1WMXA

Crystal structure of family 30 carbohydrate binding module
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
173
structure length
173
Chain Sequence
LLDVQIFKDSPVVGWSGSGMGELETIGDTLPVDTTVTYNGLPTLRLNVQTTVQSGWWISLLTLRGWNTHDLSQYVENGYLEFDIKGKEGGEDFVIGFRDKVYERVYGLEIDVTTVISNYVTVTTDWQHVKIPLRDLMKINNGFDPSSVTCLVFSKRYADPFTVWFSDIKITSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Family 30 Carbohydrate Binding Module
rcsb
source organism Clostridium thermocellum
molecule tags Sugar binding protein
molecule keywords COG3291: FOG: PKD repeat
total genus 34
structure length 173
sequence length 173
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-07-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.430 Mainly Beta Sandwich Jelly Rolls Galactose-binding lectin 1wmxA00
1GWKA 1GWMA 3ZYBA 1UOJA 1W9FA 2LROA 3ZYFA 4LJHA 4YW7A 2Q1FA 2WYFA 2VXJA 1L7LA 1W8UA 2KR2A 4YWAA 4BQ5A 4BQ2A 3F95A 4LKEA 4YW6A 4A6SA 1WZXA 3ZYHA 4AL9A 1W90A 2K46A 2JWPA 2O14A 4LK7A 4LKFA 1OKOA 2LRPA 3UT0A 1GWLA 1WMXA 1OH3A 4CP9A 1W8WA 4CPBA 4CPBD 4LKDA 1WCUA 5D21A 4BQ3A 2C24A 1W8TA 4LK6A 1V0AA 3ORJA 1W8ZA 4CP9B 4BQ4A 1HN0A
chains in the Genus database with same CATH superfamily
1APNA 4XTPA 5JZGA 4OULA 2JE9A 1R64A 1RINA 3EQEA 1RB8G 4QPGC 5F3IA 4JTNA 4L9BA 5IT6A 1RUF3 2MHFA 3K4AA 1FV3A 1HRV1 2LUWA 1CESA 1ND3B 5KXEA 3H7JA 3WNOA 1ZRCA 1PK6B 4ITCA 2QTWB 1YRZA 4EZHA 3N9MA 2Y8KA 1FPN1 2IXJA 4NIIA 3SITA 2H0VA 4BU2A 4LBJA 4IUGA 4J1XA 3WNKA 1GQPA 4K9SA 1C3HA 4LKSA 3O0WA 1POQA 1HQLA 2CGOA 1URXA 2JE8A 5D1IA 3TN91 3OPWA 1PM7A 5FK7A 2VW2A 1PGL1 2WQ4A 2A3XA 3EBRA 2R30A 1Y4WA 2Q1ZB 5F5QA 3O1UA 2IXLA 4RGAA 5I0SA 4Q4Y2 4LXLA 4GWNA 3QD6A 4BA6A 4XAEA 1UO9A 3MFAA 2HLEA 3ZSEA 5ACA3 1CIYA 1IHMA 1ZX5A 3RFRA 2X10A 2Z2SB 3AFGA 4OCTA 4RS5B 1R082 2IZWA 3KHBA 5DMYA 2LM3A 4IEXA 3U14A 2W47A 3Q9OA 3WG4A 3ZXFA 2WZR1 4CA9A 4ZU7A 5H9QA 5F3CA 4RQPB 2W2IA 2Z79A 4RD7A 3RVHA 1N1SA 4OHWA 1Z0HA 4DEQA 4LBNA 4CU9A 4FPEA 1UYZA 4C91A 1RUC3 5KC5A 4UXAA 5HI0A 3GXUA 3WW4A 2OVUA 5KHIA 2P4EA 5AVPA 2GMEA 4FTSA 2OW4A 5IFPA 2R6QA 1WA6X 5A3UA 5C5TA 5IHRA 3BKZA 2Y6HA 4HXCA 2PHDA 1HRI3 4Y1YA 1L7LA 1UXZA 1SFNA 2EXHA 3NKTA 3LAGA 5EXOA 4YVWA 3WSOA 2FHRA 3ZXKA 1CJPA 1SLCA 5FY8A 4PDWC 2WBKA 1AYN3 4PDWA 2WL1A 3OPTA 1ZA7A 3ZPOA 2VBBA 3LIGA 5JMOA 1J84A 1C57A 1RUD1 3BIWE 3N9NA 1NOVA 5LZ6A 3N7MA 1NA1A 2QQJA 3K4DA 5A6ZA 1A8DA 2BV4A 3M3OA 4N90A 5BY5A 4XHBA 5JR7B 2CU5A 2VXRA 1NG0A 4CEWA 5CU1A 2ORZA 4V1PA 4C1WA 1ASJ2 3VBOA 3OUIA 5FZOA 1W39A 4Y24A 2R7EB 1W9FA 4NPMA 5F5IA 1W99A 1GQGA 3DF0A 3FZ3A 2D6KA 3MLKA 4I2OA 4YYOA 4FP2A 1S0FA 1NCRC 3WQ0A 5L7OC 2WZR2 4UW3A 4WV8A 1IZ3A 5GM0A 3ZYIB 1YQCA 2CDOA 3LA7A 1UYXA 1FPN2 3FLTA 3OSDA 2WNUC 4M0NA 5CG9A 4EN8B 4MV2A 3MIFA 2QQOA 3ZXDA 2RR11 4DY3A 3LSEA 2E26A 2UURA 1W04A 3M3QA 1J3QA 3ZMOA 1H9WA 2K0GA 2RVAA 4LORA 3UK9A 2HBUA 4MGKE 4AW7A 1HXS2 2WZPP 2ET7A 1O3SA 2ZX0A 1V6KA 4NWWA 4RHV3 5FXWA 3ZKYA 4DFSA 1MVEA 2BJSA 3VD7A 5IJRA 2ZX4A 2GAUA 1W3XA 3WY6A 4AI3A 4WVZA 1W6OA 1RIRA 3LA3A 4NIGA 1ZYBA 1OLMA 3U75A 3GGLA 4YFZA 4Y5SA 1CQ9A 4IL7A 1HB2A 2YHJA 3POFA 5FIXA 2TNFA 3S57A 4UW6A 4C0BA 5LBBA 1EV11 4HFSA 1SFYA 1LOFA 1QJZA 2R041 4P02B 3CJXA 4LO5B 3X29B 2IC1A 2AH2A 3BODA 2WNEA 3T4HB 2VD7A 4MXWA 2PA7A 5E89A 4FPJA 1VJ2A 3J9SA 4WM8A 2G9GA 3CLPA 4R9CA 5D8AB 4E4ZA 1V6IA 4Q0VA 1W6PA 1JHJA 3I2HA 4FOYA 3O1TA 4FTEA 2VW0A 5BNPA 1TQ5A 1XNCA 1YI9A 2P3KA 4INDA 2NP0A 2RJ2A 1PVC3 2YFUA 3SC7X 5JMCA 1E57A 5JOYA 5C8CB 1D2SA 3H42B 4QQHA 4CVUA 4ISQA 3VDBA 1LHNA 3O1RA 4YVSC 1EAH2 5I8SA 5LY1A 3FBYA 3VKLA 2PHUA 2O14A 2VMHA 2OKXA 3T3YA 1OKOA 3ON7A 1COV3 1BEV3 2ZMLA 1N47A 4QX5A 4K7JA 4B1MA 1A78A 4GQ7A 3IAQA 4LTAA 1D4M2 5HBAA 1X8MA 2J1TA 3AMNA 4RA0A 1AVBA 1QXRA 2VECA 4ZU5A 4ORFA 3WLUA 3ZYBA 3DXTA 1ZVFA 2RMU2 5J98B 1YFWA 4QX3A 4PHZA 5C8CA 4QPGA 2RM21 5FPBA 3FJSA 4LKEA 3RZJA 3GZEA 3AP6A 1DZQA 3DYPA 1QY4A 2C26A 4GIQA 4M3CA 1UW8A 5L9RA 2PAMA 2E51A 1OH3A 5L36A 3L2HA 3V65A 1RXFA 1PVXA 4Y22A 5JAXA 4MSVA 4Q1PA 4TYSA 2FCTA 3PJYA 1ENQA 3IKWA 1N3QA 1LESA 2I2SA 4K8FA 2K9ZA 1WD3A 4XMIA 1H2NA 4HN1A 2YU1A 4DZGA 2D5HA 5EJ1B 1NCQA 2XVLA 1ZZ9A 4FOQA 5EV7A 4YNIA 4QGMA 4XZPA 4ZS3A 3W58A 1FMD1 3ZFEB 4COWA 3MDPA 2BQPA 1AYN1 4LA3A 1UL9A 2W68A 3B5LB 3P1IA 2JENA 3TNQA 4QPIA 1OBNA 4DXTA 3FUQA 1UZZA 3GJAA 5FZEA 2ZGLA 2PELA 5BNNB 1ULDA 1PX3A 4G4FA 3GBFA 3MV11 1R1A3 1GWLA 2XJSA 3H3UA 3N7JA 4UFIA 4CDUA 1DZRA 2BBAA 2HWD2 3INAA 4AXOA 4Y20A 1DQ4A 1JZ3A 3VBHB 3FE5A 3H1YA 4XBQA 3T2QA 4YZ4A 4AQTA 4JHTA 2QQLA 4I3PA 5EIYB 3KM5A 1HV0A 1LOEA 1JUHA 2E7QA 1I6XA 4B7EA 3POBA 3RNSA 4XILA 2VR4A 4XJAA 5SV8A 4DS0A 5C3QA 1GNZA 3N9PA 5C71A 3B94A 4R9AA 3OY8B 4D3WA 5C33A 1H1IA 4HPKA 3KV9A 2YPDA 3NV1A 5BNOA 1PMJX 4J25A 1UMHA 5LASA 5JSOA 4G3YC 1EP0A 3T09A 4JKLA 2RR13 4XZUG 2UWBA 4XFBA 4Q26A 5IVCA 1KEXA 4D0QA 1RUD2 1AR71 2VU9A 3D4KA 4YG0A 4M4RA 5CFDA 2BOJA 1ZZ7A 2GP5A 3ZN6A 4FQZA 4PT6A 1S0BA 3ILFA 4KI5M 3USSA 2WFF2 2W5FA 2WNOA 1UAIA 2K2SA 5DDJ1 4IEZA 1F15A 1K5MC 2FDGA 3DN7A 3MW4A 3VZJA 1WCQA 1EV13 5FZAA 1QJEA 2Q0AA 1ENRA 4MUVA 4FOWA 3VBRA 1I5PA 1YWKA 5FYIA 1W9TA 1OFSA 1DYPA 1BQPA 5GLTA 2HWD1 4DINB 5KHGA 4AHXA 1VBD1 3LFIA 1NCRB 3VD9A 4MADA 3AM2A 4OI1A 2FMYA 2ZGOA 4HANA 4IQPA 3QCWA 4RFRB 5JZGB 5A32B 4BM8A 1GNYA 2VCMA 2XL7A 2VQ0A 3OF1A 5LBCA 5HCHA 3AZYA 1RUI2 1RUG3 1OUXA 3VHPA 4Q0SA 2RJKA 2VUCA 3OTFA 5FYCA 4UBHA 4ZZ8A 1PVC1 4JRAA 4NWVA 1XE8A 1RJ8A 4JZRA 2XBO3 2PHXA 3MLJA 3HVDA 4BMEA 4UW5A 2RMU1 4Q4W2 3VBRC 1PM4A 1U0AA 3WG1A 3ZYGA 4JC1A 2B7YA 1CAVA 1DFQA 2VBPA 3H8XA 2V5YA 3SKJE 1BEV1 2D6MA 2VNOA 4M00A 2WNUB 3OUJA 1S0GA 4QHOA 1V6MA 5H9SA 3R6SA 3T2PA 5E1RA 4XC9A 5LEJA 1R1A2 1F4AA 2W39A 2A7AA 3DXUA 4PIZA 4EWAA 1PMIA 1BBT1 2YUEA 2XJUA 3LFMA 4H55A 3LDBA 1TME2 1HX6A 5K8SA 5E16A 1AXKA 4BIFA 4D7TA 2VNGA 4Q8KA 2ZKNA 2XQXA 3HWJA 2GN3A 2RDSA 2RM23 4KGGA 2QQVA 4KQ7A 4Q5OA 5A1AA 3UKNA 5A7PA 4DY5A 5IK7A 4LHKA 3USUB 4XF0A 2WFPA 1X9PA 5GZGA 4DIQA 1MVQA 5FXVA 2WC2A 1VB4A 1YJKA 4I02A 1N3PA 2D6OX 1YQ6A 4QGNA 1UNBA 4XIKA 4XURA 5LK5A 1OQ1A 4AG4A 4YGDA 3F2ZA 1S2EA 4B4PA 4HETA 1ND2C 5FO7B 3POJA 3BPSA 2XWBB 4CDUB 1AXZA 3D0SA 1VMJA 4HONA 1HLCA 3PHMA 2A6WA 4Q2FA 3I97A 2VZ1A 1QDCA 1JH5A 1SHWB 2GNMA 4O7XA 4GULA 5CIRA 1IGOA 1QXPA 3I3QA 1CZVA 2R16A 4LHNA 2JB8A 1FMD3 1XYNA 2BP6A 4MGQA 4XQDA 4CRQA 3NWKA 1DDLA 1O59A 2X05A 4E8CA 3E6CC 3PLQA 2X8KA 4QXBA 1IKPA 2YBPA 1GOFA 1LHUA 1Y7BA 3RMXA 2A6YA 4DUXA 4XBNA 4Q1RA 1R1A1 1Z7S1 2C5DA 4IGQA 1W8WA 1RXGA 3VDDC 3MPPG 2BWCA 3AYEA 1W8TA 1NQDA 3C8XA 3V0AA 3NNFA 4ASMB 1HN0A 2WO7A 1T2XA 5JI9A 5BXXA 3RZZA 3KHCA 2WT2A 2ZTNA 2ZOEB 5DAPA 3E5UA 3ZLIA 1DQ2A 2RE9A 1ND2B 4XAAA 2FDHA 3WDWA 1K45A 5GZEA 1H2KA 1JODA 2XUEA 3M70A 3BVCA 3KF5A 4JGZA 4BWOA 5JXIA 4NIDA 1BMV1 1EPZA 1OD3A 1J1LA 2DFCA 5T55A 3HR9A 2HWF1 4JV4A 2ORXA 2ZEXA 1TG7A 3APBA 3B9IA 2ADDA 3RPQA 3O7OA 5G05L 3I2OA 2PHRA 1RUE1 3VDCA 1GP5A 4CP0A 1AR73 1UCXA 4JGYB 1V0AA 4GWJA 3AKQA 3GCXA 1I5ZA 4LOTA 1WW5A 1Q8OA 2OPKA 3BN6A 3IN9A 1UU6A 4CYDA 4E8DA 4TXWA 2JDKA 2W52A 4OQ9A 5L73A 3WF3A 4CCCA 2C4XA 3TYJA 3W9AA 5C6CA 2RDNA 1BVVA 2QCSB 2ZXQA 5A32A 3PUHA 4Y22B 5FOBB 3I3MA 3GALA 3ATGA 4UWDA 3VKMA 1S0CA 4N9IA 1W2NA 4AVBA 1QOOA 2R1BA 4A3XA 1KD7A 4Y26A 2HWD3 4Z82A 1LCLA 4W65A 2ZGTA 1W6PB 4PI0A 1BZWA 1U5YA 5K4LA 3PU3A 3VHOA 2VZTA 4AFBA 4CUBA 3N4MA 2DDUA 4XUPA 1CAWB 5A3LA 2WS92 3P5BA 2Q5TA 5F3GA 2ZAHA 1C28A 3D5OA 3ZIWA 5EP9A 2VO5A 3V0BA 1AX2A 1XNTA 2WFF1 2KR2A 1H6XA 4B29A 4FVVA 4EN9B 4XYXA 1R081 2WO2A 5LY2A 1B35C 1BLZA 1O8PA 2O8OA 3K46A 1KGYA 1H2LA 2YPJA 2AGSA 2DWRA 2BEOA 2NM1A 3KVAA 4XPVA 3NV3A 4L0PA 3O1PA 4XACA 4FP3A 3JUUA 4P9YA 1JN2P 3OUHA 3WNPA 4FTBA 2ZEZA 1YUDA 2TUNA 3T1MA 2WDBA 5ABJA 2VMEA 3O1OA 5I0TA 5BNOB 3R05A 3AP9A 4D6SA 5F32A 1WW6A 4CXXA 4O65A 3PU8A 1PGSA 1BBT3 2CHHA 3AKRA 4NHYA 3WW1A 1XU2A 3ACFA 4KG0A 4EZ4A 1PHMA 4EROA 3BTXA 1WCSA 2ZHKA 2JX9A 4BQ5A 5FYMA 1CZTA 1NE6A 3NNGA 3AP4A 1PIV1 2W08A 4KWLA 1UZVA 1F5JA 5K7PA 5LBFA 1VBE2 1WUVA 4LIUA 1NT0A 4AWDA 3E5QA 4UW4A 4YGCA 4LBLA 4I3GA 3J26N 4FPGA 4UI9L 5FZFA 4XXPA 3AC0A 1F35A 5A7SA 3TEYA 4MHUA 3IAPA 4N53C 4XIOA 2BRTA 2WRAA 1COV2 3POGA 3S6PA 3VHRA 4HL0A 3MZHA 3TEWA 3D8CA 1AX1A 1XNKA 3ZN4A 3CJIB 2DU0A 2FCUA 4GB32 2J22A 1EAH1 4W6YA 1ODNA 1BXHA 3WEZA 5KXBA 3F95A 4LMFA 2W1QA 1QOSA 2X29A 3PUAA 1NXD1 2QE3A 4HN0A 5HPOA 1XU1A 1UZWA 3VZOA 5GZCA 4HMZA 3AXEA 2WO1A 3DEMA 3FLRA 2UY9A 1O7FA 4OMCA 1IS3A 2JIJA 1Z7S3 2CGPA 4IERA 5LA1A 1LENA 5CYYA 3WP4A 3PUIA 4FPKA 4OUMA 1BMV2 4B1LA 4Q4X2 3BYWA 3KGLA 4JGZB 1Y3TA 4NR1A 5KXDA 5C3RA 1YIFA 5FZ8A 4BMBA 2WAAA 4XHXA 5FLHA 4MXVA 4LO6B 1GWMA 4XE9A 1SG3A 1W8NA 2GN7A 3VD3A 4JGYA 1HQWA 3P3PA 