA 5AQ1A 1RBQA 3IHLA 2IE0A 4FYHA 4MWGA 4D26A 2RSLA 2QV7A 1WCYA 3FNHA 2AT1A 2QROA 3BILA 4IMPA 1W6UA 3ORFA 1T5BA 2PQMA 2H1VA 2HRRA 4RF2A 5H59A 5K05A 4CM6A 4A8PA 1DZIA 4A6EA 2J6CA 1HRDA 4MVJF 2FEPA 2VYFA 4N4AA 5U4XA 4MS3B 5AW2A 4LZWA 3I6IA 1DINA 3UG7A 1VCOA 5DHRA 1A82A 3IP1A 3FZEA 2QF7A 2ZE7A 1ZRMA 3E15A 5TEWA 3G3EA 1JRLA 4Z2AA 3E35A 2IBMA 1YA6A 3RBVA 2IYAA 3FWNA 4MCHA 1RWXA 1CS0A 3IE2A 1NVFA 1SUDA 1YE8A 2J8ZA 5F98A 3BRSA 1X74A 3L93A 3F73A 3DPUA 1ZISA 2G5GX 2X2FA 4KSBA 5U9CA 1NJ2A 5JUWA 2QRGA 4QTUB 4LGVA 1I33A 1JZQA 4HGQA 1SWVA 2VDOB 3C1TA 1LEHA 1RYNA 2RDMA 3JAKB 4ZCPA 3QX3A <