1WMSA

High resolution crystal structure of human rab9 gtpase: a novel antiviral drug target
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
174
structure length
170
Chain Sequence
b'AGKSSLFKVILLGDGGVGKSSLMNRYVTNKFDTTIGVEFLNKDLEVDGHFVTMQIWDTAGQERFRSLRTPFYRGSDCCLLTFSVDDSQSFQNLSNWKKEFIYYADVKEPESFPFVILGNKIDISERQVSTEEAQAWCRDNGDYPYFETSAKDATNVAAAFEEAVRRVLAT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ras-related protein Rab-9A
molecule tags Protein transport
source organism Homo sapiens
publication title High resolution crystal structure of human Rab9 GTPase: A novel antiviral drug target
pubmed doi rcsb
total genus 55
structure length 170
sequence length 174
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1wmsA00
2UZ3A 3JZMA 3QXCA 2ZRIA 1B0UA 4B3FX 5FPYA 2EFEB 2XTMA 1SVMA 2YWEA 1P9RA 2V1UA 1UM8A 1GSIA 2H92A 1P7CA 3AF2A 5DI3B 4ZV4A 3H1TA 1CULC 1I4DD 2W6JA 3GLIE 1CJUC 2DFNA 1FUUA 3OFNA 3AKEA 1XTIA 1P2SA 2F3RA 4NYJR 5CIQA 2IF0A 1P2TA 2PL3A 2PMKA 5J4HA 3BD9A 5JI2E 1KOFA 1E2DA 4BRUA 3A36A 4LJ6A 2DHRA 4BFVA 3V4RA 2QI9C 3I1FA 1CS4C 3VMFA 1DTSA 1UADA 1S9DA 2EWWA 2OG2A 3CBQA 5H70A 1GTVA 2J3EA 4X8OA 3S1AA 1E6CA 1Z22A 3RS7A 2XX3A 1BYIA 1W36C 3B6EA 1ZC4A 4L15A 3DVLA 5FBLB 5BN5A 1TNDA 3KQUA 2VHQA 4DCNA 2BJWA 4NCNA 5EE5B 2JLUA 1AZTA 1I2MA 5LBIA 1GOTA 4LV8B 3JVVA 1E99A 1XXHA 2OBNA 2VEDA 2VPPA 3I92A 4WAUA 3IEVA 3QJYA 3CX8A 1OB2A 5ELXA 4EFLA 4HYYA 5DH9A 3K0SA 4U7DA 4G5SA 1DELA 4NCIA 1KGDA 4D4JA 5JLJA 3VFDA 3LX8A 1J99A 1KJYA 1X6VA 2WPDA 4XVUA 4CRWB 3TBKA 3CUEF 5JWRA 2R6CA 3Q9LA 1MABB 1LTQA 1Q1ZA 4D4LA 4OQLA 2VHUA 1OH8A 2Z83A 5CK5A 2BKUA 1XTQA 2PLFA 3KQKA 3S1AB 5L3SB 1SZPA 4HAYA 4E22A 1ZNWA 4QFMA 4QGFA 4R2HA 1GDDA 1KK0A 1GILA 2IYQA 4DLWA 1XPRA 2FZ4A 1CEEA 2B6HA 4YXWA 2LKDA 3TR5A 1EFHA 2AKAB 3K0CA 1QHNA 2J41A 3C5HA 3CONA 4GRAA 2ERYA 4KV9A 4ZKDA 1OYYA 2Q9AA 3IQWA 3ADCA 1FX0A 1G8PA 1XXHE 2NZJA 1E79A 2FSFA 2H7VA 4OI4A 3UWKA 1ZUIA 3RC3A 3RS0A 3EPKA 1CJVC 4B3DA 3BRWD 3FKSD 1EFRA 4QOSA 5FPTA 4BE7B 1RRFA 3PITA 3EASA 1KO8A 4DUGA 2YOFA 4GFDA 2OEPA 4Q19A 3K70C 1VCNA 1W46A 2ZJ2A 2O8BA 1IONA 2B7CA 4AKEA 2DFLA 4EPYA 4PC7A 3OFND 5J4YA 3VR3A 1DAMA 1NIPA 2QORA 3GD7A 3K0FA 1P75A 1N6IA 1P4SA 1QHSA 2ZRMA 4PX9A 4BFZA 1CJKC 2WAXA 621PA 4EJSC 2RMKA 4WOPA 4R71A 2B21A 1AQUA 4B2IA 2RCNA 2RGGA 5EP3A 5KO2A 3VX3A 1VHTA 4HUTA 3F5FA 1SKYE 2CJWA 1ZCAA 3H4MA 2ZUDA 2J0QA 4UNPA 3AP2A 5JRZA 1G17A 2W0SA 4C0HA 1TX4B 3CR8A 1E2EA 4LHZA 2NO1A 1CIPA 3IIMA 2REXB 1Z0AA 5DN6A 2QAGA 1G8FA 1WMSA 2R6FA 5G41A 4F4CA 5KUTA 4Q4LA 1US8B 4BFXA 3FGNA 4B76A 3AQ4A 2G77B 2A3RA 4G5OA 4MKIA 5L3QA 1S4QA 4PO1A 4JVNA 5F2EA 1UKVY 3CKLA 4DC9A 4W5WA 3B5JA 4BFSA 2NO6A 2ZRPA 1UDXA 3FVQA 5JEDA 5JJIA 5FL3A 2P65A 2W6ID 4I4LA 5DYIA 1OPXA 4IXNA 3GLFE 1B23P 3AF4A 4FMDF 2GJ9A 2JDID 1VHLA 4Y0VA 5SZJA 4RD4A 4M9SA 1FQJA 3NXSA 3TJZA 2Q21A 4RFVA 1E69A 3A1UA 1NVXQ 2MMCA 3K0EA 3MWLA 4D26A 1KY2A 4LDJA 2YINC 3U6BA 3C8UA 4EPWA 3GLGA 3TE6A 2FFQA 1E0JA 4ESHA 4W5HA 1XEXA 1NI3A 1H8ED 2QMEA 5HCNA 4AWXA 4LBVA 1G7SA 5JSZA 4Q1DA 1NLYA 4BEBA 1T0JB 3MMPA 1KZ7B 5FOWA 2JATA 3AUYA 2QN6A 3QBTA 3OAAA 3DOEA 1KIMA 2W6IA 2HJVA 3A37A 4AKIA 3I5YA 4IVRA 2ZRGA 4K8OA 4BFUA 3TAHA 3LXRA 2PT5A 2YJTD 3W6NA 3VU9B 5J4LA 3Q5DA 3SYNA 1GP2A 1BMFA 3RHFA 3X1WA 5IK2D 1E4YA 3PUVA 1DO0A 1XMJA 2WOOA 2KJQA 4PQRA 4JLNA 1DAEA 3CX7A 3PUXA 3KZ1E 2F1HA 5A0FA 1ZW6A 3LV8A 2VH5R 2BBOA 3VQTA 1FL9A 1NVUQ 3BFKA 5GADl 3QEOA 4BLOA 3K9GA 1CR2A 1Q44A 2O8EA 1HE8B 1DVRA 4WVFA 4CEIB 3A8TA 5TY0A 4ZIRA 1JNYA 1XRJA 1BKDR 2CCKA 2WSMA 4IFBA 3KTAB 3SQWA 3SU8A 1E2JA 3B9QA 4MQBA 3SBDA 5JWHA 4Z54A 5JJKA 5JCZA 4HB0A 2OFOA 4IDNA 3UPUA 2XITA 1A2BA 4Q7JB 2WM9B 2WJJA 2JASA 3PUZA 3B7GA 4D0NA 2ORIA 3HR8A 2GCOB 2ZRDA 1JI0A 2WWIA 1YQTA 1F6BA 1T6NA 3DZ8A 1NRJB 3FMOB 1Z2AA 2FJUA 3ZQ6A 4B34A 2AD5A 4GNKA 1JBKA 3TQFA 4DCSA 1TUEA 3LXXA 3HYRA 2KWIA 1IM2A 4NMMA 4BUJA 2N1BA 5FI1B 4ZCLA 3MSXA 5JBQA 2BCGY 4OHXA 1NN5A 2ZI9A 3GEIA 4HLQB 5E3HA 4HB2A 1SVKA 2DFKB 1FX0B 4M8NE 1Y3AA 4QBFA 3KQNA 1ZMXA 4IOLA 3A1SA 3MWJA 5C4MA 3CH5A 2OM2A 2WAYA 4M0LA 4JVLA 4X8MA 1VTKA 4M1OA 5DYGA 3HYTA 4G3XA 1GRQA 2AD1A 5HE9A 4TT3A 4H1VA 3GFPA 3TVTA 2CK3A 1AGRA 1TADA 4G1UC 5CYPA 3TW8B 3AGQA 1UPTA 1ZNZA 4IDOA 2IUTA 2FEMA 3KJIA 3U7EB 1S96A 4OYHA 3RANA 1G3IA 2ZSFA 1OFTA 4FCTA 3RYTC 1ZUNB 2BM0A 3I3SR 3OESA 4TTQA 5FBWB 4DRZA 4QJ3A 1L4YA 2IT1A 1NMZA 5FTNA 4U00A 2SHKA 5HR5A 2L0XA 4JSYA 2CL0X 4Q21A 1E1QA 4LV6A 4EIWA 1G3UA 3NC0C 1QVAA 2IYTA 1YZQA 2YYZA 4EQ6A 2QT1A 2BCJQ 1FUKA 4FN5A 2XOKD 3B82A 3K9LA 1MABA 3HJNA 1CXZA 2X1VA 2J0SA 2IUSA 1GKYA 4LJ4A 4AK9A 3RRZA 2ZPTX 5KNDA 3AKYA 5L3QB 3AVTA 1FNNA 3EAQA 1PLLA 4QJ5A 4NYIQ 5JS7A 3QNUA 3DMNA 1OSNA 2R6DA 1N6OA 1PLJA 2NZ8A 5CM8B 5CITA 5H68A 2F3TA 2JDIA 1UKZA 5DE3A 1KDRA 4RD2A 1FFHA 4B6EA 1KMHA 1LS6A 5KNCA 1XXHB 4TYYA 4PQYA 1XEWX 2GBLC 4G01B 2I1QA 1R6BX 1CR4A 1X8JA 3PR1A 2ZE6A 5AWFC 4BZPA 2BWJA 3ZD7A 1Q57A 4KCGA 1OYWA 1FMJA 2XAUA 1R8QA 2Z4RA 4O0MA 5JWOA 1W48A 4BFTA 1E0AA 2FGKA 2X77A 3NVAA 3H86A 4O25A 4YDSA 2PX0A 5F3WB 3T61A 1G6HA 1JR3E 2ZVPX 3BIFA 2EW1A 4P4SB 2AK2A 2ZU6A 2AX4A 1VG0B 1F60A 1E9RA 2VF7A 2WZQA 2QZ4A 2RGDA 