3VBSC 3U0ZA 2G1MA 2ILMA 1W6MA 2VAUA 3HBKA 3NNJA 4DEVA 2ZCWA 3RI8A 4RSUA 3ECQA 2GMPA 4D6RA 1MZ5A 4ASKA 3KT1A 2WNVA 4EJRA 1RUJ3 2D43A 2F17A 5FLJA 2Y6LA 3ZYPA 1AL21 2DVFA 4HBNA 1OOPC 4ZONA 1Y9GA 1J83A 1I1EA 4F7ZA 2KA3A 1YO8A 3K2OA 5HXMA 1RUE3 2VZSA 3VD5A 4Q8LA 2B42B 1S0DA 4QD2A 4Y1UA 4BQ4A 1A3KA 5DUUA 5FV3A 4GWIA 1BVP1 2RR12 4P9XA 4QDSA 4MLOA 3UKTA 3J4UH 1HJGA 5FRAA 3ZYJB 1G9BA 1Q8SA 3VBOB 1ZNPA 2B39A 3H9AA 2D3SA 4XCAA 4AEJA 4RN5A 3ETPA 1SLLA 4BH9A 1T6GC 1JBCA 4HLTA 2V09A 3ILRA 2XDVA 3NNMA 1V9U1 4PIYA 2ES3A 5C4WC 1OQEA 1PZ7A 1X50A 3WF0A 3WQBA 3ZSMA 3LPGA 4B7KA 1HDKA 2OZ6A 3CEWA 5FZKA 2VZVA 2WWJA 5C8CC 4IGPA 4Y33A 1OI6A 2WQ8A 2XLFA 3SH5A 3M4FA 3I2IA 2VOWA 2YGMA 1PIV2 4BQ1A 4CCOA 1VBC2 2XJTA 3HN1A 5FY0A 1DU3D 1GZ9A 2VL4A 4X8NA 3PMEA 4BDVB 4CDWA 1YI7A 1QOTA 3N7LA 4NIAA 2WFF3 1C8M2 1I3HA 4YG6A 3ZFGA 5DDJ2 2FDIA 2JECA 2CAUA 1XE0A 1GR3A 2A6XA 3ZYHA 1VRBA 5FPXA 2DVGA 2K46A 2JDPA 4Z1VA 1XQNA 1NYWA 4LO8A 4NAOA 4WVWA 3RZKA 2Q1MA 1OMIA 2RS13 3NW4A 4ZS2A 1UD1A 3A22A 4AI0A 2L9LA 2C0ZA 1MACA 1VBD3 4ZY9A 4NRPA 3FHIB 1JYWA 4YZ2A 3GZTB 1GKBA 4A42A 3U1XA 4NHLA 3WHUA 3GNEA 3BTZA 3O1MA 3Q8BA 5T5LA 1RUG1 2P6CA 1S0EA 3EXUA 3ZSLA 3MBWA 3HMYA 2H6BA 2WYFA 4Y20B 5FFOC 3AYAA 1KXGA 3J8F1 2QQMA 1PO22 3M1HA 3NJVA 5DXDA 2EXIA 1VBD2 3K75B 1NLSA 1UYYA 1S0IA 3NSTA 5BNNA 2RMU3 3H8UA 1LB2A 3WDXA 4XFFA 2Y0IA 4LBQB 5DQ0A 5A7NA 3POIA 1GU3A 3RI9A 4FPCA 1FV2A 1NCQB 5K0UC 1AYM2 1B35B 2WJSA 4QPYA 5FR3A 2P5BA 4JX0A 3LDRA 2H0BA 5I8TA 1PO13 2OUHA 5IAXA 2VOKA 4LT5A 1UIJA 3DCQA 4QXCA 4BK5A 1EAH3 2Q1FA 1ZA4A 2VW1A 3PVOA 4BK4A 1H0BA 4Z07A 1VALA 2Y6JA 2UWCA 4A6SA 4CDXB 4CU7A 3T2OA 1H4HA 3ZSKA 1CX1A 3VZNA 1FI2A 5C3OA 4XCBA 5CBLA 3L9JT 5L19A 5F3EA 2XVGA 1QQP2 1GYKA 4UF0B 4GJZA 3I2JA 1HV1A 5K9YA 2B46X 4XFHA 1G86A 3WF2A 4AGVA 1IS6A 1JS9A 4W4ZA 3SMHA 4CTEA 4OUSA 1XXNA 1VLNA 2B45X 3HQUA 3P3NA 3UESA 2EAKA 4M3CE 1ZBE1 1H2MA 1CAUB 2VZQA 5KC6A 3I59A 3NJZA 1VBA3 2B9UA 4AVCA 2PN5A 5EZWA 3WF4A 3VBSA 1F4HA 4DRRA 2W3JA 1SBEA 4CEYB 4OHVA 1ZZ8A 4OI2A 5JSRA 2P1BA 2VVFA 2JEMA 1PNGA 5FBJA 1W06A 2ARAA 3VBFC 5IVBA 1H1MA 1UOGA 5F9TA 1V00A 3KCCA 1UMIA 3I8TA 5A3WA 3GZUC 2FZ2A 4GZ9A 4Q4V1 4QPIB 1FOD3 1UU5A 1V6OA 1OA4A 2XLGA 3WOGA 3NO8A 2LTNA 2BUKA 1GANA 5FZHA 4BYYA 2W1WA 2Y6KA 3ZSJA 2BNMA 4XJ9A 2SBAA 2BGOA 2FDJA 5FUPA 5B4XA 5FOJB 3OB8A 1OF3A 3PMSA 4QHBA 5J48A 5F5AA 5GLVA 5FTTC 5JR2A 3N9QA 2VTXJ 1DG6A 2R042 3K4ZA 5KHHA 4CDXA 1ENSA 2A3WA 4IEQA 3WW3A 4QB2A 3OOXA 2YBSA 1WWYA 1WCKA 2B4KA 3WW2A 5DAVA 5JLVA 5JOZA 1S2KA 1VRH1 1B09A 1W2TA 2VJXA 3E5XA 4N53B 3E97A 2GALA 3VKNA 3MIGA 2HWF3 4LKFA 3NV4A 5IK4A 4AQ6A 1JYNA 2JKXA 1AL0G 3VBFB 3N9LA 1TZOA 3IDEA 4M01A 5IYYA 3HOBA 2C9AA 4KWKA 2X5IA 1QMJA 1HW5A 4OHXA 4QQ2A 2NLRA 2PXJA 4MGIE 4AI2A 4NHXA 1FNYA 1SDDB 2GC3A 2VCAA 3U11A 5CKMA 1QGLA 2O0OA 1JUIA 1UYPA 3ACHA 2GU9A 3UGHA 2BFUS 4NN0A 3HNYM 2ZGUA 3CZJA 1YLLA 1UWWA 4XOGA 5A7QA 3J7HA 1IPJA 1D0HA 3USUA 4JDNA 1TMF1 2VC9A 3ZXGA 4FCAA 4D69A 3VBHC 4CEYA 2ZGNA 3VUOA 2CNAA 4Q4V2 3FL7A 5IK5A 3MW2A 3CJIC 2R0HA 2YZ4A 3GM8A 3LWCA 4Z2AA 2HBTA 3EB7A 2RS11 1OKQA 2PTMA 1RJ7A 4PBPA 4CCEA 3H8OA 3FN9A 5T5OA 4CP9A 3CU7A 3BCWA 2ARCA 4XUOA 3KMHA 2Y38A 5A70A 5IATA 4ZXKA 3HBZA 5T3NA 2ZHLA 4R8HA 4Y3OA 2XKPA 3A7QA 5C3SA 2ZX3A 4KH9A 3H50A 1MQTC 4RR3A 3POWA 1MS4A 2A70A 1DGWA 5LRSA 4FPLA 5JVVA 4LJHA 4EN6B 5FO8B 4N43B 3AKSA 1MS0A 1UKRA 3J8F3 4P9WA 1LRHA 4A44A 1R083 1VP6A 4GXLA 3UV9A 2VH9A 2MPFA 2TEPA 4PLOA 1W03A 1KITA 3IWZA 5CVRA 4IXLA 2J1VA 1PGW1 4Q29A 1W0OA 3LF7A 2RS51 1ZRIA 4LITA 1WMXA 5JIUA 3BIEA 4XQWA 3WX5A 1F2NA 2GDFA 2PHWA 1VBB3 3MICA 5EQUA 4A7YA 4EE2A 4QGLA 5A7WB 1ZZ6A 4ISRA 5C8WA 5BNOC 5I93A 5FKCA 4JQTA 3R4SA 5AC92 3VL8A 1OHFA 1PO11 1FYUA 1QXJA 3I3EA 3MO4A 4OUEA 4Z92B 1U12A 2WNVC 2AC1A 2QZ2A 3U07A 5LWBA 4B8EA 1FXZA 2P3IA 2WLQA 1PIV3 4MXWB 1W9SA 1SBFA 4WM7B 2UYAA 2G9ZA 1K12A 1SPPB 1GP6A 2PYTA 4IGOA 2Z4FA 4E4SA 4QWNA 2ZABA 3A0KA 4IE5A 3VBUA 1GOHA 5TSWA 1UKGA 5EYXA 2YC4A 1POV0 2NMOA 2WT0A 3MPBA 1WW7A 3U4XA 1NZCA 2JG9C 1OUSA 4XF1A 2G4IA 3PNAA 1S1AA 2VTXA 3M2MA 1F5FA 4YARA 2QDRA 2D97A 1U5XA 1ZBE3 3RZLA 4N43A 1BKZA 4CP1A 1VBA1 1LTEA 4K1YA 1O4TA 1ONAA 1A34A 3NMBA 4XUNA 4HT1T 1XNDA 2YU2A 3DL3A 4DUVA 2DTWA 3A4UA 5GZFA 2WR9A 5FUNA 2XJQA 2JWPA 2OA2A 4S2HA 2A1XA 1QNWA 5BNNC 3KLSA 4E2QA 1SDWA 1JU4A 3ZM8A 5IK8A 4Q4V3 3GF6A 1D2QA 3AMPA 4UYBA 5A33A 4HKLA 4M3CF 2YXSA 3FBMA 1AR62 4O9GA 5FZCA 4N53A 1X9TA 2JDZA 5FYBA 4MHRA 1NLQA 2VBDA 1TMF2 3WZ1A 4MOAA 1YXWA 2EIGA 2EVXA 2QBXA 4H7LA 4QX7A 5A6YA 3ZYFA 4TSVA 4LLOA 3K48A 3ZVXA 4LOSA 5FYSA 1QIQA 1PK6C 1YIPA 4FFFA 1E5SA 2JDUA 2HWE2 5C7GA 1REEA 1F9KA 2FZ1A 3H1WA 3H8RA 1RUJ1 1VRH3 2VCBA 4B3NA 1AL23 3CMGA 4U36A 2VOVA 2F6BA 3THTA 4BLIA 2NYYA 4OZXA 1P8JA 1ZRFA 4BXSV 3J7LA 3WT3A 2XGXA 1W9WA 1LEMA 5HV4A 5LEKA 1GOGA 3AL6A 4GKXA 4YW2A 4CSWA 5FPUA 4UBGA 3KD4A 4HVOA 1J3PA 1RITA 4L11A 4LHSA 3D0JA 1NY72 3KV6A 5J96B 1PGW2 1TNRA 1V70A 2XVKA 1EV12 1X8EA 5AFBA 5BNQA 3WR0A 3K3OA 4V2VA 3LEGA 1TMF3 4RR3B 2XPJA 4NPLA 3WQ7A 3T0BA 4AFAA 4AHYA 1C1LA 3ROUA 3ZR5A 4IE6A 1V9U3 2BW8A 4I0AA 2A5ZA 1DQ0A 5T50A 4YSFA 1JXNA 2VTFA 2VVDA 2PHLA 5FJKA 5JIAA 1C8M3 3OG2A 4CCLA 1QKQA 3THPA 5ISLA 5HXVA 1LKNA 1GQHA 2ZGRA 1MS5A 2ZBJA 2ETEA 2KM2A 2WA4A 1W3VA 5K0UB 1XRUA 1CPMA 2AYHA 2R1DA 2VUAA 4QB6A 2YY1A 2JD9A 3SISA 4AE2A 3VDAA 1UXXX 2VE1A 4CDWB 1OVPA 1UPIA 3WXPA 3KQ4B 5F6KA 5A1LA 3TEZA 3B93A 3LE0A 4J1WA 4AFDA 3W21A 5LA2A 1GUIA 5EPAA 4FO9A 3S5AA 2VULA 2VMCA 3IPVB 4PDWB 1IQDC 1X33A 2R062 3WG3A 5JDBA 3KT4A 5FWJA 2JDNA 3R0RA 3O0VA 1ZRRA 4FFIA 2RS53 4H14A 4M4PA 4JHZA 1PK6A 1QQP1 3K51A 4LBQA 1PNFA 1VBB1 1ND3C 2KXLA 2MEV3 1DHKB 2Q30A 4QDRA 1SCSA 3PUQA 3WP5A 1C4RA 2A3YA 4GH4C 3RDIA 5T54A 3MUY1 1GMMA 5FP9A 4A7KA 4YZ1A 2WYSA 5I0DA 1RUOA 1RTVA 2BVBA 1SEFA 3IIIA 4HG6B 5FUIA 3A21A 3O1VA 4QPIC 4UOJA 1X7NA 1OPMA 1RGSA 4D8MA 2PLV2 4F8AA 5FZ6A 4COVA 5EJ3A 1W8HA 4LULA 3WP6A 1KRIA 1GZTA 3W5NA 1O91A 2ZGKA 4FPOB 1EYBA 3LKJA 2HH9A 3N3HA 3EYPA 1RUH1 4QPGB 1QH6A 3IMMA 5LA0A 3NNLA 4K40A 5FP4A 3NJYA 4D94A 2PFWA 4RGGA 2CL2A 2ET1A 3SCHA 4EV0A 5LRRA 5ABJB 1K5JA 4AF9A 3BPZA 1PVC2 3Q8EA 1N1YA 4N43C 3EMRA 4CU8A 1LHOA 3OD0A 2W0XA 4IEUA 3CKHA 4KG8A 3TOJA 4XJ8A 5CISA 1AR61 3LQCA 4Q4X3 3R4UA 1S0JA 1QHDA 2E7AA 4IE7A 5K0UA 2F4LA 1ASJ1 2FBEA 3Q8AA 3HIFA 1TVGA 1JI6A 1IQAA 4LQRA 4NRQA 1MQTA 4RR3C 4GJYA 4XFAA 2VZPA 5FMDA 1VB2A 4FAHA 2EIDA 3T30A 4W50A 2OUJA 4WZCA 3THCA 1NQJA 4FFGA 4R9DA 5I8YA 4AHZA 3SCFA 2HYKA 3HPNA 3GBGA 3WG2A 4AGRA 3IDAA 3K3NA 4UFJA 3VZMA 1QWRA 1CWPA 5KHJA 3MUZ1 5LA9A 2VMDA 2ZS6B 1POV1 2D6LX 3AFKA 2VMIA 4RGKA 1C5IA 5CNAA 3ZFGB 3VBHA 1QJU1 1TE1B 1FOD2 3KS7A 4KWJA 2HEYF 4XFIA 5FJHA 4YM1A 1ALYA 5IFTA 4CCMA 1DGRA 2UWAA 2SLIA 2GH2A 1YQ2A 5FZ9A 3PIJA 2DVDA 4YVWB 4LO4B 2AENA 2D6PA 1K5MB 1KDMA 2D93A 4NPRA 4DQAA 5BNPC 2V4VA 3U78A 2R32A 2YDEA 3HD8B 1FOD1 1OLME 1XNBA 4HZFA 4P9IA 4CCKA 4Y4RA 3HN3A 5T52A 1AZDA 3ZFGC 1O8SA 4OHZA 1UU4A 1TEIA 5DPNA 3QH6A 2WZ8A 1UZ0A 3VB9A 5DABA 2BZDA 3QACA 1W2OA 1R092 1QH7A 1SLIA 1K42A 3OJBA 2B8MA 3B02A 3RWKX 4HKOA 3S7IA 3ZIXA 3FMGA 5EYYA 2R071 2DBIA 1VAMA 4CUCA 3ETQA 1WGPA 3ZX7A 4XETA 3FFZA 4BQ2A 4ZU4A 4N8MA 4YW6A 4O9EA 1WZXA 3BU7A 4NJ4A 5LATA 5I0RA 5JZGC 3T08A 3J8F2 1MS3A 1IPKA 2DV9A 2ZACA 3JBG1 2B9VA 2ZMKA 1C8M1 1OPOA 3AKPA 4FFHA 5M0TA 4LLFA 3SH4A 1M4WA 1AYN2 5FZ0A 2AUYA 4CPBD 3JQXA 4WM8C 4KL1A 4A4AA 1WMDA 1XSRA 2Z42A 4GALA 1GNHA 4XF3A 2QVSB 3AJZA 5DUXA 5C9AC 3UL2A 1LODA 1GZWB 3WDVA 3ABZA 1MZEA 4URAA 1Q8VA 1IS5A 1UOFA 3RJRA 4HOOA 2VNVA 4HVRA 1LEDA 4FPHA 4X6QB 2W91A 1K5MA 2WSUA 3VZKA 2JB4A 3TB0A 4GD4A 3ME2A 3MIBA 4PF5A 1CD3G 3HQXA 1LOBA 2OXBA 2CGNA 4LK7A 2VZUA 3C7FA 4HK8A 4YPJA 2Q8OA 4AQSA 1QF3A 2DCJA 5APAA 2DCTA 1JYCA 1QQP3 2IWGB 4KNCA 4XTMA 3TWIA 3URFA 5F7UA 1NCQC 2MEV1 3AMMA 4CDXC 3ZDSA 4E4DX 4DPNA 2DURA 1GFF2 1YC61 4KWUA 3UNPA 1RVF3 2BGCA 3BUCA 3OGGA 3POEA 3G7DA 1PMHX 1L7RA 4QXHA 4AR2A 3LGRA 3OBRA 5LK7B 1RL3A 5A7WA 1PZ8A 2IVIB 2HWC1 4JDOA 2XWJB 1KQRA 1F31A 5GZDA 3WV6A 4OQ8A 3ILNA 1MZ6A 4IV1B 2E33A 2GSYA 3WP3A 3ZXEA 2QUOA 3FHAA 4BE3A 1AR93 1DLCA 5CFDB 4FI9A 1W6QB 4QQPA 3WHTA 4IEWA 4YM2A 4GH4A 5FP8A 4QXKA 3RZMA 1VBC3 1Y9MA 5IVVA 2CY6A 2EAAA 3KGZA 4Q27A 4XXAA 3T1LA 3KCYA 4XUTA 1HIXA 2BWAA 1IG0A 2OZJA 3QLQA 3KV5A 2ZJCA 3ZN5A 1JZ4A 2GC2A 4Y5Z0 1UOBA 1KFXL 1R091 1UQXA 5FPAA 4A2UA 1AR63 1ND2A 4Q4X1 1BBT2 4ES8A 4R9BA 2HEVF 2VUDA 2BNNA 2Y60A 4RHV2 2NQYA 1CN1A 1W05A 2DCYA 3VL9A 3GDBA 5L7OB 2VQTA 3H3LA 3DKWA 1LGBA 2VOXA 5BPXA 1HB4A 5G04L 2HWE1 4XABA 1RMU1 1VBB2 1O4ZA 3PDQA 5J36A 2P3YA 2EXKA 5B4NA 1RVF2 1JW6A 3JCIA 2MEV2 3RYPA 2P34A 1UN1A 5FZOB 5A7OA 4LBKA 4U2AA 1GSLA 1VR3A 5FYUA 4MO3M 