1WMXA

Crystal structure of family 30 carbohydrate binding module
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
173
structure length
173
Chain Sequence
b'LLDVQIFKDSPVVGWSGSGMGELETIGDTLPVDTTVTYNGLPTLRLNVQTTVQSGWWISLLTLRGWNTHDLSQYVENGYLEFDIKGKEGGEDFVIGFRDKVYERVYGLEIDVTTVISNYVTVTTDWQHVKIPLRDLMKINNGFDPSSVTCLVFSKRYADPFTVWFSDIKITSE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords COG3291: FOG: PKD repeat
publication title Crystal Structure of Family 30 Carbohydrate Binding Module
rcsb
source organism Clostridium thermocellum
molecule tags Sugar binding protein
total genus 34
structure length 173
sequence length 173
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-07-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.430 Mainly Beta Sandwich Jelly Rolls Galactose-binding lectin 1wmxA00
4LKDA 2VXJA 1OH3A 1W8WA 2JWPA 4BQ4A 4CPBA 2LRPA 4LKEA 3ZYHA 1W9FA 4YW7A 1HN0A 2O14A 3F95A 1GWMA 1V0AA 1OKOA 4YWAA 3ZYFA 4CPBD 4BQ2A 4LK6A 4AL9A 2K46A 2Q1FA 4CP9B 2KR2A 5D21A 4CP9A 1UOJA 4YW6A 1W8UA 2WYFA 1W8TA 1W90A 3ZYBA 4BQ5A 1L7LA 1GWLA 1WMXA 3ORJA 4LJHA 2LROA 3UT0A 2C24A 4BQ3A 4A6SA 1GWKA 1WCUA 1WZXA 4LKFA 1W8ZA 4LK7A
chains in the Genus database with same CATH superfamily
2GP5A 3MO4A 3ME2A 5CU1A 5FIXA 1I5PA 3WDTA 2RR13 3FE5A 1UWWA 4QHZA 2E9QA 1OMIA 1UKGA 2RVAA 2WYSA 4WV8A 3WEZA 2E7TA 2JDNA 2XVKA 4ASMB 3HNMA 2PYTA 1WCQA 4FO9A 1PM7A 4LLFA 2JG8B 4CDXC 4CCDA 4CVUA 3W5NA 4Y22A 2GNTA 5CFCB 3I8TA 3NW4A 3ZYIB 4OULA 3K51A 3TN92 5LCWL 1MS0A 4FPCA 4HKLA 3JUUA 2GC3A 2ZEWA 4OZOA 1W2TA 4N53A 1DGWA 1W2AX 4EZ4A 3BPZA 3KLSA 4IV1C 3KCXA 2CGOA 4YVSC 3KVAA 4BXFA 1GANA 2R042 3KVBA 2E7AA 5HCAA 4YARA 1I5ZA 1UNBA 