3O47A 1JQJC 2ZETA 1KKMA 2TMKA 1OB5A 2GXUA 2GEDA 2JJ8A 3GQBA 2OXRA 5JHGB 3QKSA 4AD8A 3B13B 1JAHA 4RD1A 3N5CA 2UVQA 4M1MA 3L2OB 1OE0A 1VCMA 3GCGA 1GL6A 2V54A 1CKEA 4B43A 2QSYA 5J5CA 1Z6YA 2X19A 2GK7A 1Q0UA 4PPFA 3J81k 2VSXA 3KUCA 4I1SA 1X8KA 1G7RA 1RZ3A 4AKGA 2PCJA 4JJKA 4MKGA 3B85A 3QXHA 3RVBA 1P2UA 4ZO4A 2ATXA 3DMDA 5G40A 5CK4A 2O8BB 4AI6A 1QHYA 2XZPA 3FKSA 3SYLA 4ZIRB 3ZVLA 2X8AA 5H8WA 3PEYA 1G7CA 2KI5A 2REOA 4Y0AA 3THOA 1E9BA 3WNCA 5FPKA 3I32A 1OIXA 1MOZA 5IDVA 3BERA 3LBNA 2GETA 1J8MF 4C0SA 3ICEA 2XB4A 4Q1AA 1P5ZB 3DZDA 1LF0A 2ZE8A 3SJZA 5JCPA 4FI3C 1NKTA 2V7QA 4DLTA 1S3GA 1WE2A 1X1SA 2GF0A 4NP6A 1LNZA 4GI7A 1NBMA 4M1KA 5AJXA 3GPLA 3LVRE 2ONKA 3R8FA 2G0NA 1W0KA 3VKGA 1W4AA 4EFMA 1GM5A 2E9SA 4NU0A 1HURA 2GESA 2IA5A 4OQMA 3SBEA 1A1VA 1XX6A 5KOYA 4PZYA 4CEJB 4PAOA 1KY3A 3R9IA 1D9ZA 1G1MA 1M7GA 2GK6A 3E2IA 4H9GA 3K9NA 4OKSA 5BN3A 1VYVA 4A8JA 2QMOA 3IO5A 4Q66C 3V00A 4M22A 4MUBA 3W9YA 2XZOA 1Z6XA 3QVVA 1OW3B 3U7FB 1XMSA 4RSGA 5AUOB 1OHHD 3AKCA 2A78A 1GKUB 5FUXA 4DLXA 5K8LA 4NCKA 2XNDD 1UBEA 4QNRA 5GVRA 4BWYA 4MUAA 4AURA 1NJGA 3UG7A 3BB4A 4M21A 4URWR 1G3QA 1Z06A 1E2LA 3PUYA 2XEXA 1Z3IX 3GLIA 4TMXA 4KFRA 1NP6A 2EFDB 3PEUA 3WYGA 1N5LA 2ZJYA 3BOSA 4FXPA 4JKIA 2FZLA 3EA5A 3AKDA 1KZGB 2CL7X 2W6JD 2ZRAA 1U94A 3C16C 1PUIA 3HR7A 3MUFA 4F38A 4BLTA 2B92A 1N2CE 1KDTA 4LJ9A 5FBVB 3WMFA 2VHJA 2UZIR 2C77A 3EZ9A 3GEHA 4ABYA 4CT4B 2J0UB 3WXMA 1XEFA 1Q21A 3QQ5A 2ZJ5A 4F92B 4NH0A 3PFIA 4OI0A 2CEAA 2NPIA 3FKQA 1VMAA 4URVR 4DB4A 4RD6A 1VG8A 2YZ2A 1HT1E 3CZQA 2RAPA 1CR1A 2QTHA 1E32A 1WDTA 2XNDA 3B1VA 4QNMA 4U5XA 2G0TA 4B33A 4HDOB 1E2PA 4C9BA 1D2EA 3LLUA 1U8YA 3A58B 1RE0A 3LBIA 4WIAA 3CW2A 5EP4A 3U6KA 4CDGA 1M74A 4LYFA 4AYXA 4ASUD 4GT1A 4NBSA 1OXTA 2GJSA 5FTJA 2IW3A 2WKRA 2R6AA 3Q7QA 4PZLA 3AVXA 1DG3A 2B8WA 2ZSEA 4GP6A 4AC9A 4C0JA 5IF9A 3EPHA 1KSFX 2D7DA 3SN6A 3OEHD 1DBSA 2ZRFA 3U3RA 1C1YA 2V7QD 3EC1A 4N3NA 1Z0IA 3KX2A 3EIHA 1QF9A 2QBYA 1C9KA 1HE1C 3B1ZA 4TL9A 2O8CA 2OBLA 4NE2A 3PVSA 1ZM3A 2ZRNA 2F43A 4H1UA 3R7WA 3U2QA 1EX7A 1T8UA 4DLYA 3O8RA 4HDQB 2WVJA 5E7MA 5TXGA 1E9CA 5JEEA 4JMPA 4K46A 3FTQA 2QQEA 2WSSD 1TTTA 4DHEA 1OHHA 1IHUA 1RRGA 3GLHE 2BEJA 2F9MA 4BZXA 1CJMA 1R5NA 2BBTA 3MCAA 4Q02A 2D74A 3P1JA 2R9VA 2QE7D 3KJGA 4PR0A 1KSGA 1TU4A 2FFAA 1T9HA 3BH7A 3GFOA 4HAWA 2VF8A 4KFUA 4KI0A 1UBCA 4FW9A 2W2VA 4L16A 1L7VC 3FDIA 4PZZA 3SEAA 4HZUA 4JT4A 2QA5A 4IOJA 1QRAA 1FNMA 4LHWA 4LJ5A 2QG6A 4LHVA 1AZSC 3WNBA 1IJFA 1Z0DA 1W49A 2OCBA 3LH5A 3LNCA 4GP7A 4DLZA 1J90A 4EJSA 2ZE7A 4TYPA 1EXMA 3KL4A 1Q1EA 2CHQA 4US1R 2FV8A 4XD7A 1ODFA 2QP9X 3LDAA 2PBRA 5DHFA 5IK2A 3CLVA 5EE0A 1W7AA 2CNWD 4OJQA 4QRHA 1C4OA 4LV5B 1E2KA 2ZIAA 3FMIA 1JALA 3GFTA 3L0PA 4MGZR 2QPTA 4MRSA 1JB1A 3QKRB 4GPTA 4KO8A 5TB5A 2K5UA 3LW8A 1E2QA 3A1TA 1JPNA 3ZZUA 1E2IA 1SXJA 2G9NA 1KMQA 3AEZA 1ZM7A 3UMRA 4RCZA 2IYXA 4R7ZA 4B3CA 1JXOA 3AVUA 3CRW1 1ZP6A 3RRYA 4YDHB 3KKPA 4JLBA 2ZRHA 1BH2A 5EUMA 5M04A 3VR1A 4D80A 4DSNA 3Q5EA 1XJ0A 3N70A 3CR7A 1U2RA 4Q01A 3BFXA 1G41A 3FWYA 4Q9HA 4QHTA 4Q48A 3IEUA 4MKHA 3SOPA 3HWSA 1WRBA 1EWRA 2RHMA 3CZPA 1J7KA 1W36D 4JLKA 1S9HA 2ZYWX 4JZKA 5DNYB 2VO1A 1KI4A 5EP1A 4M9ZA 3VHXA 4Q7MB 4GMXA 4NTZA 2AWOA 1N6LA 1KO4A 2R62A 2C96A 3B2EA 2XXAB 3SI7A 1DAKA 4PAMA 3K70D 2ANCA 4NYMR 3QSYA 2E1RA 4HLCA 1N6HA 3ZZTA 2V55B 4QBIA 3P4XA 3PQCA 1W5TA 1ZNXA 3M6AA 4IVPA 4Q4AB 3TIFA 2QENA 3GJ8A 4BFYA 1CP2A 2CCJA 2ONJA 1EGAA 1GRNA 1OFHA 2ZUCA 5CLLA 2ZJZA 3LD9A 2WJIA 3QG5A 2RB4A 4EJSB 5C1BA 4MGIR 4OQXA 3TGPA 1F5NA 1AS3A 3O8BA 2WIAA 2FSIA 3OIUA 3QF4A 4L9WA 1Q3HA 4ERNA 5KTYA 2D3WA 1U0LA 2V1XA 2QP3A 3BGWA 1W47A 1N5IA 3IQXA 1P61B 4LZZA 4MRRA 4LYAA 1NVVQ 3QVUA 1QG4A 3RS3A 4EPVA 5CB6A 2GILA 4DLUA 4BLPA 1W1WA 2ZU0C 3ZIAA 1AGPA 4I1VA 1H8HD 4DLSA 2ZS7A 3LW7A 4M1TA 4DB2A 1G20E 5FR1A 2P67A 2A5GA 2G88A 2XOKA 3FMFA 4II7A 5H1YA 1TQDA 3JZAA 4ACBA 4HSEA 5LB4A 1DG1G 2BMFA 3BAFA 5JJLA 2BMDA 4A2PA 2OT3B 1OF1A 4Q4HB 3UANA 5TMPA 2NIPA 2J46A 4P3YA 3HP1A 3AVPA 1SHKA 4WW0A 2HJGA 3OZXA 3AB3A 2C04A 1TAGA 2QSZA 4TTPA 4XJXA 2P5TB 521PA 1YR7A 3U5ZB 2AFHE 1QZXA 1SKYB 1A7JA 1M8PA 2ZRBA 4PHTA 1Q3TA 4LYHA 2Q9CA 5HKKD 1M7HA 3G5UA 1MO3A 2IC5A 3K70B 1LW7A 2QMUA 1OH5A 1RJ9B 2QGZA 2WWHA 2WPDD 3AVOA 1ESMA 4PPQA 4XWAA 5JSZB 3MAAC 1XZPA 3ONWA 3PIRA 1G8YA 2ORWA 2OBMA 1A4RA 1IQPA 1IOZA 1G9XA 2MSEB 3RNLA 3LQQA 3ADBA 2CK3D 2HXYA 2J1LA 3Q8XB 1T0HB 3D8BA 3QI2A 1S2MA 1AIPA 2OHFA 1W4BA 3M4YA 2PZEA 2QBYB 3UXMA 2ODWA 2I4IA 2YNMA 4TLAA 1ESNA 1K5GA 4UXHA 5FOUA 3TAUA 3HDTA 1YU9A 1SVSA 2ZSDA 3KQHA 1QBKC 2PEYA 4N0EA 1E9SA 2CBZA 2JLRA 3X1YA 4URZR 3U3OA 3CF0A 1P60A 4YMUA 4QGAA 4P32A 2H18A 1KNXA 2GF9A 4KAXA 2JLXA 3MWKA 1TEXA 3ZD6A 3K0AB 2ZS8A 4I1OA 1FP6A 3QENA 1NSTA 3FB4A 3A4NA 2CLDX 3H0KA 4LHYA 2CL6X 4PHFA 2QUZA 4Q9LA 4CVNA 5EZ5A 4LBZA 4AG6A 4G5QA 2AWNA 5L3VA 1ZU4A 1QHHA 1A5TA 3PUWA 4HAXA 2DB3A 3Q7PA 1F2TB 2CLCX 1U0HC 1WF3A 2IXEA 4LC1A 3W8NA 2W2XA 2F55A 3QG1A 1EK0A 1XF9A 3TH5A 2P5SA 5C18A 1XJQA 4UNNA 4DDWA 1U99A 1K8RA 3TR0A 3I72A 3CM0A 2HDNB 1GZSA 3WMGA 2WWFA 1BIFA 2CE2X 1AA9A 1TMKA 2EYQA 2I3BA 4Q4HA 1F2UA 1HQCA 5BN4A 2C9CA 2RGAA 5CM9C 3FHTA 4D82A 1ZIOA 1ZU5A 1GFIA 1H8HA 2WJGA 1RKBA 