3ZYRA 4HSJA 1H9PA 4CEYC 3MIEA 2Y34A 2Y26A 5DZFA 2W1SA 4META 1QEXA 4QKDA 1US3A 2GMMA 3MIDA 4QAWA 1W28A 2CV6A 2NN8A 2W1UA 3BALA 5CB7A 3MFCA 4IEPA 3NKGA 2CWMA 2D3PA 4Y1VA 1WLCA 4NO4A 4AOCA 1PX4A 4YGBA 1XPWA 5FZLA 3RZGA 4BB3A 2GH8A 2DU1A 4UFLA 3Q8FA 4I0BA 5EWSA 2C9KA 3I4IA 3UJQA 1VBA2 4QX1A 1IS4A 2YC2A 5D8AC 1W2UA 3D6EA 3IZOA 1AJOA 3E1F1 1MS1A 3JBG2 4P5YA 1SACA 4FAGA 3W5MA 2E53A 3RJ2X 3ELNA 1OT5A 1NE4A 2OIIA 2QKDA 3D82A 3I59B 1J1TA 4TLFA 3HQRA 4W6XA 3TAYA 4AFCA 1H4GA 2QQKA 3PVNA 4W6WA 3ZXJA 3CHXA 4AFMA 3RQ0A 5J37A 1XSQA 2VQAA 1LULA 3CO2A 1RUC2 5BV6A 1RMU2 4RS5C 1R1ZA 1IKQA 1EPWA 2W9XA 4YW3A 5FP3A 5CFCA 4JKKA 4BZ4A 4FPFA 4PCRA 4CEWB 1WMFA 1QNYA 2AR6A 3AMQA 2OYZA 1VAKA 4BHPA 4IDZA 5FPLA 1RUG2 3ST7A 5FZMA 4BIOA 2Y6FA 2JG8B 4WZFA 4COZA 5BYNA 3BB6A 5DUWA 4ARXA 2WZEA 4BXFA 1UY3A 4NVPA 3IMNA 2OS2A 3LDKA 3PVEA 3WDTA 4CEWC 2GC0A 5EHDA 3VBUC 5A1FA 1JYVA 5FREA 3J7NA 1RHI3 2ZKLA 3EHKA 1NX9A 5HCFA 4YZ5A 3ACLA 1UY1A 3DKQA 1Q8PA 4AEDA 5IVFA 2X5IB 3FHQA 4ONUA 4BCUA 5F37A 5F6LB 1G9DA 1NCRA 4H2AA 1CAWA 2WIIB 4UF0A 3UYJA 1QJY1 1V9U2 3A23A 2CDPA 3N36A 1Z7S2 1DBNA 4PJYA 2E6VA 2AREA 5C3PA 3ES4A 3BTYA 2ARXA 3VBRB 2V4AA 4KBZA 4CDQC 2D7FA 2JXAA 3A0NA 3ASIA 3VDDB 4FBFA 1OD5A 2DYCA 2ZEWA 3JB8A 3VV1A 4ZXEA 3KV4A 1H8VA 5ANNA 5HCAA 5FDBA 3FX3A 3R4DB 1HRV2 1UZYA 3U10A 4EWEA 4AAPA 3NL1A 5F1RA 1MS8A 4P5HA 4QX0A 4YFWA 2HWC3 1W2AX 2XONA 5J1XA 3AKTA 3RZHA 3PTYA 2DUOA 4UFKA 3IB3A 4PI2A 3O1SA 1QDOA 2RS31 4CCJA 5FXZA 3V64A 2R061 5FZIA 4AL9A 4NROA 5F2SA 1LAJA 3O0XA 3TBDA 4C1XA 1XYPA 3E6DA 3RYKA 1DCSA 3RG0A 1CAUA 1ULFA 2WS93 2QJVA 4QU1A 1VMHA 1VBC1 1XYOA 5FMCA 4JGYC 3BOWA 1DZTA 3FC0A 2Q4SA 4O61A 3OY8A 1VIWB 3VBSB 1CAXB 4R52A 2IXIA 4I01A 4B4RA 2JD4A 1OC1A 1UOJA 3WUDA 4YM0A 2W87A 1SLAA 5IAVA 4COYA 4OI4A 4YZ3A 5KWRA 2Z69A 3B3QE 2D6NA 2PLV1 1KJRA 4LUMA 2HKXA 3WNLA 4XBLA 3S7EA 5DZEA 4WM7A 1AYM3 1W6NA 2ZHNA 3H1MA 2BNOA 3QBQA 1RUH3 4QT6A 4BQWA 2BU9A 4B4QA 1RMU3 3HNMA 5FY4A 1CAVB 4GMP1 4UFMA 4AVAA 3BGAA 5BNPB 1FATA 3MIHA 1QJFA 4RQPC 4ATEA 4A7ZA 1NA1B 5A6XA 2ATFA 3TEXA 5GLZA 4AVTA 4LR4A 4TLGA 3CL1A 4XJUA 5EFUA 1GWKA 2G19A 3AYDA 1DIWA 2WLPA 5D2AA 2BOIA 2J42A 1ASJ3 4L99A 3SHRA 1XNAA 3JD72 4WVMA 4ZKTB 1G7YA 3WD5A 3RYRA 2XJPA 3KVBA 4S2GA 3H0OA 1W90A 5EJZB 4NHMA 4C0HA 3CF6E 1H1AA 4YVSA 2CWSA 4JTOA 4NRMA 3I3BA 3AVRA 1RYYA 5JPMB 2VGDA 4QX8A 3SLIA 2ZMNA 4OLLA 4QX2A 4GB31 4YW4A 1LHVA 2AZ5A 1JZ6A 5DG2A 4H7MA 4QKNA 1DYKA 1POV3 1AR92 3KWVA 4D7SA 1QJU3 3CIHA 1OH4A 3I2KA 4OMDA 5IVYA 5CA6A 4BOWA 1MEC2 3IDBB 2DUPA 2QZ3A 3AP5A 1CR7A 2QQNA 3MI8A 2EXJA 4M3CB 4OFGA 3UJOA 1J59A 4MGTA 5JPNB 1OQDA 4CXYA 4LUKA 4RS5A 1JOJA 3LB9A 1QU0A 3MV01 4UFHA 4OHYA 1CGPA 4X6RB 1PZ9A 4IEYA 2UY8A 2JIGA 2P6HA 3OPZA 5FPVA 4W8JA 4FXKB 1G9AA 2CAVA 2WO3A 5KHKA 2VNRA 3TRSB 2EF6A 4DO0A 4EQVA 1VMFA 2QNKA 2IXHA 1QJX3 3LSDA 2A73B 3RMYA 2R073 4N9HA 4PLMA 3SXWA 4CP2A 4P08A 3SCGA 5IWFA 1ENXA 1RHI1 4LBMA 3M3EA 4BPZA 2DUQA 1SQ4A 3NV2A 5DAXA 1O4YA 1WLTA 1UPSA 1CX4A 1SPPA 5J7MA 3O14A 5J3UA 2J7MA 3POYA 4Q0QA 1TNFA 3JBG3 1PO21 3ZMNA 1Q43A 2ZX1A 1LOGA 1HQNA 2RJLA 4Q0PA 4CCNA 2UU8A 2JDMA 4IV3C 1SZBA 2VUJA 3LEKA 2ZZQA 2DTYA 2HWB3 4K21A 4KU7A 3AJYA 3GHMA 3OBAA 4XFCA 3N7KA 1HXS1 4N7IA 1GV9A 2ZGMA 5CAZA 1JHNA 3P6BA 4XJZA 1RUF2 3I2DA 2RG4A 4XFGA 3PURA 2EA7A 2BDRA 2QDNA 2P37A 2ZEYA 5FQ0A 5E6HA 1BK0A 1STMA 1JZ7A 2PAKA 4FOVA 4DXSA 4AHWA 2V73A 2HWF2 4V2WA 4P9LA 2RS33 4QQOA 3WNNA 1W8FA 2I45A 4C8DA 2R063 1C1FA 1IPSA 1W6OB 4K8RB 4LIVA 3TN92 4MGYE 1W0NA 2BPA2 2A6ZA 3THDA 3CQOA 3SQOA 1DQ6A 4CPBA 4LKDA 5ABJC 2JKBA 4LK6A 5IW0A 5T5JA 1NKGA 3VBUB 1SLBA 1RVF1 1OF4A 1BJQA 1JZ8A 5BUVA 1DF0A 1H6YA 4IV3B 1FNZA 1GLHA 2W95A 3TNPB 5C9AA 1AXYA 5FZBA 4WVVA 1ZBA3 3ZXAC 4DOUA 1YNAA 5FWEA 4Y5TA 5FYVA 2XJRA 2CYFA 5FMOL 2IFRA 2WWUA 4NMIA 2TBVA 3QOPA 5F5CA 3NVCA 2VCCA 3DPRB 3WQ1A 3IM0A 5JXGA 1CJDA 2GZWA 5CG8A 4YLZA 2Z5WA 1XE7A 5D8AA 5A3MA 1YQ5A 1AR91 3C2UA 4AVVA 2D40A 5GLWA 5AC93 4JRLA 2JG8C 1UF2C 4AEMA 4G9SB 2XL9A 3LD8A 3DPRC 3SKVA 5DZGA 4SBVA 1BCXA 2BFUL 4HSLA 3B01A 1OA3A 1B35A 1ST8A 2DVBA 4XW3A 2VZRA 4JDMA 5GLUA 2WN2A 4CDQB 3ZFEA 4MG2A 1R093 3AL5A 3UKVA 3UGFA 2R49A 4NHKA 3HT2A 2XB6C 4IE0A 3SNMA 3WCRA 4L92A 1XC6A 4LE3A 5FMBA 4EN7B 3ENRA 1QJX2 1AUYA 3PJQA 5FAXA 1AL22 5FMOS 4CE8A 3AZVA 3KQRA 1WKYA 2YFZA 4FSJA 3UGGA 3VLBB 1IG3A 2HWE3 1YQ8A 2XOMA 1WW4A 3ZOIA 2NMNA 3AVSA 3H7YA 1YFUA 5C9AB 3LPFA 4GB33 3OGJA 3DPRA 4A41A 3ZFFB 1WBFA 3POSA 4UT5A 1RUH2 2FQPA 5LW9A 3RS6A 3NQHA 5FZ4A 1TME1 1G9FA 1PGL2 1CAXA 4LBOA 1MEC1 5GALA 2MNGA 3WCSA 5LCWL 4YGEA 2C6SA 3LIHA 1MQTB 5FZ3A 1SFPA 1WD4A 2ZA9A 2EIEA 3GZAA 4R4ZA 4KBBA 2LS6A 2ZPXA 4BISA 1US2A 4ET7A 1BK1A 4Z8BA 1IOAA 3V0BB 1H8TA 1ZZCA 1V6NA 3CZUA 3AXDA 4L8QA 1OA2A 2CTVA 4NE9A 5LB6A 1D4M1 3ACGA 4WM7C 3SH3A 3JD73 4HKWA 1DP0A 2PAEA 1DGLA 3EJKA 5JXHA 1MS9A 2A75A 1QJX1 2RS32 2BBVA 3KCXA 1JTZX 1WCDJ 5L9VA 2JG9A 3HAGA 4CXWA 1KJLA 4LNVA 3SEPA 1Z78A 1A6CA 3KB5A 1ACCA 2V72A 4NAMA 2Y33A 4OYUA 4ASLA 4K6BA 3DYMA 5FYYA 1CZSA 1HN1A 1Y43B 2I07B 3LOIA 1VPHA 4I0WB 4MH0E 5JI7A 1UX7A 4AI8A 1VBE3 4XUQA 3AZZA 4QKBA 4GAZA 4PBOA 1W6NB 3RGBA 4D7YA 3EO6A 1DLLA 1LR5A 4WVMB 1X82A 2RV9A 1Q8QA 3IDCB 4M0HA 4CDUC 1KS4A 2D98A 2I74A 4XVHA 2HWB1 3C7OA 1RUI1 3M8LA 4K1ZA 2PQSA 1AR83 3JXSA 4IV1C 3WNXA 2VOTA 3VBOC 2DCKA 1O5LA 5CFDC 5CEHA 3DECA 4PLNA 2WT1A 4GMP0 2QQUA 4NUBA 1LU2A 4DRVA 4I30A 3B00A 3HEIA 2QQPA 1NY71 2IXKA 4CUAA 1JYTA 1NA1C 1H8TB 2IVJA 4Q4W1 1NUKA 1E5IA 5FYTA 2AEYA 3DYOA 4IESA 2R072 2QFEA 5B2GB 2RS52 2NZ9A 2X09A 4S2DA 5CKNA 2W94A 4IEOA 1QJY3 3B9CA 1ULOA 1UIKA 1G6NA 1E5HA 1T6BX 2ZZJA 4HPKB 4LE4A 3NAPA 2IXCA 2WUHA 4YVWC 4AAXA 3LZZA 1JOPA 2VZOA 4YW5A 1CIWA 1E5RA 1O6UA 1SLTA 1AJKA 2ARBA 2OQ7A 3C7HA 3ORJA 3AMHA 4Y1ZA 3OBZA 2BVVA 4XDQA 4E2SA 2YMZA 1JMUB 3JU9A 1H8TC 4IEVA 5LBEA 1ZBA1 4LPLA 1CPNA 5FY9A 3W59A 2VVEA 4JAAA 4YVSB 1RUF1 1HJFA 1RUE2 2HYXA 2W92A 1HRV3 2ZGPA 3GHNA 4YWAA 5KR7A 5GJ6A 1EUUA 4Q4Y1 4CCDA 3AX4A 2AACA 3RWNA 1EUTA 3OGVA 3NJXA 1K3IA 2VQUA 4F83A 2KD7A 2JDHA 3OCPA 5A80A 4PIXA 3WDUA 4S2FA 1WBLA 1OOPB 3I2FA 4LEJA 5FXXA 1WA4A 2WS91 1V6JA 1KDKA 2WKKA 3I3DA 2XXZA 4Z2WA 1UMZA 1VE0A 2LW8A 2ZAAA 1ZRDA 2XG3A 3M3IA 1ND3A 1REDA 4DUWA 3WINE 2D5FA 1LNSA 1BYHA 2F4PA 4QPWA 4MX3A 4QKFA 4ES9A 2ID4A 1D0GA 4NIHA 1A8MA 1LOAA 2PLV3 4EN0A 3K77A 5FPZA 4AVSA 2Q8CA 1DGRN 2WZR3 1YFYA 4GA9A 4RFT0 2Q8EA 3IBMA 1AYM1 2C1FA 4P9GA 1XB9A 3UT0A 4CDWC 4GMP3 3LEMA 2ZX2A 4X8PA 2D3RA 3CDZB 2XLAA 4R4XA 2E31A 4PF1A 4HVQA 3HT1A 2PMWB 3NAPB 3M3CA 4KMQA 2P17A 4RQPA 1YFXA 3WF1A 1LOFC 3HJRA 4C90A 4TN7A 5DN2A 2OPWA 4OZOA 5I0UA 4FPYA 2OT7A 1YHFA 2JG8A 4L97A 4H3WA 1HRI1 1GZCA 4FQ4A 4XDPA 4JCKA 1O3RA 3KT7A 1PO12 2DVAA 3GJBA 1OXCA 1Q3EA 4QM8A 4DXRA 2O1QA 3MF9A 4QU2A 1FAYA 3ZKUA 4DXZA 4ZPIA 2RM22 3FFQA 1AF9A 2J1AA 3O12A 4QMAA 3OGRA 5F39A 1LECA 2WN3A 1YYNA 2A6VA 2GC1A 2PHTA 3WDYA 2RDRA 3B69A 2BGPA 1EY2A 2J1UA 3WNMA 2FCVA 1WCUA 1D4M3 2XMLA 2X5IC 2QQIA 1J3RA 5FY7A 3L2YA 1ULPA 1BHGA 3JD71 4JQRA 3VDDA 3GCWA 2VPVA 3H3ZA 3LEIA 5HCBA 4F3JA 2VMGA 4AQ2A 1H30A 2JICA 3U37A 3RRDA 1L7QA 5AFEA 1U5IA 2GNDA 4KGQA 3ES1A 3MGUA 4L2NA 4E2GA 4E4HA 1UX6A 5F2WA 1DYOA 4YM3A 2JE7A 2HWC2 1ZREA 3GYDA 4JGZC 2BERA 3ZFEC 4AYUA 3T4VA 4YW1A 4P9JA 2HEWF 1JZ5A 1WMEA 3I49A 1O3TA 2PQQA 4LHLA 1FT9A 2XBO2 4JKMA 3MYXA 2VY0A 4XMAA 4AI9A 4WBBA 2AEZA 3ZN6B 2XJVA 2FMDA 3OD4A 5T5PA 3RSJA 3ZPYA 2NPIA 1KS5A 1NZIA 1S55A 3E6BA 1RUI3 2ZHMA 4Y4YA 2Y64A 1LHWA 4CDQA 1AR81 2Y6GA 3BU0A 4CUGA 4OI0A 3M7AA 2FDFA 3IPVA 4RL7A 2H6CA 4XF9A 4N7UA 3T0AA 3BI3A 3ZR6A 4QQLA 1RUJ2 3OYWB 3V56A 1ZM1A 4Y1XA 2BYVE 4YRDA 2D44A 5DUVA 3ZDVA 3VKFC 2VZ3A 4D6QA 3T2TA 2FD8A 1JOBA 5A3NA 1DQ5A 1GICA 4GH4B 2WAOA 1AX0A 1W6QA 4XJWA 5JUVA 1F8VA 1L3JA 2E32A 1PO23 5FCCA 5H9RA 3KSCA 5ERLA 3U4SA 2E9QA 2LRPA 4ATFA 5CFCB 4MZUA 3JQWA 1ODMA 2V5DA 4DMIA 1FX5A 5L7OA 1OFNA 4IV1A 4GKYA 4TZDA 2WQZC 1LJ7A 1YCIA 5L9BA 1VAVA 5A3OA 1D7PM 4IV3A 4BQ3A 1N3OA 1HKDA 4BQYA 4CP9B 1HXS3 3OGSA 3C7GA 1HB1A 3AZWA 2CSGA 1XJAA 3FLPA 4MGSA 1RUNA 5CFCC 3LCPA 1W0PA 1W9YA 4E9KA 5FZDA 1AR72 4YW7A 3ITQA 3VGIA 3JB4C 1W8UA 3I54A 1OURA 4IETA 3ZFFC 3IT8A 3Q8CA 4Q4Y3 4CU6A 3PIGA 1DQ1A 3PUSA 5F8PA 2DBNA 3PL0A 4I09A 4CZSA 4JVAA 4ZZ5A 3N35A 2R0FA 3CJIA 2DCZA 2J1EA 3OYWA 4K3UA 5JOXA 4FT8A 2FDKA 5FYHA 3VKOA 1COV1 4KU8A 3DV8A 1Q5OA 2QQWA 5E88A 5JSPA 1QJY2 1N1VA 3DGTA 2PHFA 2ZGSA 5FKBA 5KXCA 4SLIA 5D21A 2C24A 2HJIA 3HNBM 4AZZA 3VD4A 1AHSA 1CVNA 2P2KA 2LROA 5FLIA 4A45A 2XKOA 3AK0A 1ZBA2 2G9FA 4XEZA 5C4WB 1G9CA 2O8QA 2N7GA 3MF6A 1XBFA 1MR5A 2JG9B 4A6OA 4DB5A 3ZXLA 2VMFA 5CZKA 1FPN3 5A6QA 2J1RA 3S5QA 1HB3A 1Y9QA 1NAEA 4P14A 2XUMA 1HRI2 5I91A 2EIBA 5AC91 