1WMXA

Crystal structure of family 30 carbohydrate binding module
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
173
structure length
173
Chain Sequence
LLDVQIFKDSPVVGWSGSGMGELETIGDTLPVDTTVTYNGLPTLRLNVQTTVQSGWWISLLTLRGWNTHDLSQYVENGYLEFDIKGKEGGEDFVIGFRDKVYERVYGLEIDVTTVISNYVTVTTDWQHVKIPLRDLMKINNGFDPSSVTCLVFSKRYADPFTVWFSDIKITSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords COG3291: FOG: PKD repeat
publication title Crystal Structure of Family 30 Carbohydrate Binding Module
rcsb
source organism Clostridium thermocellum
molecule tags Sugar binding protein
total genus 34
structure length 173
sequence length 173
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-07-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.430 Mainly Beta Sandwich Jelly Rolls Galactose-binding lectin 1wmxA00
1V0AA 4BQ2A 3UT0A 2C24A 4CPBA 2WYFA 1WMXA 1OKOA 1W8TA 4LJHA 4YWAA 2Q1FA 1WCUA 1GWLA 4CP9A 1W90A 1W8UA 4CP9B 1W8WA 3ORJA 1W8ZA 5D21A 4LKFA 3F95A 4LK7A 1W9FA 2JWPA 1GWMA 2K46A 2O14A 2LRPA 4BQ4A 4A6SA 3ZYFA 2KR2A 1OH3A 1UOJA 4LKEA 1WZXA 1HN0A 1L7LA 4LK6A 4LKDA 4YW6A 2LROA 2VXJA 1GWKA 4AL9A 4BQ5A 3ZYBA 4YW7A 4BQ3A 4CPBD 3ZYHA
chains in the Genus database with same CATH superfamily
1JZ2A 2R072 4CCCA 2ZA9A 3IZOA 4IL7A 1D0HA 4FPJA 5LY2A 1R1A1 3WW3A 5ACA3 1D7PM 2JIJA 1CX1A 3NJVA 2ET7A 3JXSA 4XF9A 2BERA 4EYUA 5D1IA 4DZGA 1KGYA 2XUEA 3GZEA 1OA2A 3KT1A 3UESA 1N47A 5BYNA 3T1LA 3OEBA 3JBG1 4K20A 4V2WA 4H14A 4AEDA 5BUVA 3T0DA 3JD71 1OD3A 3POGA 3WY6A 1IPSA 4LIVA 3ILRA 3WNXA 1UZZA 1VRBA 2D6MA 3LWCA 3QBQA 4HFSA 5LA9A 1GBGA 3FBMA 3O12A 4LBQA 4XF4A 1UZVA 2XLGA 4JTOA 4BISA 4YVWA 1NAEA 3PHMA 4OI4A 1GUIA 2W52A 1PO21 4HVRA 1NE6A 1LHWA 3BIEA 1YO8A 1O5UA 1U12A 2WS91 3LZZA 4XUTA 3DCQA 2D5FA 3VDBA 2ERFA 5JWPA 1S2BA 5FKCA 1QH7A 3ZSMA 1JZ5A 2JWPA 5CFDB 1OLMA 4AHYA 1C4RA 1W9TA 4LHSA 1X82A 4AEKA 1GP4A 3CL1A 1EPWA 1QJY2 2ATFA 1FMD1 2R063 1NY71 3O0XA 3R6SA 1LODA 2WNUA 3TEWA 4FPEA 4XJ9A 3AZWA 2HWD1 3VB9A 3I3DA 1OA4A 1BCXA 1OOPB 2YMZA 3NJZA 5EFUA 3NO8A 4QD2A 4XYXA 4ZS3A 3WDWA 3U4XA 2IXIA 4CDXA 5IVYA 4FPKA 5CA6A 4AQTA 2Q1ZB 3POWA 3GYDA 3MFAA 4XUPA 2WSUA 3CEWA 2KM2A 1UKRA 4DXTA 1NYWA 3U75A 4NHKA 4Y33A 2AEYA 3SCGA 3KHCA 1JYTA 4O61A 3RZZA 4KL1A 3UJOA 5JOZA 2P5BA 4M00A 4A3XA 1D2QA 4Q4Y1 5K0UA 1YCIA 5FPZA 1IQAA 4OFGA 2WDBA 2X5IA 3E6BA 4AI3A 5BNOA 3V0AA 2Y38A 1ULFA 4X8PA 1SBDA 1LGBA 2K2SA 3EXUA 4LBKA 4Z8BA 3TRSB 3MUY1 2W94A 5A7PA 2Q8DA 1PO12 4LUMA 2W47A 3IB3A 4BQ2A 1U0AA 3AMHA 2J22A 3HQUA 3FJSA 5A3NA 3ZPOA 1COV2 4HKOA 1E5IA 4ZY9A 4XIKA 4XFHA 1VIWB 4I30A 1RUJ2 4HANA 1YFWA 5FMDA 2D6LX 3PIJA 3BGAA 4LO5B 1W6QB 4Q26A 1OFSA 5C8WA 2NP0A 1FOD2 1SLIA 3AFGA 1AHSA 1JYCA 3FFZA 5JXIA 1FPN3 1AR82 3WP4A 2ZCWA 2R0FA 1XNTA 4J25A 3PMSA 3ZIWA 1UL9A 2HWB3 4XMIA 2WNVA 3NNJA 4O9EA 2BU9A 5DAWA 4CDQB 4PT6A 3SISA 3LSEA 3PUIA 1CZTA 3O0VA 5FYSA 3WNLA 2YC2A 1OQDA 3MIHA 3KCXA 4AI1A 4DEQA 1X50A 3I3EA 3L9JT 1X36A 1QJU1 2VXRA 4F83A 5IK7A 1WMDA 4NVPA 4QQHA 1ZRDA 1VJ2A 3VBOA 5C33A 2QVSB 1AR62 1XYNA 3J9SA 3O1RA 3B01A 4C0BA 3E1F1 2DVAA 1NX9A 2FCTA 1MZ5A 3BN6A 3DV8A 3IT8A 2G4IA 2VCBA 1RUD1 2EAAA 4DB5A 1RUG1 5JXGA 4L0PA 2Y6GA 1W8OA 2GMPA 4LKSA 4DUVA 4B1LA 5J36A 3HN3A 4KBZA 4ATFA 2A73B 3IBMA 3MEPA 2HWC1 3O5SA 3T2QA 1H1MA 1C5IA 3AX4A 3FBYA 3OSDA 1PHMA 4CZSA 1H2KA 1KEXA 2GZWA 4QXKA 5GZCA 3K3OA 5KC5A 1DU3D 5IVBA 2B9VA 5C3QA 4YZ2A 4QPIC 4JQTA 5CADA 1IPKA 4CYDA 2QQJA 4ZU7A 3FC0A 2NPIA 3B93A 3BU0A 2VC9A 5EJ1B 1J83A 1OPOA 4CDWC 4M01A 1PMJX 5FZMA 1SFNA 5FWJA 1BHGA 2E26A 2QQLA 5IFPA 1KITA 1WCSA 2A5ZA 4ZXEA 2C9KA 4LKDA 4D69A 5ACA1 1B35B 1HJFA 3B02A 2VW2A 5BNPB 5L9BA 4FAGA 1S2EA 1YI9A 4HPKB 4JDMA 1XNBA 3ZSEA 4FVVA 5FFOC 3ZXLA 3IWZA 1HRV3 1V9U1 1DG6A 1MS3A 1VBC2 4RN5A 4QGLA 1W8TA 3POIA 4CUBA 1PGW2 2H0VA 3AKRA 4YM1A 1S0GA 3C2UA 1W99A 4RQPA 1OMIA 5DAPA 5FPAA 4ARXA 2P34A 4XF0A 4A7YA 3RWKX 2ZHLA 4LK7A 2Q4SA 4YRDA 4M3CF 1WW6A 1HV0A 1OD5A 1N3QA 2EXKA 1W2NA 2RJLA 3R0RA 4KU8A 5IVVA 4QX5A 3VBHB 4O9GA 2JB4A 1Y3TA 4IV1B 3RZKA 2R073 2DTYA 4FFFA 2IFRA 3PJQA 3IPVB 4LK6A 4MYEA 1GV9A 3HT1A 3THTA 4CEWC 2QDNA 5A1LA 4BQ5A 1YLLA 2VZVA 4QGNA 1HRI1 4RS5C 2CY6A 2RG4A 2GC1A 4LBOA 3VDCA 2AC1A 1ZA4A 2PELA 3ZXFA 3N9NA 1QOTA 3I2IA 4MGYE 1CJDA 1HQLA 2QFEA 2KXLA 4LMFA 4XJAA 3OUHA 2BGPA 2WNOA 3VKNA 4GH4C 5EQUA 5C4WC 4XBQA 4QQOA 5FCCA 2DBNA 3I97A 4HXCA 3LGRA 4P9GA 1W9YA 4WZCA 3VBUB 5KHGA 1RHI3 4Z82A 1GOGA 3NV1A 1Q8PA 2JKXA 3K75B 1QJX2 4LLOA 1XSQA 1Z7S1 4YW7A 4ARYA 5CAZA 1UOGA 4CP1A 3VZLA 5KXDA 2VTXA 5F3CA 3WG1A 2W08A 2JD4A 1WMXA 3D6EA 1JMUB 3I59B 2NLRA 4HN1A 1F5FA 3BOWA 4JZRA 1BLZA 2YBSA 4RR3A 5HCFA 2ZACA 5GLWA 4CCOA 2UWCA 3THCA 1QJY3 1UY2A 2RVAA 4M0HA 4E27A 2HWE1 2W1SA 3WF3A 5LATA 2XL9A 2JB8A 1QGLA 4Q4W1 3H7JA 3H3LA 4Y24A 1S0EA 2EF6A 2WQ8A 3NKGA 3ZFGB 1VAKA 1C5HA 3AVRA 4MHRA 4AEDC 4AGRA 5FPXA 1UXZA 3A7QA 4XPVA 4A45A 4A6SA 4AEMA 1IG0A 2UYBA 4A7ZA 1YEWA 1R1A2 2Z2SB 1OOPA 2WO1A 1C8NA 3LFIA 3WT3A 2VXJA 3ZSJA 3RRDA 3JQWA 5J7MA 4BK5A 2VBDA 2XJSA 2J1VA 2W5FA 4I3GA 4D3WA 4JCKA 4DXRA 5B4NA 4WM8B 2GU9A 3U37A 2X05A 5FBJA 2HBUA 4LJHA 4HSLA 3JBG2 3TAYA 3M3OA 3CQOA 4XF3A 3OBRA 4LO6B 3UV9A 1WCDJ 3K4DA 3JD72 4Z1VA 1SLCA 2WUHA 1W0PA 2RDNA 3AKTA 1H8TB 4WBBA 4YYOA 2EAKA 2C9AA 2E63A 3GCWA 4Q27A 2ZHMA 1KJLA 3MIEA 3LE0A 1PO13 4XDPA 2PTMA 4KWLA 2PAEA 1UYPA 4UW6A 1RGSA 2V73A 1PO22 4P5YA 4AZZA 1COV3 4OI1A 4UFKA 2R041 2WS92 1RUJ3 5E88A 1NCRA 4HVQA 1BYHA 1GZ9A 1Y9MA 1V0AA 3JZVA 1SQ4A 1TVGA 5FYUA 3N7LA 4CDXC 3WP5A 1FOD3 3EMRA 1AR91 2RJ2A 1W6MB 2YHJA 3CJXA 4U2AA 5AVAA 1QXPA 1AR83 3ZMNA 3J7NA 3D3AA 1FMD2 3HBKA 5EXOA 2R49A 4COZA 4PF5A 5C71A 4SLIA 5SV8A 4I01A 2VNGA 2Y34A 5CNAA 4LQRA 1I3HA 5A32B 1G9BA 4C1XA 1W05A 1CR7A 2V4VA 3ES4A 4GAZA 4R9DA 5FZDA 4CDQA 5IVEA 5K0UC 4MG2A 1PIV2 5C6CA 2Y0OA 3KVAA 1NUKA 1NXD1 3ATGA 4AFBA 4Z2AA 3VKMA 1X7NA 4C0HA 3KV6A 3J26N 2RS11 2UURA 1NQDA 3PUHA 1AR63 1E5SA 4NWWA 4RD7A 4NN0A 4AEJA 5FO8B 4Q4Y2 1LGCA 4XCAA 1G9DA 1S0BA 1W2TA 3BIWE 4X6QB 1OT5A 2QQPA 5I8SA 1EV11 4QPIB 4QQLA 5LZ6A 2J42A 3I2KA 2FQPA 4OHVA 1YFYA 1GR3A 1IS6A 1QJZA 1XQNA 1WBLA 1NXMA 3T2TA 3APBA 5F2SA 4QX8A 2QQOA 4EN0A 2EICA 2XJPA 1NCQC 5A3LA 1HIXA 2ZMNA 2OYZA 2WNVC 1TQ5A 2WA4A 2VMIA 3BALA 1VBA1 1YJLA 4B4QA 1Q43A 1ZZ8A 2BNNA 4YGDA 2CAUA 1J59A 1PK6A 4RFT0 4A42A 1PMIA 3CZJA 2YC0A 2WO7A 2J1SA 4QKFA 3TWIA 5JLVA 4CCDA 2X29A 2XB6C 1WLDA 1CAWB 3ZKYA 4NRPA 2PAMA 1L7QA 3KZ4C 5D21A 3M4FA 2ZGMA 2W39A 3FE5A 4OQ8A 3M70A 3TNQA 3VDDB 1BQPA 2GP5A 1B35A 1VBC3 2RHPA 5A6YA 1SFPA 2XPJA 1QJU2 1RJ8A 3S30A 4R9BA 4HPKA 1NG0A 4LO8A 4C8DA 2QQNA 3AYCA 1GQGA 3F2ZA 1TNFA 4LHNA 4B4PA 1LOCA 1MS1A 2WYFA 2WN3A 4DXSA 1J58A 5A7WB 1VB4A 2VU9A 5F39A 3ZFEC 1GP5A 4FOYA 1M06G 3OGJA 1FT9A 3ZO0B 2VCMA 4E2GA 4ASMB 1RUD2 2WRAA 3I3BA 4FPOB 1GSLA 1RUG2 1Y9GA 1S0DA 3L2HA 2WAAA 3KD4A 5K9YA 4I0WB 2DYCA 5FLIA 4BQ4A 3MLLA 4AVVA 2HWC2 2VE1A 2CL2A 2V5DA 2ZMLA 2XVGA 3ETPA 4ET7A 4ZHNA 1RL3A 1WMFA 5L73A 2CU5A 2ZZJA 4LA3A 5IAVA 2R1BA 4Y3OA 2H6CA 1L7RA 1S2KA 4RHV1 2E9QA 4D7TA 3HNBM 3KV9A 3LDBA 5BNNB 1GANA 2IZWA 2VCCA 2G9ZA 2XKOA 2J1UA 3BTAA 3HIFA 1VAMA 1DGWA 1XYPA 4S2DA 3H50A 1JZ6A 3LD8A 4DOUA 1SG3A 2YYOA 1UY1A 2ZTNA 5F6KA 5A7SA 3INAA 4CP9B 3S7EA 4CTEA 5FP9A 5FAXA 2BBVA 2A3XA 3MGUA 5FZOB 5A3PA 1QJX3 1W2UA 5F37A 2B39A 3KWVA 5DN2A 2YZ4A 4J6GA 3VBUA 1V9U2 2KR2A 1LB2A 1R081 2PQSA 4FTSA 3LKJA 1REFA 4XVHA 5LBFA 4P9YA 4ES8A 3RG0A 1WLTA 4KWKA 3I59A 2Y6HA 3HD8B 4AHZA 3B7MA 4FQZA 4L2NA 3LEGA 4ZKTB 3KV5A 5T50A 2ZPXA 3EBRA 2AUYA 4L92A 3JUUA 2VZQA 1Q8OA 1S1AA 3W59A 5FV3A 4LHLA 5DUVA 2HKXA 3VDAA 1DZTA 1WA6X 2ARBA 1ULPA 2VBBA 3AB0A 4QPGB 1YFUA 4KWUA 3ZFGA 1R1A3 3S5AA 3G6JB 3NV4A 4XJUA 4JKMA 5IT6A 1YIFA 1HB4A 1LU2A 1RUJ1 1UIJA 4H2AA 1HRI2 4M3CE 4D6SA 3O14A 1ZRCA 4NIGA 2FCUA 1UO9A 5DG1A 3WCSA 3O1SA 1FYUA 2Z79A 1JTZX 3FUQA 4AFDA 3JBG3 3IDBB 4MGZE 3QH7A 1H2LA 4WM8A 4PQQA 2VVDA 4A2UA 5DPNA 3A4UA 1QQP1 1XU1A 3JD73 4B7EA 1H8VA 1MEC1 3WDUA 3ZOIA 2QQIA 2ILMA 2BYVE 2ZX0A 4ZZ5A 2C0ZA 5FPUA 4PBPA 1IS3A 4XACA 3DECA 2ZHNA 4GB31 4DUXA 4UT5A 2MPFA 3M1HA 4MH0E 1HJGA 2HWF2 5CFDC 3PVOA 1W06A 1PO23 1V6KA 1UWWA 3JU9A 4QQ2A 4GMP1 4L11A 4ASLA 3OB8A 1OA3A 2WS93 1PNFA 1Z7S2 2DCJA 1UY3A 3N7MA 1Y9QA 2A1XA 1NKGA 4HZFA 1SDDB 3CLPA 3MHZA 3TOJA 4UFHA 3PJYA 5IAXA 1OOPC 2OIIA 2YC4A 3ZXJA 1MQTB 2WZPP 5DMYA 2QKDA 2SLIA 3FN9A 4JC1A 1RUH1 1TG7A 2HWE2 4F7ZA 3N36A 1FMD3 3U4SA 5FZFA 4Q4W2 5EHDA 4YWAA 2W1WA 1CJPA 4QB1A 1LOBA 2W95A 4AVSA 5IATA 1AYN1 3IMMA 4FFIA 5LY1A 4QHZA 2XVKA 1RUE1 1XOYA 2Y6JA 4W6YA 2ARAA 1PIV3 2B42B 5GKAC 2ARCA 5LEKA 3BUCA 2VUDA 5EYYA 1POV0 3USUB 3MW2A 2OZ6A 1IHMA 3MW4A 4H7LA 1ZZ7A 3FLPA 2Q8OA 2YG0A 2ENRA 