2XSZA 1TQ4A 2CE7A 4V03A 4PSAA 4XSGA 1SVOA 2JJ2D 4Q1FA 1E98A 1YR9A 5EUQB 4LJAA 5J40A 1YZLA 1Z28A 1HY3A 4UJ3A 4V0NA 1Q20A 1IN8A 2EYUA 2A5YB 5BQ5A 5FTKA 1T3LA 1UKEA 2YOHA 1JECA 2ZJ8A 3U3MA 3UWOA 1R5BA 1T4GA 3I5XA 3U44B 2HT1A 3G0HA 1ZJ6A 1R0WA 3VKHA 2J0VA 3FOZA 3L82B 2IBMA 3VNUA 1PVOA 2HEIA 1ZINA 3IHLA 1F48A 5TVKA 5IHPA 4DIEA 2OXCA 2PZFA 5EE3A 5LD2B 2PEZA 3R9WA 1E2NA 5GJBA 3ZGXA 4D25A 4L9SA 1ELOA 5B58C 3AF3A 2ZI5A 3GJ4A 1NN1A 2AXPA 2QP4A 4YMSA 5E4FA 4L4UA 4AYWA 2VQSA 1HTWA 4NL4H 3CRVA 1COWD 3GEEA 1U81A 4GBMA 4TSFD 4JJZA 1GL7A 2FX3A 3CPJB 4C0QC 1JR6A 2XTNA 3RAPR 4TL6A 5CDFA 1ZUHA 2CCGA 5LPNA 1NN0A 2BMEA 2XTZA 4CF7A 1NSFA 2OUKA 3SS8A 4S35A 1FMLA 3HU1A 2DYKA 1VPLA 3TLXA 3B1YA 1CR0A 2XXAA 3RSLA 2GXQA 2ZS9A 1OKKA 1AKEA 1N5JA 1XEXB 2Y8EA 3OHMA 1RYFA 1SQ5A 3QIAA 1ZD1A 4A0FA 2VYFA 1ZAKA 3K53A 1JJVA 3TSWA 2AL7A 2FPMA 3E70C 3D3QA 2PMDA 3K09C 4PC2A 4MA4A 721PA 3KB1A 4PPNA 4LUCA 3A4LA 2P2LA 3LWNA 1IN4A 5EXXA 2H1LA 3K8YA 1I4LD 2WSSA 1ZYUA 3K1JA 1IAQA 5DISB 2ZAMA 1KK2A 3ND9A 4NCJA 1F3OA 2I1VB 3TMKA 1NL3A 2XNSA 2CHVA 2ERXA 3T1TA 3RDPA 4KFTA 3NTUA 1W5SA 1N6PA 3NEJA 3NDPA 3U4QB 1TF7A 2ZI7A 2QY9A 2FWRA 4HB4A 3RRNA 4BPBA 1VCIA 3W90A 2LKCA 5AJWA 3IBGA 4YC7A 1W2HA 4WZBE 3ZH9B 4IOKA 4ZDKA 4TMWA 5KDDA 1G4UR 2ORVA 4Z1MA 4BRWA 1D6JA 3P26A 2CNWA 2Z4SA 4PO9A 2VIIA 1DPFA 5KDLA 2WKQA 2ZAOA 1DARA 1CTQA 4TLBA 5A5GA 2G1JA 3NHBA 1F2TA 1KDOA 2AFIE 1M6NA 1T3SA 3IPXA 3WRXC 3ZQJA 1E4VA 4ASUA 2ZANA 2DCUA 4DZZA 3IIJA 1PV4A 4MRVA 3U3KA 3QXSA 3UATA 2F7SA 3REGA 1HT2E 3OE7A 3U4QA 3B60A 1GAJA 3VAAA 1KI9A 3TUZC 3I61A 4OI2A 3HU2A 3QKRA 3RRMA 1Z6GA 1D5CA 3EC2A 3ECCA 4KSCA 2BIFA 2CHGA 1U98A 4PO8A 1D9XA 3QXJA 3LA6A 1G8HA 2V8OA 3C14C 1Z6TA 1W44A 3CH4B 1G64A 2O52A 1MV5A 3AF1A 4RKEA 1E3MA 5D3QA 1MKYA 3FHOA 1GL9B 5F9HA 1BS1A 2QT0A 4W7SA 3ZS8A 4WXRA 3HU3A 4BFWA 1GNQA 1XMVA 2VRWA 4UQOA 2O8FB 1M34E 3U3JA 1WBDA 5GJWC 3OIVA 2EFHB 4A36A 3R9XA 2GXAA 2AN9A 1NKSA 4O2RA 1BOFA 1XB2A 1RW4A 3PENA 4M1WA 4TTRA 1T91A 1XBTA 5FBRB 4A6XA 3IPYA 2C98A 2OV2A 3IILA 4OHWA 2IYRA 4JS0A 1RRCA 2HYDA 1Q1QA 1RVDA 4NKRA 1EFUA 3NBXX 2FPKA 1DOAA 4DKXA 4LGMA 2IXFA 5AK0A 4Z51A 1WBBA 1UBFA 1KSJA 2FOLA 4LSGA 2NO0A 3LFUA 3W8RA 4E09A 3D31A 4KYIB 1E0SA 1TF2A 2G3YA 2GZHA 3W3AA 4BLRA 821PA 5HPYB 1OIWA 3DPUA 1XEWY 2A5FA 4V0MA 4QBHA 4PHGA 4OHYA 3SE0A 2KSQA 4C30A 4PSKA 2XSZD 1WA5A 2GVDC 5JFGA 1KI6A 4IDHA 4F91B 1RIFA 2O8CB 4LPKA 2GWHA 3TQCA 2OFWA 3N2EA 1MO5A 3AP3A 1KSHA 5KSPA 1WB9A 4DCVA 2QEQA 4B6FA 1KNQA 5FR2A 4F93B 4BLSA 4ZI3A 4R9UC 4OQFA 4RFSB 2H5EA 2ZRJA 5JI3E 2HCBA 4TLCA 4D4MA 4N0DA 2IWRA 5HZHA 3GJXC 5E7JA 1HH4A 3CF6R 5A4JA 4QJ4A 3THXA 1KJZA 2QTVB 3QKUA 1TQ6A 4ARZB 3LAWA 1KI7A 2V4ZA 2V9PA 4JSTA 1I4TD 1R4AA 3L43A 3FYHA 4FWIB 1AK2A 3A1WA 3P27A 4MYTA 1Z0JA 4LCBA 2FMXA 3NG1A 4TLEA 4DEYA 2BJVA 3VR6A 4US0R 1DAFA 3PXGA 5KPDA 5TARA 4JVSB 4CYMA 4RY2A 1D2MA 1TF5A 1UJ2A 4G0NA 2X2EA 1G7TA 5ANRB 2GTPA 1XCGB 3ADDA 2HUPA 4Q9JA 1YJ5A 1VKJA 1KJWA 2ZROA 2MSDB 2C99A 4NHOA 2X2FA 2WIBA 3DKPA 1OJLA 4TQ9A 4Q18A 4DLVA 5B57C 4MDEA 2IS1A 1XNJA 2J45A 5FOSA 3UIEA 4DWJA 2G1KA 1YR6A 4FD2A 3IHWA 3TKLA 1VYUA 1Z5ZA 5B2ZA 1EWQA 3GJ5A 4NYJQ 4DEXA 4B3GA 3THXB 2ZREA 4NZYA 3CF2A 3L0IB 3X2SA 2XZLA 2BDTA 1IY2A 4IVQA 5FL7A 4MYUA 4OK3A 1UDWA 4IXMA 3TUIC 2IYVA 4C0KA 1MRSA 2HCJB 1U8ZA 4OQNA 5CLQA 3SR0A 4BEJA 2D62A 1II8B 3MJHA 4OJKA 4JBYA 1E94E 4JLOA 1CRPA 1Y63A 1PLKA 2VL7A 3QBVA 4G5RA 1ZNYA 2F1RA 3ZVRA 5IRCD 4XH9B 3MWYW 1NIJA 2B8TA 4RKFA 421PA 4V0KA 3ZZ0A 5JS8A 2QE7A 4KLZA 1JJ7A 1S1CA 4RZXA 1PJRA 4N1AA 3FFBA 5DIFA 1YZUA 4POAA 1G18A 3T1VA 1KI1A 2PX3A 4HI0E 4M1SA 2J7KA 2B7BA 3DHWC 3T06B 1YZKA 4RFSA 1NG1A 3FHCB 1YZNA 2YWGA 4LJYA 1GKIA 1Z2CA 1TL7C 3GJ0A 1SULA 4EFNA 2JLSA 2FSHA 3BK7A 1GITA 2OE2A 4JYCA 1OH7A 4JLJA 3WYAA 4KFSA 1OKKD 3BB3A 2C95A 4YMTA 1ZD9A 3SFZA 1IN7A 2NQ2C 5GJVC 2C8VA 5EJEA 2ZYTX 3QKTA 5JZVA 3FE2A 4RJLA 3VR5A 4V0LA 1Z08A 1AN0A 1W0JA 2AHOA 3TW4A 3NBFA 2IX3A 4TN1A 3X1ZA 2R44A 1UFQA 3LRPA 5FPSA 2IEZA 2YV5A 4V0OA 2GAOA 3BE4A 4YLGA 4ZCIA 1KI3A 4Q00A 4IKEA 2NGRA 2RHDA 5CDFE 2EWVA 1NG9A 2C5LA 1SVLA 1U8AA 1XTRA 1M1YE 1UKYA 2NO9A 4B2PA 2JEOA 2GDJA 4A82A 2IL1A 2JLQA 3T15A 2Z6VA 2BVNA 3MGCA 1YHNA 4A2WA 2IWHA 1WQ1R 3QOFA 3BJIC 3BS4A 4Q1BA 4DIDA 4G5GA 4HEJA 2ZJBA 3RS2A 1XD9A 2ZSAA 3OAAD 5D3MA 2GA8A 3VTKA 3PG5A 1TEVA 2O8DA 2FE4A 1XU4A 2GCNA 1EFTA 4A2QA 1MH1A 2UKDA 1VECA 4AKHA 4JVMA 2Q9BA 4LY6A 3NC1C 2FFHA 4ZDWA 3PJRA 2OO7A 1NY6A 3BFVA 3EXAA 2W2TA 6Q21A 2WKPA 2C9YA 2IYLD 4URXR 1CF4A 3T12A 1NMYA 3QKSB 1MRNA 2HT6A 3MD0A 4HZIA 4DDUA 4OBEA 2HF8A 2GKSA 2FGJA 2FN4A 1JAIA 1KI8A 2IUUA 1AS0A 4RZUA 5FOVA 2GCOA 3OEEA 4C0AC 4D6PA 4I81A 1QHIA 4MYHA 3TRFA 5UKDA 3TVDA 3U60B 2VHTA 1L8QA 3KXIA 1E9DA 1G8GA 3VR2A 3KFVA 4KBFA 1IY1A 2PCLA 2ZR0A 4TMKA 3WYFA 3AVVA 1U90A 2GAAA 4YXWD 3KDSE 2GZAA 4FMCB 4KJZA 4O2LA 2EQBA 1BYUA 1ZM2A 2D4HA 2WJVA 4LOAA 4US2R 4CEIA 4JLDA 4OK6A 5B64A 4KODA 3VHLB 2GCPA 1J8YF 3GP8A 1Z07A 3BWDD 1Z47A 1O3YA 1R0ZA 1QHHB 2QMHA 2CMKA 1HYQA 2ZJAA 4XD7D 2HLDD 2ZSBA 4GZLA 4IJMA 4F7WA 3MLEA 1DAIA 4A4DA 3EIQA 2Q3MA 3K0CC 2RGBA 3P4YA 2F6RA 2IYSA 4X8HA 2BEKA 3W5IA 3KKOA 1AJEA 2FG5A 1NF3A 1NLFA 2ZYUX 1X8LA 