2XGXA 1OHFA 1LU1A 2Y6JA 3KV9A 1TME2 4Q1RA 3CJXA 2HWE3 3WX5A 3PVEA 2SLIA 3L9JT 1W6QA 3MV11 4CPBD 2WINB 4XUPA 3ZOIA 2VUAA 2PHFA 4PIXA 3GCXA 4FOWA 3RYKA 1W8FA 1DDLA 2VULA 5FZOA 1NCRB 1W90A 2E32A 1G7YA 3IIAA 4LE4A 2JENA 4XMIA 4A3XA 1H1IA 5G05L 4QQHA 1ND2A 5F3EA 4YW5A 3ZSJA 4BIOA 1IKPA 1ZZ6A 2A6VA 2ZJCA 3RJ2X 4A7ZA 4HANA 1RHI2 3H1YA 4H7LA 5K9YA 3AP5A 4LTAA 3LQCA 5ACA1 5BY5A 2TUNA 2WJSA 3WNKA 3NNFA 4MZUA 4LE3A 3AMQA 1MACA 1X82A 2FCTA 1LHNA 3AJYA 1KD7A 4L9BA 3LFIA 5C9AB 4OHXA 1SFPA 1W99A 3CHXA 2RMU1 4C90A 1G6NA 2VVDA 5KBFA 4FOVA 4W65A 2B42B 1PMIA 3PTYA 1Y9QA 4NAMA 5L7OB 1AR62 4UW5A 4LBJA 1WCSA 1AR83 4TWTA 1OUXA 5FYMA 4WVWA 3K2OA 4M00A 3UETA 1V70A 4QKFA 4CDWA 1GWLA 3N35A 2AZ5A 1ENRA 3D8CA 1UIKA 2OIIA 5DQ0A 1JYTA 3PUHA 4IV1B 1PVXA 5FYUA 1RC6A 2QQKA 4NWWA 1OI6A 3A21A 5ANNA 4MXWA 3ZVXA 4AI2A 1GU3A 1CZVA 3FFQA 4HPKA 1ZRIA 2JIGA 5GALA 5F8PA 2R32A 3FBMA 2RHPA 4DNYA 4GWNA 1R1A2 3ZLIA 2ZX4A 4R9DA 4YZ1A 3IAPA 3POIA 4CCOA 5T5JA 2JKBA 1QGLA 4HZFA 2WFF2 5BUVA 4H7MA 1X8EA 3VBUA 5JOXA 3C7GA 5LA1A 3LDBA 3AYAA 3RI9A 2BGCA 2B7YA 1ZRRA 4LBOA 1YLLA 3RSJA 5IFPA 4AEJA 2VUJA 3U14A 3G7DA 4FPEA 5BXXA 1E5IA 1Z7S1 3O14A 3I3EA 3ON7A 4HKOA 1IKQA 4Q4X1 1VBE1 4PBPA 4K9SA 3I3BA 4Q29A 2JB4A 1W9SA 2FCUA 2GNMA 2CAUA 3GJBA 2D6NA 4AVCA 4NHYA 2QZ3A 3ELNA 1RUI1 2ZMNA 1NLQA 3K3NA 1S0IA 4X8NA 3S0MA 4KU7A 5C3QA 5JZGB 2WZEA 3G6JB 1C8M2 1PO22 2GH8A 3ZFGC 4KBBA 1COV2 3INAA 4DZGA 1VR3A 1D0HA 1RXGA 1WW4A 3FMGA 1BVP1 5K7PA 3ZX7A 4LO7A 3VBHA 1ZBA1 2W92A 2ZGKA 2E33A 3FLRA 3J8F3 3N9PA 4RFRB 4ARYA 1ZZ9A 5BNOC 4KG0A 2VMIA 3O7OA 5E1RA 2XJUA 1W06A 2JE7A 4M3CF 3SKVA 2JWPA 2PELA 1DZTA 5AVPA 1SHWB 1ULFA 4AFCA 1YQ2A 1C1FA 3UKNA 3C7OA 4CXYA 2FDKA 3H1MA 4JDOA 