4IGPA 2VH9A 3CZUA 2X10A 2RR12 4JQRA 5F32A 4Q4Y3 1JYVA 2Z42A 3VBRB 3WV6A 1AJKA 3DPRB 4UW4A 1H30A 1YNAA 4AYUA 4CCLA 2IXLA 3LF7A 2D3PA 3UK9A 1UMZA 4GMP0 3NSTA 2YROA 4CP0A 3PTRB 4QPIA 1MR5A 2ZOEB 1VR3A 3J8F1 4XJWA 1JU3A 4U36A 3AP6A 1MS4A 3H7YA 4NPLA 1F31A 3C7OA 3DXUA 3OBAA 4AAXA 4CDWA 2ZJCA 3BYWA 4MLOA 5CZKA 4LITA 2WNEA 2YU2A 3R4UA 3WF1A 1DGLA 4UF0B 1HXS1 3M3CA 1W2OA 4QDSA 4LKEA 4CDQC 4EE2A 3TB0A 4FSJA 3KLSA 1JYIA 1AR92 2VQTA 4QQPA 3RYPA 1ZBE1 2XWJB 1G9AA 2OQ6A 1LESA 4IXLA 2XL7A 2PQQA 2WZR2 1ACCA 5J3UA 2Y6FA 3KQ4B 1CAWA 3WXPA 2CTVA 2P1BA 5DZEA 4CE8A 1V6OA 4XF1A 5FMCA 4DMIA 3C3VA 4ZU4A 2Y6LA 4ATEA 1WLCA 1BBT1 1W28A 4XFIA 4BXFA 2JE8A 5L9RA 3GBFA 1QJU3 3BCWA 4OI2A 1POQA 1C28A 3GCXA 1FI2A 1DYPA 4BWOA 3SCFA 4ZONA 5CG9A 5LCWL 2E31A 2RS12 2W46A 4YM2A 1EP0A 1WZXA 4YPJA 5HV0A 1CONA 2Q1MA 2QQWA 2FBEA 3OTFA 2VZRA 1MS8A 3T4HB 4RS5A 1KQRA 1DF0A 4LBJA 4LXLA 1RUD3 1EV12 3C7FA 4HOOA 5FZCA 1RUG3 5FYCA 4YZ1A 2VGDA 5HBAA 2WN2A 4W50A 1O4TA 4BQYA 5F5QA 3N9LA 4YFWA 2GALA 2P6HA 1A8MA 2VZOA 4PHZA 4MGQA 2LUWA 3PURA 1XJAA 4QPWA 2HWC3 3AKQA 5FQ0B 1VBA2 4AQ2A 4CUCA 1WKYA 4ZPIA 1J3PA 3O1OA 3OGSA 2Y0IA 3PU3A 4QGMA 2VOXA 3KM5A 1JZ4A 2QE3A 1LTEA 4YFZA 1B35C 4GALA 5BNPC 2F4PA 2VOWA 2B8MA 1R091 1AR71 1UMHA 3A22A 3KF3A 4MSVA 4GWIA 2RDSA 4QU2A 4XMAA 4YGBA 1RXFA 5FZIA 3RGBA 5BNNA 2A70A 3V0BB 2Y6KA 5JOXA 2YY1A 3KT4A 3WP3A 4AVBA 4MX3A 5FZ0A 2O1QA 1VPHA 4CP9A 5FY1A 5CU1A 4XHXA 4CUGA 4UWDA 1UX7A 1FX5A 1V9U3 2ID4A 2NMOA 3T0AA 4N43B 5IVJA 5FZBA 5HPOA 4OHXA 1AZDA 3KVBA 3VBHC 1VMHA 3ACIA 1F2NA 4IV1C 5FYVA 2WA3A 3WNMA 2JICA 4G3YC 4P5HA 3VZKA 1EUTA 4I3PA 1JZ8A 1BK1A 3TNPB 1S55A 5C3SA 3K4ZA 3LA7A 1HB1A 3UT0A 3TEYA 2WQ4A 5LA1A 1C3HA 5FK8A 3CHXA 5H9RA 5FZAA 4H55A 4XUNA 4DXZA 1DFQA 4XXAA 3ORJA 1HRI3 1RJ7A 4LKFA 2GNTA 3PU8A 3UGGA 1CGPA 1UMIA 1ND3B 2B46X 2PHRA 3OGVA 4ZXKA 3C7EA 3VKOA 2I74A 2N7GA 5FK7A 5KHHA 3AZVA 1OXCA 2NM1A 4A6OA 1JHNA 4RHV2 3GJBA 5EP9A 3VBUC 1QY4A 5A1FA 1VALA 3J7MA 5A3WA 3T4VA 5FYZA 3TN91 4P9WA 1ULEA 2JXAA 3H1YA 4PLOA 4XDQA 1W39A 2FDHA 1SBEA 2XHKA 3MIDA 4GULA 4PJYA 1PIV1 3WW1A 3VV1A 4BPZA 3BTZA 3R05A 2P6CA 4FAHA 2IFWA 4NIDA 4OUSA 1UYZA 1RMU1 1QU0A 1Z7S3 2W1UA 2PHUA 2OX0A 2VZ1A 4PDWB 4OHZA 2AREA 1R082 3HQRA 3RNSA 1VE0A 2WZ8A 1XE7A 2XONA 5GALA 5H9SA 3V65A 4M4PA 2W9XA 3ZSLA 2R16A 3ZFGC 2BZDA 5FKBA 5FYBA 5FMOS 1JOBA 2ARXA 4IEZA 1RB8G 3UKNA 1TZOA 4CDUB 3M8LA 2NQYA 1SLAA 2HWE3 4EQVA 2PMWB 5FYMA 4N8MA 4Q4W3 2CGNA 1MQTA 4L99A 1REEA 5FP7A 4BM8A 1GZWB 1UZYA 1S0IA 2VMHA 5JR7B 4TTGA 4DFSA 4WM8C 3O1TA 3WNKA 3CNAA 4DRVA 4E4ZA 2CAVA 2YGLA 1W0OA 5KHKA 3LOBA 3M3EA 4BQXA 1ST8A 5K8SA 5A7OA 3CU7A 2VZUA 1CPMA 4BZ4A 3RPQA 3SNMA 2F4LA 5FUNA 1W8WA 1SACA 1UZWA 4B3NA 3OBZA 1QJEA 2RS52 1H8TC 4AFMA 4YARA 3CMGA 4XCBA 2RM21 3WHUA 3USUA 1CPNA 2ZGOA 3AYEA 3KSCA 4ISRA 4GD4A 5ISLA 1V6LA 4FPYA 1VP6A 1NCQA 1QQP2 1WA4A 1WD3A 4KQ7A 4PF1A 5FJHA 5E8AA 1AL0G 1MEC2 3Q8CA 5FYIA 3RFRA 3AJZA 4A44A 5JXHA 2OS2A 1EYBA 5AC91 3AP5A 1CAVB 4CUAA 4XTPA 4ORFA 4IEXA 1H1AA 3VBRA 1LEDA 3A0NA 1UU5A 3DPRA 4GB32 4YG6A 5H9PA 2EIGA 4FPLA 5JXJA 1ZZCA 2IXKA 2ES3A 3PL0A 2JENA 4GIQA 5C8CB 2R043 2CDPA 3UNPA 3SITA 3U07A 4CCJA 1F35A 2CHHA 4XJZA 2IC1A 4CU6A 1V00A 3VHOA 4JGZB 1AR93 2K46A 1PVC1 2V09A 1ND2B 5T5OA 1HX6A 1RUH2 4NRQA 4Y22A 2ZABA 3O0WA 1AL21 1EAH1 1FV2A 2PAKA 3UGHA 1YQ6A 2GAUA 2J7MA 2ORXA 4NRMA 3QCWA 4IUGA 2QJVA 4DO0A 3ZM8A 3E5UA 4BA6A 2YU1A 1AYN2 1VBD1 3FL7A 4K3UA 5CFCB 3WUCA 3G7DA 1RUE2 4QU1A 3WQ0A 2GN7A 2DV9A 4IDZA 4BJ0A 2G9FA 3C7GA 4MGSA 1RUC1 2A75A 4TWTA 3ZFEA 3POFA 4AF9A 1DZQA 2WO2A 4PCRA 4LBLA 4XTMA 2L9LA 4XFCA 1SDWA 1O7FA 2RS13 4PIYA 4BB3A 5BV6A 1O8SA 1DQ2A 2CWSA 4UAPA 4EN6B 5JZGB 5E6HA 1VMFA 3ON7A 4D94A 2I45A 5FZLA 2IVIB 2JDPA 4ISQA 1EV13 1W6NB 2VNOA 1HN0A 4GWNA 4URTA 5GLUA 2ZX1A 1CAXB 1OLME 2W0XA 2MEV2 3SLIA 3ACLA 3SXWA 3J8F2 1XBFA 5FZEA 3QH6A 5IWFA 3RZMA 4YZ3A 4NHXA 4CSWA 1VBA3 2WWJA 4HL0A 1O6UA 1CZSA 4XBNA 1IKPA 1KDKA 3DKWA 2VL4A 4Y1XA 1W9WA 4MZUA 1JS9A 3WG2A 1Z0HA 1HXS2 5FQ0A 2DCYA 1BJQA 2JDHA 3V64A 3NNMA 3EQEA 1ZBE2 4W6XA 3VDDC 4AI9A 1DYKA 2J1AA 4QX3A 5FY7A 3NV3A 2P2KA 1UOBA 4Q0SA 5DZGA 1SPPA 2WYSA 4K8RB 3HEIA 1BEV2 2VD7A 5HCHA 2Z69A 2XH6A 2JG8B 3KB5A 4Q0QA 4W8JA 3ZR5A 3V0BA 1YJKA 5EIYB 4LR4A 1OVSA 5T5JA 4CCNA 1G9CA 1BBT2 3RI9A 1V6JA 1ZVFA 2R6QA 5FYTA 3ENRA 1XNAA 2C4XA 1W90A 4AAPA 1VLNA 1A8DA 4IE7A 2DURA 4EWDA 1W8ZA 2XQRA 4CCMA 3ASIA 1ULGA 3E5XA 2DVFA 3P3PA 3GJAA 5FOBB 1N1TA 4JKLA 2LW8A 3OD0A 2BOJA 4B4RA 4F3JA 1AXZA 1US3A 1WW5A 4FCAA 2RDQA 2XGXA 2HWF1 1IGOA 1ZRIA 2VTFA 1FXZA 3MDPA 2GC0A 3NMBA 3WHTA 3ZYRA 1QWRA 4TN7A 4BIOA 5BNNC 1JBCA 1OBNA 1SCRA 1Q5OA 4WVVA 5I8TA 3S0MA 4LT5A 1J1TA 1SBFA 5J09A 4INDA 1NT0A 5FZ8A 5JSPA 3WX5A 5ANNA 1JZ3A 5I0TA 2WINB 1DQ6A 3FHAA 4Q2FA 1OHFA 1YI7A 2JKBA 1ENRA 4RHV3 1UZ0A 4RSUA 3RQ0A 4BLJA 2D3SA 1ND3A 4E2SA 4IV3B 5CFDA 2VUCA 1REDA 2BGOA 1VBB1 3WEZA 1ZZ6A 3SH4A 2YPJA 1R092 1AR72 3WF0A 3VBSB 5IK8A 1I5PA 4QM8A 2YBKA 1ZZBA 4DINB 2P3YA 5FUPA 3J7HA 1I6XA 3N9PA 1XPWA 2JE9A 3IIAA 3R4SA 4PI0A 5J37A 4BMBA 2WIIB 2WFF1 4QM9A 4AGGA 5J1XA 2QQKA 3N35A 4H3WA 1CAUB 2C24A 4ES9A 1JI6A 1DP0A 1O4YA 1PGSA 1UYYA 5AFBA 1R083 2WT2A 5JSOA 4JHTA 5FZKA 2CGPA 1OKQA 2UYAA 1UOFA 2RR11 4YSFA 4IGQA 3KF5A 4PDWA 2VJXA 4L8QA 3T30A 4QPGC 4PQ9A 1H9PA 2XJVA 2XHNA 1FV3A 3R4DB 4CEYB 3E6CC 3SEEA 1TE1B 1C1FA 1P8JA 4CDUA 1JN2P 1DQ0A 4UXAA 4Y5Z0 2NN8A 3MIGA 1F9KA 1JHJA 2QTWB 5FREA 1ENSA 1W3XA 1HQNA 1ODNA 2WR9A 1QNYA 3ZYIB 1ZREA 5GZGA 3MYXA 3HN1A 3U10A 5C3OA 1YFXA 2Q30A 4CU8A 1ASJ1 3WF2A 1CD3G 1YQ5A 1W9SA 4XOGA 4HMZA 1O3RA 4KG8A 1QHDA 2PFWA 3H9AA 2QDRA 4EN8B 2GNDA 4RA0A 5DDJ1 5F3IA 1DQ1A 1W6QA 2TEPA 4CP2A 4XJ8A 5HCAA 1YHFA 4K8FA 1QQP3 3ZFFB 2WZR1 5FO7B 2CGOA 1MEC3 3A0KA 1RYYA 4DY3A 3OBTA 2BBAA 4LBNA 1WCQA 4LTAA 3TN92 5I0RA 5FUIA 5KWRA 3P5BA 1OF4A 4OHYA 4QHOA 1F4HA 2G1MA 4GB33 4N9HA 5LK5A 1AJOA 3WNPA 3I54A 1W8HA 5DABA 3W5NA 5T5PA 3WW4A 4GMP3 3POSA 1MQTC 4BMEA 2HBTA 4OUEA 1RMU2 2W91A 2BGCA 1LOEA 3SEPA 4X8NA 1AYM1 3CIHA 4BQWA 2F17A 4IQPA 4K1YA 3H0OA 2ZHKA 4ONUA 3RZJA 5C8CA 5JCTA 3KCCA 4P9IA 2NZ9A 2EIDA 3ACHA 2A6VA 5HV4A 3MV11 4I0AA 3FUOA 1RUH3 3FFQA 1NE4A 3WDVA 3VZNA 4FTEA 3LFMA 4HT1T 1U5YA 3HNMA 3V56A 1AYN3 1JW6A 5K4LA 4Q8KA 4IE5A 1LKNA 4XE9A 2IXHA 4YVSB 5FRAA 1RUE3 1NZIA 4IESA 4LIUA 4MHUA 3W9AA 3N7KA 4IEYA 1T2XA 2QQUA 4AXOA 2EIBA 5CFCA 1C8M1 1RTVA 1UF2C 2OUHA 5CYYA 1N1SA 3VBRC 1MVEA 1PNGA 2O8QA 2XMLA 3DPRC 3WF4A 5T52A 5C5UA 5LBEA 1H2MA 2RM22 1YUDA 4MV2A 2Q1FA 2FDIA 5F5CA 2P3KA 1R1ZA 4K1ZA 1VBE1 2CNAA 2Y60A 3CJIB 2OPWA 5DZFA 3O1MA 1K5MB 3W5MA 1H6XA 1XSRA 3HAGA 5CIRA 4BU2A 3O7OA 5AC92 2PHWA 2Y26A 3S5QA 1NA1C 1XYOA 4AVCA 4COUA 3VD3A 5FZ7A 2IVJA 1LJ7A 2VVFA 1W6NA 2ZEZA 5L7OC 2BJSA 4K9SA 4UI9L 3J8F3 5FZ6A 4Z07A 3DN7A 3H8UA 3MLJA 4FFHA 5G05L 3ZLIA 1VRH1 5BNPA 4KGQA 1S0CA 3GBWA 5IVCA 2WT0A 4DY5A 5DAVA 4AI2A 1HXS3 5EJZB 4C1WA 1UAIA 3SH3A 5LBCA 3OYWB 4W65A 2AYHA 3PUQA 1PVC2 2XOMA 2ZX2A 1ZBE3 3ZR6A 3LSDA 3W20A 2JG9B 1K42A 1AL22 1EAH2 2XVLA 2Q8EA 4N53B 1BEV3 2YDEA 3VBHA 3ITQA 2XJRA 1M4WA 4Y20B 1VBD2 4Y26A 3TEZA 4IV1A 2G19A 2JIGA 1OH3A 5FOJB 2BOIA 3IPVA 1BBT3 2VBPA 1OURA 4FXGB 5KHJA 1N3PA 1RUOA 1QMJA 2VQ0A 1RUC2 3AZXA 4E8CA 1DYOA 3I7DA 3MF9A 2DUPA 1XB9A 1NOVA 2VZPA 2J1EA 3EHKA 2VW0A 2HJIA 4SBVA 3GF6A 1XU2A 4HKLA 4WVWA 3WCRA 2VZ3A 1ONAA 4DQAA 4Q4X1 5IFTA 1R64A 2DTWA 3NV2A 4P9JA 1W6OB 3QOPA 2I2SA 3C7HA 3OY8B 1AF9A 5LA0A 5FMOL 3WP6A 1GNYA 4QKNA 2Q8CA 3PNAA 5IVFA 1KRIA 3WZ1A 1JUHA 3WNNA 1BKZA 3H3ZA 4XAAA 2E51A 5LRSA 3IDCB 5C9AB 5CKNA 2JDZA 3IIIA 1IPJA 4QMAA 5A80A 4MXWB 1N3OA 5J98B 4AL9A 5IJRA 3PIGA 1QXRA 1RUF1 4FXKB 1AXYA 5HCBA 3P3NA 3MFCA 5BNQA 3ILFA 1J84A 1SFYA 2NYYA 2YBPA 3OJBA 4XAEA 3OOXA 1EPZA 1AR73 1LHNA 1R093 2ZKNA 3WUDA 1IQDC 5EJ3A 1GU3A 3HR9A 5BPXA 3KQRA 3WDYA 4N43C 3JQXA 4CVUA 3VBSA 3NRUA 4UW3A 2Y33A 3QLQA 3GBGA 1LNSA 4XURA 4FT8A 1NLSA 3LA3A 2RS51 1A78A 4D0QA 4XQDA 4BDVB 2AR6A 4PIXA 1POV1 1X33A 3FLTA 4LBQB 1CAUA 4GQ7A 3OCPA 2X8KA 2ZGPA 4Q1PA 3ZDVA 1ZRFA 2O0OA 1MZ6A 2QZ2A 2WFPA 4YVWB 1OLRA 2BV4A 4FQ4A 1LOFA 1OPMA 4I0BA 2FDJA 5L19A 5H9QA 4YM0A 5A6XA 1GWLA 4HK9A 3O1UA 2ZGTA 4JRAA 1HB2A 2UWAA 3FZ3A 1LEMA 3OEAA 1H8TA 3HVDA 1ND3C 1RVF1 1UQXA 2BNOA 3Q8EA 4NPRA 4WM7B 4UBHA 2X09A 3NWKA 2SBAA 3OD4A 4QX0A 1MS5A 1C57A 2GMMA 5DXDA 4AWDA 2D43A 2GC3A 4MO3M 2WNUB 5B2GB 2ZGUA 3WVJA 3X29B 5C3RA 4JRLA 1UN1A 5FP8A 5FZ9A 3WR0A 4MGTA 1GZTA 2R062 3LPFA 3MF6A 2PN5A 4DS0A 2P37A 3SQOA 4COVA 1CWPA 2XQXA 3DKQA 1VBB2 5FYYA 3QD6A 4A41A 1W6MA 3J4UH 3TN93 2B45X 5J96B 3S57A 4AW7A 4PDWC 3VHPA 2IXJA 4NO4A 3LEKA 3ZN5A 5JI9A 4P9XA 2W3JA 3VZJA 2XKPA 2WWSA 4RGKA 5A32A 3ZYGA 1J3RA 2WFF2 3BTXA 