3EZ7A 1K6MA 1N5KA 3AP1A 4JL8A 5J47A 3Q3JB 3TSOA 3DL0A 1E2GA 2VP9A 3W6PA 5SZKB 3GJ7A 3LBHA 4QGHA 4OK5A 2JLYA 4LWZA 2JJ1D 1XP8A 3KFXA 4Z8YA 1IXRC 1BMFD 1KMHB 4TT3D 4S2EA 2A5DA 2ZUBA 4FCVA 3HPQA 4JIMA 2A30A 5AR1A 3L0OA 5HCIA 5CJ2A 1TUIA 1H65A 1DO2A 3CIOA 2VP4A 2NPFA 2FFBA 3NH9A 2O8FA 4LYJA 4FMBB 3AUXA 3OE7D 3VU9A 2J0UA 2JLVA 1P9NA 2BOVA 3T5DA 2BBSA 4WBSA 3A1VA 2ZI3A 2G6BA 4ZKEA 2XJ4A 4B74A 2QM7A 1VYTA 5EZ6B 1DAGA 3NH6A 1S3SA 4MDFA 2ATVA 4KXFB 5GJCA 4DBLC 2GZDA 3ND8A 2JJ1A 3C41J 1ZC3A 4U02A 2AR7A 4PC6A 3K0AA 2IYWA 1DEKA 3SNHA 4Q47A 3NDBB 3T1QA 3EA0A 1KK1A 5P21A 3ZVMA 4PQFA 1SGWA 4C2UA 1JEEA 2YC4C 2QROA 3IIKA 5GVSA 2FPLA 4TYNA 3I73A 2AK3A 1TU3A 1GIAA 4MYCA 1A2KC 4NYMQ 3CRMA 1V5WA 1EFCA 4B44A 5F9FA 4LHXA 3EZ6A 4XTRA 1M7BA 4P31A 4A0GA 1E96A 2KBEA 4GZMA 1G5RA 1XDBA 4LJ7A 3KUDA 1EX6A 3I4LA 1LFDB 5BXQC 1FOEB 3BH0A 4RVCA 2YOGA 1FTNA 4XVRA 4YQFA 2E87A 4QXAA 4Q1EA 3AM1A 2P0EA 2WMNB 3QUSA 3UK6A 4FIDA 1E0KA 4HLUA 2FNAA 3IKJA 3T1OA 4Q7LA 1N6RA 1R2QA 1XMIA 4JBWA 4EDHA 3DO6A 1G6OA 2EVWX 1F2UB 3LO5A 3M0EA 4D2IA 1MO6A 4PPGA 2DWOA 1RPZA 3CNOA 4IDPA 2VP2A 1Q1BA 1YZGA 2WHXA 1ZM9A 3QXXA 5TDHA 4A6PA 1Z6AA 1T3HA 4AY2A 4BZQA 3KQLA 1U9IA 5KDOA 1Q12A 1YRAA 1A82A 3CWQA 3P20A 1KK3A 2ZITA 1AQYA 4B47A 4L8GA 1G4AE 1EG7A 3TK1A 1NY5A 2IK8A 1KO1A 1WP9A 5CYOA 4LI0A 4B35A 2HV8A 2F1JA 2BC9A 4PANA 3ZVNA 2Q3FA 3EIEA 4ZPXA 3H84A 2KB0A 1QHGA 1ZIPA 4V0ME 4WXPA 5AUPB 2Q3HA 4EPRA 4B2LA 1IXZA 5FUVA 3F3YA 3L8YA 5L3SA 2V3CC 4DVGA 3NEYA 3CPHA 3GMTA 5HTKA 3T5GA 3ZS9A 4EPTA 3ZLJA 4AYTA 2PT7A 4Q03A 2RKOA 1Z63A 4URUR 4B75A 2ZI6A 2MMGA 3BB1A 5JECA 5BW8A 4CGZA 4QHYA 2O5VA 2GEVA 3WHLA 3W5JA 4P4TA 2G83A 3NHAA 1T5IA 1JQLB 1N0UA 4XVQA 4ACAA 2PH1A 3DKVA 4FINA 1LVGA 4UNSA 1KKLA 2VSOA 1SXJE 3IGFA 3EG5A 2OCYC 3SHFA 1YKSA 3QPWA 4L5BA 4P4UA 5E95A 2RH5A 4CW7A 2N42A 1IJEA 5B30A 2F9LA 2WJHA 4FWTA 1T8TA 3K9HA 1UAAA 3MG9A 1E9EA 4JT2A 5E7IA 2WICA 2WWWA 3WBKA 4MITA 4TWZA 2PLRA 4I99A 3WNDA 2ZJOA 1CBUA 2IS4A 1W36B 1E9FA 1S1MA 3ETLA 4XIGS 1KDPA 3QE0A 2F1IA 5G53C 2QQ0A 3KXKA 4JL6A 1US8A 1G19A 4C0LA 4RZ3A 2QAGB 1OH6A 1P6XA 1TQ2A 3CB4A 5F98A 4J0QA 4B3XA 1WXQA 1XJCA 4IEEA 2MSCB 1Q22A 5HKKA 4AG5A 1E79D 2OSBA 4JLVA 4M4SA 2GJ8A 2P6NA 2VBCA 5CJPA 2IYUA 4JLAA 5C2JB 3WRYC 5KPJA 2FDCA 4ZI2A 1NJFA 4GOJA 1EFRD 2R2AA 1G291 3B9PA 4KSBA 2J59A 3DEFA 3GLHA 4CEHB 5BYJA 2RGCA 3KJEA 2ZRLA 4LC0A 4DT1B 5TV2A 2CLSA 3MJRA 4Q9KA 4F4JA 3BXZA 1LV7A 3NWJA 3SZRA 3OEHA 5L3RA 3AVWA 221PA 4TYWA 1FP7A 2KE5A 1MO4A 1P2VA 4KITB 2J5XA 4C0BA 2YWHA 2YHSA 2J7PA 3SJBA 3O8CA 1V43A 1E1RD 2IYZA 1G3MA 1NN3A 2ZQ5A 4QL3A 3M1IA 2NTYC 1FTSA 2LCFA 4Q1CA 1IXSB 4WZAE 2OZEA 3CPEA 4R2IA 2Z0MA 2FH5B 3CNNA 4DXAA 3GLFB 1CJTC 2GHIA 3C5CA 4Q4AA 4BQSA 5L8VA 4TZ0A 2QRNA 2YKGA 2DPXA 2IHBA 1LS1A 4TLDA 4DSUA 5EQTA 4HDCA 3L0SA 3FPAA 2HLDA 5G3ZA 1KAOA 4RD3A 2R8RA 4GSYA 3IUYA 1L2TA 1AS2A 3EX7C 2ODNA 4IDQA 1CRQA 3R8CA 1P72A 2JCSA 1ETUA 4LK2A 4LX0A 2QL6A 1HEIA 2ZYVX 4DT1A 5KSZA 1PUJA 3C15C 3AVYA 3K09A 2WBLC 2QM8A 1UF9A 3C7KA 3FFAA 1HQYE 3WP0A 2ZR7A 4PHHA 1QDEA 1JEDA 1N3BA 3PEVA 4Q9IA 2Z43A 2H57A 5FI0B 3B8HA 3V4FA 4OI1A 2RGXA 1OIVA 4JLMA 3UG6A 1Z83A 4D0LB 2OILA 1H8EA 2VTKA 5FH9A 2FEOA 4B73A 1IN5A 4I1UA 1NVVR 2OLJA 2RGEA 4TL8A 2C2HA 3G82C 3WHKA 4A1FA 4M2LA 1XD8A 4LBWA 4TQUS 1RC8A 2YWFA 4YONB 3B1XA 3KTAA 4UJ5A 3B78A 4Q7KA 1ONBA 2IS6A 2A7QA 1SVIA 2P6RA 4M1YA 4NPHA 1COWA 1JXMA 3THYB 2FF7A 2QPAA 2IXGA 2XGJA 1E2HA 1OFUX 5LB2A 1W0JD 4PFSA 1YRBA 1S8FA 3RWOA 3EWSA 5AJYA 4CIDA 3SDZA 1UEIA 1OXVA 2DBYA 2QAGC 5FTMA 1LB1B 3WP1B 5C46F 3F8TA 1G21E 4HLDA 4QBGB 1Z0FA 3OIYA 4C4PA 1OFIA 2KBFA 2ZTSA 4FMCF 4ZCMA 5EP2A 4GDFA 1LY1A 1P62B 1HV8A 2ZE5A 2WMOB 5DGXA 1IN6A 3TSZA 1RJ9A 1YE8A 5DLQC 1XTSA 2ZR9A 2XB2A 2QRZA 3ZDQA 1VIYA 1ZRHA 5C4GB 3MRSA 5AUNB 1QHXA 1VG9B 3VKWA 3SFVA 5KSYA 1X86B 4DUGD 2OESA 1N0WA 4B71A 3JVUA 2P6UA 1ZVQA 5K8IA 4QHSA 1RRPA 1XD2A 4TYQA 1NBME 4E5UA 4D0GA 2JIZD 4OL0A 2ANBA 1W2GA 1DS6A 2QPOA 2ZRCA 4JLPA 4ON9A 5FTLA 1G3RA 4A0HA 1SXJC 4TZ6A 1CU1A 4PAQA 4DJTA 1GUAA 1II9A 1XPOA 2VLIA 4NDZA 3R7WB 2Z5FA 3ASZA 5EXPA 4B48A 2JGNA 4P33A 1SXJD 4TMVA 2WWGA 1CLUA 1O87A 5LD2C 2O8EB 3EWAA 2CXXA 1D8TA 4X8LA 3THWB 2IEYA 1Z29A 1W4RA 3BC1A 1NMXA 3PCRB 3THWA 4MKFA 2GRJA 2RGNC 3IO3A 4HATA 4BLQA 2HF9A 3W34A 4P0TA 1R0XA 1R8SA 2JLZA 2ZM5A 4QC2A 1BO6A 2BKEA 1P3JA 1P9WA 2O8DB 5CIWA 2EFCB 2IF2A 5FUWA 4A8JC 1U0JA 1GNRA 2ECKA 4DDVA 2YC2C 3ZIAD 4P4SA 4LJ8A 3K0FB 3UKDA 1KTVA 5FL7D 2R6GA 2VP5A 5HZKA 3QF7A 1XTJA 2VP0A 3NKVA 4GL2A 1OXSC 1DADA 3IDQA 1W0KD 3HPRA 1DAHA 4IW3B 1NNEA 2PJRA 2JLWA 3RSOA 5JHHB 1DE0A 3AF0A 3KXLA 3EW9A 3KKNA 2HYIC 3VX4A 4LBYA 3NBYC 2CVFA 3AV0B 2NO7A 4TMZA 1E1RA 2CJWB 2OAQ1 2QGNA 4UNRA 1XZQA 1YZTA 3I8XA 1XCMA 2J7PD 4LRWA 8OHMA 4TQAA 4MH0R 5K8UA 1XTKA 1XWIA 2C03A 2W00A 2AKYA 2BHRA 2DY1A 2WWYA 3RC8A 3RS4A 4ITRC 1JR3A 3Q85A 2WJYA 3DOFA 5EXTA 4QM6A 1RFLA 1R7RA 3ZJYA 2N46A 3LQRA 5G3YA 3CNLA 2O0HA 5KNBA 1X3SA 3CRQA 4DLRA 4CEJA 5HE8A 2A9KA 2FU5C 5FFMA 2FA9A 3THYA 3PV0A 4M9QA 3R20A 4EKDA 1S0UA 4HAVA 3GLHB 4MRPA 3MFYA 4RCYA 2OCPA 2Q6TA 4URYR 4CEHA 1W4CA 2BMJA 2QNRA 3CWZA 4AIIA 1R5OA 3F0TA 3LX5A 4F4IA 3KKMA 3OEED 4PSVA 2ASEA 