3T2TA 3IDBB 2D40A 3SEPA 4JGZC 3UGFA 3N3HA 2GNDA 5FYTA 1LHWA 2WFPA 5FV3A 5EPAA 4D7YA 5JXIA 2VOKA 1W6MA 4Q4V3 2RMU3 2ZACA 2IXJA 2AYHA 5D8AB 4FFGA 4XDPA 4YM1A 2DCTA 4Y5SA 5E89A 3O5SA 3ZYBA 4KU8A 5FZBA 4A7KA 3H8OA 4CDUB 4LJHA 2JDMA 3NRUA 1UX6A 4L97A 3B7MA 1YRZA 2ZGMA 1GWKA 1U5IA 4JKLA 2WKKA 4YFZA 5A7SA 1JH5A 4EV0A 2DUQA 4AEKA 3BKZA 2QQMA 1MZ6A 5EIYB 1SLTA 1RUH1 5FKCA 3ZIWA 4XF9A 1NA1C 4E2SA 3QLQA 4P5YA 1R092 3VD5A 5FZ8A 1IZ3A 3N7LA 3VDAA 2TNFA 2ZKNA 1LR5A 3DF0A 3DPRB 4W6WA 2J1SA 4TYSA 1GZCA 3J26N 1W8OA 4BZ4A 2YV8A 4LK6A 4BQ2A 5FQ0B 3MGUA 4HN0A 5FBJA 5K0UA 4NRPA 5DPNA 1BQPA 5BNNA 3NV2A 2WYFA 1MS9A 1DHKB 3THTA 1AF9A 5AFBA 5FZIA 2FHRA 1G9BA 4IERA 4A2UA 1QJFA 2VO5A 4NHLA 3E6DA 4CCKA 4P9XA 3RNSA 3WQBA 1UY0A 3N9OA 3U37A 4D7SA 1ULDA 4YW2A 1Z7S3 2RDRA 4LBLA 5H9PA 5CA6A 4Q4X3 3WP5A 1MR5A 1VBE3 4FAGA 3PUSA 2VCAA 3AM2A 3MI8A 5J09A 1PGL1 2DTWA 3M2MA 3J4UH 3F95A 3ACLA 4Q4W1 1UMHA 1S0DA 4X6RB 4RS5C 3TAYA 3D0SA 4QDSA 4LITA 4OI4A 2JG8A 4CP9A 1VAMA 4QHOA 1SLAA 2ZEYA 1RUI3 5CFCA 4HOOA 3CQOA 4R8HA 1YFUA 3IB3A 4CXXA 4FP2A 4HLTA 4QQLA 2W9XA 5TSWA 4LNVA 4XBLA 1IG3A 1JYIA 4TTGA 2KXLA 1A78A 2E7QA 1Y3TA 1HB1A 2H6CA 2PLV1 2VXJA 2W1UA 3B9CA 4QAWA 4URTA 1S0FA 3VGIA 2FD8A 5FYYA 1ZBA3 2ZMKA 4PLOA 5GLVA 4YPJA 1H30A 1KDMA 1OFNA 2HWF2 3T2PA 2WA3A 1GQPA 2VQAA 1OA2A 1DZRA 1O5LA 3AX4A 2WNUC 5F6LB 2Y6GA 4LIVA 5DG2A 1O4TA 1GZWB 4FPJA 1K5MC 1XB9A 1W04A 1IS5A 3B01A 3QD6A 5FK7A 1CX1A 1Q5OA 5EP9A 5L73A 1VP6A 2Q5TA 1ZBE3 1GP5A 1HRV1 1UOJA 2XH6A 2ZTNA 3HMYA 4HBNA 5FZLA 1V00A 2FCVA 4E4ZA 1RJ8A 1B09A 2LROA 4Y1UA 1CAWB 3A0NA 2GN7A 4DB5A 1BLZA 4EE2A 2HWC2 1S55A 1UZWA 1QJY1 1PIV2 1HJGA 4XIOA 2Q8OA 3SISA 3WNXA 1LAJA 4IV3C 1QQP2 2A3XA 4N43C 1URXA 