2D5HA 4CDUC 5JAXA 1RMU3 3VD4A 3N3HA 4JDNA 5BNOB 5JDBA 3V0AB 1BVVA 4Q4V1 3RDIA 4OULA 4R4ZA 2B7YA 3WOGA 1HQWA 1JH5A 2QBXA 1V70A 4XFBA 1FATA 2BQPA 4HSJA 3ZXGA 1ULOA 3IM0A 2DDUA 1YQCA 1ODMA 5JSRA 4AI0A 3ZKUA 4LPLA 3ABZA 4JX0A 2K9ZA 5FTTC 2P3IA 2FDFA 2VECA 1H2NA 1DCSA 4P00B 2MEV1 3ECQA 4OZXA 4C91A 4E4SA 5DAXA 1SLLA 2XXZA 3T3YA 2NMNA 5EZWA 3O1VA 4META 1HLCA 5FYHA 4YVSA 2Z4FA 3SC7X 1JUIA 1NA1B 2VVEA 5F8PA 1ASJ2 4HVOA 3FX3A 2OVUA 5FZ4A 5C7GA 1TMF1 4YG3A 5L7OB 2RM23 3D8CA 2YUEA 4CXYA 2R30A 5DDJ2 4CU9A 2VMDA 2EXHA 3C8XA 1U5XA 2RMU2 1D4M1 2RJKA 1Q3EA 2Q0AA 3WG3A 4QB6A 1Q56A 1BEV1 1QDOA 2YV8A 5AC93 5C8CC 5FXZA 4D6QA 2VMFA 3CJIA 5A33B 2D40A 3T08A 1K5MA 3VBOB 3H8XA 1CZVA 3GHMA 2ZGKA 1RC6A 1ZM1A 4JGZC 4RL7A 3PVBB 1YQ8A 3GZTB 4K40A 4QX7A 4UFJA 3VDDA 1GFF2 1ND2C 4NJ4A 4YW1A 4YM3A 4QKDA 5T54A 3U0ZA 5I93A 2JDUA 1AYM2 4GA9A 4CA9A 4KU7A 2LALA 3NJXA 3KHBA 4YG0A 2FMDA 3K2OA 5JPMB 1I9RA 2A7AA 2WT1A 3HOBA 3VBFB 2DF7A 2EXJA 1I1EA 3U14A 5CKMA 1UPSA 2R1DA 2V72A 3MW3A 3WG4A 1W0NA 1PVC3 5CFCC 5HXVA 2RS31 2VO5A 4BCUA 1HKDA 2BTVC 2VM9A 5A7WA 1AL23 1EAH3 3ST7A 1OH4A 1K12A 2HH9A 4XFAA 2CV6A 3W58A 2ZGNA 4I02A 3MICA 3AMMA 1KS4A 2H6BA 1VBD3 2JG9A 4OMCA 4GJYA 5DQ0A 5FP3A 3BVCA 5KR7A 2K0GA 2VOKA 1D4VB 4IE6A 4YGCA 4Y20A 5JZGC 1W8FA 2D7FA 1RUC3 4EV0A 5JIUA 3CDZB 1C8M2 1PM7A 5T3NA 2QQVA 5LK7B 3AZYA 2W2IA 2WBKA 1XNKA 3B9CA 3SH5A 2XR4A 4P08A 2JJ6A 1PZ9A 1DDLA 5FY4A 3MPPG 4AFCA 3SHRA 4N7UA 2LROA 4OZOA 3A23A 3P1IA 2E6VA 2DFCA 1T6BX 2ZMKA 1VBE2 1UNBA 1WW7A 5IK4A 2E7TA 1CESA 2BNMA 1LOAA 4AK3A 4QX1A 4XZPA 3RI8A 5KXBA 1OQ1A 1MZFA 3I2GA 2DU0A 4RQPB 1W6OA 3ZN4A 2PHLA 4LEJA 1W8UA 2D6NA 2WO3A 1TNRA 3OY8A 4LNVA 2JDNA 1K5JA 1OSGA 3LIHA 3ROUA 1CIWA 1JOJA 4XUOA 3AL5A 2VMEA 5BY5A 4L97A 3LDRA 1NQJA 3AVSA 4XZUG 4OI0A 3UJQA 2CSGA 2ORZA 3RMXA 1VRH2 1QKQA 5HXMA 5FZOA 4A4AA 4XBLA 2O14A 3HNYM 5GZEA 3POEA 1GOFA 3AK0A 1RUI1 2ZAHA 5GM0A 4FPGA 2GC2A 1OC1A 2TUNA 4MXWA 4V2VA 2JG8C 3UL2A 2OUJA 2WWUA 1VMJA 1GOHA 2VR4A 3MUZ1 5E89A 2VCAA 3B5LB 1RITA 5GLVA 4OYUA 4XQWA 1O3SA 5IHRA 3OPZA 3MIFA 5FZGA 3DL3A 3NNLA 1A34A 2PLV1 1Z78A 3M3IA 2GMEA 4IETA 1JU4A 2V5YA 4OQ9A 4QPGA 4IEWA 5FP4A 5FZ3A 1VB2A 5B4XA 3ELNA 3KGZA 3E5QA 4TSVA 4H7MA 1HN1A 1N1YA 2C1FA 5M0TA 3B69A 4EJRA 4FTBA 1W6PB 3K46A 1GQHA 2FHRA 4QX2A 4Q4X2 1OLQA 2DVGA 4E9KA 1RHI2 4RGGA 5DUWA 1O3QA 2EIEA 4FOQA 1XC6A 2FD8A 3AP7A 3GZUC 4Q8LA 1S4CA 3CKHA 2MHFA 2HWF3 3POYA 4MXVA 5D2AA 3VZMA 4RR3B 2P3JA 3I2JA 1T6GC 2AH2A 4IV3C 4WM7A 4Y1UA 5ABJC 3TBDA 4Q0UA 4JAAA 4HN0A 2D44A 2XBO1 3UGFA 3I2OA 4YNIA 1PX4A 4FFGA 1PMHX 3VBSC 2VNRA 4V1PA 1IZ3A 1GKBA 1AX0A 5BXXA 3OF1A 5F5AA 1RUF2 2EA7A 3USSA 1Y43B 2DU1A 3NKTA 1CQ9A 4CXXA 2I07B 2DVBA 1VBB3 1TME1 5JPNB 1Q8VA 3U11A 4E2QA 1PX3A 2DCKA 2BDRA 3AL6A 1UKGA 2R7EB 2ZEXA 4JTNA 1WMEA 4URAA 1A6CA 2VPVA 2JDAA 3RWNA 1LOFC 5K7PA 1W03A 3ZYJB 3ZXEA 4WZFA 2CDOA 4YW5A 1O91A 2XLAA 2WFF3 1EY2A 3H3UA 3WDTA 4AQ6A 3F95A 1JZ7A 4CEYC 4F8AA 3RMYA 4KWJA 3K51A 4NOTA 4TLGA 5I8YA 2BWAA 2RR13 3OPWA 5FPBA 3OG2A 3AFKA 3BTYA 4FP3A 3I2HA 2JE7A 4BHPA 4BYYA 1JODA 3NNFA 4JGYB 4CXWA 1NZCA 1AXKA 1MPXA 5APAA 2WZEA 4CRQA 3URFA 4QT6A 3KCYA 1STMA 1IG3A 2PA7A 1NCRB 1OVPA 4XHBA 3O1PA 1UD1A 3VN4A 1RVF2 2CYFA 2GSYA 4QXCA 1WCUA 2OA2A 4DRRA 4RGAA 1O5LA 3M7AA 1WBFA 2IWGB 2D97A 5DG2A 3H8RA 1E57A 1QEXA 2VZTA 3ZFFC 2AACA 4YZ5A 1ASJ3 3KMHA 1A3KA 4YW2A 2HYXA 3AXEA 1X9TA 2F6BA 4XILA 1YIPA 1NA1A 1XE8A 1ENQA 5DDJ3 4NHLA 1U5IA 5IW0A 2QZ3A 1F4AA 4UF0A 4BQ1A 5L7OA 2RMU3 4WVZA 2WZR3 3WLUA 1HV1A 3W21A 4TLFA 2X53S 5D8AB 4D7YA 5I0DA 4W6WA 3PVEA 1QDCA 3GDBA 1QF3A 3ILNA 4R4XA 4S2HA 5JUVA 1O8PA 1H4HA 2IUWA 1AVBA 3AKSA 1UYXA 2J1RA 1ZBA1 4LUKA 5LBBA 4ASKA 4DNYA 1LHVA 4OLLA 5A33A 3TYJA 1JXNA 4M3CB 3IDEA 5FZ1A 4BE3A 2VULA 5A3TA 4E4HA 4NIHA 4Q4V2 1AYM3 4DIQA 3NAPB 1W2AX 4IE0A 3AP9A 1X8MA 5A6QA 2GN3A 2PHFA 4NAOA 2VUJA 1BZWA 4HONA 4QKBA 4AHWA 5AVPA 4E4DX 4YVSC 3L2YA 2G9GA 1GMMA 1UCXA 3DYOA 3ZDSA 1KJRA 3VBFA 3EYPA 1L7LA 4LORA 3OGGA 4QXHA 5GZFA 5T55A 4Q1RA 5JOWA 3WINE 1PK6B 1MZEA 5CB7A 2OPKA 3FWEA 2P17A 3N9MA 2FDKA 1FNZA 1QIQA 1V6MA 3Q8BA 1WGPA 2B9UA 4KI5M 4Q5OA 5LRRA 4BIFA 4D7SA 4JV4A 4ITCA 4FI9A 3UKTA 1C8M3 3CJIC 1N1VA 1K5MC 1IKQA 2ZAAA 1TMF2 3FLRA 1YC61 1CX4A 4MVTA 4R52A 4UW5A 1MS9A 1KDMA 4GXLA 3ZXKA 1VBE3 3ZN6B 2OZJA 4FO9A 1WW4A 2W68A 1NLRA 1ALYA 3B94A 4OVEA 1D4M2 2VW1A 3AC0A 3LEMA 4IEPA 4B29A 3ZVXA 1ZX5A 3D82A 3WNOA 1O4ZA 2HEYF 3M2MA 1XNCA 3ACFA 3DXTA 1DQ5A 3PDQA 4HK8A 3AYDA 3AP4A 2XDVA 2XUMA 4OUMA 1VRH3 3MV01 3CO2A 3FMGA 5F7UA 1KFUL 3AMNA 2VAUA 4OHWA 2JG9C 3LCPA 4XFGA 4N43A 4UFIA 4N53C 3D4KA 1DBNA 1GNHA 1MACA 4GKYA 1JOPA 4AVAA 5FY5A 4COWA 3T09A 5F9TA 4GWJA 2RS32 4LHKA 1OQEA 4N90A 5I91A 3EO6A 4E8DA 4QHBA 3NVCA 2PHXA 1V6NA 3I4IA 1HDKA 3I49A 4NWVA 3D0SA 4NPMA 4Q0VA 5LEJA 3FHQA 3E6DA 5I0SA 5IK5A 3FHIB 3N9QA 2E33A 4QDQA 1G9FA 2R061 3SKVA 2J1TA 3DF0A 1UU4A 2W92A 4UFLA 4BXSV 1O3TA 3H42B 2BP6A 3PUSA 5ABJB 2E53A 1XE0A 4P02B 4Q4X3 1YXWA 2FCVA 2OT7A 4QB2A 5T5LA 1IS4A 3MIBA 1W6PA 5GLZA 3AKPA 5C9AC 1UOJA 3N7JA 5I0UA 1SCSA 3LEIA 3PLQA 1K3IA 1UX6A 3RJRA 2WABA 1MVQA 2YGMA 2PHTA 1SLBA 3IAQA 4W4ZA 1QJFA 4BLIA 3D0JA 4IGOA 4JKKA 3BI3A 3LAGA 2OW4A 3I8TA 3T2OA 3H8OA 1RUNA 4LOSA 4XUQA 2ZGRA 4KG0A 5FZHA 2XWBB 5JR2A 1UIKA 2VY0A 4COYA 3BPSA 4EWAA 3B9IA 4B7KA 3Q8AA 1BMV1 4S2FA 1RUI2 2RDRA 1RUF3 2VUAA 2XJUA 3MLKA 1G7YA 4EROA 2BFUS 1LR5A 2XG3A 1Y7BA 2ZXQA 4Y5SA 3VD7A 4D6RA 4XETA 1F8VA 3GHNA 3K3NA 4NROA 4FPFA 4Y1YA 1TEIA 4M0NA 1XRUA 3HT2A 2XLFA 3Q9OA 2YFUA 2AEZA 1NLQA 1LRHA 2PLV2 3K77A 1GZWA 5FY8A 2ZS6B 3H1MA 4K7JA 4CPBD 2D98A 4YVWC 2BVVA 2VG9A 5GZDA 5A3UA 1QXJA 2JDYA 3DYPA 2RS53 1FPN1 3ZXAC 4XDOA 1DHKB 1POV3 4YW3A 2ET1A 2HWB1 3BOPA 2D6OX 2RMU1 1G86A 4WM7C 2YB7A 1SHWB 2MNGA 5JMOA 3SMHA 3HWJA 5JIAA 3ETQA 3U1XA 2DUQA 2LRPA 1LULA 4JGYA 3ZYFA 1Q8SA 4GZ9A 1YQ2A 2E7AA 2WNUC 1DQ4A 1RVF3 2AENA 1AX2A 3JB4C 3ACGA 1CAVA 2LM3A 1GWKA 4KMQA 4K21A 4QAWA 3ZYBA 4BQ3A 1LHUA 1QH6A 4RYDA 4YLZA 3ZSKA 5JOYA 2HYKA 2PXJA 4CPBA 3S6PA 2WJSA 2PYTA 3WQ1A 1OKOA 4EZ4A 5F1RA 1RIRA 1YYNA 3JCIA 2UWBA 2XBO2 1WD4A 4I09A 2XJTA 2OXBA 3H1WA 4L9BA 3LIGA 4R9AA 1YWKA 3AM2A 1NY72 2ZEYA 2ETEA 1G6NA 1ZNPA 2DCTA 5EPAA 5SV5A 2BWCA 2HWD2 1W9FA 3B00A 5F3EA 3MO4A 4JGZA 1AUYA 1TME2 3NJYA 3S7IA 1GYKA 2BRTA 2BVBA 1ND2A 3UYJA 2X5IC 2D93A 5BNOC 4P9LA 5FLHA 5A70A 2ZZQA 3ME2A 1F5JA 2Q5TA 4IEUA 5D8AA 1EUUA 4IE4A 1HB3A 3GNEA 1U5ZA 2ZEWA 4KNCA 3ZPYA 1PGL1 1FAYA 5FJKA 3AZZA 5JVVA 3ZYHA 3ZMOA 1MS0A 4NMIA 3VZOA 4MADA 2A3WA 4Q4V3 1LCLA 2QUOA 5EV7A 2ADDA 4M3CA 1RXGA 5IYYA 2JEMA 2QQMA 1H6YA 1UXXX 1XXNA 2ZX3A 4GWMA 4IERA 3ZX7A 1PZ7A 1WWYA 2ZKLA 2UU8A 4O65A 3NAPA 1DLCA 1GICA 3OPTA 4J1WA 4AGVA 3BKZA 2VTXJ 4LULA 3KGLA 1G8WA 5JZGA 5CG8A 5A7NA 2D6PA 4J1XA 1HRV1 4CDWB 1DIWA 3OUIA 2MEV3 4G9SB 1UW8A 2ZGQA 3B3QE 3BU7A 1URXA 4O7XA 3RSJA 3VKLA 1S0FA 4AVTA 4Z92B 2C26A 5KXCA 4FBFA 1CAXA 1K45A 4MOAA 1DGRA 5CVRA 1GZCA 4PLNA 3K48A 2ZX4A 1JYNA 4CCEA 3WDXA 2QCSB 2FDGA 1DZRA 1TMF3 4NR1A 5ANQA 3SKJE 1DGWX 3IKWA 3ZXDA 3ALQA 2ZGSA 1J1LA 4Q0PA 3MPBA 2R071 4WVMB 3VBOC 1JYXA 2PHDA 3WW2A 1H4GA 1D4M3 4HLTA 4TZDA 5AFEA 1UPIA 1CN1A 2A6YA 1KS5A 2DFBA 3UETA 4FOVA 3ZN6A 1SEFA 2B5HA 3IDAA 4PIZA 3HPNA 5F6LB 3THPA 2JECA 3RZGA 4LOTA 1ZBA2 4PBOA 3VBFC 1IOAA 2JG8A 3VD5A 4AI8A 4DPNA 4CEWB 5KHIA 4X6RB 1H1IA 2DUOA 1PM4A 3HQXA 4G4FA 4RS5B 3RJ2X 3N4MA 3I2DA 1D0GA 4AOCA 4LLFA 4UYBA 3GGLA 3DEMA 4M4RA 1CVNA 3D5OA 1Q8QA 2FZ1A 4FPCA 4QWNA 3HBZA 5E16A 1L3JA 3RYRA 4FPHA 2LS6A 4YGEA 4IW3A 4YZ4A 3PUAA 4CU7A 4DUWA 5FDBA 5HI0A 2RS33 1RHI1 2KD7A 4P14A 3J7LA 3IAPA 4GH4B 1LOGA 5C4WB 3GZAA 3LA2A 2Y64A 3U78A 1O59A 2EALA 1UY0A 4R9CA 4KH9A 2DVDA 2ZGLA 4TXWA 4YW4A 5G04L 1LENA 1D2SA 1SZBA 2WL1A 4EN9B 1LECA 5DUUA 5F3GA 3ES1A 5JI7A 2FMYA 1ULDA 1QJY1 5TSWA 4NAMA 5A3OA 4A3ZA 3VLBB 4PLMA 4S2GA 4EWEA 2UY8A 5KBFA 3DUIA 1GQPA 1QNWA 2O8OA 3MBWA 2WKKA 3RVHA 4RQPC 5EWSA 5A1AA 2EXIA 4XIOA 4EN7B 1E5RA 1BXHA 4R8HA 1KFXL 2E32A 4IV3A 2JDKA 3VL8A 5ACA2 5ABJA 5A3MA 3PTYA 5C70A 1LU1A 2BUKA 1LHOA 2D6KA 2GDFA 1ZRRA 4CCKA 3BB6A 4AEDB 4AG4A 4QPYA 5CEHA 2JD9A 5LASA 3K4AA 1SMVA 3KV4A 1US2A 3VL9A 2OQ7A 4UBGA 5J48A 2VOVA 2H0BA 1GP6A 2JDMA 2EVXA 1W8NA 2WAOA 3N9OA 2GH2A 4Y1ZA 4MGKE 4KBBA 5DUXA 1GLHA 2UY9A 3RZHA 1RUI3 2A6ZA 2A71A 3QACA 2AGSA 5FY9A 4DEVA 2WSVA 5FO9B 1BVP1 2TNFA 3LOIA 2JX9A 1PZ8A 4Y1VA 1PO11 1XNDA 5EYXA 5A6ZA 2Y8KA 2RV9A 1COV1 4Y4RA 4I2OA 4LE4A 4CEYA 1QOOA 1Y4WA 3GALA 1JYWA 2PLV3 3JB8A 5FWEA 5JMCA 4B8EA 4BK4A 1GNZA 2A6XA 3I2FA 5L9VA 1FOD1 3I3MA 2VOTA 3NQHA 4MGIE 5KXEA 5IUQA 1CIYA 4UOJA 2BW8A 1AR81 3OUJA 5FXXA 4HETA 4IEQA 4ZZ8A 4IEOA 5L36A 5CKQA 2LTNA 2GP3A 1C1LA 4HKWA 3SCHA 