4Q5IA 2RGNA 3U7HB 4C7OB 4LPSA 3GLIB 3PEWA 3QEJA 4WZ6A 4EAQA 1LF5A 1UBGA 3LLMA 4IRUB 1II0A 3QF4B 2ODBA 4QG7A 4KVAA 4XTCS 1G5TA 4PXAA 1KAGA 3QPUA 1VG1A 3GJ6A 3REFA 5KSOA 2VHCA 5FBQB 4KYUA 4KU4A 3OIWA 5EXSA 2O0JA 5DHAA 3AGPA 3EPLA 3I8SA 5SZHB 2Q0HA 2D2EA 4NCHA 5DN6D 2IS2A 2FSGA 4GOKA 3SHWA 121PA 2YVUA 4ILEA 5EE9A 1ANKA 2JAQA 4DSTA 3KB2A 2ODEA 4RD0A 3SJCA 3W3ZB 2H16A 3A6PC 2ZRKA 4TMTA 1E2FA 1FPMA 1NLZA 5JRJA 2GJAA 1NBMD 1GRRA 1SKQA 2PJZA 3W6OA 2VSFA 1GNPA 4NYIR 4R98A 4UNQA 2VA8A 2REBA 1IBRA 3Q72A 1ZM4A 2DFTA 2C9OA 1OV4A 2ZI4A 4DCTA 3NIBA 1J70A 2H8KA 2PZGA 2WOJA 2DR3A 5J4VA 4ESVA 3EZ2A 3WY9A 3CO5A 2QU8A 2WV9A 2J87A 1E2MA 3C4JA 3KJHA 1M2OB 5SZIA 2OFXA 5DSZA 1XPUA 1U9IC 2CDNA 3OF5A 1ZD8A 3X1XA 2VP6A 3AH8A 4M53A 1Z8FA 5KU1A 3BH6A 4HAUA 3IBYA 1IY0A 4GMDA 4XOIA 5AJVB 4XWKA 1YVDA 4HAZA 2AXNA 4E07A 1N6KA 2D06A 4E03A 5K8TA 1VIAA 1N0VC 3UMSA 1FW6A 2A2ZA 4DCUA 3QPVA 5KYKA 1G16A 1AKYA 1SXJB 4HLUC 1WCV1 4HUQA 4CZ2A 4C7OA 4A92A 4O3MA 2GVZC 3U61B 1XD2B 2ZVQX 1RYHA 3T35A 4M9XA 1N6NA 4JYBA 3EPJA 2W0MA 4FMDB 1GVNB 3KKQA 2R65A 5FOXA 3WBJA 5J4KA 5JMTA 2V6IA 2O0KA 1JR3D 4QGGA 4Z1MD 4IHQA 1XCPA 2LWIA 4D81A 4ZDIA 3SC3A 4NONA 4KBGA 2GJKA 3DDCA 3DM5A 5AUQA 4PC3A 4MGYR 3DM9B 1EESA 2JIZA 1KI2A 3ASYA 5IT5A 3BBPA 3A4MA 4IOMA 5CB8A 2HXSA 3EZFA 1OXUA 1QG2A 5D3MB 4BASA 2C78A 4WA7A 4QKQA 1GWNA 4HZUB 3ICQB 4TL7A 4V02A 1ZCBA 2H17A 3RS5A 1HUQA 3L8ZA 4KLNA 5BWMA 1MT0A 4A8JB 1X1RA 4JKYA 3QY0A 2EU8A 2V6JA 1TPZA 4OHVA 4Q4JA 4EPXA 3U44A 4BECA 1J2JA 1R0YA 4Z8XA 1HA3A 1AM4D 4MGKR 3WMEA 1KHTA 2OAP1 1OLOA 4KVGA 3CRRA 3EARA 5KHOC 2IHYA 4A0RA 2OCAA 3E5HA 3CX6A 1K5DA 3RABA 4YMWA 5LDDC 4JL5A 5AJZA 3T34A 3H2YA 2W83A 3VNVA 1QVRA 3UMFA 1OT3A 3V9PA 4A9AA 3RLFA 2DWQA 2JA1A 2ZEJA 3GLGB 2WTUA 4IEIA 1KO5A 3SYKA 5BYKA 1T5LA 3N2IA 1N25A 2GBLA 1R10A 4DSOA 3O8DA 4ARZA 5DI3A 3ZYCA 2OLKA 1KYIA 1II8A 3RWMB 4K81B 4KHZA 4HB3A 4XSHA 3SJAA 4QM7A 4A15A 1UEJA 2BV3A 4W9MC 5DI9A 4IFEA 3VR4A 1D2NA 1GG2A 4EQ6B 4BGDA 3U7GA 4EUNA 3D6TB 4TSFA 1SHZA 2GEUA 2NMVA 4JBXA 2J9RA 4ZDJA 3B1WA 1VDZA 1P73A 5FPHA 4CT5A 4PTLA 3AVQA 4MRNA 2P3SA 1L4UA 1KI6B 2D2FA 2BBWA 1G5PA 3GJ3A 1YR8A 3GLGE 4RZ2A 2DWPA 2NG1A 4W5JA 2EFGA 1VCOA 3SQXA 4FCWA 3NBZC 2QTFA 4OHZA 4D4KA 2F43B 2NOAA 2QAJA 5EE1A 4DDTA 2D7CA 2IYYA 2CVHA 5DO9A 4UKDA 5FOTA 4B32A 2XJ9A 4B3BA 3LVQE 3LY5A 1JPJA 3GLFA 1Z0KA 1PZNA 4XWOA 3FMPB 1NVWQ 4C3ZA 1OXXK 3X1DA 1ZBDA 2BM1A 3ADKA 1E1QD 3I62A 1I2DA 4PC1A 2A5JA 3D7MA 1FQKA 4UXJA 4C2TA 3TNFA 3P32A 2GXSA 4Q4JB 3TUJC 1E9AA 2W58A 4HUQB 5FUYA 1MR3F 1SVWA 1KO7A 2ZXUA 4YMVA 3BORA 2GNOA 4UXIA 4GOXA 2JJ2A 1FZQA 3E1SA 2WWXA 1XFAA
chains in the Genus database with same CATH superfamily
2PRZA 1YB5A 2UZ3A 3C5VA 3FGPA 3SQOA 4EECA 1CYEA 3GLTA 4J07A 2EFEB 4KB5A 2XTMA 4CG1A 5B1EA 4M0EA 2ZSUA 3P9QA 4KUHA 1P9RA 5K20A 4F71A 2COUA 3EG9A 1T2NA 4CM3A 5DHRA 4JUDX 4Q39A 5DI3B 2WUVA 4IGKA 4FDUA 3JYQA 1MVNA 2XYPA 4LYEA 2VKQA 4HH1A 4JI8B 4KXYA 4BWVA 2Q49A 1SR8A 1GSHA 3OFNA 1XTIA 1P2SA 3O1JC 4FDLA 2ID9A 2IF0A 4JR2A 5CIQA 3UQZA 4CMIA 1PIWA 5A4MS 3FZQA 4CKZA 4Q3KA 1KOFA 1E2DA 4BRUA 3A36A 3HBJA 5IVDA 2Y1EA 3UNXA 3I1FA 3UT5B 4F1KA 1CS4C 2HY7A 4NOJA 2EWWA 5LQNA 1YK1A 3LP8A 4EKIA 1GTVA 4E1BA 2I2WA 2Q3DA 4X8OA 3S1AA 3W8EA 1WXHA 1Z22A 2W6OA 5JBNA 4UU0A 1SUIA 1ZC4A 5F78A 1QF6A 2EJBA 3JPWA 2VHQA 3DC7A 3MK31 2BSAA 4G41A 3ZI0A 1H2RS 4NCNA 5EE5B 1AZTA 2R00C 4DADA 3TTWA 1YTUA 4NMXB 1SQGA 4UOZA 5EHXA 2JZNA 2VEDA 1L7QA 3B12A 3QJYA 2X5OA 2YMPA 3FVWA 1C7QA 1NFRA 3QPBA 4IPTA 4EFLA 5LBTA 5K0CA 5KB3A 2Y1DA 1YFKA 5FP0A 2GCEA 1AKMA 3N7UA 4MUIA 1LQUA 2YYYA 4G0VA 3WFIA 4GH5A 3BRSA 2ETXA 4PSUA 1KEWA 3TL6A 4GMKA 3WMXA 1CD5A 1CUBA 3LX8A 3SNKA 3BYZA 1E0DA 3UTDA 4ISBA 3SSOA 3UGJA 3ESZA 4FK8A 1ATIA 9ATCA 2WM8A 16PKA 2I7VA 5JWRA 1R4NA 3Q6MA 4K9NA 3SZGA 1RPNA 1ZI8A 5TIIA 1LTQA 3QLUA 4H1HA 1GGMA 2VHUA 5C5IA 4S3MA 1AKVA 1S2GA 4QXRA 2Z83A 4BEWA 2CBGA 2VNKA 1AB6A 1PQUA 1CDOA 4ZC1A 3WSTA 4BFLA 3VBEA 3IUJA 1K86A 3PNYA 5I5EA 1QGUA 2HSJA 1NW6A 4E22A 5KTKA 4QFMA 1PL7A 4MW9A 4R2HA 1WKVA 1KK0A 2IHZA 1BWSA 1QC5B 3IAAA 3LTEA 4CXMA 4LJLA 2OHXA 3NUGA 2AKAB 4ZKDA 2P2GA 3VO8A 4K03A 4MWOA 1FDRA 3A2LA 2D1SA 3MTQA 2DLDA 3X2EA 4UFPA 5K0EA 3T7RA 1FX0A 3FIJA 3L6DA 3RHZA 2XTAA 1KC1A 1OLSA 4NU5A 3SC2A 1T43A 1XF1A 1ZCJA 1TEHA 2VK4A 2YVLA 4JJGA 1UDAA 5FPTA 2EDAA 1E4OA 3PITA 3EASA 1YGPA 2YOFA 4GFDA 4BNDA 1U04A 1I2ZA 2OEPA 1YUMA 3GFVA 4HDKB 4JB0A 1R6UA 3E7FA 1VCNA 4OLHA 5CVDA 3U9TA 4DILA 3N8GA 4LF5B 3C3WA 1J9GA 4XM2A 1AKQA 3F5SA 2B2NA 5T3YA 5T6BA 3TO5A 4G85A 2NZ2A 2DFLA 1H5NA 1EBFA 4E32A 4G9EA 4II3A 3HVJA 3VR3A 3GI1A 4NG4A 1DAMA 5T67A 1U9JA 4J1QA 1P4SA 3DLCA 1U2TA 3VJLA 2G5TA 2VYVD 3DWEX 3FTEA 3DE5X 3AEUB 2RMKA 3DEYX 1GTMA 1BGWA 2B21A 2DBVO 2YS7A 1AQUA 5AI0A 4YCNA 2RCNA 2RGGA 5ED4A 3ACCA 1TQ8A 3GCZA 4HUTA 1P1RA 3LT5A 2YY5A 7REQA 2MOKA 5F73A 3G2OA 1ZCAA 3K5IA 3WK8A 1RQ7A 1BXKA 1Z4IA 3PHBE 4GX5A 4J0DA 3H19A 5I7OA 5KC9A 2ZKIA 1RRKA 2DH6A 4RMJA 3EXIB 2BHLA 3PHGA 3W9SA 1SHJA 2HV9A 4I9NA 3IIMA 3A4YA 3QGMA 1J0BA 3TQOA 5DN6A 3V2HA 3C1TA 3V2UA 3QWFA 1E63A 2IEGA 1AF4A 4HMQA 2MU1A 4OHFA 3VDQA 4C87A 4DQDA 3EA4A 1V4BA 1ZNQO 1CR6A 1N1MA 2FFRA 3JD1A 