2UYAA 2VNOA 2WQZC 3LEKA 2VC9A 2WNEA 4IDZA 3OUJA 4IETA 4NMIA 4UFIA 3A23A 5EZWA 2FZ1A 1RUH3 2DCJA 2NLRA 2CU5A 4RS5B 1WA6X 2JDAA 4CDXA 5C71A 1GNZA 3FLPA 4UT5A 2JE8A 4CP2A 2A6XA 3VDDC 3UT0A 5IK4A 2R061 2OVUA 3AYDA 1UOFA 5JSOA 4COYA 4E4DX 3NJYA 2J1RA 4IV1A 3BOWA 5T54A 4YVSA 4TXWA 2VBBA 4PJYA 5EWSA 4NIAA 2YY1A 4M3CE 4ZZ8A 4Q0PA 3VL8A 1QIQA 3R4UA 3FUOA 2BZDA 2VCBA 1PK6B 5T3NA 5F3CA 5IVBA 5LRSA 3GALA 1S0BA 5H9RA 1HDKA 4MV2A 4AWDA 5DAWA 2DF7A 1SLCA 3UJQA 5KHGA 1NCQC 3T09A 4QMAA 2QVSB 1AVBA 5F39A 2ZKLA 1WLDA 2YPJA 4Q4W3 5DUXA 4Y1YA 5EJ3A 1JOJA 1R1ZA 2ZGRA 2Q8EA 2A7AA 1YUDA 1RUD1 2VOWA 2YHJA 1NY71 5C33A 1BBT2 1UW8A 3GZEA 5KXBA 2IUWA 3U4XA 4LHSA 1VRH3 2CAVA 2WDBA 4KWKA 1FPN3 1ZZBA 3VBRB 4KQ7A 3ZYRA 4RGGA 5JI7A 2PLV3 5DZFA 4XFGA 4NJ4A 2FMDA 3NNLA 5FTTC 3AKTA 3NJVA 1AR93 1X50A 4O7XA 4XIKA 1N3PA 2YGLA 1OUSA 3WVJA 5KHIA 2ARAA 1U5YA 4Q4Y2 3WQ1A 1AX0A 2BVVA 1KJLA 2GSYA 3KV5A 1CAXA 1UOGA 4K6BA 1W8TA 4GH4C 5F5IA 2UY8A 2G9GA 2PAEA 3POFA 5ABJC 1DCSA 2QQVA 1H1MA 1OVSA 2RS12 2GZWA 1OLME 1YJKA 2ZX2A 2V5YA 4LHNA 4L0PA 4RL7A 4AVSA 3E5QA 2BFUL 5FAXA 2ZZQA 5GZFA 1XC6A 3ILNA 3UNPA 3ZKYA 4BQ4A 3C3VA 1N3QA 1YQ5A 4QX3A 2V72A 3LAGA 1RUJ2 2J42A 3LWCA 3S30A 5GLWA 2QZ2A 3D4KA 4KWUA 4AK3A 4DXRA 2Y8KA 4Z07A 3VDCA 4D3WA 2Q4SA 1NCQB 3DKWA 1UAIA 3B94A 3K4ZA 4J1XA 4MO3M 5DUUA 3KT4A 1PZ8A 5F1RA 1OLMA 4LO5B 1NQDA 5JOYA 2P6HA 2OZ6A 4AR2A 3TN91 3OPWA 1N47A 1PVC2 5FZ7A 1CESA 2QTWB 3FN9A 1XOYA 1AX1A 2A73B 5F32A 5L9RA 2CHHA 4FFHA 2WN2A 5FZ4A 5FR3A 2RS52 4UF0B 1J3RA 2Q1ZB 4C1WA 3QCWA 2R041 1I9RA 2PHRA 1LGBA 2BOIA 4AI8A 2VMGA 1MQTB 4BPZA 4YW7A 2AEYA 2B45X 3THCA 2D6PA 4LMFA 1TME1 4C8DA 2IZWA 2QCSB 4NROA 2D3SA 1SCRA 4YG6A 1OD3A 2GC0A 1YQ8A 1OQEA 