5A33B 1LGNA 3TN93 2EICA 4LBQD 2YV8A 2B5HA 3BTAA 4MYEA 1N1TA 2YYOA 5FY1A 5FP7A 4BLJA 2YB7A 5CKQA 5KBFA 2OQ6A 2P3JA 3AP7A 4NOTA 3ALQA 4P00B 1D4VB 5ACA1 1UY0A 4IE4A 2WNUA 3N9OA 5FYZA 4TTGA 1LOCA 5FQ0B 3MLLA 1X36A 1WLWA 5CADA 1W8OA 2XHKA 3DUIA 3FUOA 4XF4A 5H9PA 4TWTA 1RC6A 5DAWA 3AB0A 2BTVC 3C7EA 2GP3A 4ZHNA 1NXMA 1XOYA 3W20A 3AYCA 5FK8A 4GWMA 1OSGA 4RYDA 2EALA 3IIAA 1G8WA 5A3PA 2WABA 1MPXA 2W46A 5ACA2 4EWDA 3ZFFA 1RUC1 1JYXA 1SBDA 1C5HA 1YEWA 4PQQA 4URTA 1OLQA 4E27A 4XQ4A 3WUCA 2YG0A 4QM9A 1TME3 2ADEA 2GNBA 1I9RA 1LGCA 1RHI2 3MEPA 2ERFA 4PQ9A 1OVSA 2JDYA 1S4CA 1MEC3 2IFWA 2ENRA 3OBTA 2E63A 1QJU2 5E8AA 5C4WA 3S30A 5IVEA 5IUQA 3G6JB 3SEEA 3CNAA 4AK3A 3JZVA 2VXJA 3D3AA 4IW3A 1Q56A 3OEAA 2A71A 4HK9A 3NAPC 4QB1A 1OLRA 2WINB 1REFA 5FY5A 5ANQA 3B7MA 4WM8B 1ULGA 1O3QA 1FMD2 2UYBA 1KFUL 2XHNA 3CBNA 1LU1A 3LA2A 3MW3A 5AVAA 1UY2A 4AEDB 4BQXA 1NLRA 3MHZA 1J58A 2VM9A 3GBWA 3VBFA 3AZXA 2WWSA 4BJ0A 1CONA 5FZ1A 1RUD3 4J6GA 3VZLA 1GZWA 3ACIA 5HV0A 3LOBA 1M06G 2YROA 3FWEA 4EYUA 2J1SA 2RS12 4XDOA 1W8ZA 5C70A 5IVJA 3T0DA 4LO7A 1OOPA 3J7MA 2JDAA 2VG9A 2DFBA 3O5SA 1ZZBA 1ULCA 5DAQA 1SCRA 2WNVB 1JZ2A 1SMVA 5DDJ3 2WA3A 4AEDC 4AI1A 3C3VA 1BEV2 4OVEA 3WVJA 4MVTA 3I7DA 3PTRB 1W6MB 4ARYA 5J09A 2OX0A 5FO9B 1ULEA 1DGWX 3OEBA 5JWPA 1VBE1 2WSVA 3V0AB 4QDQA 2RDQA 3KF3A 2Y0OA 5SV5A 1MZFA 1JYIA 1S2BA 5JOWA 2XR4A 3NRUA 2YC0A 4MGZE 4Q0UA 4RHV1 5DG1A 3QH7A 2HWB2 3VHNA 4QHZA 1AR82 2YGLA 4AGGA 1JU3A 1GBGA 5FZGA 3VN4A 2RHPA 2E7TA 5JXJA 1WLDA 2Q8DA 1GP4A 1U5ZA 1YJLA 4K20A 4AEKA 1UY4A 4Q4W3 3PVBB 4DNYA 5C5UA 2XBO1 2JJ6A 3BOPA 4UAPA 4A3ZA 1V6LA 5A3TA 4COUA 3UETA 3ZO0B 2R043 5FBZA 2YBKA 2X53S 2DF7A 4LA2A 5JCTA 1ZBE2 2XQRA 1C8NA 5GKAC 2IUWA 2ZGQA 2LALA 4YG3A 4FXGB 5FZ7A 1O5UA 1VRH2 2GNTA 3S0MA 3KZ4C 2XH6A 3I2GA
chains in the Genus database with same CATH topology
1GWKA 1GWMA 3ZYBA 1UOJA 1W9FA 2LROA 3ZYFA 4LJHA 4YW7A 2Q1FA 2WYFA 2VXJA 1L7LA 1W8UA 2KR2A 4YWAA 4BQ5A 4BQ2A 3F95A 4LKEA 4YW6A 4A6SA 1WZXA 3ZYHA 4AL9A 1W90A 2K46A 2JWPA 2O14A 4LK7A 4LKFA 1OKOA 2LRPA 3UT0A 1GWLA 1WMXA 1OH3A 4CP9A 1W8WA 4CPBA 4CPBD 4LKDA 1WCUA 5D21A 4BQ3A 2C24A 1W8TA 4LK6A 1V0AA 3ORJA 1W8ZA 4CP9B 4BQ4A 1HN0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GWK A;  1GWM A;  3ZYB A;  1UOJ A;  1W9F A;  2LRO A;  3ZYF A;  4LJH A;  4YW7 A;  2Q1F A;  2WYF A;  2VXJ A;  1L7L A;  1W8U A;  2KR2 A;  4YWA A;  4BQ5 A;  4BQ2 A;  3F95 A;  4LKE A;  4YW6 A;  4A6S A;  1WZX A;  3ZYH A;  4AL9 A;  1W90 A;  2K46 A;  2JWP A;  2O14 A;  4LK7 A;  4LKF A;  1OKO A;  2LRP A;  3UT0 A;  1GWL A;  1WMX A;  1OH3 A;  4CP9 A;  1W8W A;  4CPB A;  4CPB D;  4LKD A;  1WCU A;  5D21 A;  4BQ3 A;  2C24 A;  1W8T A;  4LK6 A;  1V0A A;  3ORJ A;  1W8Z A;  4CP9 B;  4BQ4 A;  1HN0 A; 
#chains in the Genus database with same CATH topology
 1APN A;  4XTP A;  5JZG A;  4OUL A;  2JE9 A;  1R64 A;  1RIN A;  3EQE A;  1RB8 G;  4QPG C;  5F3I A;  4JTN A;  4L9B A;  5IT6 A;  1RUF 3;  2MHF A;  3K4A A;  1FV3 A;  1HRV 1;  2LUW A;  1CES A;  1ND3 B;  5KXE A;  3H7J A;  3WNO A;  1ZRC A;  1PK6 B;  4ITC A;  2QTW B;  1YRZ A;  4EZH A;  3N9M A;  2Y8K A;  1FPN 1;  2IXJ A;  4NII A;  3SIT A;  2H0V A;  4BU2 A;  4LBJ A;  4IUG A;  4J1X A;  3WNK A;  1GQP A;  4K9S A;  1C3H A;  4LKS A;  3O0W A;  1POQ A;  1HQL A;  2CGO A;  1URX A;  2JE8 A;  5D1I A;  3TN9 1;  3OPW A;  1PM7 A;  5FK7 A;  2VW2 A;  1PGL 1;  2WQ4 A;  2A3X A;  3EBR A;  2R30 A;  1Y4W A;  2Q1Z B;  5F5Q A;  3O1U A;  2IXL A;  4RGA A;  5I0S A;  4Q4Y 2;  4LXL A;  4GWN A;  3QD6 A;  4BA6 A;  4XAE A;  1UO9 A;  3MFA A;  2HLE A;  3ZSE A;  5ACA 3;  1CIY A;  1IHM A;  1ZX5 A;  3RFR A;  2X10 A;  2Z2S B;  3AFG A;  4OCT A;  4RS5 B;  1R08 2;  2IZW A;  3KHB A;  5DMY A;  2LM3 A;  4IEX A;  3U14 A;  2W47 A;  3Q9O A;  3WG4 A;  3ZXF A;  2WZR 1;  4CA9 A;  4ZU7 A;  5H9Q A;  5F3C A;  4RQP B;  2W2I A;  2Z79 A;  4RD7 A;  3RVH A;  1N1S A;  4OHW A;  1Z0H A;  4DEQ A;  4LBN A;  4CU9 A;  4FPE A;  1UYZ A;  4C91 A;  1RUC 3;  5KC5 A;  4UXA A;  5HI0 A;  3GXU A;  3WW4 A;  2OVU A;  5KHI A;  2P4E A;  5AVP A;  2GME A;  4FTS A;  2OW4 A;  5IFP A;  2R6Q A;  1WA6 X;  5A3U A;  5C5T A;  5IHR A;  3BKZ A;  2Y6H A;  4HXC A;  2PHD A;  1HRI 3;  4Y1Y A;  1L7L A;  1UXZ A;  1SFN A;  2EXH A;  3NKT A;  3LAG A;  5EXO A;  4YVW A;  3WSO A;  2FHR A;  3ZXK A;  1CJP A;  1SLC A;  5FY8 A;  4PDW C;  2WBK A;  1AYN 3;  4PDW A;  2WL1 A;  3OPT A;  1ZA7 A;  3ZPO A;  2VBB A;  3LIG A;  5JMO A;  1J84 A;  1C57 A;  1RUD 1;  3BIW E;  3N9N A;  1NOV A;  5LZ6 A;  3N7M A;  1NA1 A;  2QQJ A;  3K4D A;  5A6Z A;  1A8D A;  2BV4 A;  3M3O A;  4N90 A;  5BY5 A;  4XHB A;  5JR7 B;  2CU5 A;  2VXR A;  1NG0 A;  4CEW A;  5CU1 A;  2ORZ A;  4V1P A;  4C1W A;  1ASJ 2;  3VBO A;  3OUI A;  5FZO A;  1W39 A;  4Y24 A;  2R7E B;  1W9F A;  4NPM A;  5F5I A;  1W99 A;  1GQG A;  3DF0 A;  3FZ3 A;  2D6K A;  3MLK A;  4I2O A;  4YYO A;  4FP2 A;  1S0F A;  1NCR C;  3WQ0 A;  5L7O C;  2WZR 2;  4UW3 A;  4WV8 A;  1IZ3 A;  5GM0 A;  3ZYI B;  1YQC A;  2CDO A;  3LA7 A;  1UYX A;  1FPN 2;  3FLT A;  3OSD A;  2WNU C;  4M0N A;  5CG9 A;  4EN8 B;  4MV2 A;  3MIF A;  2QQO A;  3ZXD A;  2RR1 1;  4DY3 A;  3LSE A;  2E26 A;  2UUR A;  1W04 A;  3M3Q A;  1J3Q A;  3ZMO A;  1H9W A;  2K0G A;  2RVA A;  4LOR A;  3UK9 A;  2HBU A;  4MGK E;  4AW7 A;  1HXS 2;  2WZP P;  2ET7 A;  1O3S A;  2ZX0 A;  1V6K A;  4NWW A;  4RHV 3;  5FXW A;  3ZKY A;  4DFS A;  1MVE A;  2BJS A;  3VD7 A;  5IJR A;  2ZX4 A;  2GAU A;  1W3X A;  3WY6 A;  4AI3 A;  4WVZ A;  1W6O A;  1RIR A;  3LA3 A;  4NIG A;  1ZYB A;  1OLM A;  3U75 A;  3GGL A;  4YFZ A;  4Y5S A;  1CQ9 A;  4IL7 A;  1HB2 A;  2YHJ A;  3POF A;  5FIX A;  2TNF A;  3S57 A;  4UW6 A;  4C0B A;  5LBB A;  1EV1 1;  4HFS A;  1SFY A;  1LOF A;  1QJZ A;  2R04 1;  4P02 B;  3CJX A;  4LO5 B;  3X29 B;  2IC1 A;  2AH2 A;  3BOD A;  2WNE A;  3T4H B;  2VD7 A;  4MXW A;  2PA7 A;  5E89 A;  4FPJ A;  1VJ2 A;  3J9S A;  4WM8 A;  2G9G A;  3CLP A;  4R9C A;  5D8A B;  4E4Z A;  1V6I A;  4Q0V A;  1W6P A;  1JHJ A;  3I2H A;  4FOY A;  3O1T A;  4FTE A;  2VW0 A;  5BNP A;  1TQ5 A;  1XNC A;  1YI9 A;  2P3K A;  4IND A;  2NP0 A;  2RJ2 A;  1PVC 3;  2YFU A;  3SC7 X;  5JMC A;  1E57 A;  5JOY A;  5C8C B;  1D2S A;  3H42 B;  4QQH A;  4CVU A;  4ISQ A;  3VDB A;  1LHN A;  3O1R A;  4YVS C;  1EAH 2;  5I8S A;  5LY1 A;  3FBY A;  3VKL A;  2PHU A;  2O14 A;  2VMH A;  2OKX A;  3T3Y A;  1OKO A;  3ON7 A;  1COV 3;  1BEV 3;  2ZML A;  1N47 A;  4QX5 A;  4K7J A;  4B1M A;  1A78 A;  4GQ7 A;  3IAQ A;  4LTA A;  1D4M 2;  5HBA A;  1X8M A;  2J1T A;  3AMN A;  4RA0 A;  1AVB A;  1QXR A;  2VEC A;  4ZU5 A;  4ORF A;  3WLU A;  3ZYB A;  3DXT A;  1ZVF A;  2RMU 2;  5J98 B;  1YFW A;  4QX3 A;  4PHZ A;  5C8C A;  4QPG A;  2RM2 1;  5FPB A;  3FJS A;  4LKE A;  3RZJ A;  3GZE A;  3AP6 A;  1DZQ A;  3DYP A;  1QY4 A;  2C26 A;  4GIQ A;  4M3C A;  1UW8 A;  5L9R A;  2PAM A;  2E51 A;  1OH3 A;  5L36 A;  3L2H A;  3V65 A;  1RXF A;  1PVX A;  4Y22 A;  5JAX A;  4MSV A;  4Q1P A;  4TYS A;  2FCT A;  3PJY A;  1ENQ A;  3IKW A;  1N3Q A;  1LES A;  2I2S A;  4K8F A;  2K9Z A;  1WD3 A;  4XMI A;  1H2N A;  4HN1 A;  2YU1 A;  4DZG A;  2D5H A;  5EJ1 B;  1NCQ A;  2XVL A;  1ZZ9 A;  4FOQ A;  5EV7 A;  4YNI A;  4QGM A;  4XZP A;  4ZS3 A;  3W58 A;  1FMD 1;  3ZFE B;  4COW A;  3MDP A;  2BQP A;  1AYN 1;  4LA3 A;  1UL9 A;  2W68 A;  3B5L B;  3P1I A;  2JEN A;  3TNQ A;  4QPI A;  1OBN A;  4DXT A;  3FUQ A;  1UZZ A;  3GJA A;  5FZE A;  2ZGL A;  2PEL A;  5BNN B;  1ULD A;  1PX3 A;  4G4F A;  3GBF A;  3MV1 1;  1R1A 3;  1GWL A;  2XJS A;  3H3U A;  3N7J A;  4UFI A;  4CDU A;  1DZR A;  2BBA A;  2HWD 2;  3INA A;  4AXO A;  4Y20 A;  1DQ4 A;  1JZ3 A;  3VBH B;  3FE5 A;  3H1Y A;  4XBQ A;  3T2Q A;  4YZ4 A;  4AQT A;  4JHT A;  2QQL A;  4I3P A;  5EIY B;  3KM5 A;  1HV0 A;  1LOE A;  1JUH A;  2E7Q A;  1I6X A;  4B7E A;  3POB A;  3RNS A;  4XIL A;  2VR4 A;  4XJA A;  5SV8 A;  4DS0 A;  5C3Q A;  1GNZ A;  3N9P A;  5C71 A;  3B94 A;  4R9A A;  3OY8 B;  4D3W A;  5C33 A;  1H1I A;  4HPK A;  3KV9 A;  2YPD A;  3NV1 A;  5BNO A;  1PMJ X;  4J25 A;  1UMH A;  5LAS A;  5JSO A;  4G3Y C;  1EP0 A;  3T09 A;  4JKL A;  2RR1 3;  4XZU G;  2UWB A;  4XFB A;  4Q26 A;  5IVC A;  1KEX A;  4D0Q A;  1RUD 2;  1AR7 1;  2VU9 A;  3D4K A;  4YG0 A;  4M4R A;  5CFD A;  2BOJ A;  1ZZ7 A;  2GP5 A;  3ZN6 A;  4FQZ A;  4PT6 A;  1S0B A;  3ILF A;  4KI5 M;  3USS A;  2WFF 2;  2W5F A;  2WNO A;  1UAI A;  2K2S A;  5DDJ 1;  4IEZ A;  1F15 A;  1K5M C;  2FDG A;  3DN7 A;  3MW4 A;  3VZJ A;  1WCQ A;  1EV1 3;  5FZA A;  1QJE A;  2Q0A A;  1ENR A;  4MUV A;  4FOW A;  3VBR A;  1I5P A;  1YWK A;  5FYI