2VQAA 2AZ5A 4CDXB 5E1RA 4RR3C 4JVAA 2FZ2A 1H9WA 4LE3A 2W87A 5FXVA 2GH8A 4AE2A 2TBVA 3POBA 2HEVF 3WSOA 3VHNA 3ZFFA 2WLQA 2ADEA 2KA3A 4QXBA 5KC6A 2WQZC 1GWMA 4XEZA 1QOSA 4A7KA 2E7QA 5K0UB 1SLTA 4Y4YA 1OF3A 2VMGA 1AR61 1OI6A 2X5IB 3LB9A 1V6IA 4N9IA 1OFNA 3MZHA 4GJZA 1IS5A 2XBO3 2DBIA 4BH9A 5CBLA 2V4AA 4LA2A 3THDA 1LGNA 1BMV2 4PI2A 2DWRA 1WUVA 1WLWA 2HWD3 3NW4A 5A7QA 2HEWF 2OKXA 3VHRA 1BK0A 1HW5A 2IXCA 3CF6E 1TME3 4JHZA 3WQBA 4XABA 1OUXA 2YXSA 2BPA2 1J3QA 3I3QA 1FNYA 4N7IA 1ENXA 3PVNA 4AQSA 4Y5TA 3WQ7A 2HLEA 5FPLA 4JGYC 3P6BA 1NCQB 5LWBA 4C90A 3POJA 4NIAA 3T1MA 2P4EA 2WNVB 1FPN2 1PVXA 2C6SA 2A6WA 3GXUA 3VD9A 1NCRC 1ZA7A 2HWB2 1RINA 4WV8A 3DYMA 2R32A 3AMPA 1DLLA 5LB6A 5FXWA 2D3RA 4NHMA 2RE9A 4UFMA 1KD7A 3RS6A 2W1QA 2Z5WA 3ZIXA 1VBC1 3TEXA 3UKVA 3A21A 4HG6B 1PGW1 3AYAA 2R042 4RFRB 2GNMA 2WLPA 4LBMA 5CISA 1LAJA 4Y22B 4FP2A 4IEVA 2ZBJA 4HBNA 5C3PA 5F2WA 4FOWA 4XC9A 5D8AC 5GLTA 1ZZ9A 2A3YA 4NE9A 2QNKA 4OMDA 1YRZA 2VZSA 3T0BA 3KT7A 3OYWA 4NHYA 3RYKA 2B4KA 1OUSA 1I5ZA 4TYSA 4WVMA 3ZFEB 3OGRA 2YFZA 3IN9A 3AXDA 4QDRA 3VGIA 3NAPC 4Q29A 2C5DA 4XQ4A 4N53A 5FR3A 2BEOA 4AR2A 5FY0A 3BODA 3EJKA 1ZBA3 1KXGA 3MI8A 2DCZA 3NNGA 5ERLA 1H0BA 3HMYA 4XW3A 5DAQA 5GJ6A 4LO4B 4AHXA 1PGL2 2YPDA 1DGRN 1S0JA 3VKFC 2GNBA 2VMCA 5LW9A 4ZU5A 5LA2A 2R0HA 4EZHA 4CEWA 3M3QA 4D8MA 3E97A 1UU6A 5FMBA 1PK6C 2VNVA 3AMQA 1B09A 5FBZA 4ZS2A 4NIIA 3NL1A 3CBNA 1W3VA 1UY4A 3RZLA 1WCKA 1X8EA 1QJX1 1W04A 1F15A 4GKXA 1APNA 3GM8A 1HRV2 1E5HA 3WD5A 4MUVA 4LO7A 4JDOA 4K6BA 2BFUL 5F5IA 3DGTA 4GH4A 4OCTA 1ULCA 3BPZA 2VQUA 5FLJA 5C4WA 4AFAA 3AJYA 5C5TA 3LQCA 3IMNA 1X9PA 1ZYBA 2CWMA 2XJQA 4NUBA 3HJRA 3KS7A 5C9AA 3LPGA 1SPPB 5FIXA 3ZYPA 4B1MA 4BOWA 3LDKA 4YW6A 3VUOA 1VAVA 3EB7A 2WC2A 4XFFA 4LBQD 3T2PA 1AX1A 4XXPA 5FPVA 3PMEA 4Z2WA 4KGGA 3Q8FA
chains in the Genus database with same CATH topology
1V0AA 4BQ2A 3UT0A 2C24A 4CPBA 2WYFA 1WMXA 1OKOA 1W8TA 4LJHA 4YWAA 2Q1FA 1WCUA 1GWLA 4CP9A 1W90A 1W8UA 4CP9B 1W8WA 3ORJA 1W8ZA 5D21A 4LKFA 3F95A 4LK7A 1W9FA 2JWPA 1GWMA 2K46A 2O14A 2LRPA 4BQ4A 4A6SA 3ZYFA 2KR2A 1OH3A 1UOJA 4LKEA 1WZXA 1HN0A 1L7LA 4LK6A 4LKDA 4YW6A 2LROA 2VXJA 1GWKA 4AL9A 4BQ5A 3ZYBA 4YW7A 4BQ3A 4CPBD 3ZYHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1V0A A;  4BQ2 A;  3UT0 A;  2C24 A;  4CPB A;  2WYF A;  1WMX A;  1OKO A;  1W8T A;  4LJH A;  4YWA A;  2Q1F A;  1WCU A;  1GWL A;  4CP9 A;  1W90 A;  1W8U A;  4CP9 B;  1W8W A;  3ORJ A;  1W8Z A;  5D21 A;  4LKF A;  3F95 A;  4LK7 A;  1W9F A;  2JWP A;  1GWM A;  2K46 A;  2O14 A;  2LRP A;  4BQ4 A;  4A6S A;  3ZYF A;  2KR2 A;  1OH3 A;  1UOJ A;  4LKE A;  1WZX A;  1HN0 A;  1L7L A;  4LK6 A;  4LKD A;  4YW6 A;  2LRO A;  2VXJ A;  1GWK A;  4AL9 A;  4BQ5 A;  3ZYB A;  4YW7 A;  4BQ3 A;  4CPB D;  3ZYH A; 
#chains in the Genus database with same CATH topology
 1JZ2 A;  2R07 2;  4CCC A;  2ZA9 A;  3IZO A;  4IL7 A;  1D0H A;  4FPJ A;  5LY2 A;  1R1A 1;  3WW3 A;  5ACA 3;  1D7P M;  2JIJ A;  1CX1 A;  3NJV A;  2ET7 A;  3JXS A;  4XF9 A;  2BER A;  4EYU A;  5D1I A;  4DZG A;  1KGY A;  2XUE A;  3GZE A;  1OA2 A;  3KT1 A;  3UES A;  1N47 A;  5BYN A;  3T1L A;  3OEB A;  3JBG 1;  4K20 A;  4V2W A;  4H14 A;  4AED A;  5BUV A;  3T0D A;  3JD7 1;  1OD3 A;  3POG A;  3WY6 A;  1IPS A;  4LIV A;  3ILR A;  3WNX A;  1UZZ A;  1VRB A;  2D6M A;  3LWC A;  3QBQ A;  4HFS A;  5LA9 A;  1GBG A;  3FBM A;  3O12 A;  4LBQ A;  4XF4 A;  1UZV A;  2XLG A;  4JTO A;  4BIS A;  4YVW A;  1NAE A;  3PHM A;  4OI4 A;  1GUI A;  2W52 A;  1PO2 1;  4HVR A;  1NE6 A;  1LHW A;  3BIE A;  1YO8 A;  1O5U A;  1U12 A;  2WS9 1;  3LZZ A;  4XUT A;  3DCQ A;  2D5F A;  3VDB A;  2ERF A;  5JWP A;  1S2B A;  5FKC A;  1QH7 A;  3ZSM A;  1JZ5 A;  2JWP A;  5CFD B;  1OLM A;  4AHY A;  1C4R A;  1W9T A;  4LHS A;  1X82 A;  4AEK A;  1GP4 A;  3CL1 A;  1EPW A;  1QJY 2;  2ATF A;  1FMD 1;  2R06 3;  1NY7 1;  3O0X A;  3R6S A;  1LOD A;  2WNU A;  3TEW A;  4FPE A;  4XJ9 A;  3AZW A;  2HWD 1;  3VB9 A;  3I3D A;  1OA4 A;  1BCX A;  1OOP B;  2YMZ A;  3NJZ A;  5EFU A;  3NO8 A;  4QD2 A;  4XYX A;  4ZS3 A;  3WDW A;  3U4X A;  2IXI A;  4CDX A;  5IVY A;  4FPK A;  5CA6 A;  4AQT A;  2Q1Z B;  3POW A;  3GYD A;  3MFA A;  4XUP A;  2WSU A;  3CEW A;  2KM2 A;  1UKR A;  4DXT A;  1NYW A;  3U75 A;  4NHK A;  4Y33 A;  2AEY A;  3SCG A;  3KHC A;  1JYT A;  4O61 A;  3RZZ A;  4KL1 A;  3UJO A;  5JOZ A;  2P5B A;  4M00 A;  4A3X A;  1D2Q A;  4Q4Y 1;  5K0U A;  1YCI A;  5FPZ A;  1IQA A;  4OFG A;  2WDB A;  2X5I A;  3E6B A;  4AI3 A;  5BNO A;  3V0A A;  2Y38 A;  1ULF A;  4X8P A;  1SBD A;  1LGB A;  2K2S A;  3EXU A;  4LBK A;  4Z8B A;  3TRS B;  3MUY 1;  2W94 A;  5A7P A;  2Q8D A;  1PO1 2;  4LUM A;  2W47 A;  3IB3 A;  4BQ2 A;  1U0A A;  3AMH A;  2J22 A;  3HQU A;  3FJS A;  5A3N A;  3ZPO A;  1COV 2;  4HKO A;  1E5I A;  4ZY9 A;  4XIK A;  4XFH A;  1VIW B;  4I30 A;  1RUJ 2;  4HAN A;  1YFW A;  5FMD A;  2D6L X;  3PIJ A;  3BGA A;  4LO5 B;  1W6Q B;  4Q26 A;  1OFS A;  5C8W A;  2NP0 A;  1FOD 2;  1SLI A;  3AFG A;  1AHS A;  1JYC A;  3FFZ A;  5JXI A;  1FPN 3;  1AR8 2;  3WP4 A;  2ZCW A;  2R0F A;  1XNT A;  4J25 A;  3PMS A;  3ZIW A;  1UL9 A;  2HWB 3;  4XMI A;  2WNV A;  3NNJ A;  4O9E A;  2BU9 A;  5DAW A;  4CDQ B;  4PT6 A;  3SIS A;  3LSE A;  3PUI A;  1CZT A;  3O0V A;  5FYS A;  3WNL A;  2YC2 A;  1OQD A;  3MIH A;  3KCX A;  4AI1 A;  4DEQ A;  1X50 A;  3I3E A;  3L9J T;  1X36 A;  1QJU 1;  2VXR A;  4F83 A;  5IK7 A;  1WMD A;  4NVP A;  4QQH A;  1ZRD A;  1VJ2 A;  3VBO A;  5C33 A;  2QVS B;  1AR6 2;  1XYN A;  3J9S A;  3O1R A;  3B01 A;  4C0B A;  3E1F 1;  2DVA A;  1NX9 A;  2FCT A;  1MZ5 A;  3BN6 A;  3DV8 A;  3IT8 A;  2G4I A;  2VCB A;  1RUD 1;  2EAA A;  4DB5 A;  1RUG 1;  5JXG A;  4L0P A;  2Y6G A;  1W8O A;  2GMP A;  4LKS A;  4DUV A;  4B1L A;  5J36 A;  3HN3 A;  4KBZ A;  4ATF A;  2A73 B;  3IBM A;  3MEP A;  2HWC 1;  3O5S A;  3T2Q A;  1H1M A;  1C5I A;  3AX4 A;  3FBY A;  3OSD A;  1PHM A;  4CZS A;  1H2K A;  1KEX A;  2GZW A;  4QXK A;  5GZC A;  3K3O A;  5KC5 A;  1DU3 D;  5IVB A;  2B9V A;  5C3Q A;  4YZ2 A;  4QPI C;  4JQT A;  5CAD A;  1IPK A;  4CYD A;  2QQJ A;  4ZU7 A;  3FC0 A;  2NPI A;  3B93 A;  3BU0 A;  2VC9 A;  5EJ1 B;  1J83 A;  1OPO A;  4CDW C;  4M01 A;  1PMJ X;  5FZM A;  1SFN A;  5FWJ A;  1BHG A;  2E26 A;  2QQL A;  5IFP A;  1KIT A;  1WCS A;  2A5Z A;  4ZXE A;  2C9K A;  4LKD A;  4D69 A;  5ACA 1;  1B35 B;  1HJF A;  3B02 A;  2VW2 A;  5BNP B;  5L9B A;  4FAG A;  1S2E A;  1YI9 A;  4HPK B;  4JDM A;  1XNB A;  3ZSE A;  4FVV A;  5FFO C;  3ZXL A;  3IWZ A;  1HRV 3;  1V9U 1;  1DG6 A;  1MS3 A;  1VBC 2;  4RN5 A;  4QGL A;  1W8T A;  3POI A;  4CUB A;  1PGW 2;  2H0V A;  3AKR A;  4YM1 A;  1S0G A;  3C2U A;  1W99 A;  4RQP A;  1OMI A;  5DAP A;  5FPA A;  4ARX A;  2P34 A;  4XF0 A;  4A7Y A;  3RWK X;  2ZHL A;  4LK7 A;  2Q4S A;  4YRD A;  4M3C F;  1WW6 A;  1HV0 A;  1OD5 A;  1N3Q A;  2EXK A;  1W2N A;  2RJL A;  3R0R A;  4KU8 A;  5IVV A;  4QX5 A;  3VBH B;  4O9G A;  2JB4 A;  1Y3T A;  4IV1 B;  3RZK A;  2R07 3;  2DTY A;  4FFF A;  2IFR A;  3PJQ A;  3IPV B;  4LK6 A;  4MYE A;  1GV9 A;  3HT1 A;  3THT A;  4CEW C;  2QDN A;  5A1L A;  4BQ5 A;  1YLL A;  2VZV A;  4QGN A;  1HRI 1;  4RS5 C;  2CY6 A;  2RG4 A;  2GC1 A;  4LBO A;  3VDC A;  2AC1 A;  1ZA4 A;  2PEL A;  3ZXF A;  3N9N A;  1QOT A;  3I2I A;  4MGY E;  1CJD A;  1HQL A;  2QFE A;  2KXL A;  4LMF A;  4XJA A;  3OUH A;  2BGP A;  2WNO A;  3VKN A;  4GH4 C;  5EQU A;  5C4W C;  4XBQ A;  4QQO A;  5FCC A;  2DBN A;  3I97 A;  4HXC A;  3LGR A;  4P9G A;  1W9Y A;  4WZC A;  3VBU B;  5KHG A;  1RHI 3;  4Z82 A;  1GOG A;  3NV1 A;  1Q8P A;  2JKX A;  3K75 B;  1QJX 2;  4LLO A;  1XSQ A;  1Z7S 1;  4YW7 A;  4ARY A;  5CAZ A;  1UOG A;  4CP1 A;  3VZL A;  5KXD A;  2VTX A;  5F3C A;  3WG1 A;  2W08 A;  2JD4 A;  1WMX A;  3D6E A;  1JMU B;  3I59 B;  2NLR A;  4HN1 A;  1F5F A;  3BOW A;  4JZR A;  1BLZ A;  2YBS A;  4RR3 A;  5HCF A;  2ZAC A;  5GLW A;  4CCO A;  2UWC A;  3THC A;  1QJY 3;  1UY2 A;  2RVA A;  4M0H A;  4E27 A;  2HWE 1;  2W1S A;  3WF3 A;  5LAT A;  2XL9 A;  2JB8 A;  1QGL A;  4Q4W 1;  3H7J A;  3H3L A;  4Y24 A;  1S0E A;  2EF6 A;  2WQ8 A;  3NKG A;  3ZFG B;  1VAK A;  1C5H A;  3AVR A;  4MHR A;  4AED C;  4AGR A;  5FPX A;  1UXZ A;  3A7Q A;  4XPV A;  4A45 A;  4A6S A;  4AEM A;  1IG0 A;  2UYB A;  4A7Z A;  1YEW A;  1R1A 2;  2Z2S B;  1OOP A;  2WO1 A;  1C8N A;  3LFI A;  3WT3 A;  2VXJ A;  3ZSJ A;  3RRD A;  3JQW A;  5J7M A;  4BK5 A;  2VBD A;  2XJS A;  2J1V A;  2W5F A;  4I3G A;  4D3W A;  4JCK A;  4DXR A;  5B4N A;  4WM8 B;  2GU9 A;  3U37 A;  2X05 A;  5FBJ A;  2HBU A;  4LJH A;  4HSL A;  3JBG 2;  3TAY A;  