1AZDA 2QQUA 3WNOA 4QPIB 1QNYA 1RUF3 2DUOA 1YFXA 4NAOA 3ZFGA 2UY9A 4J1WA 3MDPA 1LGNA 2Q30A 3PHMA 3ES4A 2D3PA 5T5OA 1REDA 3RZHA 1KGYA 2K0GA 4MYEA 1SEFA 2Z4FA 2P3YA 3LA2A 4FPYA 4SBVA 5FJHA 5DABA 2PHUA 2W87A 4XURA 4B1MA 5BNOA 1QJU2 3ACFA 2C4XA 2P4EA 4QX1A 3AL6A 1J59A 2A70A 4R4ZA 1TNRA 3HIFA 1DGRN 1RHI1 4JGYC 4URAA 5C3RA 1CONA 3V64A 5FBZA 2R6QA 5C4WC 2W52A 4ATEA 3D0JA 4LULA 3KGZA 2A6ZA 5B2GB 1GP6A 3N9MA 4Y22B 2PAMA 4E8DA 5A3MA 1OT5A 1PX3A 1HX6A 4JGZA 5LASA 2YB7A 4XBQA 1VBC2 1RUG2 1YHFA 3LEIA 2XONA 1AR61 1MS8A 1MEC2 4IE0A 4GMP3 1IG0A 4DQAA 3H42B 3NKTA 4IGOA 4FCAA 5LA0A 1E57A 5B4XA 3OD0A 4BMEA 2XL9A 1IQAA 1PMHX 5T5PA 2LW8A 4CCNA 1UXZA 1W9TA 2HWB2 4ET7A 3IM0A 1Y7BA 4XDQA 3VD4A 3OGGA 2HEVF 4OMDA 3MLLA 3OPZA 2ES3A 2R30A 2GDFA 1HV0A 2IWGB 3AP4A 4LLOA 4LOSA 4Y20A 2XJRA 1W2NA 1XSRA 5CB7A 5IT6A 1NA1A 3X29B 1HIXA 1Y4WA 3K75B 3SEEA 5A7WA 1OF3A 1R1A1 4NHMA 2A1XA 4PQQA 3WNMA 1WW6A 2DBNA 3FWEA 1GZWA 2JDPA 3P5BA 4Y4RA 3URFA 2WFF1 5FZOB 1JYNA 2PHWA 4FTEA 4XJUA 2XOMA 4E8CA 2YPDA 3VKOA 2R0HA 3WDXA 3VKLA 5JLVA 1S2KA 1UY1A 2VQUA 2XLAA 4ZS3A 1UIJA 1E5RA 3ACHA 1DP0A 4ZXKA 1ND2B 5KXCA 1C4RA 1DLCA 4ZU5A 4DY3A 3ZKUA 2XUMA 4Y1VA 1C5HA 5CKQA 1Q56A 2WL1A 4JVAA 4QM8A 2ZX1A 5I0SA 4JGYB 3HNYM 4QX2A 1V9U2 1UOBA 3KV6A 5C4WB 1KEXA 4Y5Z0 1SZBA 4LPLA 1BK1A 2R043 1UPSA 3J9SA 3Q9OA 2ZAHA 4LUKA 1RUE2 2TBVA 4FPGA 4D69A 5C5TA 3MV01 1HB4A 4OUEA 4XQWA 3ZDVA 5GZCA 4RS5A 2F6BA 4D7TA 1TME3 3AKSA 2NPIA 5T50A 1AYN3 4HMZA 3H8XA 1GNHA 4GWJA 1PO21 2WT2A 1HJFA 2EIEA 2YC2A 5CZKA 4I3GA 5I0DA 3MW3A 3LSDA 4AZZA 4MXWB 1HN1A 2D5HA 5CIRA 3THPA 4XACA 1D2SA 1DFQA 4PF1A 5FZKA 3TEXA 4XXAA 3U07A 4PCRA 2D5FA 3LFMA 4LR4A 3J7LA 3UV9A 2YBSA 3WW1A 1UF2C 5FP3A 3RPQA 1JMUB 