4Z99A 3V8PA 2A3RA 1E7MA 4G5OA 4OLAA 1VJDA 1S4QA 4PO1A 3PTAA 4AXXA 4HJXA 2C2WA 4F2DA 5IASA 1E89A 5AK4A 3OM8A 2C8JA 4DC9A 1NYRA 3HZRA 3LRTA 4OGLA 1BHQ1 2XCUA 3CRNA 2ZRPA 3HQ4O 2W6MA 5FWAA 4PLGA 3ZHRA 5JJIA 3L79A 2W6ID 3WK6A 5DYIA 3QTTA 4IXNA 1KAMA 4BNTA 3AF4A 1DQRA 4X24A 2CXQA 2QSJA 2WTAA 2IHKA 3U0VA 4M9SA 1FQJA 1RR6A 1JHUA 5DT9A 3KV1A 1XDZA 4TLMB 4AIRA 3A1UA 1BTOA 4UHDA 3MWLA 4BO4A 2MHCA 1CZKA 1KY2A 4S1PA 2QPLA 2IRWA 4MPRA 5FF9A 5JZMA 1WHSB 3ZPXA 2VFAA 4MS1A 4PZPA 4EL5A 2OV4A 3U6BA 3GLGA 2GBIA 3TE6A 2OM6A 1E0JA 1GZHB 2C1XA 4R1MA 4W5HA 1G9TA 1XEXA 1NI3A 2ZIXB 4RLFA 1SN7A 3BKXA 4UVGA 5JSZA 4GSLA 4B4WA 4BEBA 1W5AA 2FMFA 3EK2A 2Q41A 3MMPA 4H3VA 1URPA 3AUYA 3ZOZA 3L7DA 1YDFA 1W7AA 4YT8A 5IEBA 1YU6A 2WG0A 1K7XB 3DOIA 2W6IA 1DZIA 2I4RA 3F78A 2HJVA 3A37A 5I01A 4DNOA 3I5YA 1E6KA 4KG7A 5CVJA 4DDKA 3WISA 4XGKA 3G5TA 4CMAA 1KVTA 1T1GA 4WK2B 3E2MA 2YW2A 1MAHA 4ZICA 3IBSA 2G1UA 3MSCA 4OU4A 4WCVA 5J4LA 2AFVA 3UAYA 3SYNA 1BMFA 1JKIA 3AIMA 3DCNA 3RHFA 5JZOA 1ABBA 4QEZA 5A9SA 3F1LA 4TM8A 3LPNA 2OCKA 4PFJA 3RBAA 1FY2A 2F1HA 3LQYA 2H2IA 3EMDA 2IE8A 2F48A 4EYOA 4M6WA 1V4VA 4MR7B 3KSAC 2BBOA 3PXUA 1JAXA 3AHGA 4XQCA 4ENWA 3TFQA 5GADl 1Q0QA 4Y18A 4B3IA 1NZJA 1WB4A 1H1TA 4BLOA 3K6RA 4X64B 4ZQBA 2B34A 5ARDA 1I94B 1BXGA 1KMMA 3QWBA 2JIQA 4BCCA 1HE8B 5BR7A 1EE2A 2O8EA 3JRNA 4AJ9A 3A8TA 2IYPA 1L4BA 3EQ6A 1EBBA 2WDZA 4E6EA 1Q7EA 4DM4A 4MW4A 2WSMA 3P9SA 3HDVA 2AUMA 1MB9A 3KTAB 3B9QA 4GIBA 4B4VA 4DMUB 1R6VA 1OGIA 1YO6A 1J1ZA 3BCUA 3F8SA 1EVLA 2OFOA 1ZGGA 3UPUA 1A2BA 1F8GA 3AUFA 3H8SA 2WJJA 2YWXA 2NMVA 4PLZA 3VAYA 1IMJA 5JDCC 3HR8A 3UJNA 2BHTA 1JI0A 2WWIA 3BWYA 3N2KB 1E5XA 1D6NA 2EKBA 5HZMA 3ZQ6A 2FJUA 1E1MA 1LDBA 3GRPA 1PD1A 4JCCA 4KR6A 2PLNA 3LXXA 1T9GR 2FWPA 2XDAA 1XT6A 2P4SA 4QVGA 5C51B 4BUJA 5FFFA 1E1CA 3STYA 3DB1A 4ZCLA 3KOZA 3MSXA 4YCLA 2BCGY 4OHXA 5LBUA 2WY2D 4L5CA 3R7DA 3C3AA 4EW6A 1EVYA 4HB2A 4M8NE 2DFKB 4XRRA 2GX6A 1Z4KA 2R4TA 2WUGA 4F85A 4V0QA 4XSVA 5D6NA 3ZWDA 1ZMXA 1EZZA 3A1SA 3MWJA 3IJPA 5C4MA 1GADO 2HIMA 3WL3A 4X8MA 3REOA 1I8TA 1U3UA 4IFTA 4P8RA 1THGA 3OSZA 1J0AA 2BY4A 3MUOA 4XJSA 5HE9A 1FP4A 3AZQA 4H1VA 5AMXA 2BCEA 3KCQA 1L7AA 4J1TC 2WR8A 5GM1A 3UICA 1CCWA 3TW8B 3AGQA 1KIAA 5T6MA 4DCOA 4BNWA 4IDOA 4C29A 5LQAA 4AJJA 3GYBA 2GN4A 3RANA 4YJGA 2QK4A 1Z8DA 1EWVA 2P9YA 5FUBA 4GZ5A 5AKKA 5AW3A 2OCLA 2EJTA 3LFTA 3QE3A 4P98A 1T0IA 5HQJA 4MMZB 3VSDA 4AZ3A 4CUJA 4DRZA 4QJ3A 5LNK6 2IT1A 4BQRA 1NMZA 3NJRA 5FTNA 1SBZA 3K5WA 3OU2A 2OXTA 3W1WA 1RBMA 2HA6A 2XDWA 2PGNA 3NCTA 3H9JA 3ZDDA 2JGDA 1W581 2L0XA 4NABA 4RGBA 3W5BA 1YQUA 3PVZA 3HV2A 1RAHA 4Y6PA 1U1DA 1DIRA 1F14A 4LDQA 5JAQA 1X9HA 2G36A 3EDYA 4QYWA 5EJIA 1XJWA 4ARSA 1LPNA 3VPAA 3RM3A 4MVJF 1NWHA 1R4ZA 1YZQA 4HJRA 2YYZA 1N8NA 1IBMB 5JCXA 1KZ1A 4EQ6A 2QT1A 1C30B 2BF4A 3EDCA 4G6ZA 4IX1A 4MQUA 3ZWYA 1ODKA 3E8MA 1T2EA 1MABA 1X0XA 2IOQA 3K6JA 1I1HA 4K6GA 5A0TA 3R8XA 1G38A 3STWA 2PRYA 2AC4A 4X61A 3E15A 2ZPTX 5T3UA 1SG9A 4AK9A 5L3QB 4J0JA 3RC2A 4CLRA 4RLHA 2L42A 3WWZA 2G1AA 4HCJA 5F7XA 4WVLA 5KAMA 1IJBA 1L4MA 4QJ5A 2HZBA 2NP6A 2Q3BA 1DRVA 5BQPA 4BMNA 2JGDB 4NCBA 2A3NA 2CFOA 3WLQA 4I4CA 3EEBA 1SEVA 5H68A 4FR2A 2YZNA 1Z5PA 1QBGA 3MJFA 1X14A 2P9GA 4LW8A 2AOUB 3JVEA 1FFHA 3KAQA 1TECE 1LLCA 3FVVA 1LS6A 1MJ5A 1XXHB 2QL7A 4Z9XA 4TYYA 2UV8A 2GBLC 2X14A 2I1QA 1E3JA 3PIDA 4IH4A 1CR4A 1G8KA 4IDBA 5LYJB 2EZ4A 3DDZX 4M0MA 1J2RA 1PSZA 2BW0A 3RTAA 3G9UA 4EHHA 7REQB 2WNSA 4MUXA 1DX9A 1JEJA 1MLDA 2QL5A 3CX3A 4QU8A 1FMJA 2JW5A 1BRTA 5KVSA 4UCQA 2GN6A 3L84A 1K3FA 2YVKA 4O0MA 2OVFA 4MUJA 2ZT6A 1SCBA 2X77A 3H86A 4YDSA 1U65A 1XQVA 5JZ9A 5JD5A 1TJ4A 1XRSB 2ZVPX 2PNJA 4EVRA 4OFZA 2AK2A 2EARA 2ZU6A 1VG0B 1F60A 3PT9A 5AW5A 3MT8A 5LMCA 4WOJA 3DFFA 1V48A 3O47A 4ICIA 4M7WA 2NUBA 4MAFA 4C21A 2V5UA 1EM8B 2W42A 1TMGE 1X80B 1ZRSA 3SVTA 2OXRA 4WD3A 4ZPJA 1DI0A 2PWZA 3QUAA 3MERA 1DTWA 4JNCA 4RD1A 1U11A 4PCUA 3AQIA 3N5CA 4R2XA 4M1MA 2P2SA 4PE5B 1DRKA 3GCGA 1YQ9A 3DV0B 3FDJA 2W4QA 3GJTA 3R9KA 2B37A 4G4JA 2FPSA 5JDIC 4B43A 1DX4A 3W05A 2DSNA 2WTBA 4C4OA 3HBAA 1NNSA 4CM9D 5I9NA 1HMYA 1C7ZA 1KVQA 2Z8ZA 4NNJA 3KZVA 4OATA 1EIWA 2QKYA 1MAAA 1GU1A 1VLZA 2E7ZA 4HK4A 5AIAA 4XYLA 2BMVA 1X8KA 3J81k 3Q6NA 2PCJA 4BC1A 3B85A 1J1IA 4RK4A 5ENDA 2I54A 4LF6B 3Q3IA 1CUSA 1WHTB 5CK4A 3K1TA 4EGCB 4AI6A 3SYLA 1I4OA 3BRWA 3FKSA 2CLMB 2NTVA 3UCEA 4U6QA 2QIPA 2VF4X 3ZVLA 3FUUA 2X8AA 4DPMA 3UZUA 2R00A 3PNKA 3PEYA 1IPEA 2P35A 3EXEB 3U48A 3OQMA 1R37A 5IDVA 5AVZA 4DABA 1ADBA 3BERA 1A8UA 2GD1O 3IT0A 1L5KA 3JATB 3BILA 3WLEA 1CVRA 3M4XA 1P5ZB 4MSUA 1K8XB 3W78A 1VHQA 3A6DA 1LF0A 1QB8A 4KRXA 2Y1CA 1Q7GA 1M66A 2I7TA 1H85A 2Q5FA 3F4BA 4FI3C 5L4LA 5IKEA 1N4AA 1X94A 1WE2A 3V5NA 1NF9A 3H83A 4GI7A 3O8QB 4X93A 1KYZA 4OLBA 1IHDA 2G0NA 2BP7B 2CDBA 1OBFO 2ILVA 1W4AA 3UBMA 3UOGA 2AVNA 4RKWA 3NP9A 2ADFA 5FHRA 4HXGA 2DCMA 2GESA 3LNTA 1I5OA 3Q9UA 4UPVA 2HU8A 3PQ3A 5CG1A 2IA5A 4OREX 4E11A 1I3CA 4GU5A 4OQMA 4PX3A 3SXPA 3AJAA 3W4JA 5D8DA 4PAOA 4HAOA 1GA4A 3E2IA 3GUVA 5BN3A 1NUHA 2GF2A 5IDWA 1GUDA 3V00A 1VLQA 4M22A 4MUBA 3W9YA 2OAEA 3RTEA 1NOIA 1Z6XA 5CEJA 1XZDA 3MWDA 4MHSA 5BXYA 3QU7A 3E22A 5LUBA 3AKCA 5FI3A 5A9RA 2A78A 3FZGA 