3M3O A;  3CQO A;  4XF3 A;  3OBR A;  4LO6 B;  3UV9 A;  1WCD J;  3K4D A;  3JD7 2;  4Z1V A;  1SLC A;  2WUH A;  1W0P A;  2RDN A;  3AKT A;  1H8T B;  4WBB A;  4YYO A;  2EAK A;  2C9A A;  2E63 A;  3GCW A;  4Q27 A;  2ZHM A;  1KJL A;  3MIE A;  3LE0 A;  1PO1 3;  4XDP A;  2PTM A;  4KWL A;  2PAE A;  1UYP A;  4UW6 A;  1RGS A;  2V73 A;  1PO2 2;  4P5Y A;  4AZZ A;  1COV 3;  4OI1 A;  4UFK A;  2R04 1;  2WS9 2;  1RUJ 3;  5E88 A;  1NCR A;  4HVQ A;  1BYH A;  1GZ9 A;  1Y9M A;  1V0A A;  3JZV A;  1SQ4 A;  1TVG A;  5FYU A;  3N7L A;  4CDX C;  3WP5 A;  1FOD 3;  3EMR A;  1AR9 1;  2RJ2 A;  1W6M B;  2YHJ A;  3CJX A;  4U2A A;  5AVA A;  1QXP A;  1AR8 3;  3ZMN A;  3J7N A;  3D3A A;  1FMD 2;  3HBK A;  5EXO A;  2R49 A;  4COZ A;  4PF5 A;  5C71 A;  4SLI A;  5SV8 A;  4I01 A;  2VNG A;  2Y34 A;  5CNA A;  4LQR A;  1I3H A;  5A32 B;  1G9B A;  4C1X A;  1W05 A;  1CR7 A;  2V4V A;  3ES4 A;  4GAZ A;  4R9D A;  5FZD A;  4CDQ A;  5IVE A;  5K0U C;  4MG2 A;  1PIV 2;  5C6C A;  2Y0O A;  3KVA A;  1NUK A;  1NXD 1;  3ATG A;  4AFB A;  4Z2A A;  3VKM A;  1X7N A;  4C0H A;  3KV6 A;  3J26 N;  2RS1 1;  2UUR A;  1NQD A;  3PUH A;  1AR6 3;  1E5S A;  4NWW A;  4RD7 A;  4NN0 A;  4AEJ A;  5FO8 B;  4Q4Y 2;  1LGC A;  4XCA A;  1G9D A;  1S0B A;  1W2T A;  3BIW E;  4X6Q B;  1OT5 A;  2QQP A;  5I8S A;  1EV1 1;  4QPI B;  4QQL A;  5LZ6 A;  2J42 A;  3I2K A;  2FQP A;  4OHV A;  1YFY A;  1GR3 A;  1IS6 A;  1QJZ A;  1XQN A;  1WBL A;  1NXM A;  3T2T A;  3APB A;  5F2S A;  4QX8 A;  2QQO A;  4EN0 A;  2EIC A;  2XJP A;  1NCQ C;  5A3L A;  1HIX A;  2ZMN A;  2OYZ A;  2WNV C;  1TQ5 A;  2WA4 A;  2VMI A;  3BAL A;  1VBA 1;  1YJL A;  4B4Q A;  1Q43 A;  1ZZ8 A;  2BNN A;  4YGD A;  2CAU A;  1J59 A;  1PK6 A;  4RFT 0;  4A42 A;  1PMI A;  3CZJ A;  2YC0 A;  2WO7 A;  2J1S A;  4QKF A;  3TWI A;  5JLV A;  4CCD A;  2X29 A;  2XB6 C;  1WLD A;  1CAW B;  3ZKY A;  4NRP A;  2PAM A;  1L7Q A;  3KZ4 C;  5D21 A;  3M4F A;  2ZGM A;  2W39 A;  3FE5 A;  4OQ8 A;  3M70 A;  3TNQ A;  3VDD B;  1BQP A;  2GP5 A;  1B35 A;  1VBC 3;  2RHP A;  5A6Y A;  1SFP A;  2XPJ A;  1QJU 2;  1RJ8 A;  3S30 A;  4R9B A;  4HPK A;  1NG0 A;  4LO8 A;  4C8D A;  2QQN A;  3AYC A;  1GQG A;  3F2Z A;  1TNF A;  4LHN A;  4B4P A;  1LOC A;  1MS1 A;  2WYF A;  2WN3 A;  4DXS A;  1J58 A;  5A7W B;  1VB4 A;  2VU9 A;  5F39 A;  3ZFE C;  1GP5 A;  4FOY A;  1M06 G;  3OGJ A;  1FT9 A;  3ZO0 B;  2VCM A;  4E2G A;  4ASM B;  1RUD 2;  2WRA A;  3I3B A;  4FPO B;  1GSL A;  1RUG 2;  1Y9G A;  1S0D A;  3L2H A;  2WAA A;  3KD4 A;  5K9Y A;  4I0W B;  2DYC A;  5FLI A;  4BQ4 A;  3MLL A;  4AVV A;  2HWC 2;  2VE1 A;  2CL2 A;  2V5D A;  2ZML A;  2XVG A;  3ETP A;  4ET7 A;  4ZHN A;  1RL3 A;  1WMF A;  5L73 A;  2CU5 A;  2ZZJ A;  4LA3 A;  5IAV A;  2R1B A;  4Y3O A;  2H6C A;  1L7R A;  1S2K A;  4RHV 1;  2E9Q A;  4D7T A;  3HNB M;  3KV9 A;  3LDB A;  5BNN B;  1GAN A;  2IZW A;  2VCC A;  2G9Z A;  2XKO A;  2J1U A;  3BTA A;  3HIF A;  1VAM A;  1DGW A;  1XYP A;  4S2D A;  3H50 A;  1JZ6 A;  3LD8 A;  4DOU A;  1SG3 A;  2YYO A;  1UY1 A;  2ZTN A;  5F6K A;  5A7S A;  3INA A;  4CP9 B;  3S7E A;  4CTE A;  5FP9 A;  5FAX A;  2BBV A;  2A3X A;  3MGU A;  5FZO B;  5A3P A;  1QJX 3;  1W2U A;  5F37 A;  2B39 A;  3KWV A;  5DN2 A;  2YZ4 A;  4J6G A;  3VBU A;  1V9U 2;  2KR2 A;  1LB2 A;  1R08 1;  2PQS A;  4FTS A;  3LKJ A;  1REF A;  4XVH A;  5LBF A;  4P9Y A;  4ES8 A;  3RG0 A;  1WLT A;  4KWK A;  3I59 A;  2Y6H A;  3HD8 B;  4AHZ A;  3B7M A;  4FQZ A;  4L2N A;  3LEG A;  4ZKT B;  3KV5 A;  5T50 A;  2ZPX A;  3EBR A;  2AUY A;  4L92 A;  3JUU A;  2VZQ A;  1Q8O A;  1S1A A;  3W59 A;  5FV3 A;  4LHL A;  5DUV A;  2HKX A;  3VDA A;  1DZT A;  1WA6 X;  2ARB A;  1ULP A;  2VBB A;  3AB0 A;  4QPG B;  1YFU A;  4KWU A;  3ZFG A;  1R1A 3;  3S5A A;  3G6J B;  3NV4 A;  4XJU A;  4JKM A;  5IT6 A;  1YIF A;  1HB4 A;  1LU2 A;  1RUJ 1;  1UIJ A;  4H2A A;  1HRI 2;  4M3C E;  4D6S A;  3O14 A;  1ZRC A;  4NIG A;  2FCU A;  1UO9 A;  5DG1 A;  3WCS A;  3O1S A;  1FYU A;  2Z79 A;  1JTZ X;  3FUQ A;  4AFD A;  3JBG 3;  3IDB B;  4MGZ E;  3QH7 A;  1H2L A;  4WM8 A;  4PQQ A;  2VVD A;  4A2U A;  5DPN A;  3A4U A;  1QQP 1;  1XU1 A;  3JD7 3;  4B7E A;  1H8V A;  1MEC 1;  3WDU A;  3ZOI A;  2QQI A;  2ILM A;  2BYV E;  2ZX0 A;  4ZZ5 A;  2C0Z A;  5FPU A;  4PBP A;  1IS3 A;  4XAC A;  3DEC A;  2ZHN A;  4GB3 1;  4DUX A;  4UT5 A;  2MPF A;  3M1H A;  4MH0 E;  1HJG A;  2HWF 2;  5CFD C;  3PVO A;  1W06 A;  1PO2 3;  1V6K A;  1UWW A;  3JU9 A;  4QQ2 A;  4GMP 1;  4L11 A;  4ASL A;  3OB8 A;  1OA3 A;  2WS9 3;  1PNF A;  1Z7S 2;  2DCJ A;  1UY3 A;  3N7M A;  1Y9Q A;  2A1X A;  1NKG A;  4HZF A;  1SDD B;  3CLP A;  3MHZ A;  3TOJ A;  4UFH A;  3PJY A;  5IAX A;  1OOP C;  2OII A;  2YC4 A;  3ZXJ A;  1MQT B;  2WZP P;  5DMY A;  2QKD A;  2SLI A;  3FN9 A;  4JC1 A;  1RUH 1;  1TG7 A;  2HWE 2;  4F7Z A;  3N36 A;  1FMD 3;  3U4S A;  5FZF A;  4Q4W 2;  5EHD A;  4YWA A;  2W1W A;  1CJP A;  4QB1 A;  1LOB A;  2W95 A;  4AVS A;  5IAT A;  1AYN 1;  3IMM A;  4FFI A;  5LY1 A;  4QHZ A;  2XVK A;  1RUE 1;  1XOY A;  2Y6J A;  4W6Y A;  2ARA A;  1PIV 3;  2B42 B;  5GKA C;  2ARC A;  5LEK A;  3BUC A;  2VUD A;  5EYY A;  1POV 0;  3USU B;  3MW2 A;  2OZ6 A;  1IHM A;  3MW4 A;  4H7L A;  1ZZ7 A;  3FLP A;  2Q8O A;  2YG0 A;  2ENR A;  4IGP A;  2VH9 A;  3CZU A;  2X10 A;  2RR1 2;  4JQR A;  5F32 A;  4Q4Y 3;  1JYV A;  2Z42 A;  3VBR B;  3WV6 A;  1AJK A;  3DPR B;  4UW4 A;  1H30 A;  1YNA A;  4AYU A;  4CCL A;  2IXL A;  3LF7 A;  2D3P A;  3UK9 A;  1UMZ A;  4GMP 0;  3NST A;  2YRO A;  4CP0 A;  3PTR B;  4QPI A;  1MR5 A;  2ZOE B;  1VR3 A;  3J8F 1;  4XJW A;  1JU3 A;  4U36 A;  3AP6 A;  1MS4 A;  3H7Y A;  4NPL A;  1F31 A;  3C7O A;  3DXU A;  3OBA A;  4AAX A;  4CDW A;  2ZJC A;  3BYW A;  4MLO A;  5CZK A;  4LIT A;  2WNE A;  2YU2 A;  3R4U A;  3WF1 A;  1DGL A;  4UF0 B;  1HXS 1;  3M3C A;  1W2O A;  4QDS A;  4LKE A;  4CDQ C;  4EE2 A;  3TB0 A;  4FSJ A;  3KLS A;  1JYI A;  1AR9 2;  2VQT A;  4QQP A;  3RYP A;  1ZBE 1;  2XWJ B;  1G9A A;  2OQ6 A;  1LES A;  4IXL A;  2XL7 A;  2PQQ A;  2WZR 2;  1ACC A;  5J3U A;  2Y6F A;  3KQ4 B;  1CAW A;  3WXP A;  2CTV A;  2P1B A;  5DZE A;  4CE8 A;  1V6O A;  4XF1 A;  5FMC A;  4DMI A;  3C3V A;  4ZU4 A;  2Y6L A;  4ATE A;  1WLC A;  1BBT 1;  1W28 A;  4XFI A;  4BXF A;  2JE8 A;  5L9R A;  3GBF A;  1QJU 3;  3BCW A;  4OI2 A;  1POQ A;  1C28 A;  3GCX A;  1FI2 A;  1DYP A;  4BWO A;  3SCF A;  4ZON A;  5CG9 A;  5LCW L;  2E31 A;  2RS1 2;  2W46 A;  4YM2 A;  1EP0 A;  1WZX A;  4YPJ A;  5HV0 A;  1CON A;  2Q1M A;  2QQW A;  2FBE A;  3OTF A;  2VZR A;  1MS8 A;  3T4H B;  4RS5 A;  1KQR A;  1DF0 A;  4LBJ A;  4LXL A;  1RUD 3;  1EV1 2;  3C7F A;  4HOO A;  5FZC A;  1RUG 3;  5FYC A;  4YZ1 A;  2VGD A;  5HBA A;  2WN2 A;  4W50 A;  1O4T A;  4BQY A;  5F5Q A;  3N9L A;  4YFW A;  2GAL A;  2P6H A;  1A8M A;  2VZO A;  4PHZ A;  4MGQ A;  2LUW A;  3PUR A;  1XJA A;  4QPW A;  2HWC 3;  3AKQ A;  5FQ0 B;  1VBA 2;  4AQ2 A;  4CUC A;  1WKY A;  4ZPI A;  1J3P A;  3O1O A;  3OGS A;  2Y0I A;  3PU3 A;  4QGM A;  2VOX A;  3KM5 A;  1JZ4 A;  2QE3 A;  1LTE A;  4YFZ A;  1B35 C;  4GAL A;  5BNP C;  2F4P A;  2VOW A;  2B8M A;  1R09 1;  1AR7 1;  1UMH A;  3A22 A;  3KF3 A;  4MSV A;  4GWI A;  2RDS A;  4QU2 A;  4XMA A;  4YGB A;  1RXF A;  5FZI A;  3RGB A;  5BNN A;  2A70 A;  3V0B B;  2Y6K A;  5JOX A;  2YY1 A;  3KT4 A;  3WP3 A;  4AVB A;  4MX3 A;  5FZ0 A;  2O1Q A;  1VPH A;  4CP9 A;  5FY1 A;  5CU1 A;  4XHX A;  4CUG A;  4UWD A;  1UX7 A;  1FX5 A;  1V9U 3;  2ID4 A;  2NMO A;  3T0A A;  4N43 B;  5IVJ A;  5FZB A;  5HPO A;  4OHX A;  1AZD A;  3KVB A;  3VBH C;  1VMH A;  3ACI A;  1F2N A;  4IV1 C;  5FYV A;  2WA3 A;  3WNM A;  2JIC A;  4G3Y C;  4P5H A;  3VZK A;  1EUT A;  4I3P A;  1JZ8 A;  1BK1 A;  3TNP B;  1S55 A;  5C3S A;  3K4Z A;  3LA7 A;  1HB1 A;  3UT0 A;  3TEY A;  2WQ4 A;  5LA1 A;  1C3H A;  5FK8 A;  3CHX A;  5H9R A;  5FZA A;  4H55 A;  4XUN A;  4DXZ A;  1DFQ A;  4XXA A;  3ORJ A;  1HRI 3;  1RJ7 A;  4LKF A;  2GNT A;  3PU8 A;  3UGG A;  1CGP A;  1UMI A;  1ND3 B;  2B46 X;  2PHR A;  3OGV A;  4ZXK A;  3C7E A;  3VKO A;  2I74 A;  2N7G A;  5FK7 A;  5KHH A;  3AZV A;  1OXC A;  2NM1 A;  4A6O A;  1JHN A;  4RHV 2;  3GJB A;  5EP9 A;  3VBU C;  1QY4 A;  5A1F A;  1VAL A;  3J7M A;  5A3W A;  3T4V A;  5FYZ A;  3TN9 1;  4P9W A;  1ULE A;  2JXA A;  3H1Y A;  4PLO A;  4XDQ A;  1W39 A;  2FDH A;  1SBE A;  2XHK A;  3MID A;  4GUL A;  4PJY A;  1PIV 1;  3WW1 A;  3VV1 A;  4BPZ A;  3BTZ A;  3R05 A;  2P6C A;  4FAH A;  2IFW A;  4NID A;  4OUS A;  1UYZ A;  1RMU 1;  1QU0 A;  1Z7S 3;  2W1U A;  2PHU A;  2OX0 A;  2VZ1 A;  4PDW B;  4OHZ A;  2ARE A;  1R08 2;  3HQR