2GAUA 4AGRA 1DLLA 5LEKA 4AAXA 1LRHA 1RHI3 2PXJA 1QJX2 1GNYA 4GJZA 2WNUA 3CIHA 1DYPA 3H9AA 3VBUB 3SLIA 5CEHA 1TZOA 2C6SA 3I59A 2XLGA 3OB8A 1K5MA 1GQHA 1H2MA 2GMPA 4YM2A 2DUPA 1RL3A 2Y64A 3BI3A 2P3JA 4ZHNA 4YM0A 1ZZCA 2ZCWA 4BQ3A 5T52A 1VBB2 1AR63 3LDRA 1ZZ7A 1XQNA 3CJIC 1ENSA 2W2IA 4Y5TA 5EV7A 4IEUA 4FFFA 4XUNA 3GBGA 3PVOA 4XHXA 4IV3A 2D43A 4N43A 3GHMA 3GYDA 5GLTA 4QHBA 1UZVA 3H0OA 4Q8LA 1ZX5A 4Q0QA 4UBHA 1EPWA 3E5UA 2N7GA 2WO7A 1OH4A 5J1XA 2Y34A 3FFZA 2QQNA 1BVVA 1R091 1C3HA 1CAVA 4LBQA 3BYWA 4NWVA 3SCHA 4D6RA 1WMEA 2JD9A 2VNRA 1QOOA 3I7DA 4G9SB 1GKBA 3R0RA 1M06G 1REFA 3WF1A 3O12A 2WFF3 3VBHB 3VN4A 2WNVC 4LIUA 4YW3A 2YG0A 3VDDA 2Y6LA 1AYM2 4R9AA 1SBFA 4L11A 1Q8VA 1DQ2A 3IPVA 4YNIA 2W39A 1D4M2 1UZZA 2YUEA 3IMMA 4FPHA 5F3IA 1YIPA 5CBLA 3CLPA 4HONA 5FY7A 3O1RA 1H6XA 2E31A 3NJZA 2ZMLA 4UW3A 2HYKA 3Q8BA 5KXDA 2ARXA 1ONAA 3ROUA 4FXGB 1W6MB 3LPFA 1D7PM 4YW4A 3KHBA 2VZQA 4OCTA 4XAAA 4XFFA 1NCQA 3DYPA 3AP9A 1V6NA 2VW2A 3VB9A 1MS3A 1FATA 1QU0A 2DFCA 2RM22 3KM5A 3MYXA 5LBEA 4ES9A 4LO6B 1F35A 4OHZA 5F2SA 4TLFA 1PO23 4DEVA 3H7YA 3ILRA 1SMVA 1OLQA 1W9YA 4RR3C 3U0ZA 4ZY9A 4XJAA 4GXLA 2OPKA 4UF0A 3E97A 4KG8A 2HWF1 3H50A 1AR72 1HB3A 4K21A 4GQ7A 4X6QB 4Y33A 2G1MA 4XCBA 4CU9A 1OKOA 3AB0A 3BTYA 1CWPA 3AZZA 1B35C 3ENRA 1ALYA 4P9IA 5IVVA 5K0UB 1U0AA 4OVEA 2C9KA 5BNNB 2F4PA 3KGLA 4D0QA 4HVQA 2BBVA 4GH4A 3OYWA 2A6WA 4BK5A 1SLIA 1RINA 2PHXA 5ABJA 4ITCA 5HV0A 1TEIA 4PI2A 4LKFA 1TMF2 1CJDA 5FK8A 1RITA 1PIV1 3EB7A 3GF6A 2BFUS 1QQP1 2XXZA 2XJTA 4LUMA 4YG0A 4AVAA 4EWEA 1XNAA 3HAGA 1MZEA 2OQ6A 3NVCA 4EN9B 2EXIA 2BNMA 4JTOA 3O1UA 1OSGA 5JSRA 2WZR2 4DRRA 2AGSA 3VHOA 4CP9B 4BM8A 1ASJ2 3MLJA 3CNAA 2Y0IA 1PO12 4P9LA 2EVXA 1NAEA 