A;  1W9T A;  1OFS A;  1DYP A;  1BQP A;  5GLT A;  2HWD 1;  4DIN B;  5KHG A;  4AHX A;  1VBD 1;  3LFI A;  1NCR B;  3VD9 A;  4MAD A;  3AM2 A;  4OI1 A;  2FMY A;  2ZGO A;  4HAN A;  4IQP A;  3QCW A;  4RFR B;  5JZG B;  5A32 B;  4BM8 A;  1GNY A;  2VCM A;  2XL7 A;  2VQ0 A;  3OF1 A;  5LBC A;  5HCH A;  3AZY A;  1RUI 2;  1RUG 3;  1OUX A;  3VHP A;  4Q0S A;  2RJK A;  2VUC A;  3OTF A;  5FYC A;  4UBH A;  4ZZ8 A;  1PVC 1;  4JRA A;  4NWV A;  1XE8 A;  1RJ8 A;  4JZR A;  2XBO 3;  2PHX A;  3MLJ A;  3HVD A;  4BME A;  4UW5 A;  2RMU 1;  4Q4W 2;  3VBR C;  1PM4 A;  1U0A A;  3WG1 A;  3ZYG A;  4JC1 A;  2B7Y A;  1CAV A;  1DFQ A;  2VBP A;  3H8X A;  2V5Y A;  3SKJ E;  1BEV 1;  2D6M A;  2VNO A;  4M00 A;  2WNU B;  3OUJ A;  1S0G A;  4QHO A;  1V6M A;  5H9S A;  3R6S A;  3T2P A;  5E1R A;  4XC9 A;  5LEJ A;  1R1A 2;  1F4A A;  2W39 A;  2A7A A;  3DXU A;  4PIZ A;  4EWA A;  1PMI A;  1BBT 1;  2YUE A;  2XJU A;  3LFM A;  4H55 A;  3LDB A;  1TME 2;  1HX6 A;  5K8S A;  5E16 A;  1AXK A;  4BIF A;  4D7T A;  2VNG A;  4Q8K A;  2ZKN A;  2XQX A;  3HWJ A;  2GN3 A;  2RDS A;  2RM2 3;  4KGG A;  2QQV A;  4KQ7 A;  4Q5O A;  5A1A A;  3UKN A;  5A7P A;  4DY5 A;  5IK7 A;  4LHK A;  3USU B;  4XF0 A;  2WFP A;  1X9P A;  5GZG A;  4DIQ A;  1MVQ A;  5FXV A;  2WC2 A;  1VB4 A;  1YJK A;  4I02 A;  1N3P A;  2D6O X;  1YQ6 A;  4QGN A;  1UNB A;  4XIK A;  4XUR A;  5LK5 A;  1OQ1 A;  4AG4 A;  4YGD A;  3F2Z A;  1S2E A;  4B4P A;  4HET A;  1ND2 C;  5FO7 B;  3POJ A;  3BPS A;  2XWB B;  4CDU B;  1AXZ A;  3D0S A;  1VMJ A;  4HON A;  1HLC A;  3PHM A;  2A6W A;  4Q2F A;  3I97 A;  2VZ1 A;  1QDC A;  1JH5 A;  1SHW B;  2GNM A;  4O7X A;  4GUL A;  5CIR A;  1IGO A;  1QXP A;  3I3Q A;  1CZV A;  2R16 A;  4LHN A;  2JB8 A;  1FMD 3;  1XYN A;  2BP6 A;  4MGQ A;  4XQD A;  4CRQ A;  3NWK A;  1DDL A;  1O59 A;  2X05 A;  4E8C A;  3E6C C;  3PLQ A;  2X8K A;  4QXB A;  1IKP A;  2YBP A;  1GOF A;  1LHU A;  1Y7B A;  3RMX A;  2A6Y A;  4DUX A;  4XBN A;  4Q1R A;  1R1A 1;  1Z7S 1;  2C5D A;  4IGQ A;  1W8W A;  1RXG A;  3VDD C;  3MPP G;  2BWC A;  3AYE A;  1W8T A;  1NQD A;  3C8X A;  3V0A A;  3NNF A;  4ASM B;  1HN0 A;  2WO7 A;  1T2X A;  5JI9 A;  5BXX A;  3RZZ A;  3KHC A;  2WT2 A;  2ZTN A;  2ZOE B;  5DAP A;  3E5U A;  3ZLI A;  1DQ2 A;  2RE9 A;  1ND2 B;  4XAA A;  2FDH A;  3WDW A;  1K45 A;  5GZE A;  1H2K A;  1JOD A;  2XUE A;  3M70 A;  3BVC A;  3KF5 A;  4JGZ A;  4BWO A;  5JXI A;  4NID A;  1BMV 1;  1EPZ A;  1OD3 A;  1J1L A;  2DFC A;  5T55 A;  3HR9 A;  2HWF 1;  4JV4 A;  2ORX A;  2ZEX A;  1TG7 A;  3APB A;  3B9I A;  2ADD A;  3RPQ A;  3O7O A;  5G05 L;  3I2O A;  2PHR A;  1RUE 1;  3VDC A;  1GP5 A;  4CP0 A;  1AR7 3;  1UCX A;  4JGY B;  1V0A A;  4GWJ A;  3AKQ A;  3GCX A;  1I5Z A;  4LOT A;  1WW5 A;  1Q8O A;  2OPK A;  3BN6 A;  3IN9 A;  1UU6 A;  4CYD A;  4E8D A;  4TXW A;  2JDK A;  2W52 A;  4OQ9 A;  5L73 A;  3WF3 A;  4CCC A;  2C4X A;  3TYJ A;  3W9A A;  5C6C A;  2RDN A;  1BVV A;  2QCS B;  2ZXQ A;  5A32 A;  3PUH A;  4Y22 B;  5FOB B;  3I3M A;  3GAL A;  3ATG A;  4UWD A;  3VKM A;  1S0C A;  4N9I A;  1W2N A;  4AVB A;  1QOO A;  2R1B A;  4A3X A;  1KD7 A;  4Y26 A;  2HWD 3;  4Z82 A;  1LCL A;  4W65 A;  2ZGT A;  1W6P B;  4PI0 A;  1BZW A;  1U5Y A;  5K4L A;  3PU3 A;  3VHO A;  2VZT A;  4AFB A;  4CUB A;  3N4M A;  2DDU A;  4XUP A;  1CAW B;  5A3L A;  2WS9 2;  3P5B A;  2Q5T A;  5F3G A;  2ZAH A;  1C28 A;  3D5O A;  3ZIW A;  5EP9 A;  2VO5 A;  3V0B A;  1AX2 A;  1XNT A;  2WFF 1;  2KR2 A;  1H6X A;  4B29 A;  4FVV A;  4EN9 B;  4XYX A;  1R08 1;  2WO2 A;  5LY2 A;  1B35 C;  1BLZ A;  1O8P A;  2O8O A;  3K46 A;  1KGY A;  1H2L A;  2YPJ A;  2AGS A;  2DWR A;  2BEO A;  2NM1 A;  3KVA A;  4XPV A;  3NV3 A;  4L0P A;  3O1P A;  4XAC A;  4FP3 A;  3JUU A;  4P9Y A;  1JN2 P;  3OUH A;  3WNP A;  4FTB A;  2ZEZ A;  1YUD A;  2TUN A;  3T1M A;  2WDB A;  5ABJ A;  2VME A;  3O1O A;  5I0T A;  5BNO B;  3R05 A;  3AP9 A;  4D6S A;  5F32 A;  1WW6 A;  4CXX A;  4O65 A;  3PU8 A;  1PGS A;  1BBT 3;  2CHH A;  3AKR A;  4NHY A;  3WW1 A;  1XU2 A;  3ACF A;  4KG0 A;  4EZ4 A;  1PHM A;  4ERO A;  3BTX A;  1WCS A;  2ZHK A;  2JX9 A;  4BQ5 A;  5FYM A;  1CZT A;  1NE6 A;  3NNG A;  3AP4 A;  1PIV 1;  2W08 A;  4KWL A;  1UZV A;  1F5J A;  5K7P A;  5LBF A;  1VBE 2;  1WUV A;  4LIU A;  1NT0 A;  4AWD A;  3E5Q A;  4UW4 A;  4YGC A;  4LBL A;  4I3G A;  3J26 N;  4FPG A;  4UI9 L;  5FZF A;  4XXP A;  3AC0 A;  1F35 A;  5A7S A;  3TEY A;  4MHU A;  3IAP A;  4N53 C;  4XIO A;  2BRT A;  2WRA A;  1COV 2;  3POG A;  3S6P A;  3VHR A;  4HL0 A;  3MZH A;  3TEW A;  3D8C A;  1AX1 A;  1XNK A;  3ZN4 A;  3CJI B;  2DU0 A;  2FCU A;  4GB3 2;  2J22 A;  1EAH 1;  4W6Y A;  1ODN A;  1BXH A;  3WEZ A;  5KXB A;  3F95 A;  4LMF A;  2W1Q A;  1QOS A;  2X29 A;  3PUA A;  1NXD 1;  2QE3 A;  4HN0 A;  5HPO A;  1XU1 A;  1UZW A;  3VZO A;  5GZC A;  4HMZ A;  3AXE A;  2WO1 A;  3DEM A;  3FLR A;  2UY9 A;  1O7F A;  4OMC A;  1IS3 A;  2JIJ A;  1Z7S 3;  2CGP A;  4IER A;  5LA1 A;  1LEN A;  5CYY A;  3WP4 A;  3PUI A;  4FPK A;  4OUM A;  1BMV 2;  4B1L A;  4Q4X 2;  3BYW A;  3KGL A;  4JGZ B;  1Y3T A;  4NR1 A;  5KXD A;  5C3R A;  1YIF A;  5FZ8 A;  4BMB A;  2WAA A;  4XHX A;  5FLH A;  4MXV A;  4LO6 B;  1GWM A;  4XE9 A;  1SG3 A;  1W8N A;  2GN7 A;  3VD3 A;  4JGY A;  1HQW A;  3P3P A;  3VBS C;  3U0Z A;  2G1M A;  2ILM A;  1W6M A;  2VAU A;  3HBK A;  3NNJ A;  4DEV A;  2ZCW A;  3RI8 A;  4RSU A;  3ECQ A;  2GMP A;  4D6R A;  1MZ5 A;  4ASK A;  3KT1 A;  2WNV A;  4EJR A;  1RUJ 3;  2D43 A;  2F17 A;  5FLJ A;  2Y6L A;  3ZYP A;  1AL2 1;  2DVF A;  4HBN A;  1OOP C;  4ZON A;  1Y9G A;  1J83 A;  1I1E A;  4F7Z A;  2KA3 A;  1YO8 A;  3K2O A;  5HXM A;  1RUE 3;  2VZS A;  3VD5 A;  4Q8L A;  2B42 B;  1S0D A;  4QD2 A;  4Y1U A;  4BQ4 A;  1A3K A;  5DUU A;  5FV3 A;  4GWI A;  1BVP 1;  2RR1 2;  4P9X A;  4QDS A;  4MLO A;  3UKT A;  3J4U H;  1HJG A;  5FRA A;  3ZYJ B;  1G9B A;  1Q8S A;  3VBO B;  1ZNP A;  2B39 A;  3H9A A;  2D3S A;  4XCA A;  4AEJ A;  4RN5 A;  3ETP A;  1SLL A;  4BH9 A;  1T6G C;  1JBC A;  4HLT A;  2V09 A;  3ILR A;  2XDV A;  3NNM A;  1V9U 1;  4PIY A;  2ES3 A;  5C4W C;  1OQE A;  1PZ7 A;  1X50 A;  3WF0 A;  3WQB A;  3ZSM A;  3LPG A;  4B7K A;  1HDK A;  2OZ6 A;  3CEW A;  5FZK A;  2VZV A;  2WWJ A;  5C8C C;  4IGP A;  4Y33 A;  1OI6 A;  2WQ8 A;  2XLF A;  3SH5 A;  3M4F A;  3I2I A;  2VOW A;  2YGM A;  1PIV 2;  4BQ1 A;  4CCO A;  1VBC 2;  2XJT A;  3HN1 A;  5FY0 A;  1DU3 D;  1GZ9 A;  2VL4 A;  4X8N A;  3PME A;  4BDV B;  4CDW A;  1YI7 A;  1QOT A;  3N7L A;  4NIA A;  2WFF 3;  1C8M 2;  1I3H A;  4YG6 A;  3ZFG A;  5DDJ 2;  2FDI A;  2JEC A;  2CAU A;  1XE0 A;  1GR3 A;  2A6X A;  3ZYH A;  1VRB A;  5FPX A;  2DVG A;  2K46 A;  2JDP A;  4Z1V A;  1XQN A;  1NYW A;  4LO8 A;  4NAO A;  4WVW A;  3RZK A;  2Q1M A;  1OMI A;  2RS1 3;  3NW4 A;  4ZS2 A;  1UD1 A;  3A22 A;  4AI0 A;  2L9L A;  2C0Z A;  1MAC A;  1VBD 3;  4ZY9 A;  4NRP A;  3FHI B;  1JYW A;  4YZ2 A;  3GZT B;  1GKB A;  4A42 A;  3U1X A;  4NHL A;  3WHU A;  3GNE A;  3BTZ A;  3O1M A;  3Q8B A;  5T5L A;  1RUG 1;  2P6C A;  1S0E A;  3EXU A;  3ZSL A;  3MBW A;  3HMY A;  2H6B A;  2WYF A;  4Y20 B;  5FFO C;  3AYA A;  1KXG A;  3J8F 1;  2QQM A;  1PO2 2;  3M1H A;  3NJV A;  5DXD A;  2EXI A;  1VBD 2;  3K75 B;  1NLS A;  1UYY A;  1S0I A;  3NST A;  5BNN A;  2RMU 3;  3H8U A;  1LB2 A;  3WDX A;  4XFF A;  2Y0I A;  4LBQ B;  5DQ0 A;  5A7N A;  3POI A;  1GU3 A;  3RI9 A;  4FPC A;  1FV2 A;  1NCQ B;  5K0U C;  1AYM 2;  1B35 B;  2WJS A;  4QPY A;  5FR3 A;  2P5B A;  4JX0 A;  3LDR A;  2H0B A;  5I8T A;  1PO1 3;  2OUH A;  5IAX A;  2VOK A;  4LT5 A;  1UIJ A;  3DCQ A;  4QXC A;  4BK5 A;  1EAH 3;  2Q1F A;  1ZA4 A;  2VW1 A;  3PVO A;  4BK4 A;  1H0B A;  4Z07 A;  1VAL A;  2Y6J A;  2UWC A;  4A6S A;  4CDX B;  4CU7 A;  3T2O A;  1H4H A;  3ZSK A;  1CX1 A;  3VZN A;  1FI2 A;  5C3O A;  4XCB A;  5CBL A;  3L9J T;  5L19 A;  5F3E A;  2XVG A;  1QQP 2;  1GYK A;  4UF0 B;  4GJZ A;  3I2J A;  1HV1 A;  5K9Y A;  2B46 X;  4XFH A;  1G86 A;  3WF2 A;  4AGV A;  1IS6 A;  1JS9 A;  4W4Z A;  3SMH A;  4CTE A;  4OUS A;  1XXN A;  1VLN A;  2B45 X;  3HQU A;  3P3N A;  3UES A;  2EAK A;  4M3C E;  1ZBE 1;  1H2M A;  1CAU B;  2VZQ A;  5KC6 A;  3I59 A;  3NJZ A;  1VBA 3;  2B9U A;  4AVC A;  2PN5 A;  5EZW A;  3WF4 A;  3VBS A;  1F4H A;  4DRR A;  2W3J A;  1SBE A;  4CEY B;  4OHV A;  1ZZ8 A;  4OI2 A;  5JSR A;  2P1B A;  2VVF A;  2JEM A;  1PNG A;  5FBJ A;  1W06 A;  2ARA A;  3VBF C;  5IVB A;  1H1M A;  1UOG A;  5F9T A;  1V00 A;  3KCC A;  1UMI A;  3I8T A;  5A3W A;  3GZU C;  2FZ2 A;  4GZ9 A;  4Q4V 1;  4QPI B;  1FOD 3;  1UU5 A;  1V6O A;  1OA4 A;  2XLG A;  3WOG A;  