A;  3RNS A;  1VE0 A;  2WZ8 A;  1XE7 A;  2XON A;  5GAL A;  5H9S A;  3V65 A;  4M4P A;  2W9X A;  3ZSL A;  2R16 A;  3ZFG C;  2BZD A;  5FKB A;  5FYB A;  5FMO S;  1JOB A;  2ARX A;  4IEZ A;  1RB8 G;  3UKN A;  1TZO A;  4CDU B;  3M8L A;  2NQY A;  1SLA A;  2HWE 3;  4EQV A;  2PMW B;  5FYM A;  4N8M A;  4Q4W 3;  2CGN A;  1MQT A;  4L99 A;  1REE A;  5FP7 A;  4BM8 A;  1GZW B;  1UZY A;  1S0I A;  2VMH A;  5JR7 B;  4TTG A;  4DFS A;  4WM8 C;  3O1T A;  3WNK A;  3CNA A;  4DRV A;  4E4Z A;  2CAV A;  2YGL A;  1W0O A;  5KHK A;  3LOB A;  3M3E A;  4BQX A;  1ST8 A;  5K8S A;  5A7O A;  3CU7 A;  2VZU A;  1CPM A;  4BZ4 A;  3RPQ A;  3SNM A;  2F4L A;  5FUN A;  1W8W A;  1SAC A;  1UZW A;  4B3N A;  3OBZ A;  1QJE A;  2RS5 2;  1H8T C;  4AFM A;  4YAR A;  3CMG A;  4XCB A;  2RM2 1;  3WHU A;  3USU A;  1CPN A;  2ZGO A;  3AYE A;  3KSC A;  4ISR A;  4GD4 A;  5ISL A;  1V6L A;  4FPY A;  1VP6 A;  1NCQ A;  1QQP 2;  1WA4 A;  1WD3 A;  4KQ7 A;  4PF1 A;  5FJH A;  5E8A A;  1AL0 G;  1MEC 2;  3Q8C A;  5FYI A;  3RFR A;  3AJZ A;  4A44 A;  5JXH A;  2OS2 A;  1EYB A;  5AC9 1;  3AP5 A;  1CAV B;  4CUA A;  4XTP A;  4ORF A;  4IEX A;  1H1A A;  3VBR A;  1LED A;  3A0N A;  1UU5 A;  3DPR A;  4GB3 2;  4YG6 A;  5H9P A;  2EIG A;  4FPL A;  5JXJ A;  1ZZC A;  2IXK A;  2ES3 A;  3PL0 A;  2JEN A;  4GIQ A;  5C8C B;  2R04 3;  2CDP A;  3UNP A;  3SIT A;  3U07 A;  4CCJ A;  1F35 A;  2CHH A;  4XJZ A;  2IC1 A;  4CU6 A;  1V00 A;  3VHO A;  4JGZ B;  1AR9 3;  2K46 A;  1PVC 1;  2V09 A;  1ND2 B;  5T5O A;  1HX6 A;  1RUH 2;  4NRQ A;  4Y22 A;  2ZAB A;  3O0W A;  1AL2 1;  1EAH 1;  1FV2 A;  2PAK A;  3UGH A;  1YQ6 A;  2GAU A;  2J7M A;  2ORX A;  4NRM A;  3QCW A;  4IUG A;  2QJV A;  4DO0 A;  3ZM8 A;  3E5U A;  4BA6 A;  2YU1 A;  1AYN 2;  1VBD 1;  3FL7 A;  4K3U A;  5CFC B;  3WUC A;  3G7D A;  1RUE 2;  4QU1 A;  3WQ0 A;  2GN7 A;  2DV9 A;  4IDZ A;  4BJ0 A;  2G9F A;  3C7G A;  4MGS A;  1RUC 1;  2A75 A;  4TWT A;  3ZFE A;  3POF A;  4AF9 A;  1DZQ A;  2WO2 A;  4PCR A;  4LBL A;  4XTM A;  2L9L A;  4XFC A;  1SDW A;  1O7F A;  2RS1 3;  4PIY A;  4BB3 A;  5BV6 A;  1O8S A;  1DQ2 A;  2CWS A;  4UAP A;  4EN6 B;  5JZG B;  5E6H A;  1VMF A;  3ON7 A;  4D94 A;  2I45 A;  5FZL A;  2IVI B;  2JDP A;  4ISQ A;  1EV1 3;  1W6N B;  2VNO A;  1HN0 A;  4GWN A;  4URT A;  5GLU A;  2ZX1 A;  1CAX B;  1OLM E;  2W0X A;  2MEV 2;  3SLI A;  3ACL A;  3SXW A;  3J8F 2;  1XBF A;  5FZE A;  3QH6 A;  5IWF A;  3RZM A;  4YZ3 A;  4NHX A;  4CSW A;  1VBA 3;  2WWJ A;  4HL0 A;  1O6U A;  1CZS A;  4XBN A;  1IKP A;  1KDK A;  3DKW A;  2VL4 A;  4Y1X A;  1W9W A;  4MZU A;  1JS9 A;  3WG2 A;  1Z0H A;  1HXS 2;  5FQ0 A;  2DCY A;  1BJQ A;  2JDH A;  3V64 A;  3NNM A;  3EQE A;  1ZBE 2;  4W6X A;  3VDD C;  4AI9 A;  1DYK A;  2J1A A;  4QX3 A;  5FY7 A;  3NV3 A;  2P2K A;  1UOB A;  4Q0S A;  5DZG A;  1SPP A;  2WYS A;  4K8R B;  3HEI A;  1BEV 2;  2VD7 A;  5HCH A;  2Z69 A;  2XH6 A;  2JG8 B;  3KB5 A;  4Q0Q A;  4W8J A;  3ZR5 A;  3V0B A;  1YJK A;  5EIY B;  4LR4 A;  1OVS A;  5T5J A;  4CCN A;  1G9C A;  1BBT 2;  3RI9 A;  1V6J A;  1ZVF A;  2R6Q A;  5FYT A;  3ENR A;  1XNA A;  2C4X A;  1W90 A;  4AAP A;  1VLN A;  1A8D A;  4IE7 A;  2DUR A;  4EWD A;  1W8Z A;  2XQR A;  4CCM A;  3ASI A;  1ULG A;  3E5X A;  2DVF A;  3P3P A;  3GJA A;  5FOB B;  1N1T A;  4JKL A;  2LW8 A;  3OD0 A;  2BOJ A;  4B4R A;  4F3J A;  1AXZ A;  1US3 A;  1WW5 A;  4FCA A;  2RDQ A;  2XGX A;  2HWF 1;  1IGO A;  1ZRI A;  2VTF A;  1FXZ A;  3MDP A;  2GC0 A;  3NMB A;  3WHT A;  3ZYR A;  1QWR A;  4TN7 A;  4BIO A;  5BNN C;  1JBC A;  1OBN A;  1SCR A;  1Q5O A;  4WVV A;  5I8T A;  3S0M A;  4LT5 A;  1J1T A;  1SBF A;  5J09 A;  4IND A;  1NT0 A;  5FZ8 A;  5JSP A;  3WX5 A;  5ANN A;  1JZ3 A;  5I0T A;  2WIN B;  1DQ6 A;  3FHA A;  4Q2F A;  1OHF A;  1YI7 A;  2JKB A;  1ENR A;  4RHV 3;  1UZ0 A;  4RSU A;  3RQ0 A;  4BLJ A;  2D3S A;  1ND3 A;  4E2S A;  4IV3 B;  5CFD A;  2VUC A;  1RED A;  2BGO A;  1VBB 1;  3WEZ A;  1ZZ6 A;  3SH4 A;  2YPJ A;  1R09 2;  1AR7 2;  3WF0 A;  3VBS B;  5IK8 A;  1I5P A;  4QM8 A;  2YBK A;  1ZZB A;  4DIN B;  2P3Y A;  5FUP A;  3J7H A;  1I6X A;  3N9P A;  1XPW A;  2JE9 A;  3IIA A;  3R4S A;  4PI0 A;  5J37 A;  4BMB A;  2WII B;  2WFF 1;  4QM9 A;  4AGG A;  5J1X A;  2QQK A;  3N35 A;  4H3W A;  1CAU B;  2C24 A;  4ES9 A;  1JI6 A;  1DP0 A;  1O4Y A;  1PGS A;  1UYY A;  5AFB A;  1R08 3;  2WT2 A;  5JSO A;  4JHT A;  5FZK A;  2CGP A;  1OKQ A;  2UYA A;  1UOF A;  2RR1 1;  4YSF A;  4IGQ A;  3KF5 A;  4PDW A;  2VJX A;  4L8Q A;  3T30 A;  4QPG C;  4PQ9 A;  1H9P A;  2XJV A;  2XHN A;  1FV3 A;  3R4D B;  4CEY B;  3E6C C;  3SEE A;  1TE1 B;  1C1F A;  1P8J A;  4CDU A;  1JN2 P;  1DQ0 A;  4UXA A;  4Y5Z 0;  2NN8 A;  3MIG A;  1F9K A;  1JHJ A;  2QTW B;  5FRE A;  1ENS A;  1W3X A;  1HQN A;  1ODN A;  2WR9 A;  1QNY A;  3ZYI B;  1ZRE A;  5GZG A;  3MYX A;  3HN1 A;  3U10 A;  5C3O A;  1YFX A;  2Q30 A;  4CU8 A;  1ASJ 1;  3WF2 A;  1CD3 G;  1YQ5 A;  1W9S A;  4XOG A;  4HMZ A;  1O3R A;  4KG8 A;  1QHD A;  2PFW A;  3H9A A;  2QDR A;  4EN8 B;  2GND A;  4RA0 A;  5DDJ 1;  5F3I A;  1DQ1 A;  1W6Q A;  2TEP A;  4CP2 A;  4XJ8 A;  5HCA A;  1YHF A;  4K8F A;  1QQP 3;  3ZFF B;  2WZR 1;  5FO7 B;  2CGO A;  1MEC 3;  3A0K A;  1RYY A;  4DY3 A;  3OBT A;  2BBA A;  4LBN A;  1WCQ A;  4LTA A;  3TN9 2;  5I0R A;  5FUI A;  5KWR A;  3P5B A;  1OF4 A;  4OHY A;  4QHO A;  1F4H A;  2G1M A;  4GB3 3;  4N9H A;  5LK5 A;  1AJO A;  3WNP A;  3I54 A;  1W8H A;  5DAB A;  3W5N A;  5T5P A;  3WW4 A;  4GMP 3;  3POS A;  1MQT C;  4BME A;  2HBT A;  4OUE A;  1RMU 2;  2W91 A;  2BGC A;  1LOE A;  3SEP A;  4X8N A;  1AYM 1;  3CIH A;  4BQW A;  2F17 A;  4IQP A;  4K1Y A;  3H0O A;  2ZHK A;  4ONU A;  3RZJ A;  5C8C A;  5JCT A;  3KCC A;  4P9I A;  2NZ9 A;  2EID A;  3ACH A;  2A6V A;  5HV4 A;  3MV1 1;  4I0A A;  3FUO A;  1RUH 3;  3FFQ A;  1NE4 A;  3WDV A;  3VZN A;  4FTE A;  3LFM A;  4HT1 T;  1U5Y A;  3HNM A;  3V56 A;  1AYN 3;  1JW6 A;  5K4L A;  4Q8K A;  4IE5 A;  1LKN A;  4XE9 A;  2IXH A;  4YVS B;  5FRA A;  1RUE 3;  1NZI A;  4IES A;  4LIU A;  4MHU A;  3W9A A;  3N7K A;  4IEY A;  1T2X A;  2QQU A;  4AXO A;  2EIB A;  5CFC A;  1C8M 1;  1RTV A;  1UF2 C;  2OUH A;  5CYY A;  1N1S A;  3VBR C;  1MVE A;  1PNG A;  2O8Q A;  2XML A;  3DPR C;  3WF4 A;  5T52 A;  5C5U A;  5LBE A;  1H2M A;  2RM2 2;  1YUD A;  4MV2 A;  2Q1F A;  2FDI A;  5F5C A;  2P3K A;  1R1Z A;  4K1Z A;  1VBE 1;  2CNA A;  2Y60 A;  3CJI B;  2OPW A;  5DZF A;  3O1M A;  1K5M B;  3W5M A;  1H6X A;  1XSR A;  3HAG A;  5CIR A;  4BU2 A;  3O7O A;  5AC9 2;  2PHW A;  2Y26 A;  3S5Q A;  1NA1 C;  1XYO A;  4AVC A;  4COU A;  3VD3 A;  5FZ7 A;  2IVJ A;  1LJ7 A;  2VVF A;  1W6N A;  2ZEZ A;  5L7O C;  2BJS A;  4K9S A;  4UI9 L;  3J8F 3;  5FZ6 A;  4Z07 A;  3DN7 A;  3H8U A;  3MLJ A;  4FFH A;  5G05 L;  3ZLI A;  1VRH 1;  5BNP A;  4KGQ A;  1S0C A;  3GBW A;  5IVC A;  2WT0 A;  4DY5 A;  5DAV A;  4AI2 A;  1HXS 3;  5EJZ B;  4C1W A;  1UAI A;  3SH3 A;  5LBC A;  3OYW B;  4W65 A;  2AYH A;  3PUQ A;  1PVC 2;  2XOM A;  2ZX2 A;  1ZBE 3;  3ZR6 A;  3LSD A;  3W20 A;  2JG9 B;  1K42 A;  1AL2 2;  1EAH 2;  2XVL A;  2Q8E A;  4N53 B;  1BEV 3;  2YDE A;  3VBH A;  3ITQ A;  2XJR A;  1M4W A;  4Y20 B;  1VBD 2;  4Y26 A;  3TEZ A;  4IV1 A;  2G19 A;  2JIG A;  1OH3 A;  5FOJ B;  2BOI A;  3IPV A;  1BBT 3;  2VBP A;  1OUR A;  4FXG B;  5KHJ A;  1N3P A;  1RUO A;  1QMJ A;  2VQ0 A;  1RUC 2;  3AZX A;  4E8C A;  1DYO A;  3I7D A;  3MF9 A;  2DUP A;  1XB9 A;  1NOV A;  2VZP A;  2J1E A;  3EHK A;  2VW0 A;  2HJI A;  4SBV A;  3GF6 A;  1XU2 A;  4HKL A;  4WVW A;  3WCR A;  2VZ3 A;  1ONA A;  4DQA A;  4Q4X 1;  5IFT A;  1R64 A;  2DTW A;  3NV2 A;  4P9J A;  1W6O B;  3QOP A;  2I2S A;  3C7H A;  3OY8 B;  1AF9 A;  5LA0 A;  5FMO L;  3WP6 A;  1GNY A;  4QKN A;  2Q8C A;  3PNA A;  5IVF A;  1KRI A;  3WZ1 A;  1JUH A;  3WNN A;  1BKZ A;  3H3Z A;  4XAA A;  2E51 A;  5LRS A;  3IDC B;  5C9A B;  5CKN A;  2JDZ A;  3III A;  1IPJ A;  4QMA A;  5A80 A;  4MXW B;  1N3O A;  5J98 B;  4AL9 A;  5IJR A;  3PIG A;  1QXR A;  1RUF 1;  4FXK B;  1AXY A;  5HCB A;  3P3N A;  3MFC A;  5BNQ A;  3ILF A;  1J84 A;  1SFY A;  2NYY A;  2YBP A;  3OJB A;  4XAE A;  3OOX A;  1EPZ A;  1AR7 3;  1LHN A;  1R09 3;  2ZKN A;  3WUD A;  1IQD C;  5EJ3 A;  1GU3 A;  3HR9 A;  5BPX A;  3KQR A;  3WDY A;  4N43 C;  3JQX A;  4CVU A;  3VBS A;  3NRU A;  4UW3 A;  2Y33 A;  3QLQ A;  3GBG A;  1LNS A;  4XUR A;  4FT8 A;  1NLS A;  3LA3 A;  2RS5 1;  1A78 A;  4D0Q A;  4XQD A;  4BDV B;  2AR6 A;  4PIX A;  1POV 1;  1X33 A;  3FLT A;  4LBQ B;  1CAU A;  4GQ7 A;  3OCP A;  2X8K A;  2ZGP A;  4Q1P A;  3ZDV A;  1ZRF A;  2O0O A;  1MZ6 A;  2QZ2 