2FDIA 2ORZA 4DUVA 1OPMA 3RDIA 4QPGC 4QXHA 4MGSA 1EV13 5FXWA 1J58A 5DDJ3 5JR2A 5EJZB 3SMHA 3BVCA 4I0WB 4CCLA 4OHWA 4IQPA 3ACGA 3UL2A 1ZYBA 1FNZA 2FDFA 1WKYA 2VCCA 1W2OA 3WP3A 1GP4A 2Y38A 3O1PA 5FY1A 4E2QA 3N7KA 5L9VA 2CTVA 2BYVE 5IUQA 2LM3A 4GKYA 1LOEA 2DURA 1K42A 4H14A 3V65A 3WG2A 1JTZX 4AG4A 4QDQA 3Q8AA 3PNAA 3CZUA 4XF4A 4XQ4A 5FLHA 1MZFA 3NQHA 3ZPOA 2ZPXA 3WLUA 2JEMA 2VW0A 3UESA 1V6OA 2P17A 1OVPA 2YDEA 4NPMA 4YYOA 1IHMA 3VZOA 3VD7A 4YZ5A 3WZ1A 4Y26A 1HQLA 1LEMA 2W0XA 5FJKA 4ZZ5A 3HWJA 2GNBA 1EPZA 3R4SA 2JDYA 5FZHA 4COZA 1XNBA 2ZHKA 4EN8B 2K2SA 4ZXEA 1WCDJ 3VZLA 5KC5A 1O7FA 2G9ZA 1LHVA 1HB2A 3NMBA 4L92A 2IC1A 4JGYA 5FP8A 3JCIA 3K48A 1AXYA 4GB32 5FYVA 5C4WA 1UY3A 2HWF3 4YZ3A 3ZXLA 4CDXB 5A1LA 1BK0A 4K8RB 2VVEA 3CZJA 4MVTA 1S0JA 4BQWA 3LPGA 2WS92 3RWKX 3OF1A 3DUIA 2VZTA 4KWJA 1F9KA 4QDRA 3VUOA 4YZ4A 4Q8KA 1S0CA 2ZZJA 4NE9A 4QXCA 1GICA 1DQ5A 1IGOA 5SV8A 4BQYA 2CSGA 4DO0A 3WINE 2ET1A 4YVSB 5I93A 1Q8QA 4BDVB 1LOCA 2RS11 1ZA4A 1SDDB 5C6CA 1UZYA 1SCSA 3OGRA 2V73A 3ALQA 4AYUA 2C26A 5EQUA 2WZ8A 1US3A 4EJRA 1W6PA 4A41A 5JAXA 3WDVA 4NVPA 1APNA 1NE6A 1PIV3 3ZYGA 4GWMA 3BALA 1QQP3 1RUJ1 4Q5OA 4QQ2A 4JX0A 1C5IA 2VZ1A 1BEV2 3R6SA 4IEOA 2ZGNA 4WVMB 4EWDA 1BZWA 1U5ZA 4XJZA 3T08A 1XBFA 1S1AA 4DRVA 5CNAA 5F7UA 1JODA 4FPOB 1SACA 5FY9A 3B5LB 4Y1XA 1JU3A 2WC2A 1W3VA 2R072 5FZ3A 2OYZA 1ENQA 1GR3A 2WO2A 1PVC1 3AMPA 4GZ9A 2X5IC 4H2AA 5FO7B 4XUQA 1QEXA 1UKRA 2IXLA 2BU9A 2RS51 3AMNA 3WF0A 2VNGA 1CPNA 2EXHA 4EQVA 1WW7A 2L9LA 4MX3A 2QFEA 1KDKA 3BPSA 3O0WA 1G9DA 4WZFA 4PLNA 1CAXB 3VHPA 1A6CA 4I30A 5FP7A 1O3SA 4CEWC 5FY8A 2Y6KA 1CR7A 4I09A 1UU6A 4HL0A 3HR9A 4M0HA 5LA9A 4CU6A 2CY6A 1WCUA 1XNKA 4NIDA 1PX4A 4IL7A 2QNKA 1PZ7A 