5FUXA 5JD4A 5K8LA 5J1SB 1SOAA 2PE5A 4RA9B 2EX4A 4IVNA 4IIJB 4B87A 1IL0A 1WM1A 2ZYDA 4URWR 1G3QA 1OTXA 1P5JA 4NEHB 2XEXA 1Z3IX 4GRIA 4BQOA 1HYEA 3FRJA 5AFSA 5AKJA 1NP6A 1UP6A 5ALKA 3WO1A 4C3UA 1D3AA 2ZJYA 3V4SA 1BZYA 4FXPA 1BE8A 3W6ZA 4MJ3A 2FZLA 4ZO8A 1NX9A 1FJ2A 2CL7X 2W6JD 5AXAA 4ETNA 3FFWA 3C16C 4LC9A 5JS2A 4F38A 4QGSA 4HNSA 4NQRA 3FZNA 3RGGA 2QTNA 4LJ9A 5JYDA 4LQDA 2VHJA 1JIJA 1WIWA 2UZIR 2C77A 3FIUA 5ETJA 3RARA 1Z39A 1OFGA 1P5HA 2J0UB 3WXMA 1XEFA 4DWVA 4OFWA 1T9KA 2PYDA 5BPFA 3N07A 3MCTA 1XO1A 2CEAA 2NPIA 2B4QA 2NXNA 4A91A 1P74A 4K7JA 1P0CA 2NO5A 2JAHA 3LXMA 1S2LA 2FR8A 3MLAA 4RD6A 1KQFA 3CZQA 2RAPA 2WYHA 2QTHA 2HPHA 1E32A 1Y4DE 3H8JA 4YR9A 2HUNA 2FEKA 3RT9A 4B33A 4FYXA 3A3KA 3CYFA 4RHCA 2YHUA 1ODJA 2WHEA 4GWKA 5HQTA 1U8YA 3A58B 2BD0A 1W52X 3DOCA 2FEAA 1YB6A 3ZR4B 2Z08A 3U6KA 1B74A 1PT7A 2J3IA 4KQMA 2AZ4A 4O1IA 4V1CI 3EPPA 4R1SA 4AFNA 4UHEA 2Y0EA 3L5KA 4NBSA 4NG5A 1ADGA 1ZDMA 2A9RA 4D9GA 2VRNA 1NOKA 3U80A 2WD8A 2R6AA 2O1EA 1DG3A 1M8KA 2B8WA 3ENZA 1Y6GA 1BHO1 4C0JA 2EKQA 1KXJA 4INPA 3RROA 5IF9A 2BT4A 3EPHA 2PRKA 3SN6A 1E61A 3OEHD 4H0FA 4CQLB 1FU4A 3NHSA 3KX2A 1NUPA 2I8LA 1VHWA 3KEMA 4IFIA 4R1UA 2MCFA 3S2IA 3W5DA 1C9KA 2WD7B 2AYZA 3H2IA 5EKTA 4RK5A 4HV4A 1KWGA 4DV0B 4MR9B 3AR4A 2P79A 2CEKA 3WR5A 1U7WA 1K2WA 5K3FB 3R7WA 5BRJA 1FRVA 2O7SA 3L1VA 1LXCA 3M9WA 1XVLA 5IAKA 5F21A 4UM7A 2GO7A 4Y6QA 4BXOA 3U7RA 4K6OA 4NZNA 4R8MA 1YZYA 2WVJA 3DDHA 3DE1X 2DC1A 3GCDA 1E9CA 1HETA 4JMPA 1NTOA 2AG0A 4N5MA 2GD0A 3AJ8A 4OXIA 4EB8A 4JB2A 2WSSD 1YL6A 1KAHA 2ZDGA 3ZDBA 2P8JA 3GLHE 3NYWA 2O2GA 2VUUA 3M1LA 1J33A 1U5AA 1YAHA 2QE7D 1U9CA 1OMOA 4O4LF 1YQGA 1UC9A 1JB9A 2YIJA 3HKBB 3GFOA 3QMPA 4HAWA 4JOCA 4RAOA 4HFJA 1E7WA 4CTNA 2IYFA 1ZSYA 5H7XA 1SOWA 1VPVA 3SX0A 1QMGA 4C3OB 3SEAA 5AW1A 4KXQA 2PR7A 4JT4A 5H80A 2VHWA 2HQBA 3PFHA 1IM5A 1L7MA 5M5BA 1CB7A 1SEPA 2XNHA 3IDSA 1XDUA 2WAOA 1Z0DA 4MW0A 1W49A 1C3JA 1ECJA 4EL0A 5EQDA 3K9BA 4GP7A 1BHSA 4X41A 4DIBA 1BC5A 4OG2A 3LYAA 3AFGA 1EXMA 3KL4A 1R27A 2QIOA 2WU4A 2PFGA 5TR9A 1BSVA 4GXNA 2Y66A 4DVJA 1VJ5A 4DIKA 3EXHA 2VP3A 1ODFA 2DUNA 4W9RA 2PBRA 2A9OA 4QOHA 4EMBA 3V48A 1TA4A 1V5EA 4C6TA 1YT5A 2FE1A 3FCEA 4OJQA 4FOLA 1ZR2A 2QVCA 2X5XA 1E2KA 2I3DA 4NJEA 5TRTA 2O2CA 3FMIA 3GFTA 4FFDA 3L0PA 1NFQA 3MBKA 4N03A 4GPTA 4TM7A 1HDCA 4KO8A 3ZI7A 4YB8A 1T25A 4YT5A 4ETWA 2NPOA 3U49A 2P9TA 1W5FA 3AONB 1N3YA 2B30A 1E2IA 1E7SA 1SXJA 1LSOA 1U3TA 4M98A 5JLAA 1ZM7A 1FK8A 1U8CB 1V2GA 1JXOA 3RRYA 1O4WA 1W29A 2R68A 1PRYA 2WJAA 4P3XA 4C1BA 4HQNA 4BO7A 1GLVA 4D5GA 2V98A 5KWIA 4JB8A 4RTSA 1XJ0A 4QOJA 5COAA 4DNQA 5I7UA 3F7MA 1T1EA 1UOOA 3BFXA 4YV1A 3PHJA 3EYWA 3R7SA 1RKUA 3RVOA 4MKHA 1NXQA 3CSSA 1CZNA 1HLFA 1TYEB 1ZJ4A 2JK1A 1EUCB 5EEHA 2RHMA 2YNMC 4Q16A 4PV7A 2BFAA 4AKTA 5IKOA 3BFPA 2HREA 1DRJA 2Q3JA 1UZAA 4P83A 4YVFA 3MNFA 1FDWA 1KI4A 2WVGA 5EP1A 4M9ZA 4XFJA 4BB5A 5CB4A 2DQYA 2ZIUB 1KA9H 4Q7MB 4RS4A 4D3ZA 3WOVA 1N6LA 4MDYA 5CNJA 4WQMA 4ZT5A 3MT9A 3UT5A 3B2EA 3TSYA 5E6UB 2XXAB 2RAVA 3MGBA 4PAMA 5AM0A 5E2IA 3AEKB 4IGEA 5DRYA 3GPIA 4NYMR 3THRA 3QSYA 1AT1A 1A9YA 1A4XA 4HLCA 4J0IA 4Y1EA 1SIOA 1DKQA 4YPFA 3L93A 3HCAA 1ZNXA 2IITA 4HDNA 3TIFA 2GN9A 2QENA 4BFYA 5IKXA 3F73A 2YFKA 3A25A 4YQZA 4YACA 3HO6A 4G5FA 1EGAA 1M33A 1KBZA 4Q3AA 1H2FA 5JO9A 2R8EA 5BV8A 1QFZA 3GMSA 2CLHB 1RU3A 5L40A 1PI3A 2DX7A 1BMDA 2HU5A 2XA2A 5T4HA 4OQXA 5GONB 5C1BA 1ATZA 3TGPA 3H2BA 3C87A 3THSA 4O2BB 1AUQA 5FTMA 3WNZA 3ELYA 4ERNA 4CPDA 3BGWA 5DK4A 3FWKA 4AUMA 1W47A 1HDRA 5ALVA 1BFUA 4QARA 2QTVA 4UHBA 3JAMA 1KP3A 4JB3A 4BVHA 5C8ZA 5AQEA 5L51A 1BN7A 4ARAA 4EPVA 1PR9A 5CB6A 4XCVA 1V2HE 2RDMA 1PNRA 4BLPA 3LDHA 1JLLA 3HSYA 3FHLA 4JBNA 4WCDA 3ZE1B 4E5YA 2WZDA 3HJHA 2CV1A 4I1VA 2QQ5A 3LC2O 1YMVA 2ZIEA 1YRHA 2ZXEA 3DLTA 1IQ0A 4AZSA 1IFXA 3F98A 2E3JA 3KJZA 1L5NA 3M3PA 2WJ6A 5I4BA 2G88A 2XOKA 4EG1A 1NOJA 1ZA2A 5H1YA 4J0GA 1TQDA 4QXMA 4L0MA 2AX3A 3EUWA 5H5JA 3EGXB 1KHHA 1YIAA 2FG7C 2QZSA 3FMGA 3JYNA 3REQA 3UENA 4EELA 3QEAZ 2D1FA 2GHQA 1UPBA 1CK4A 3BAFA 3PNQA 5TMPA 5FWNA 1KFKB 1W88A 1KPHA 3ETDA 3OSUA 3FYSA 4IH1A 5BVGA 2QOEA 4EKGA 3SMVA 2GUWA 1SHKA 1WCXA 4LXGA 2AI1A 4FFNA 4WCFC 1ACMA 1CC1S 2P5TB 5TS3A 3CGWA 4Z0TA 1CUVA 1N2JA 1YS2X 4YJHA 3WMWA 4KVZA 2PZLA 1A7JA 4ZQCB 3OCZA 1FXWF 1LVUA 3O92A 4OHPA 4PHTA 1TVKA 3FVTA 3SQLA 3G5UA 3PRJA 3BSSA 4OFXA 4J4BA 3K70B 2GWRA 2C3YA 2CY0A 4X92A 1H66A 1TYBE 1HFWA 4R3NA 2YASA 1P4AA 4TQGA 3BM5A 4GPIB 2HPAA 3CCBA 4PPQA 1FLNA 2MT9A 5ARBA 1XZPA 4FJ2A 3U4AA 4CLOB 3HFJA 3EB9A 3G8YA 2AN4A 2ORWA 4X54A 4KL8S 1HC7A 1GGJA 3LQQA 1W6RA 2CK3D 2QV0A 2IEBA 3WZMA 3ZCPA 3D8BA 3JR3A 3Q7SA 3QI2A 4OBBA 1S2MA 3COJA 5HF6A 1E62A 5DB4A 5KKNB 3MMXA 5P8WA 1TKBA 2H3EA 2QBYB 1NM5C 2XCLA 4QSHA 2XIQA 2XOXA 4OXQA 2WT4A 4FFVA 2PXXA 1YJAA 2B2CA 3DLHA 3HDTA 4J1NA 1GT91 3GO4A 1B2RA 4ED9A 2OHHA 3EFHA 3L77A 5IYZB 4DHWA 2CBZA 1O96B 2G63A 4BE4A 2QTTA 4OQQA 2P8SA 1RQ2A 2NV0A 3OWHA 5DFAA 5F5LA 1XG5A 4QGAA 3RSZA 1MX5A 1DV1A 2H18A 2IOFA 4HX5A 5HIJA 3ZE7A 2H59A 2QWXA 4H7FA 2JLXA 3H6HA 2H4YA 3MWKA 3HN7A 3SG0A 4I1OA 3QX8A 4A27A 3UY4A 2IDZA 3A4NA 2CLDX 3WK7A 3OQVA 2QUZA 4Q9LA 1QO9A 4ALLA 4CMHA 3NI2A 5A4AA 5L3VA 1A5TA 2VXBA 