3NO8 A;  2LTN A;  2BUK A;  1GAN A;  5FZH A;  4BYY A;  2W1W A;  2Y6K A;  3ZSJ A;  2BNM A;  4XJ9 A;  2SBA A;  2BGO A;  2FDJ A;  5FUP A;  5B4X A;  5FOJ B;  3OB8 A;  1OF3 A;  3PMS A;  4QHB A;  5J48 A;  5F5A A;  5GLV A;  5FTT C;  5JR2 A;  3N9Q A;  2VTX J;  1DG6 A;  2R04 2;  3K4Z A;  5KHH A;  4CDX A;  1ENS A;  2A3W A;  4IEQ A;  3WW3 A;  4QB2 A;  3OOX A;  2YBS A;  1WWY A;  1WCK A;  2B4K A;  3WW2 A;  5DAV A;  5JLV A;  5JOZ A;  1S2K A;  1VRH 1;  1B09 A;  1W2T A;  2VJX A;  3E5X A;  4N53 B;  3E97 A;  2GAL A;  3VKN A;  3MIG A;  2HWF 3;  4LKF A;  3NV4 A;  5IK4 A;  4AQ6 A;  1JYN A;  2JKX A;  1AL0 G;  3VBF B;  3N9L A;  1TZO A;  3IDE A;  4M01 A;  5IYY A;  3HOB A;  2C9A A;  4KWK A;  2X5I A;  1QMJ A;  1HW5 A;  4OHX A;  4QQ2 A;  2NLR A;  2PXJ A;  4MGI E;  4AI2 A;  4NHX A;  1FNY A;  1SDD B;  2GC3 A;  2VCA A;  3U11 A;  5CKM A;  1QGL A;  2O0O A;  1JUI A;  1UYP A;  3ACH A;  2GU9 A;  3UGH A;  2BFU S;  4NN0 A;  3HNY M;  2ZGU A;  3CZJ A;  1YLL A;  1UWW A;  4XOG A;  5A7Q A;  3J7H A;  1IPJ A;  1D0H A;  3USU A;  4JDN A;  1TMF 1;  2VC9 A;  3ZXG A;  4FCA A;  4D69 A;  3VBH C;  4CEY A;  2ZGN A;  3VUO A;  2CNA A;  4Q4V 2;  3FL7 A;  5IK5 A;  3MW2 A;  3CJI C;  2R0H A;  2YZ4 A;  3GM8 A;  3LWC A;  4Z2A A;  2HBT A;  3EB7 A;  2RS1 1;  1OKQ A;  2PTM A;  1RJ7 A;  4PBP A;  4CCE A;  3H8O A;  3FN9 A;  5T5O A;  4CP9 A;  3CU7 A;  3BCW A;  2ARC A;  4XUO A;  3KMH A;  2Y38 A;  5A70 A;  5IAT A;  4ZXK A;  3HBZ A;  5T3N A;  2ZHL A;  4R8H A;  4Y3O A;  2XKP A;  3A7Q A;  5C3S A;  2ZX3 A;  4KH9 A;  3H50 A;  1MQT C;  4RR3 A;  3POW A;  1MS4 A;  2A70 A;  1DGW A;  5LRS A;  4FPL A;  5JVV A;  4LJH A;  4EN6 B;  5FO8 B;  4N43 B;  3AKS A;  1MS0 A;  1UKR A;  3J8F 3;  4P9W A;  1LRH A;  4A44 A;  1R08 3;  1VP6 A;  4GXL A;  3UV9 A;  2VH9 A;  2MPF A;  2TEP A;  4PLO A;  1W03 A;  1KIT A;  3IWZ A;  5CVR A;  4IXL A;  2J1V A;  1PGW 1;  4Q29 A;  1W0O A;  3LF7 A;  2RS5 1;  1ZRI A;  4LIT A;  1WMX A;  5JIU A;  3BIE A;  4XQW A;  3WX5 A;  1F2N A;  2GDF A;  2PHW A;  1VBB 3;  3MIC A;  5EQU A;  4A7Y A;  4EE2 A;  4QGL A;  5A7W B;  1ZZ6 A;  4ISR A;  5C8W A;  5BNO C;  5I93 A;  5FKC A;  4JQT A;  3R4S A;  5AC9 2;  3VL8 A;  1OHF A;  1PO1 1;  1FYU A;  1QXJ A;  3I3E A;  3MO4 A;  4OUE A;  4Z92 B;  1U12 A;  2WNV C;  2AC1 A;  2QZ2 A;  3U07 A;  5LWB A;  4B8E A;  1FXZ A;  2P3I A;  2WLQ A;  1PIV 3;  4MXW B;  1W9S A;  1SBF A;  4WM7 B;  2UYA A;  2G9Z A;  1K12 A;  1SPP B;  1GP6 A;  2PYT A;  4IGO A;  2Z4F A;  4E4S A;  4QWN A;  2ZAB A;  3A0K A;  4IE5 A;  3VBU A;  1GOH A;  5TSW A;  1UKG A;  5EYX A;  2YC4 A;  1POV 0;  2NMO A;  2WT0 A;  3MPB A;  1WW7 A;  3U4X A;  1NZC A;  2JG9 C;  1OUS A;  4XF1 A;  2G4I A;  3PNA A;  1S1A A;  2VTX A;  3M2M A;  1F5F A;  4YAR A;  2QDR A;  2D97 A;  1U5X A;  1ZBE 3;  3RZL A;  4N43 A;  1BKZ A;  4CP1 A;  1VBA 1;  1LTE A;  4K1Y A;  1O4T A;  1ONA A;  1A34 A;  3NMB A;  4XUN A;  4HT1 T;  1XND A;  2YU2 A;  3DL3 A;  4DUV A;  2DTW A;  3A4U A;  5GZF A;  2WR9 A;  5FUN A;  2XJQ A;  2JWP A;  2OA2 A;  4S2H A;  2A1X A;  1QNW A;  5BNN C;  3KLS A;  4E2Q A;  1SDW A;  1JU4 A;  3ZM8 A;  5IK8 A;  4Q4V 3;  3GF6 A;  1D2Q A;  3AMP A;  4UYB A;  5A33 A;  4HKL A;  4M3C F;  2YXS A;  3FBM A;  1AR6 2;  4O9G A;  5FZC A;  4N53 A;  1X9T A;  2JDZ A;  5FYB A;  4MHR A;  1NLQ A;  2VBD A;  1TMF 2;  3WZ1 A;  4MOA A;  1YXW A;  2EIG A;  2EVX A;  2QBX A;  4H7L A;  4QX7 A;  5A6Y A;  3ZYF A;  4TSV A;  4LLO A;  3K48 A;  3ZVX A;  4LOS A;  5FYS A;  1QIQ A;  1PK6 C;  1YIP A;  4FFF A;  1E5S A;  2JDU A;  2HWE 2;  5C7G A;  1REE A;  1F9K A;  2FZ1 A;  3H1W A;  3H8R A;  1RUJ 1;  1VRH 3;  2VCB A;  4B3N A;  1AL2 3;  3CMG A;  4U36 A;  2VOV A;  2F6B A;  3THT A;  4BLI A;  2NYY A;  4OZX A;  1P8J A;  1ZRF A;  4BXS V;  3J7L A;  3WT3 A;  2XGX A;  1W9W A;  1LEM A;  5HV4 A;  5LEK A;  1GOG A;  3AL6 A;  4GKX A;  4YW2 A;  4CSW A;  5FPU A;  4UBG A;  3KD4 A;  4HVO A;  1J3P A;  1RIT A;  4L11 A;  4LHS A;  3D0J A;  1NY7 2;  3KV6 A;  5J96 B;  1PGW 2;  1TNR A;  1V70 A;  2XVK A;  1EV1 2;  1X8E A;  5AFB A;  5BNQ A;  3WR0 A;  3K3O A;  4V2V A;  3LEG A;  1TMF 3;  4RR3 B;  2XPJ A;  4NPL A;  3WQ7 A;  3T0B A;  4AFA A;  4AHY A;  1C1L A;  3ROU A;  3ZR5 A;  4IE6 A;  1V9U 3;  2BW8 A;  4I0A A;  2A5Z A;  1DQ0 A;  5T50 A;  4YSF A;  1JXN A;  2VTF A;  2VVD A;  2PHL A;  5FJK A;  5JIA A;  1C8M 3;  3OG2 A;  4CCL A;  1QKQ A;  3THP A;  5ISL A;  5HXV A;  1LKN A;  1GQH A;  2ZGR A;  1MS5 A;  2ZBJ A;  2ETE A;  2KM2 A;  2WA4 A;  1W3V A;  5K0U B;  1XRU A;  1CPM A;  2AYH A;  2R1D A;  2VUA A;  4QB6 A;  2YY1 A;  2JD9 A;  3SIS A;  4AE2 A;  3VDA A;  1UXX X;  2VE1 A;  4CDW B;  1OVP A;  1UPI A;  3WXP A;  3KQ4 B;  5F6K A;  5A1L A;  3TEZ A;  3B93 A;  3LE0 A;  4J1W A;  4AFD A;  3W21 A;  5LA2 A;  1GUI A;  5EPA A;  4FO9 A;  3S5A A;  2VUL A;  2VMC A;  3IPV B;  4PDW B;  1IQD C;  1X33 A;  2R06 2;  3WG3 A;  5JDB A;  3KT4 A;  5FWJ A;  2JDN A;  3R0R A;  3O0V A;  1ZRR A;  4FFI A;  2RS5 3;  4H14 A;  4M4P A;  4JHZ A;  1PK6 A;  1QQP 1;  3K51 A;  4LBQ A;  1PNF A;  1VBB 1;  1ND3 C;  2KXL A;  2MEV 3;  1DHK B;  2Q30 A;  4QDR A;  1SCS A;  3PUQ A;  3WP5 A;  1C4R A;  2A3Y A;  4GH4 C;  3RDI A;  5T54 A;  3MUY 1;  1GMM A;  5FP9 A;  4A7K A;  4YZ1 A;  2WYS A;  5I0D A;  1RUO A;  1RTV A;  2BVB A;  1SEF A;  3III A;  4HG6 B;  5FUI A;  3A21 A;  3O1V A;  4QPI C;  4UOJ A;  1X7N A;  1OPM A;  1RGS A;  4D8M A;  2PLV 2;  4F8A A;  5FZ6 A;  4COV A;  5EJ3 A;  1W8H A;  4LUL A;  3WP6 A;  1KRI A;  1GZT A;  3W5N A;  1O91 A;  2ZGK A;  4FPO B;  1EYB A;  3LKJ A;  2HH9 A;  3N3H A;  3EYP A;  1RUH 1;  4QPG B;  1QH6 A;  3IMM A;  5LA0 A;  3NNL A;  4K40 A;  5FP4 A;  3NJY A;  4D94 A;  2PFW A;  4RGG A;  2CL2 A;  2ET1 A;  3SCH A;  4EV0 A;  5LRR A;  5ABJ B;  1K5J A;  4AF9 A;  3BPZ A;  1PVC 2;  3Q8E A;  1N1Y A;  4N43 C;  3EMR A;  4CU8 A;  1LHO A;  3OD0 A;  2W0X A;  4IEU A;  3CKH A;  4KG8 A;  3TOJ A;  4XJ8 A;  5CIS A;  1AR6 1;  3LQC A;  4Q4X 3;  3R4U A;  1S0J A;  1QHD A;  2E7A A;  4IE7 A;  5K0U A;  2F4L A;  1ASJ 1;  2FBE A;  3Q8A A;  3HIF A;  1TVG A;  1JI6 A;  1IQA A;  4LQR A;  4NRQ A;  1MQT A;  4RR3 C;  4GJY A;  4XFA A;  2VZP A;  5FMD A;  1VB2 A;  4FAH A;  2EID A;  3T30 A;  4W50 A;  2OUJ A;  4WZC A;  3THC A;  1NQJ A;  4FFG A;  4R9D A;  5I8Y A;  4AHZ A;  3SCF A;  2HYK A;  3HPN A;  3GBG A;  3WG2 A;  4AGR A;  3IDA A;  3K3N A;  4UFJ A;  3VZM A;  1QWR A;  1CWP A;  5KHJ A;  3MUZ 1;  5LA9 A;  2VMD A;  2ZS6 B;  1POV 1;  2D6L X;  3AFK A;  2VMI A;  4RGK A;  1C5I A;  5CNA A;  3ZFG B;  3VBH A;  1QJU 1;  1TE1 B;  1FOD 2;  3KS7 A;  4KWJ A;  2HEY F;  4XFI A;  5FJH A;  4YM1 A;  1ALY A;  5IFT A;  4CCM A;  1DGR A;  2UWA A;  2SLI A;  2GH2 A;  1YQ2 A;  5FZ9 A;  3PIJ A;  2DVD A;  4YVW B;  4LO4 B;  2AEN A;  2D6P A;  1K5M B;  1KDM A;  2D93 A;  4NPR A;  4DQA A;  5BNP C;  2V4V A;  3U78 A;  2R32 A;  2YDE A;  3HD8 B;  1FOD 1;  1OLM E;  1XNB A;  4HZF A;  4P9I A;  4CCK A;  4Y4R A;  3HN3 A;  5T52 A;  1AZD A;  3ZFG C;  1O8S A;  4OHZ A;  1UU4 A;  1TEI A;  5DPN A;  3QH6 A;  2WZ8 A;  1UZ0 A;  3VB9 A;  5DAB A;  2BZD A;  3QAC A;  1W2O A;  1R09 2;  1QH7 A;  1SLI A;  1K42 A;  3OJB A;  2B8M A;  3B02 A;  3RWK X;  4HKO A;  3S7I A;  3ZIX A;  3FMG A;  5EYY A;  2R07 1;  2DBI A;  1VAM A;  4CUC A;  3ETQ A;  1WGP A;  3ZX7 A;  4XET A;  3FFZ A;  4BQ2 A;  4ZU4 A;  4N8M A;  4YW6 A;  4O9E A;  1WZX A;  3BU7 A;  4NJ4 A;  5LAT A;  5I0R A;  5JZG C;  3T08 A;  3J8F 2;  1MS3 A;  1IPK A;  2DV9 A;  2ZAC A;  3JBG 1;  2B9V A;  2ZMK A;  1C8M 1;  1OPO A;  3AKP A;  4FFH A;  5M0T A;  4LLF A;  3SH4 A;  1M4W A;  1AYN 2;  5FZ0 A;  2AUY A;  4CPB D;  3JQX A;  4WM8 C;  4KL1 A;  4A4A A;  1WMD A;  1XSR A;  2Z42 A;  4GAL A;  1GNH A;  4XF3 A;  2QVS B;  3AJZ A;  5DUX A;  5C9A C;  3UL2 A;  1LOD A;  1GZW B;  3WDV A;  3ABZ A;  1MZE A;  4URA A;  1Q8V A;  1IS5 A;  1UOF A;  3RJR A;  4HOO A;  2VNV A;  4HVR A;  1LED A;  4FPH A;  4X6Q B;  2W91 A;  1K5M A;  2WSU A;  3VZK A;  2JB4 A;  3TB0 A;  4GD4 A;  3ME2 A;  3MIB A;  4PF5 A;  1CD3 G;  3HQX A;  1LOB A;  2OXB A;  2CGN A;  4LK7 A;  2VZU A;  3C7F A;  4HK8 A;  4YPJ A;  2Q8O A;  4AQS A;  1QF3 A;  2DCJ A;  5APA A;  2DCT A;  1JYC A;  1QQP 3;  2IWG B;  4KNC A;  4XTM A;  3TWI A;  3URF A;  5F7U A;  1NCQ C;  2MEV 1;  3AMM A;  4CDX C;  3ZDS A;  4E4D X;  4DPN A;  2DUR A;  1GFF 2;  1YC6 1;  4KWU A;  3UNP A;  1RVF 3;  2BGC A;  3BUC A;  3OGG A;  3POE A;  3G7D A;  1PMH X;  1L7R A;  4QXH A;  4AR2 A;  3LGR A;  3OBR A;  5LK7 B;  1RL3 A;  5A7W A;  1PZ8 A;  2IVI B;  2HWC 1;  4JDO A;  2XWJ B;  1KQR A;  1F31 A;  5GZD A;  3WV6 A;  4OQ8 A;  