A;  2WFP A;  4YVW B;  1OLR A;  2BV4 A;  4FQ4 A;  1LOF A;  1OPM A;  4I0B A;  2FDJ A;  5L19 A;  5H9Q A;  4YM0 A;  5A6X A;  1GWL A;  4HK9 A;  3O1U A;  2ZGT A;  4JRA A;  1HB2 A;  2UWA A;  3FZ3 A;  1LEM A;  3OEA A;  1H8T A;  3HVD A;  1ND3 C;  1RVF 1;  1UQX A;  2BNO A;  3Q8E A;  4NPR A;  4WM7 B;  4UBH A;  2X09 A;  3NWK A;  2SBA A;  3OD4 A;  4QX0 A;  1MS5 A;  1C57 A;  2GMM A;  5DXD A;  4AWD A;  2D43 A;  2GC3 A;  4MO3 M;  2WNU B;  5B2G B;  2ZGU A;  3WVJ A;  3X29 B;  5C3R A;  4JRL A;  1UN1 A;  5FP8 A;  5FZ9 A;  3WR0 A;  4MGT A;  1GZT A;  2R06 2;  3LPF A;  3MF6 A;  2PN5 A;  4DS0 A;  2P37 A;  3SQO A;  4COV A;  1CWP A;  2XQX A;  3DKQ A;  1VBB 2;  5FYY A;  3QD6 A;  4A41 A;  1W6M A;  3J4U H;  3TN9 3;  2B45 X;  5J96 B;  3S57 A;  4AW7 A;  4PDW C;  3VHP A;  2IXJ A;  4NO4 A;  3LEK A;  3ZN5 A;  5JI9 A;  4P9X A;  2W3J A;  3VZJ A;  2XKP A;  2WWS A;  4RGK A;  5A32 A;  3ZYG A;  1J3R A;  2WFF 2;  3BTX A;  2D5H A;  4CDU C;  5JAX A;  1RMU 3;  3VD4 A;  3N3H A;  4JDN A;  5BNO B;  5JDB A;  3V0A B;  1BVV A;  4Q4V 1;  3RDI A;  4OUL A;  4R4Z A;  2B7Y A;  3WOG A;  1HQW A;  1JH5 A;  2QBX A;  1V70 A;  4XFB A;  1FAT A;  2BQP A;  4HSJ A;  3ZXG A;  1ULO A;  3IM0 A;  2DDU A;  1YQC A;  1ODM A;  5JSR A;  4AI0 A;  3ZKU A;  4LPL A;  3ABZ A;  4JX0 A;  2K9Z A;  5FTT C;  2P3I A;  2FDF A;  2VEC A;  1H2N A;  1DCS A;  4P00 B;  2MEV 1;  3ECQ A;  4OZX A;  4C91 A;  4E4S A;  5DAX A;  1SLL A;  2XXZ A;  3T3Y A;  2NMN A;  5EZW A;  3O1V A;  4MET A;  1HLC A;  5FYH A;  4YVS A;  2Z4F A;  3SC7 X;  1JUI A;  1NA1 B;  2VVE A;  5F8P A;  1ASJ 2;  4HVO A;  3FX3 A;  2OVU A;  5FZ4 A;  5C7G A;  1TMF 1;  4YG3 A;  5L7O B;  2RM2 3;  3D8C A;  2YUE A;  4CXY A;  2R30 A;  5DDJ 2;  4CU9 A;  2VMD A;  2EXH A;  3C8X A;  1U5X A;  2RMU 2;  1D4M 1;  2RJK A;  1Q3E A;  2Q0A A;  3WG3 A;  4QB6 A;  1Q56 A;  1BEV 1;  1QDO A;  2YV8 A;  5AC9 3;  5C8C C;  5FXZ A;  4D6Q A;  2VMF A;  3CJI A;  5A33 B;  2D40 A;  3T08 A;  1K5M A;  3VBO B;  3H8X A;  1CZV A;  3GHM A;  2ZGK A;  1RC6 A;  1ZM1 A;  4JGZ C;  4RL7 A;  3PVB B;  1YQ8 A;  3GZT B;  4K40 A;  4QX7 A;  4UFJ A;  3VDD A;  1GFF 2;  1ND2 C;  4NJ4 A;  4YW1 A;  4YM3 A;  4QKD A;  5T54 A;  3U0Z A;  5I93 A;  2JDU A;  1AYM 2;  4GA9 A;  4CA9 A;  4KU7 A;  2LAL A;  3NJX A;  3KHB A;  4YG0 A;  2FMD A;  3K2O A;  5JPM B;  1I9R A;  2A7A A;  2WT1 A;  3HOB A;  3VBF B;  2DF7 A;  2EXJ A;  1I1E A;  3U14 A;  5CKM A;  1UPS A;  2R1D A;  2V72 A;  3MW3 A;  3WG4 A;  1W0N A;  1PVC 3;  5CFC C;  5HXV A;  2RS3 1;  2VO5 A;  4BCU A;  1HKD A;  2BTV C;  2VM9 A;  5A7W A;  1AL2 3;  1EAH 3;  3ST7 A;  1OH4 A;  1K12 A;  2HH9 A;  4XFA A;  2CV6 A;  3W58 A;  2ZGN A;  4I02 A;  3MIC A;  3AMM A;  1KS4 A;  2H6B A;  1VBD 3;  2JG9 A;  4OMC A;  4GJY A;  5DQ0 A;  5FP3 A;  3BVC A;  5KR7 A;  2K0G A;  2VOK A;  1D4V B;  4IE6 A;  4YGC A;  4Y20 A;  5JZG C;  1W8F A;  2D7F A;  1RUC 3;  4EV0 A;  5JIU A;  3CDZ B;  1C8M 2;  1PM7 A;  5T3N A;  2QQV A;  5LK7 B;  3AZY A;  2W2I A;  2WBK A;  1XNK A;  3B9C A;  3SH5 A;  2XR4 A;  4P08 A;  2JJ6 A;  1PZ9 A;  1DDL A;  5FY4 A;  3MPP G;  4AFC A;  3SHR A;  4N7U A;  2LRO A;  4OZO A;  3A23 A;  3P1I A;  2E6V A;  2DFC A;  1T6B X;  2ZMK A;  1VBE 2;  1UNB A;  1WW7 A;  5IK4 A;  2E7T A;  1CES A;  2BNM A;  1LOA A;  4AK3 A;  4QX1 A;  4XZP A;  3RI8 A;  5KXB A;  1OQ1 A;  1MZF A;  3I2G A;  2DU0 A;  4RQP B;  1W6O A;  3ZN4 A;  2PHL A;  4LEJ A;  1W8U A;  2D6N A;  2WO3 A;  1TNR A;  3OY8 A;  4LNV A;  2JDN A;  1K5J A;  1OSG A;  3LIH A;  3ROU A;  1CIW A;  1JOJ A;  4XUO A;  3AL5 A;  2VME A;  5BY5 A;  4L97 A;  3LDR A;  1NQJ A;  3AVS A;  4XZU G;  4OI0 A;  3UJQ A;  2CSG A;  2ORZ A;  3RMX A;  1VRH 2;  1QKQ A;  5HXM A;  5FZO A;  4A4A A;  4XBL A;  2O14 A;  3HNY M;  5GZE A;  3POE A;  1GOF A;  3AK0 A;  1RUI 1;  2ZAH A;  5GM0 A;  4FPG A;  2GC2 A;  1OC1 A;  2TUN A;  4MXW A;  4V2V A;  2JG8 C;  3UL2 A;  2OUJ A;  2WWU A;  1VMJ A;  1GOH A;  2VR4 A;  3MUZ 1;  5E89 A;  2VCA A;  3B5L B;  1RIT A;  5GLV A;  4OYU A;  4XQW A;  1O3S A;  5IHR A;  3OPZ A;  3MIF A;  5FZG A;  3DL3 A;  3NNL A;  1A34 A;  2PLV 1;  1Z78 A;  3M3I A;  2GME A;  4IET A;  1JU4 A;  2V5Y A;  4OQ9 A;  4QPG A;  4IEW A;  5FP4 A;  5FZ3 A;  1VB2 A;  5B4X A;  3ELN A;  3KGZ A;  3E5Q A;  4TSV A;  4H7M A;  1HN1 A;  1N1Y A;  2C1F A;  5M0T A;  3B69 A;  4EJR A;  4FTB A;  1W6P B;  3K46 A;  1GQH A;  2FHR A;  4QX2 A;  4Q4X 2;  1OLQ A;  2DVG A;  4E9K A;  1RHI 2;  4RGG A;  5DUW A;  1O3Q A;  2EIE A;  4FOQ A;  1XC6 A;  2FD8 A;  3AP7 A;  3GZU C;  4Q8L A;  1S4C A;  3CKH A;  2MHF A;  2HWF 3;  3POY A;  4MXV A;  5D2A A;  3VZM A;  4RR3 B;  2P3J A;  3I2J A;  1T6G C;  2AH2 A;  4IV3 C;  4WM7 A;  4Y1U A;  5ABJ C;  3TBD A;  4Q0U A;  4JAA A;  4HN0 A;  2D44 A;  2XBO 1;  3UGF A;  3I2O A;  4YNI A;  1PX4 A;  4FFG A;  1PMH X;  3VBS C;  2VNR A;  4V1P A;  1IZ3 A;  1GKB A;  1AX0 A;  5BXX A;  3OF1 A;  5F5A A;  1RUF 2;  2EA7 A;  3USS A;  1Y43 B;  2DU1 A;  3NKT A;  1CQ9 A;  4CXX A;  2I07 B;  2DVB A;  1VBB 3;  1TME 1;  5JPN B;  1Q8V A;  3U11 A;  4E2Q A;  1PX3 A;  2DCK A;  2BDR A;  3AL6 A;  1UKG A;  2R7E B;  2ZEX A;  4JTN A;  1WME A;  4URA A;  1A6C A;  2VPV A;  2JDA A;  3RWN A;  1LOF C;  5K7P A;  1W03 A;  3ZYJ B;  3ZXE A;  4WZF A;  2CDO A;  4YW5 A;  1O91 A;  2XLA A;  2WFF 3;  1EY2 A;  3H3U A;  3WDT A;  4AQ6 A;  3F95 A;  1JZ7 A;  4CEY C;  4F8A A;  3RMY A;  4KWJ A;  3K51 A;  4NOT A;  4TLG A;  5I8Y A;  2BWA A;  2RR1 3;  3OPW A;  5FPB A;  3OG2 A;  3AFK A;  3BTY A;  4FP3 A;  3I2H A;  2JE7 A;  4BHP A;  4BYY A;  1JOD A;  3NNF A;  4JGY B;  4CXW A;  1NZC A;  1AXK A;  1MPX A;  5APA A;  2WZE A;  4CRQ A;  3URF A;  4QT6 A;  3KCY A;  1STM A;  1IG3 A;  2PA7 A;  1NCR B;  1OVP A;  4XHB A;  3O1P A;  1UD1 A;  3VN4 A;  1RVF 2;  2CYF A;  2GSY A;  4QXC A;  1WCU A;  2OA2 A;  4DRR A;  4RGA A;  1O5L A;  3M7A A;  1WBF A;  2IWG B;  2D97 A;  5DG2 A;  3H8R A;  1E57 A;  1QEX A;  2VZT A;  3ZFF C;  2AAC A;  4YZ5 A;  1ASJ 3;  3KMH A;  1A3K A;  4YW2 A;  2HYX A;  3AXE A;  1X9T A;  2F6B A;  4XIL A;  1YIP A;  1NA1 A;  1XE8 A;  1ENQ A;  5DDJ 3;  4NHL A;  1U5I A;  5IW0 A;  2QZ3 A;  1F4A A;  4UF0 A;  4BQ1 A;  5L7O A;  2RMU 3;  4WVZ A;  2WZR 3;  3WLU A;  1HV1 A;  3W21 A;  4TLF A;  2X53 S;  5D8A B;  4D7Y A;  5I0D A;  4W6W A;  3PVE A;  1QDC A;  3GDB A;  1QF3 A;  3ILN A;  4R4X A;  4S2H A;  5JUV A;  1O8P A;  1H4H A;  2IUW A;  1AVB A;  3AKS A;  1UYX A;  2J1R A;  1ZBA 1;  4LUK A;  5LBB A;  4ASK A;  4DNY A;  1LHV A;  4OLL A;  5A33 A;  3TYJ A;  1JXN A;  4M3C B;  3IDE A;  5FZ1 A;  4BE3 A;  2VUL A;  5A3T A;  4E4H A;  4NIH A;  4Q4V 2;  1AYM 3;  4DIQ A;  3NAP B;  1W2A X;  4IE0 A;  3AP9 A;  1X8M A;  5A6Q A;  2GN3 A;  2PHF A;  4NAO A;  2VUJ A;  1BZW A;  4HON A;  4QKB A;  4AHW A;  5AVP A;  4E4D X;  4YVS C;  3L2Y A;  2G9G A;  1GMM A;  1UCX A;  3DYO A;  3ZDS A;  1KJR A;  3VBF A;  3EYP A;  1L7L A;  4LOR A;  3OGG A;  4QXH A;  5GZF A;  5T55 A;  4Q1R A;  5JOW A;  3WIN E;  1PK6 B;  1MZE A;  5CB7 A;  2OPK A;  3FWE A;  2P17 A;  3N9M A;  2FDK A;  1FNZ A;  1QIQ A;  1V6M A;  3Q8B A;  1WGP A;  2B9U A;  4KI5 M;  4Q5O A;  5LRR A;  4BIF A;  4D7S A;  4JV4 A;  4ITC A;  4FI9 A;  3UKT A;  1C8M 3;  3CJI C;  1N1V A;  1K5M C;  1IKQ A;  2ZAA A;  1TMF 2;  3FLR A;  1YC6 1;  1CX4 A;  4MVT A;  4R52 A;  4UW5 A;  1MS9 A;  1KDM A;  4GXL A;  3ZXK A;  1VBE 3;  3ZN6 B;  2OZJ A;  4FO9 A;  1WW4 A;  2W68 A;  1NLR A;  1ALY A;  3B94 A;  4OVE A;  1D4M 2;  2VW1 A;  3AC0 A;  3LEM A;  4IEP A;  4B29 A;  3ZVX A;  1ZX5 A;  3D82 A;  3WNO A;  1O4Z A;  2HEY F;  3M2M A;  1XNC A;  3ACF A;  3DXT A;  1DQ5 A;  3PDQ A;  4HK8 A;  3AYD A;  3AP4 A;  2XDV A;  2XUM A;  4OUM A;  1VRH 3;  3MV0 1;  3CO2 A;  3FMG A;  5F7U A;  1KFU L;  3AMN A;  2VAU A;  4OHW A;  2JG9 C;  3LCP A;  4XFG A;  4N43 A;  4UFI A;  4N53 C;  3D4K A;  1DBN A;  1GNH A;  1MAC A;  4GKY A;  1JOP A;  4AVA A;  5FY5 A;  4COW A;  3T09 A;  5F9T A;  4GWJ A;  2RS3 2;  4LHK A;  1OQE A;  4N90 A;  5I91 A;  3EO6 A;  4E8D A;  4QHB A;  3NVC A;  2PHX A;  1V6N A;  3I4I A;  1HDK A;  3I49 A;  4NWV A;  3D0S A;  4NPM A;  4Q0V A;  5LEJ A;  3FHQ A;  3E6D A;  5I0S A;  5IK5 A;  3FHI B;  3N9Q A;  2E33 A;  4QDQ A;  1G9F A;  2R06 1;  3SKV A;  2J1T A;  3DF0 A;  1UU4 A;  2W92 A;  4UFL A;  4BXS V;  1O3T A;  3H42 B;  2BP6 A;  3PUS A;  5ABJ B;  2E53 A;  1XE0 A;  4P02 B;  4Q4X 3;  1YXW A;  2FCV A;  2OT7 A;  4QB2 A;  5T5L A;  1IS4 A;  3MIB A;  1W6P A;  5GLZ A;  3AKP A;  5C9A C;  1UOJ A;  3N7J A;  5I0U A;  1SCS A;  3LEI A;  3PLQ A;  1K3I A;  1UX6 A;  3RJR A;  2WAB A;  1MVQ A;  2YGM A;  2PHT A;  1SLB A;  3IAQ A;  