1WD5A 1YMUA 2E5LB 2DB3A 3FTFA 2VK8A 4FJ1A 1NBIA 1C7IA 1TM3E 1VJGA 1Y1RA 4UU1A 3W2IA 1ZJYA 1QANA 3OTOB 4RY9A 5ALSA 4PWZA 3DPIA 1IPFA 1EK0A 4OQYA 4ZXPA 2PA3A 2JGEA 4M87A 2ZWAA 3TG8A 1WSBA 2JVIA 3C3CA 5E1MA 2I67A 5H0IA 3RR2A 1FNBA 3TR0A 3WMGA 3WWOA 2DPLA 3QY9A 4Q4HA 1HDOA 1CEXA 1HQCA 3K94A 3MUNA 5BN4A 4ZV7A 3D6NB 1GA1A 4XVCA 3ZWCA 1ZIOA 1ZU5A 2BTQB 1GFIA 3BMCB 2DXIA 1XZCA 5LZ4A 3KSBC 1TQ4A 3EXG2 4KE8A 4M8LA 1SVOA 1SHLA 4IWXA 2OLEA 4N5IX 1QKJA 3TZLA 1AVTA 1YR9A 3VYTB 5J1TB 1Q6YA 3C7DB 2XYGA 3EJWA 5J40A 2NVUB 1HY3A 4DXDA 4LQLA 2J4CA 3P2KA 4V0NA 2FUG1 5BQ5A 4KQWA 5FTKA 1T3LA 2YOHA 3JYPA 5AM3A 1JECA 3U3MA 5LVAA 5ALHA 2N75A 1UAGA 1O5OA 3KDAA 1R0WA 3VKHA 2J0VA 5IJZA 3FOZA 4YAOA 1CQXA 1NLUA 3FPKA 1ORRA 3EPRA 1XUOA 1N5MA 3QPDA 4LK3A 3R9XB 1XTZA 3QX3A 4J90A 1PFWA 2OXCA 2PSDA 1GO2A 3D7NA 5EE3A 5EPUA 4DE5A 5GJBA 1D5WA 1Z5WA 1Q19A 3RV3A 4L4UA 4NL4H 2WD9A 3IP9A 1COWD 1XP5A 3M5PA 1JG2A 2D0IA 4TSFD 1GL7A 3DP9A 2Z2YA 4XEUA 3G2JA 1RRMA 1SQ6A 3WQSB 3P5BA 1QFJA 3D3KA 3LLCA 2JGMA 1T8WA 2B9VA 2IZOA 1XZMA 4RVFA 1NSFA 2NSDA 4CF7A 3MWEB 2X6TA 3D8RA 1FMLA 2DYKA 2W22A 4FGSA 5F64A 3ESBA 3TLXA 1C7RA 2C2ZA 2RHJA 4PVDA 1BVUA 5DZSA 2PUFA 3CLUD 3QIAA 1WKCA 2V7TA 4GM0A 3U4DA 3R3WA 3BIOA 1JJVA 3TSWA 2BMWA 2FPMA 2V65A 3E70C 1Y5IA 2ERCA 2M1XA 2OGSA 3D3EA 3QFRA 3D3QA 5CPBA 1JJFA 1NVGA 1U02A 2ZBGA 1V4NA 2WK1A 721PA 1N33B 3KB1A 3IULA 3LCCA 5A2QA 4B3MB 4TWRA 4TVOA 4LUCA 5YASA 3TQRA 3A4LA 2W4IA 2TS1A 3FLAA 1H1LA 2IZ6A 3DYBA 3LWNA 4IUDS 5EXXA 1ADYA 2Z2IA 3LU1A 5ELLA 2WSSA 3I1JA 1EE1A 3V6MA 3K1JA 4BGEA 4EYGA 3WAJA 1ZCZA 1AY0A 1UJ5A 3R7LA 1ORHA 2ZAMA 4O4JF 4BX2A 2ACKA 1AOXA 3QIVA 2OO3A 1CQIB 4WJKB 3ZKWB 4KK4A 2XY4A 3CUSA 2XNSA 1LI7A 3RDPA 4N5DA 4D9FA 4PZCA 4HVCA 4M7RA 5CNKA 3NDPA 4WX2B 4CQNA 1RXUA 4URFA 1NPDA 5HK9A 1ZOIA 2FWRA 2QJWA 3RRNA 3SQDA 2PH7A 5A6VA 3G2QA 4U7GA 1SO8A 3HI4A 4CTOA 5AJWA 4BMYA 3OA0A 4D97A 1TA9A 2ALJA 2H2HA 4AMBA 2X5KO 4C76A 3GT3A 4K9PA 1G4UR 2XRFA 2V7EA 2ORVA 1V16A 1CUHA 1BX3A 4WUTA 4HN4B 4YUAA 1XE3A 2CUKA 4J6EA 1CTQA 4C6RA 1G0NA 2AOWA 2HSEA 3PVCA 4NULA 4R41A 4F45A 4RTQA 4MV8A 1PJSA 3FRIA 1XDSA 3I9FA 2UUPA 2LD4A 2X0EA 3WRXC 3ZQJA 1DCTA 1GTJ1 4JOQA 2BGJA 4Y3UA 4FEAA 2R6R1 3HFRA 3O90A 1NC1A 3CVJA 3OPQA 3QKWA 5AW4A 2CDCA 4YJ3F 3A9UA 3F46A 3SQNA 2XLCA 3EZGA 1L8XA 3FN4A 3EJ6A 2CVPA 3QKRA 3ER9A 1Z6GA 1D5CA 1IWOA 1NAIA 2MR6A 1SUEA 2C29D 2CHGA 3ECCA 3EC2A 1XDDA 1Z5UA 3GK3A 3GLSA 1UL1X 2W8BB 3M4JA 1E3WB 2XADA 1JPUA 3NWBA 3PSAA 5AYVA 2GRUA 3JD4A 3A06A 4PYOA 4KR3A 3KTFA 1XR3A 1W44A 1EK6A 1H2EA 4ALKA 3HXLA 4UQPA 5IMBA 3EFOA 3SAJA 1GL9B 5F9HA 2QT0A 3KXDA 1Y3DE 1ZH8A 3GDOA 1FLVA 3UM9A 1KFEB 3DUWA 1GNQA 2VRWA 3DQPA 1USGA 4HX9A 4UQOA 1MX3A 5KEIA 3U3JA 4KPEC 1WBDA 3OCXA 2X4LA 1Q2XA 4YRJA 4R4JA 1OZGA 1KMCA 4LSGA 5CFRA 4R8SA 1TYAE 3HKCB 3R9XA 2WG1A 5FHQA 2E21A 3T9EA 4M1WA 3EVZA 3RFFA 3RVJA 1DWOA 1GA6A 3IPYA 4FNMA 4IZIA 2OV2A 2ZUEA 3L4SO 4OHWA 4ALIA 1TW2A 4K05A 4NJEB 1JFRA 1RVDA 1QP7A 4ERXA 3PGKA 4NKRA 2QUJA 2WFLB 2EIXA 4JELA 1KSJA 4GKKB 2NO0A 5FI5A 5KYNA 1J5PA 4DV3B 3H16A 4RDIA 3ORQA 3C8MA 1U80A 4HMPA 2GZHA 3C6KA 1QPBA 1U2QA 3W3AA 1OIWA 5GOZA 4ES6A 1ZOOA 2A5FA 4GX1A 4V0MA 1VE9A 5F7ZA 4PHGA 4OHYA 3WX0A 3SE0A 3W2TA 2KSQA 4NS4A 4E2FA 2HHJA 2CHUA 3MCZA 5KOHB 2IUEA 5JFGA 1E5LA 1WULS 1NW7A 3OJEA 4S1WA 4ENVA 1PZFA 2ENUA 1OROA 3OLQA 5DMXA 1H2XA 4KXXA 3EVDA 5KSPA 2Z98A 3SICE 2EV9A 4P2BA 4DCVA 4F93B 3TCNA 4F9FA 1N78A 4BLSA 5J5AA 2AMLA 3C7AA 1J5EB 3WG9A 4ZI3A 2VJMA 3BHIA 4RFSB 4W1PA 5DW3A 2XCSB 4FE7A 1FFSA 2GZSA 4JP5A 3WLNA 2WIJA 1LDEA 5I48A 2CUTA 5HZHA 3GJXC 2ADMA 2VI5A 4WNAB 3CF6R 2R48A 3ZE8A 1LK5A 1NXTA 4B3JA 1T0BA 4D96A 5I4IA 4KR7A 1K97A 4ARZB 2VHEA 3LAWA 1KI7A 1A8QA 1YF3A 1A9XB 1Y80A 1DBQA 2GZMA 2DM6A 1BQ4A 1DQPA 3L43A 3HDJA 1EINA 2W2PA 2FK7A 3UXEA 4ZZ2A 2BJVA 2PU5A 3AHEA 4US0R 1DAFA 1CIJA 3GJRA 5PNTA 3E8XA 4IIXA 1C1XA 1ENYA 3B7PA 3SXUB 3TM4A 2TRSB 1OVMA 1D2MA 2H1CA 2RGUA 3WGYA 4G0NA 3NPMA 4C04A 2YJ4A 4F04A 5C7OO 5DI9A 2HCRA 3L46A 4G89A 4MX8A 5ESDA 3FTCA 2CUZA 1KJWA 1QFXA 2J6CA 4E15A 4M0KA 4BMXA 3ASVA 5L7WA 1BW9A 4NHOA 2X2FA 1X80A 4HO1X 3VOSA 4Q18A 1PK9A 1E5DA 2YHBA 1CQZA 1XNJA 2O0LA 2VK1A 4IZ6A 4S1TA 5ERGB 3WLRA 1WMFA 4JI4B 2G1KA 1YR6A 2WKWA 3D59A 3HCNA 4HWPA 4EYQA 4LSZA 2FWIA 2R7LA 1Z5ZA 3EXFB 3ICOA 4F3KA 3CF2A 5LQDA 2EFJA 3R3VA 5KYUB 2HJRA 3CZRA 1IY2A 4IVQA 1KOJA 1Z6ZA 2AFIA 3PXAA 3SVLA 3FYUA 5A3VA 4OK3A 2A0KA 1UDWA 2G06A 2AZXA 2R79A 2VDLB 1TYZA 4Q1VA 1WZ2A 4C0KA 4C08A 3OECA 2HCJB 4BEJA 5CLQA 9LDTA 1DV2A 3LOQA 5TQ0A 3GOHA 4JLOA 4RMGA 4LZAA 1DX6A 4YK7A 1NYTA 1R6AA 1Y63A 2QR3A 3STVA 1VGQA 5K0BA 3QBVA 4EAAA 3ENWA 3IVXA 3K7EA 4JY7A 5K0NA 3ZVRA 3TIXB 1EM8A 4BLUA 2RD2A 2E6UX 1VMKA 1NIJA 3E1KA 3E22B 1K8QA 4ER3A 3ZWQA 4RKFA 4V0KA 3CTPA 1B0PA 3JXEA 2W2KB 2H11A 2EZTA 2X0FA 2RC5A 2YJ5A 4FOOA 1G18A 3AF6A 1I51A 3AYZB 2ZTUA 3M6VA 5EMNA 5HJ5A 1D4ZA 1ZSVA 2B7BA 4HMOA 4OOFA 3DHWC 5JJBA 3G0CA 3EAFA 1V6AA 2VQDA 3SCZA 3IE2A 3LA8A 2XUGA 3NIFB 3ZDYB 1L1EA 2YWGA 2NT4A 4Q12A 1FDOA 3LCUA 4W5QA 1UBNA 1CY7A 2JLSA 4KAAA 2P9JA 1W94A 2Q1WA 5FNVF 1GITA 3V8BA 4MUHA 1H9CA 4LDPA 3WYAA 4J7UA 4HWOA 4HXYA 4KFSA 4Z0PA 1OKKD 3BB3A 2OQIA