3ILN A;  1MZ6 A;  4IV1 B;  2E33 A;  2GSY A;  3WP3 A;  3ZXE A;  2QUO A;  3FHA A;  4BE3 A;  1AR9 3;  1DLC A;  5CFD B;  4FI9 A;  1W6Q B;  4QQP A;  3WHT A;  4IEW A;  4YM2 A;  4GH4 A;  5FP8 A;  4QXK A;  3RZM A;  1VBC 3;  1Y9M A;  5IVV A;  2CY6 A;  2EAA A;  3KGZ A;  4Q27 A;  4XXA A;  3T1L A;  3KCY A;  4XUT A;  1HIX A;  2BWA A;  1IG0 A;  2OZJ A;  3QLQ A;  3KV5 A;  2ZJC A;  3ZN5 A;  1JZ4 A;  2GC2 A;  4Y5Z 0;  1UOB A;  1KFX L;  1R09 1;  1UQX A;  5FPA A;  4A2U A;  1AR6 3;  1ND2 A;  4Q4X 1;  1BBT 2;  4ES8 A;  4R9B A;  2HEV F;  2VUD A;  2BNN A;  2Y60 A;  4RHV 2;  2NQY A;  1CN1 A;  1W05 A;  2DCY A;  3VL9 A;  3GDB A;  5L7O B;  2VQT A;  3H3L A;  3DKW A;  1LGB A;  2VOX A;  5BPX A;  1HB4 A;  5G04 L;  2HWE 1;  4XAB A;  1RMU 1;  1VBB 2;  1O4Z A;  3PDQ A;  5J36 A;  2P3Y A;  2EXK A;  5B4N A;  1RVF 2;  1JW6 A;  3JCI A;  2MEV 2;  3RYP A;  2P34 A;  1UN1 A;  5FZO B;  5A7O A;  4LBK A;  4U2A A;  1GSL A;  1VR3 A;  5FYU A;  4MO3 M;  3ZYR A;  4HSJ A;  1H9P A;  4CEY C;  3MIE A;  2Y34 A;  2Y26 A;  5DZF A;  2W1S A;  4MET A;  1QEX A;  4QKD A;  1US3 A;  2GMM A;  3MID A;  4QAW A;  1W28 A;  2CV6 A;  2NN8 A;  2W1U A;  3BAL A;  5CB7 A;  3MFC A;  4IEP A;  3NKG A;  2CWM A;  2D3P A;  4Y1V A;  1WLC A;  4NO4 A;  4AOC A;  1PX4 A;  4YGB A;  1XPW A;  5FZL A;  3RZG A;  4BB3 A;  2GH8 A;  2DU1 A;  4UFL A;  3Q8F A;  4I0B A;  5EWS A;  2C9K A;  3I4I A;  3UJQ A;  1VBA 2;  4QX1 A;  1IS4 A;  2YC2 A;  5D8A C;  1W2U A;  3D6E A;  3IZO A;  1AJO A;  3E1F 1;  1MS1 A;  3JBG 2;  4P5Y A;  1SAC A;  4FAG A;  3W5M A;  2E53 A;  3RJ2 X;  3ELN A;  1OT5 A;  1NE4 A;  2OII A;  2QKD A;  3D82 A;  3I59 B;  1J1T A;  4TLF A;  3HQR A;  4W6X A;  3TAY A;  4AFC A;  1H4G A;  2QQK A;  3PVN A;  4W6W A;  3ZXJ A;  3CHX A;  4AFM A;  3RQ0 A;  5J37 A;  1XSQ A;  2VQA A;  1LUL A;  3CO2 A;  1RUC 2;  5BV6 A;  1RMU 2;  4RS5 C;  1R1Z A;  1IKQ A;  1EPW A;  2W9X A;  4YW3 A;  5FP3 A;  5CFC A;  4JKK A;  4BZ4 A;  4FPF A;  4PCR A;  4CEW B;  1WMF A;  1QNY A;  2AR6 A;  3AMQ A;  2OYZ A;  1VAK A;  4BHP A;  4IDZ A;  5FPL A;  1RUG 2;  3ST7 A;  5FZM A;  4BIO A;  2Y6F A;  2JG8 B;  4WZF A;  4COZ A;  5BYN A;  3BB6 A;  5DUW A;  4ARX A;  2WZE A;  4BXF A;  1UY3 A;  4NVP A;  3IMN A;  2OS2 A;  3LDK A;  3PVE A;  3WDT A;  4CEW C;  2GC0 A;  5EHD A;  3VBU C;  5A1F A;  1JYV A;  5FRE A;  3J7N A;  1RHI 3;  2ZKL A;  3EHK A;  1NX9 A;  5HCF A;  4YZ5 A;  3ACL A;  1UY1 A;  3DKQ A;  1Q8P A;  4AED A;  5IVF A;  2X5I B;  3FHQ A;  4ONU A;  4BCU A;  5F37 A;  5F6L B;  1G9D A;  1NCR A;  4H2A A;  1CAW A;  2WII B;  4UF0 A;  3UYJ A;  1QJY 1;  1V9U 2;  3A23 A;  2CDP A;  3N36 A;  1Z7S 2;  1DBN A;  4PJY A;  2E6V A;  2ARE A;  5C3P A;  3ES4 A;  3BTY A;  2ARX A;  3VBR B;  2V4A A;  4KBZ A;  4CDQ C;  2D7F A;  2JXA A;  3A0N A;  3ASI A;  3VDD B;  4FBF A;  1OD5 A;  2DYC A;  2ZEW A;  3JB8 A;  3VV1 A;  4ZXE A;  3KV4 A;  1H8V A;  5ANN A;  5HCA A;  5FDB A;  3FX3 A;  3R4D B;  1HRV 2;  1UZY A;  3U10 A;  4EWE A;  4AAP A;  3NL1 A;  5F1R A;  1MS8 A;  4P5H A;  4QX0 A;  4YFW A;  2HWC 3;  1W2A X;  2XON A;  5J1X A;  3AKT A;  3RZH A;  3PTY A;  2DUO A;  4UFK A;  3IB3 A;  4PI2 A;  3O1S A;  1QDO A;  2RS3 1;  4CCJ A;  5FXZ A;  3V64 A;  2R06 1;  5FZI A;  4AL9 A;  4NRO A;  5F2S A;  1LAJ A;  3O0X A;  3TBD A;  4C1X A;  1XYP A;  3E6D A;  3RYK A;  1DCS A;  3RG0 A;  1CAU A;  1ULF A;  2WS9 3;  2QJV A;  4QU1 A;  1VMH A;  1VBC 1;  1XYO A;  5FMC A;  4JGY C;  3BOW A;  1DZT A;  3FC0 A;  2Q4S A;  4O61 A;  3OY8 A;  1VIW B;  3VBS B;  1CAX B;  4R52 A;  2IXI A;  4I01 A;  4B4R A;  2JD4 A;  1OC1 A;  1UOJ A;  3WUD A;  4YM0 A;  2W87 A;  1SLA A;  5IAV A;  4COY A;  4OI4 A;  4YZ3 A;  5KWR A;  2Z69 A;  3B3Q E;  2D6N A;  2PLV 1;  1KJR A;  4LUM A;  2HKX A;  3WNL A;  4XBL A;  3S7E A;  5DZE A;  4WM7 A;  1AYM 3;  1W6N A;  2ZHN A;  3H1M A;  2BNO A;  3QBQ A;  1RUH 3;  4QT6 A;  4BQW A;  2BU9 A;  4B4Q A;  1RMU 3;  3HNM A;  5FY4 A;  1CAV B;  4GMP 1;  4UFM A;  4AVA A;  3BGA A;  5BNP B;  1FAT A;  3MIH A;  1QJF A;  4RQP C;  4ATE A;  4A7Z A;  1NA1 B;  5A6X A;  2ATF A;  3TEX A;  5GLZ A;  4AVT A;  4LR4 A;  4TLG A;  3CL1 A;  4XJU A;  5EFU A;  1GWK A;  2G19 A;  3AYD A;  1DIW A;  2WLP A;  5D2A A;  2BOI A;  2J42 A;  1ASJ 3;  4L99 A;  3SHR A;  1XNA A;  3JD7 2;  4WVM A;  4ZKT B;  1G7Y A;  3WD5 A;  3RYR A;  2XJP A;  3KVB A;  4S2G A;  3H0O A;  1W90 A;  5EJZ B;  4NHM A;  4C0H A;  3CF6 E;  1H1A A;  4YVS A;  2CWS A;  4JTO A;  4NRM A;  3I3B A;  3AVR A;  1RYY A;  5JPM B;  2VGD A;  4QX8 A;  3SLI A;  2ZMN A;  4OLL A;  4QX2 A;  4GB3 1;  4YW4 A;  1LHV A;  2AZ5 A;  1JZ6 A;  5DG2 A;  4H7M A;  4QKN A;  1DYK A;  1POV 3;  1AR9 2;  3KWV A;  4D7S A;  1QJU 3;  3CIH A;  1OH4 A;  3I2K A;  4OMD A;  5IVY A;  5CA6 A;  4BOW A;  1MEC 2;  3IDB B;  2DUP A;  2QZ3 A;  3AP5 A;  1CR7 A;  2QQN A;  3MI8 A;  2EXJ A;  4M3C B;  4OFG A;  3UJO A;  1J59 A;  4MGT A;  5JPN B;  1OQD A;  4CXY A;  4LUK A;  4RS5 A;  1JOJ A;  3LB9 A;  1QU0 A;  3MV0 1;  4UFH A;  4OHY A;  1CGP A;  4X6R B;  1PZ9 A;  4IEY A;  2UY8 A;  2JIG A;  2P6H A;  3OPZ A;  5FPV A;  4W8J A;  4FXK B;  1G9A A;  2CAV A;  2WO3 A;  5KHK A;  2VNR A;  3TRS B;  2EF6 A;  4DO0 A;  4EQV A;  1VMF A;  2QNK A;  2IXH A;  1QJX 3;  3LSD A;  2A73 B;  3RMY A;  2R07 3;  4N9H A;  4PLM A;  3SXW A;  4CP2 A;  4P08 A;  3SCG A;  5IWF A;  1ENX A;  1RHI 1;  4LBM A;  3M3E A;  4BPZ A;  2DUQ A;  1SQ4 A;  3NV2 A;  5DAX A;  1O4Y A;  1WLT A;  1UPS A;  1CX4 A;  1SPP A;  5J7M A;  3O14 A;  5J3U A;  2J7M A;  3POY A;  4Q0Q A;  1TNF A;  3JBG 3;  1PO2 1;  3ZMN A;  1Q43 A;  2ZX1 A;  1LOG A;  1HQN A;  2RJL A;  4Q0P A;  4CCN A;  2UU8 A;  2JDM A;  4IV3 C;  1SZB A;  2VUJ A;  3LEK A;  2ZZQ A;  2DTY A;  2HWB 3;  4K21 A;  4KU7 A;  3AJY A;  3GHM A;  3OBA A;  4XFC A;  3N7K A;  1HXS 1;  4N7I A;  1GV9 A;  2ZGM A;  5CAZ A;  1JHN A;  3P6B A;  4XJZ A;  1RUF 2;  3I2D A;  2RG4 A;  4XFG A;  3PUR A;  2EA7 A;  2BDR A;  2QDN A;  2P37 A;  2ZEY A;  5FQ0 A;  5E6H A;  1BK0 A;  1STM A;  1JZ7 A;  2PAK A;  4FOV A;  4DXS A;  4AHW A;  2V73 A;  2HWF 2;  4V2W A;  4P9L A;  2RS3 3;  4QQO A;  3WNN A;  1W8F A;  2I45 A;  4C8D A;  2R06 3;  1C1F A;  1IPS A;  1W6O B;  4K8R B;  4LIV A;  3TN9 2;  4MGY E;  1W0N A;  2BPA 2;  2A6Z A;  3THD A;  3CQO A;  3SQO A;  1DQ6 A;  4CPB A;  4LKD A;  5ABJ C;  2JKB A;  4LK6 A;  5IW0 A;  5T5J A;  1NKG A;  3VBU B;  1SLB A;  1RVF 1;  1OF4 A;  1BJQ A;  1JZ8 A;  5BUV A;  1DF0 A;  1H6Y A;  4IV3 B;  1FNZ A;  1GLH A;  2W95 A;  3TNP B;  5C9A A;  1AXY A;  5FZB A;  4WVV A;  1ZBA 3;  3ZXA C;  4DOU A;  1YNA A;  5FWE A;  4Y5T A;  5FYV A;  2XJR A;  2CYF A;  5FMO L;  2IFR A;  2WWU A;  4NMI A;  2TBV A;  3QOP A;  5F5C A;  3NVC A;  2VCC A;  3DPR B;  3WQ1 A;  3IM0 A;  5JXG A;  1CJD A;  2GZW A;  5CG8 A;  4YLZ A;  2Z5W A;  1XE7 A;  5D8A A;  5A3M A;  1YQ5 A;  1AR9 1;  3C2U A;  4AVV A;  2D40 A;  5GLW A;  5AC9 3;  4JRL A;  2JG8 C;  1UF2 C;  4AEM A;  4G9S B;  2XL9 A;  3LD8 A;  3DPR C;  3SKV A;  5DZG A;  4SBV A;  1BCX A;  2BFU L;  4HSL A;  3B01 A;  1OA3 A;  1B35 A;  1ST8 A;  2DVB A;  4XW3 A;  2VZR A;  4JDM A;  5GLU A;  2WN2 A;  4CDQ B;  3ZFE A;  4MG2 A;  1R09 3;  3AL5 A;  3UKV A;  3UGF A;  2R49 A;  4NHK A;  3HT2 A;  2XB6 C;  4IE0 A;  3SNM A;  3WCR A;  4L92 A;  1XC6 A;  4LE3 A;  5FMB A;  4EN7 B;  3ENR A;  1QJX 2;  1AUY A;  3PJQ A;  5FAX A;  1AL2 2;  5FMO S;  4CE8 A;  3AZV A;  3KQR A;  1WKY A;  2YFZ A;  4FSJ A;  3UGG A;  3VLB B;  1IG3 A;  2HWE 3;  1YQ8 A;  2XOM A;  1WW4 A;  3ZOI A;  2NMN A;  3AVS A;  3H7Y A;  1YFU A;  5C9A B;  3LPF A;  4GB3 3;  3OGJ A;  3DPR A;  4A41 A;  3ZFF B;  1WBF A;  3POS A;  4UT5 A;  1RUH 2;  2FQP A;  5LW9 A;  3RS6 A;  3NQH A;  5FZ4 A;  1TME 1;  1G9F A;  1PGL 2;  1CAX A;  4LBO A;  1MEC 1;  5GAL A;  2MNG A;  3WCS A;  5LCW L;  4YGE A;  2C6S A;  3LIH A;  1MQT B;  5FZ3 A;  1SFP A;  1WD4 A;  2ZA9 A;  2EIE A;  3GZA A;  4R4Z A;  4KBB A;  2LS6 A;  2ZPX A;  4BIS A;  1US2 A;  4ET7 A;  1BK1 A;  4Z8B A;  1IOA A;  3V0B B;  1H8T A;  1ZZC A;  1V6N A;  3CZU A;  3AXD A;  4L8Q A;  1OA2 A;  2CTV A;  4NE9 A;  5LB6 A;  1D4M 1;  3ACG A;  4WM7 C;  3SH3 A;  3JD7 3;  4HKW A;  1DP0 A;  2PAE A;  1DGL A;  3EJK A;  5JXH A;  1MS9 A;  2A75 A;  1QJX 1;  2RS3 2;  2BBV A;  3KCX A;  1JTZ X;  1WCD J;  5L9V A;  2JG9 A;  3HAG A;  4CXW A;  1KJL A;  4LNV A;  3SEP A;  1Z78 A;  1A6C A;  3KB5 A;  1ACC A;  2V72 A;  4NAM A;  2Y33 A;  4OYU A;  4ASL A;  4K6B A;  3DYM A;  5FYY A;  1CZS A;  1HN1 A;  1Y43 B;  2I07 B;  3LOI A;  1VPH A;  4I0W B;  4MH0 E;  5JI7 A;  1UX7 A;  4AI8 A;  1VBE 3;  4XUQ A;  3AZZ A;  4QKB A;  4GAZ A;  4PBO A;  1W6N