4W4Z A;  1QJF A;  4BLI A;  3D0J A;  4IGO A;  4JKK A;  3BI3 A;  3LAG A;  2OW4 A;  3I8T A;  3T2O A;  3H8O A;  1RUN A;  4LOS A;  4XUQ A;  2ZGR A;  4KG0 A;  5FZH A;  2XWB B;  5JR2 A;  1UIK A;  2VY0 A;  4COY A;  3BPS A;  4EWA A;  3B9I A;  4B7K A;  3Q8A A;  1BMV 1;  4S2F A;  1RUI 2;  2RDR A;  1RUF 3;  2VUA A;  2XJU A;  3MLK A;  1G7Y A;  4ERO A;  2BFU S;  1LR5 A;  2XG3 A;  1Y7B A;  2ZXQ A;  4Y5S A;  3VD7 A;  4D6R A;  4XET A;  1F8V A;  3GHN A;  3K3N A;  4NRO A;  4FPF A;  4Y1Y A;  1TEI A;  4M0N A;  1XRU A;  3HT2 A;  2XLF A;  3Q9O A;  2YFU A;  2AEZ A;  1NLQ A;  1LRH A;  2PLV 2;  3K77 A;  1GZW A;  5FY8 A;  2ZS6 B;  3H1M A;  4K7J A;  4CPB D;  2D98 A;  4YVW C;  2BVV A;  2VG9 A;  5GZD A;  5A3U A;  1QXJ A;  2JDY A;  3DYP A;  2RS5 3;  1FPN 1;  3ZXA C;  4XDO A;  1DHK B;  1POV 3;  4YW3 A;  2ET1 A;  2HWB 1;  3BOP A;  2D6O X;  2RMU 1;  1G86 A;  4WM7 C;  2YB7 A;  1SHW B;  2MNG A;  5JMO A;  3SMH A;  3HWJ A;  5JIA A;  3ETQ A;  3U1X A;  2DUQ A;  2LRP A;  1LUL A;  4JGY A;  3ZYF A;  1Q8S A;  4GZ9 A;  1YQ2 A;  2E7A A;  2WNU C;  1DQ4 A;  1RVF 3;  2AEN A;  1AX2 A;  3JB4 C;  3ACG A;  1CAV A;  2LM3 A;  1GWK A;  4KMQ A;  4K21 A;  4QAW A;  3ZYB A;  4BQ3 A;  1LHU A;  1QH6 A;  4RYD A;  4YLZ A;  3ZSK A;  5JOY A;  2HYK A;  2PXJ A;  4CPB A;  3S6P A;  2WJS A;  2PYT A;  3WQ1 A;  1OKO A;  4EZ4 A;  5F1R A;  1RIR A;  1YYN A;  3JCI A;  2UWB A;  2XBO 2;  1WD4 A;  4I09 A;  2XJT A;  2OXB A;  3H1W A;  4L9B A;  3LIG A;  4R9A A;  1YWK A;  3AM2 A;  1NY7 2;  2ZEY A;  2ETE A;  1G6N A;  1ZNP A;  2DCT A;  5EPA A;  5SV5 A;  2BWC A;  2HWD 2;  1W9F A;  3B00 A;  5F3E A;  3MO4 A;  4JGZ A;  1AUY A;  1TME 2;  3NJY A;  3S7I A;  1GYK A;  2BRT A;  2BVB A;  1ND2 A;  3UYJ A;  2X5I C;  2D93 A;  5BNO C;  4P9L A;  5FLH A;  5A70 A;  2ZZQ A;  3ME2 A;  1F5J A;  2Q5T A;  4IEU A;  5D8A A;  1EUU A;  4IE4 A;  1HB3 A;  3GNE A;  1U5Z A;  2ZEW A;  4KNC A;  3ZPY A;  1PGL 1;  1FAY A;  5FJK A;  3AZZ A;  5JVV A;  3ZYH A;  3ZMO A;  1MS0 A;  4NMI A;  3VZO A;  4MAD A;  2A3W A;  4Q4V 3;  1LCL A;  2QUO A;  5EV7 A;  2ADD A;  4M3C A;  1RXG A;  5IYY A;  2JEM A;  2QQM A;  1H6Y A;  1UXX X;  1XXN A;  2ZX3 A;  4GWM A;  4IER A;  3ZX7 A;  1PZ7 A;  1WWY A;  2ZKL A;  2UU8 A;  4O65 A;  3NAP A;  1DLC A;  1GIC A;  3OPT A;  4J1W A;  4AGV A;  3BKZ A;  2VTX J;  4LUL A;  3KGL A;  1G8W A;  5JZG A;  5CG8 A;  5A7N A;  2D6P A;  4J1X A;  1HRV 1;  4CDW B;  1DIW A;  3OUI A;  2MEV 3;  4G9S B;  1UW8 A;  2ZGQ A;  3B3Q E;  3BU7 A;  1URX A;  4O7X A;  3RSJ A;  3VKL A;  1S0F A;  4AVT A;  4Z92 B;  2C26 A;  5KXC A;  4FBF A;  1CAX A;  1K45 A;  4MOA A;  1DGR A;  5CVR A;  1GZC A;  4PLN A;  3K48 A;  2ZX4 A;  1JYN A;  4CCE A;  3WDX A;  2QCS B;  2FDG A;  1DZR A;  1TMF 3;  4NR1 A;  5ANQ A;  3SKJ E;  1DGW X;  3IKW A;  3ZXD A;  3ALQ A;  2ZGS A;  1J1L A;  4Q0P A;  3MPB A;  2R07 1;  4WVM B;  3VBO C;  1JYX A;  2PHD A;  3WW2 A;  1H4G A;  1D4M 3;  4HLT A;  4TZD A;  5AFE A;  1UPI A;  1CN1 A;  2A6Y A;  1KS5 A;  2DFB A;  3UET A;  4FOV A;  3ZN6 A;  1SEF A;  2B5H A;  3IDA A;  4PIZ A;  3HPN A;  5F6L B;  3THP A;  2JEC A;  3RZG A;  4LOT A;  1ZBA 2;  4PBO A;  3VBF C;  1IOA A;  2JG8 A;  3VD5 A;  4AI8 A;  4DPN A;  4CEW B;  5KHI A;  4X6R B;  1H1I A;  2DUO A;  1PM4 A;  3HQX A;  4G4F A;  4RS5 B;  3RJ2 X;  3N4M A;  3I2D A;  1D0G A;  4AOC A;  4LLF A;  4UYB A;  3GGL A;  3DEM A;  4M4R A;  1CVN A;  3D5O A;  1Q8Q A;  2FZ1 A;  4FPC A;  4QWN A;  3HBZ A;  5E16 A;  1L3J A;  3RYR A;  4FPH A;  2LS6 A;  4YGE A;  4IW3 A;  4YZ4 A;  3PUA A;  4CU7 A;  4DUW A;  5FDB A;  5HI0 A;  2RS3 3;  1RHI 1;  2KD7 A;  4P14 A;  3J7L A;  3IAP A;  4GH4 B;  1LOG A;  5C4W B;  3GZA A;  3LA2 A;  2Y64 A;  3U78 A;  1O59 A;  2EAL A;  1UY0 A;  4R9C A;  4KH9 A;  2DVD A;  2ZGL A;  4TXW A;  4YW4 A;  5G04 L;  1LEN A;  1D2S A;  1SZB A;  2WL1 A;  4EN9 B;  1LEC A;  5DUU A;  5F3G A;  3ES1 A;  5JI7 A;  2FMY A;  1ULD A;  1QJY 1;  5TSW A;  4NAM A;  5A3O A;  4A3Z A;  3VLB B;  4PLM A;  4S2G A;  4EWE A;  2UY8 A;  5KBF A;  3DUI A;  1GQP A;  1QNW A;  2O8O A;  3MBW A;  2WKK A;  3RVH A;  4RQP C;  5EWS A;  5A1A A;  2EXI A;  4XIO A;  4EN7 B;  1E5R A;  1BXH A;  4R8H A;  1KFX L;  2E32 A;  4IV3 A;  2JDK A;  3VL8 A;  5ACA 2;  5ABJ A;  5A3M A;  3PTY A;  5C70 A;  1LU1 A;  2BUK A;  1LHO A;  2D6K A;  2GDF A;  1ZRR A;  4CCK A;  3BB6 A;  4AED B;  4AG4 A;  4QPY A;  5CEH A;  2JD9 A;  5LAS A;  3K4A A;  1SMV A;  3KV4 A;  1US2 A;  3VL9 A;  2OQ7 A;  4UBG A;  5J48 A;  2VOV A;  2H0B A;  1GP6 A;  2JDM A;  2EVX A;  1W8N A;  2WAO A;  3N9O A;  2GH2 A;  4Y1Z A;  4MGK E;  4KBB A;  5DUX A;  1GLH A;  2UY9 A;  3RZH A;  1RUI 3;  2A6Z A;  2A71 A;  3QAC A;  2AGS A;  5FY9 A;  4DEV A;  2WSV A;  5FO9 B;  1BVP 1;  2TNF A;  3LOI A;  2JX9 A;  1PZ8 A;  4Y1V A;  1PO1 1;  1XND A;  5EYX A;  5A6Z A;  2Y8K A;  2RV9 A;  1COV 1;  4Y4R A;  4I2O A;  4LE4 A;  4CEY A;  1QOO A;  1Y4W A;  3GAL A;  1JYW A;  2PLV 3;  3JB8 A;  5FWE A;  5JMC A;  4B8E A;  4BK4 A;  1GNZ A;  2A6X A;  3I2F A;  5L9V A;  1FOD 1;  3I3M A;  2VOT A;  3NQH A;  4MGI E;  5KXE A;  5IUQ A;  1CIY A;  4UOJ A;  2BW8 A;  1AR8 1;  3OUJ A;  5FXX A;  4HET A;  4IEQ A;  4ZZ8 A;  4IEO A;  5L36 A;  5CKQ A;  2LTN A;  2GP3 A;  1C1L A;  4HKW A;  3SCH A;  2VQA A;  2AZ5 A;  4CDX B;  5E1R A;  4RR3 C;  4JVA A;  2FZ2 A;  1H9W A;  4LE3 A;  2W87 A;  5FXV A;  2GH8 A;  4AE2 A;  2TBV A;  3POB A;  2HEV F;  3WSO A;  3VHN A;  3ZFF A;  2WLQ A;  2ADE A;  2KA3 A;  4QXB A;  5KC6 A;  2WQZ C;  1GWM A;  4XEZ A;  1QOS A;  4A7K A;  2E7Q A;  5K0U B;  1SLT A;  4Y4Y A;  1OF3 A;  2VMG A;  1AR6 1;  1OI6 A;  2X5I B;  3LB9 A;  1V6I A;  4N9I A;  1OFN A;  3MZH A;  4GJZ A;  1IS5 A;  2XBO 3;  2DBI A;  4BH9 A;  5CBL A;  2V4A A;  4LA2 A;  3THD A;  1LGN A;  1BMV 2;  4PI2 A;  2DWR A;  1WUV A;  1WLW A;  2HWD 3;  3NW4 A;  5A7Q A;  2HEW F;  2OKX A;  3VHR A;  1BK0 A;  1HW5 A;  2IXC A;  3CF6 E;  1TME 3;  4JHZ A;  3WQB A;  4XAB A;  1OUX A;  2YXS A;  2BPA 2;  1J3Q A;  3I3Q A;  1FNY A;  4N7I A;  1ENX A;  3PVN A;  4AQS A;  4Y5T A;  3WQ7 A;  2HLE A;  5FPL A;  4JGY C;  3P6B A;  1NCQ B;  5LWB A;  4C90 A;  3POJ A;  4NIA A;  3T1M A;  2P4E A;  2WNV B;  1FPN 2;  1PVX A;  2C6S A;  2A6W A;  3GXU A;  3VD9 A;  1NCR C;  1ZA7 A;  2HWB 2;  1RIN A;  4WV8 A;  3DYM A;  2R32 A;  3AMP A;  1DLL A;  5LB6 A;  5FXW A;  2D3R A;  4NHM A;  2RE9 A;  4UFM A;  1KD7 A;  3RS6 A;  2W1Q A;  2Z5W A;  3ZIX A;  1VBC 1;  3TEX A;  3UKV A;  3A21 A;  4HG6 B;  1PGW 1;  3AYA A;  2R04 2;  4RFR B;  2GNM A;  2WLP A;  4LBM A;  5CIS A;  1LAJ A;  4Y22 B;  4FP2 A;  4IEV A;  2ZBJ A;  4HBN A;  5C3P A;  5F2W A;  4FOW A;  4XC9 A;  5D8A C;  5GLT A;  1ZZ9 A;  2A3Y A;  4NE9 A;  2QNK A;  4OMD A;  1YRZ A;  2VZS A;  3T0B A;  3KT7 A;  3OYW A;  4NHY A;  3RYK A;  2B4K A;  1OUS A;  1I5Z A;  4TYS A;  4WVM A;  3ZFE B;  3OGR A;  2YFZ A;  3IN9 A;  3AXD A;  4QDR A;  3VGI A;  3NAP C;  4Q29 A;  2C5D A;  4XQ4 A;  4N53 A;  5FR3 A;  2BEO A;  4AR2 A;  5FY0 A;  3BOD A;  3EJK A;  1ZBA 3;  1KXG A;  3MI8 A;  2DCZ A;  3NNG A;  5ERL A;  1H0B A;  3HMY A;  4XW3 A;  5DAQ A;  5GJ6 A;  4LO4 B;  4AHX A;  1PGL 2;  2YPD A;  1DGR N;  1S0J A;  3VKF C;  2GNB A;  2VMC A;  5LW9 A;  4ZU5 A;  5LA2 A;  2R0H A;  4EZH A;  4CEW A;  3M3Q A;  4D8M A;  3E97 A;  1UU6 A;  5FMB A;  1PK6 C;  2VNV A;  3AMQ A;  1B09 A;  5FBZ A;  4ZS2 A;  4NII A;  3NL1 A;  3CBN A;  1W3V A;  1UY4 A;  3RZL A;  1WCK A;  1X8E A;  1QJX 1;  1W04 A;  1F15 A;  4GKX A;  1APN A;  3GM8 A;  1HRV 2;  1E5H A;  3WD5 A;  4MUV A;  4LO7 A;  4JDO A;  4K6B A;  2BFU L;  5F5I A;  3DGT A;  4GH4 A;  4OCT A;  1ULC A;  3BPZ A;  2VQU A;  5FLJ A;  5C4W A;  4AFA A;  3AJY A;  5C5T A;  3LQC A;  3IMN A;  1X9P A;  1ZYB A;  2CWM A;  2XJQ A;  4NUB A;  3HJR A;  3KS7 A;  5C9A A;  3LPG A;  1SPP B;  5FIX A;  3ZYP A;  4B1M A;  4BOW A;  3LDK A;  4YW6 A;  3VUO A;  1VAV A;  3EB7 A;  2WC2 A;  4XFF A;  4LBQ D;  3T2P A;  1AX1 A;  4XXP A;  5FPV A;  3PME A;  4Z2W A;  4KGG A;  3Q8F A; 
#chains in the Genus database with same CATH homology
 1V0A A;  4BQ2 A;  3UT0 A;  2C24 A;  4CPB A;  2WYF A;  1WMX A;  1OKO A;  1W8T A;  4LJH A;  4YWA A;  2Q1F A;  1WCU A;  1GWL A;  4CP9 A;  1W90 A;  1W8U A;  4CP9 B;  1W8W A;  3ORJ A;  1W8Z A;  5D21 A;  4LKF A;  3F95 A;  4LK7 A;  1W9F A;  2JWP A;  1GWM A;  2K46 A;  2O14 A;  2LRP A;  4BQ4 A;  4A6S A;  3ZYF A;  2KR2 A;  1OH3 A;  1UOJ A;  4LKE A;  1WZX A;  1HN0 A;  1L7L A;  4LK6 A;  4LKD A;  4YW6 A;  2LRO A;  2VXJ A;  1GWK A;  4AL9 A;  4BQ5 A;  3ZYB A;  4YW7 A;  4BQ3 A;  4CPB D;  3ZYH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...