B;  3RGB A;  4D7Y A;  3EO6 A;  1DLL A;  1LR5 A;  4WVM B;  1X82 A;  2RV9 A;  1Q8Q A;  3IDC B;  4M0H A;  4CDU C;  1KS4 A;  2D98 A;  2I74 A;  4XVH A;  2HWB 1;  3C7O A;  1RUI 1;  3M8L A;  4K1Z A;  2PQS A;  1AR8 3;  3JXS A;  4IV1 C;  3WNX A;  2VOT A;  3VBO C;  2DCK A;  1O5L A;  5CFD C;  5CEH A;  3DEC A;  4PLN A;  2WT1 A;  4GMP 0;  2QQU A;  4NUB A;  1LU2 A;  4DRV A;  4I30 A;  3B00 A;  3HEI A;  2QQP A;  1NY7 1;  2IXK A;  4CUA A;  1JYT A;  1NA1 C;  1H8T B;  2IVJ A;  4Q4W 1;  1NUK A;  1E5I A;  5FYT A;  2AEY A;  3DYO A;  4IES A;  2R07 2;  2QFE A;  5B2G B;  2RS5 2;  2NZ9 A;  2X09 A;  4S2D A;  5CKN A;  2W94 A;  4IEO A;  1QJY 3;  3B9C A;  1ULO A;  1UIK A;  1G6N A;  1E5H A;  1T6B X;  2ZZJ A;  4HPK B;  4LE4 A;  3NAP A;  2IXC A;  2WUH A;  4YVW C;  4AAX A;  3LZZ A;  1JOP A;  2VZO A;  4YW5 A;  1CIW A;  1E5R A;  1O6U A;  1SLT A;  1AJK A;  2ARB A;  2OQ7 A;  3C7H A;  3ORJ A;  3AMH A;  4Y1Z A;  3OBZ A;  2BVV A;  4XDQ A;  4E2S A;  2YMZ A;  1JMU B;  3JU9 A;  1H8T C;  4IEV A;  5LBE A;  1ZBA 1;  4LPL A;  1CPN A;  5FY9 A;  3W59 A;  2VVE A;  4JAA A;  4YVS B;  1RUF 1;  1HJF A;  1RUE 2;  2HYX A;  2W92 A;  1HRV 3;  2ZGP A;  3GHN A;  4YWA A;  5KR7 A;  5GJ6 A;  1EUU A;  4Q4Y 1;  4CCD A;  3AX4 A;  2AAC A;  3RWN A;  1EUT A;  3OGV A;  3NJX A;  1K3I A;  2VQU A;  4F83 A;  2KD7 A;  2JDH A;  3OCP A;  5A80 A;  4PIX A;  3WDU A;  4S2F A;  1WBL A;  1OOP B;  3I2F A;  4LEJ A;  5FXX A;  1WA4 A;  2WS9 1;  1V6J A;  1KDK A;  2WKK A;  3I3D A;  2XXZ A;  4Z2W A;  1UMZ A;  1VE0 A;  2LW8 A;  2ZAA A;  1ZRD A;  2XG3 A;  3M3I A;  1ND3 A;  1RED A;  4DUW A;  3WIN E;  2D5F A;  1LNS A;  1BYH A;  2F4P A;  4QPW A;  4MX3 A;  4QKF A;  4ES9 A;  2ID4 A;  1D0G A;  4NIH A;  1A8M A;  1LOA A;  2PLV 3;  4EN0 A;  3K77 A;  5FPZ A;  4AVS A;  2Q8C A;  1DGR N;  2WZR 3;  1YFY A;  4GA9 A;  4RFT 0;  2Q8E A;  3IBM A;  1AYM 1;  2C1F A;  4P9G A;  1XB9 A;  3UT0 A;  4CDW C;  4GMP 3;  3LEM A;  2ZX2 A;  4X8P A;  2D3R A;  3CDZ B;  2XLA A;  4R4X A;  2E31 A;  4PF1 A;  4HVQ A;  3HT1 A;  2PMW B;  3NAP B;  3M3C A;  4KMQ A;  2P17 A;  4RQP A;  1YFX A;  3WF1 A;  1LOF C;  3HJR A;  4C90 A;  4TN7 A;  5DN2 A;  2OPW A;  4OZO A;  5I0U A;  4FPY A;  2OT7 A;  1YHF A;  2JG8 A;  4L97 A;  4H3W A;  1HRI 1;  1GZC A;  4FQ4 A;  4XDP A;  4JCK A;  1O3R A;  3KT7 A;  1PO1 2;  2DVA A;  3GJB A;  1OXC A;  1Q3E A;  4QM8 A;  4DXR A;  2O1Q A;  3MF9 A;  4QU2 A;  1FAY A;  3ZKU A;  4DXZ A;  4ZPI A;  2RM2 2;  3FFQ A;  1AF9 A;  2J1A A;  3O12 A;  4QMA A;  3OGR A;  5F39 A;  1LEC A;  2WN3 A;  1YYN A;  2A6V A;  2GC1 A;  2PHT A;  3WDY A;  2RDR A;  3B69 A;  2BGP A;  1EY2 A;  2J1U A;  3WNM A;  2FCV A;  1WCU A;  1D4M 3;  2XML A;  2X5I C;  2QQI A;  1J3R A;  5FY7 A;  3L2Y A;  1ULP A;  1BHG A;  3JD7 1;  4JQR A;  3VDD A;  3GCW A;  2VPV A;  3H3Z A;  3LEI A;  5HCB A;  4F3J A;  2VMG A;  4AQ2 A;  1H30 A;  2JIC A;  3U37 A;  3RRD A;  1L7Q A;  5AFE A;  1U5I A;  2GND A;  4KGQ A;  3ES1 A;  3MGU A;  4L2N A;  4E2G A;  4E4H A;  1UX6 A;  5F2W A;  1DYO A;  4YM3 A;  2JE7 A;  2HWC 2;  1ZRE A;  3GYD A;  4JGZ C;  2BER A;  3ZFE C;  4AYU A;  3T4V A;  4YW1 A;  4P9J A;  2HEW F;  1JZ5 A;  1WME A;  3I49 A;  1O3T A;  2PQQ A;  4LHL A;  1FT9 A;  2XBO 2;  4JKM A;  3MYX A;  2VY0 A;  4XMA A;  4AI9 A;  4WBB A;  2AEZ A;  3ZN6 B;  2XJV A;  2FMD A;  3OD4 A;  5T5P A;  3RSJ A;  3ZPY A;  2NPI A;  1KS5 A;  1NZI A;  1S55 A;  3E6B A;  1RUI 3;  2ZHM A;  4Y4Y A;  2Y64 A;  1LHW A;  4CDQ A;  1AR8 1;  2Y6G A;  3BU0 A;  4CUG A;  4OI0 A;  3M7A A;  2FDF A;  3IPV A;  4RL7 A;  2H6C A;  4XF9 A;  4N7U A;  3T0A A;  3BI3 A;  3ZR6 A;  4QQL A;  1RUJ 2;  3OYW B;  3V56 A;  1ZM1 A;  4Y1X A;  2BYV E;  4YRD A;  2D44 A;  5DUV A;  3ZDV A;  3VKF C;  2VZ3 A;  4D6Q A;  3T2T A;  2FD8 A;  1JOB A;  5A3N A;  1DQ5 A;  1GIC A;  4GH4 B;  2WAO A;  1AX0 A;  1W6Q A;  4XJW A;  5JUV A;  1F8V A;  1L3J A;  2E32 A;  1PO2 3;  5FCC A;  5H9R A;  3KSC A;  5ERL A;  3U4S A;  2E9Q A;  2LRP A;  4ATF A;  5CFC B;  4MZU A;  3JQW A;  1ODM A;  2V5D A;  4DMI A;  1FX5 A;  5L7O A;  1OFN A;  4IV1 A;  4GKY A;  4TZD A;  2WQZ C;  1LJ7 A;  1YCI A;  5L9B A;  1VAV A;  5A3O A;  1D7P M;  4IV3 A;  4BQ3 A;  1N3O A;  1HKD A;  4BQY A;  4CP9 B;  1HXS 3;  3OGS A;  3C7G A;  1HB1 A;  3AZW A;  2CSG A;  1XJA A;  3FLP A;  4MGS A;  1RUN A;  5CFC C;  3LCP A;  1W0P A;  1W9Y A;  4E9K A;  5FZD A;  1AR7 2;  4YW7 A;  3ITQ A;  3VGI A;  3JB4 C;  1W8U A;  3I54 A;  1OUR A;  4IET A;  3ZFF C;  3IT8 A;  3Q8C A;  4Q4Y 3;  4CU6 A;  3PIG A;  1DQ1 A;  3PUS A;  5F8P A;  2DBN A;  3PL0 A;  4I09 A;  4CZS A;  4JVA A;  4ZZ5 A;  3N35 A;  2R0F A;  3CJI A;  2DCZ A;  2J1E A;  3OYW A;  4K3U A;  5JOX A;  4FT8 A;  2FDK A;  5FYH A;  3VKO A;  1COV 1;  4KU8 A;  3DV8 A;  1Q5O A;  2QQW A;  5E88 A;  5JSP A;  1QJY 2;  1N1V A;  3DGT A;  2PHF A;  2ZGS A;  5FKB A;  5KXC A;  4SLI A;  5D21 A;  2C24 A;  2HJI A;  3HNB M;  4AZZ A;  3VD4 A;  1AHS A;  1CVN A;  2P2K A;  2LRO A;  5FLI A;  4A45 A;  2XKO A;  3AK0 A;  1ZBA 2;  2G9F A;  4XEZ A;  5C4W B;  1G9C A;  2O8Q A;  2N7G A;  3MF6 A;  1XBF A;  1MR5 A;  2JG9 B;  4A6O A;  4DB5 A;  3ZXL A;  2VMF A;  5CZK A;  1FPN 3;  5A6Q A;  2J1R A;  3S5Q A;  1HB3 A;  1Y9Q A;  1NAE A;  4P14 A;  2XUM A;  1HRI 2;  5I91 A;  2EIB A;  5AC9 1;  5A33 B;  1LGN A;  3TN9 3;  2EIC A;  4LBQ D;  2YV8 A;  2B5H A;  3BTA A;  4MYE A;  1N1T A;  2YYO A;  5FY1 A;  5FP7 A;  4BLJ A;  2YB7 A;  5CKQ A;  5KBF A;  2OQ6 A;  2P3J A;  3AP7 A;  4NOT A;  3ALQ A;  4P00 B;  1D4V B;  5ACA 1;  1UY0 A;  4IE4 A;  2WNU A;  3N9O A;  5FYZ A;  4TTG A;  1LOC A;  5FQ0 B;  3MLL A;  1X36 A;  1WLW A;  5CAD A;  1W8O A;  2XHK A;  3DUI A;  3FUO A;  4XF4 A;  5H9P A;  4TWT A;  1RC6 A;  5DAW A;  3AB0 A;  2BTV C;  3C7E A;  2GP3 A;  4ZHN A;  1NXM A;  1XOY A;  3W20 A;  3AYC A;  5FK8 A;  4GWM A;  1OSG A;  4RYD A;  2EAL A;  3IIA A;  1G8W A;  5A3P A;  2WAB A;  1MPX A;  2W46 A;  5ACA 2;  4EWD A;  3ZFF A;  1RUC 1;  1JYX A;  1SBD A;  1C5H A;  1YEW A;  4PQQ A;  4URT A;  1OLQ A;  4E27 A;  4XQ4 A;  3WUC A;  2YG0 A;  4QM9 A;  1TME 3;  2ADE A;  2GNB A;  1I9R A;  1LGC A;  1RHI 2;  3MEP A;  2ERF A;  4PQ9 A;  1OVS A;  2JDY A;  1S4C A;  1MEC 3;  2IFW A;  2ENR A;  3OBT A;  2E63 A;  1QJU 2;  5E8A A;  5C4W A;  3S30 A;  5IVE A;  5IUQ A;  3G6J B;  3SEE A;  3CNA A;  4AK3 A;  3JZV A;  2VXJ A;  3D3A A;  4IW3 A;  1Q56 A;  3OEA A;  2A71 A;  4HK9 A;  3NAP C;  4QB1 A;  1OLR A;  2WIN B;  1REF A;  5FY5 A;  5ANQ A;  3B7M A;  4WM8 B;  1ULG A;  1O3Q A;  1FMD 2;  2UYB A;  1KFU L;  2XHN A;  3CBN A;  1LU1 A;  3LA2 A;  3MW3 A;  5AVA A;  1UY2 A;  4AED B;  4BQX A;  1NLR A;  3MHZ A;  1J58 A;  2VM9 A;  3GBW A;  3VBF A;  3AZX A;  2WWS A;  4BJ0 A;  1CON A;  5FZ1 A;  1RUD 3;  4J6G A;  3VZL A;  1GZW A;  3ACI A;  5HV0 A;  3LOB A;  1M06 G;  2YRO A;  3FWE A;  4EYU A;  2J1S A;  2RS1 2;  4XDO A;  1W8Z A;  5C70 A;  5IVJ A;  3T0D A;  4LO7 A;  1OOP A;  3J7M A;  2JDA A;  2VG9 A;  2DFB A;  3O5S A;  1ZZB A;  1ULC A;  5DAQ A;  1SCR A;  2WNV B;  1JZ2 A;  1SMV A;  5DDJ 3;  2WA3 A;  4AED C;  4AI1 A;  3C3V A;  1BEV 2;  4OVE A;  3WVJ A;  4MVT A;  3I7D A;  3PTR B;  1W6M B;  4ARY A;  5J09 A;  2OX0 A;  5FO9 B;  1ULE A;  1DGW X;  3OEB A;  5JWP A;  1VBE 1;  2WSV A;  3V0A B;  4QDQ A;  2RDQ A;  3KF3 A;  2Y0O A;  5SV5 A;  1MZF A;  1JYI A;  1S2B A;  5JOW A;  2XR4 A;  3NRU A;  2YC0 A;  4MGZ E;  4Q0U A;  4RHV 1;  5DG1 A;  3QH7 A;  2HWB 2;  3VHN A;  4QHZ A;  1AR8 2;  2YGL A;  4AGG A;  1JU3 A;  1GBG A;  5FZG A;  3VN4 A;  2RHP A;  2E7T A;  5JXJ A;  1WLD A;  2Q8D A;  1GP4 A;  1U5Z A;  1YJL A;  4K20 A;  4AEK A;  1UY4 A;  4Q4W 3;  3PVB B;  4DNY A;  5C5U A;  2XBO 1;  2JJ6 A;  3BOP A;  4UAP A;  4A3Z A;  1V6L A;  5A3T A;  4COU A;  3UET A;  3ZO0 B;  2R04 3;  5FBZ A;  2YBK A;  2X53 S;  2DF7 A;  4LA2 A;  5JCT A;  1ZBE 2;  2XQR A;  1C8N A;  5GKA C;  2IUW A;  2ZGQ A;  2LAL A;  4YG3 A;  4FXG B;  5FZ7 A;  1O5U A;  1VRH 2;  2GNT A;  3S0M A;  3KZ4 C;  2XH6 A;  3I2G A; 
#chains in the Genus database with same CATH homology
 1GWK A;  1GWM A;  3ZYB A;  1UOJ A;  1W9F A;  2LRO A;  3ZYF A;  4LJH A;  4YW7 A;  2Q1F A;  2WYF A;  2VXJ A;  1L7L A;  1W8U A;  2KR2 A;  4YWA A;  4BQ5 A;  4BQ2 A;  3F95 A;  4LKE A;  4YW6 A;  4A6S A;  1WZX A;  3ZYH A;  4AL9 A;  1W90 A;  2K46 A;  2JWP A;  2O14 A;  4LK7 A;  4LKF A;  1OKO A;  2LRP A;  3UT0 A;  1GWL A;  1WMX A;  1OH3 A;  4CP9 A;  1W8W A;  4CPB A;  4CPB D;  4LKD A;  1WCU A;  5D21 A;  4BQ3 A;  2C24 A;  1W8T A;  4LK6 A;  1V0A A;  3ORJ A;  1W8Z A;  4CP9 B;  4BQ4 A;  1HN0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...