2NZ9A 4IEYA 5AC92 4AI3A 2ZGOA 2BJSA 1POQA 4A3ZA 3ZMOA 1W05A 1VBA2 1IPSA 1QJU1 1WLWA 1ENXA 5SV5A 2ZAAA 4ATFA 5T55A 1FAYA 1X33A 5ACA3 1JUIA 5FMBA 1CD3G 2HBUA 3RVHA 4TZDA 3I97A 1CGPA 2AREA 4DUWA 3I54A 4CCMA 3HBZA 1NQJA 4ZU7A 1FI2A 4MH0E 3U4SA 4IEWA 4LBQD 1R64A 4O61A 1AJOA 1RUG1 5FLJA 3GBWA 5DMYA 4XABA 4TSVA 3O1SA 1MEC1 4B7EA 2BGPA 1QOSA 4AI1A 2X05A 3I2IA 3CJIA 3BTXA 4A45A 2ILMA 1DGWX 3NV1A 4HFSA 4AEMA 3BU0A 2C5DA 2HWB1 2A75A 2PHDA 2V4VA 1JOBA 1TQ5A 2PHLA 2RS13 2VH9A 3WV6A 5BNPC 2C1FA 4HK8A 1SFNA 4S2DA 3TWIA 3K3OA 5HPOA 3J7MA 1ZM1A 4Q1PA 4Q0SA 3RZLA 1O3RA 2OKXA 5FO8B 5KR7A 4OFGA 4QGLA 3HQXA 2BRTA 3ZFGB 1RUJ3 1NG0A 2ZEXA 4BJ0A 5JUVA 4AQ6A 2WWSA 4FFIA 4I3PA 1W0NA 3T0DA 3WW2A 3E6CC 3T0AA 2RR12 4P9GA 1LOBA 2XJPA 3U10A 5I8SA 1L7QA 2O8OA 1YI9A 2WNVA 1GSLA 1UMZA 5EFUA 4P02B 4BQ5A 5BNOB 5IVCA 4RA0A 3ZFEC 2VL4A 3HNBM 2ARBA 4BXSV 1WMFA 4W4ZA 3WOGA 3AKRA 2P6CA 4AFDA 1V9U1 5FZ0A 2RS53 2W47A 5FZGA 4MADA 1SBEA 3E1F1 4JGZB 4XJ9A 4M4PA 1YFYA 4LO4B 1RUE1 4YGEA 3RRDA 1K3IA 2B5HA 3KS7A 4BMBA 4QGNA 2B46X 2RDQA 2Y26A 4AVTA 1YC61 2O0OA 5FUIA 4D6QA 4FPKA 1V6LA 5C8CC 2QBXA 2VZ3A 4N7UA 4I01A 2PHTA 3JBG1 3MIDA 1NZIA 4N90A 4Y20B 3SXWA 4XAEA 4EN7B 3M3CA 5I0RA 4RR3A 2JECA 2ZHNA 4LA3A 4E4SA 1NA1B 4RGKA 4LKEA 1MPXA 1XXNA 4W6XA 5A7WB 1HQNA 4XF1A 3CBNA 1QJU3 2BWCA 4YG3A 5FZEA 5FMCA 1BMV2 3L2HA 4LBKA 3KCYA 1QJX1 1B35A 1SDWA 5A3NA 2PQQA 2ADDA 4JHTA 3M3OA 3WCRA 1TVGA 2VCMA 1OURA 1BKZA 4LORA 2HEYF 5HXMA 1DYOA 2CL2A 3IAQA 3LB9A 1C28A 2WIIB 2DU1A 4OI2A 3A7QA 2ZX3A 3WHTA 3BU7A 1ULEA 4MLOA 1GOHA 4ES8A 1JZ2A 3AXDA 2XDVA 5FZMA 2RG4A 3OBTA 4DS0A 4B4PA 3M4FA 5A70A 3POEA 4A7YA 1O8PA 3VBOC 3GNEA 2HWB3 3ZDSA 1DYKA 1ZA7A 4AHWA 2JB8A 5L19A 3OSDA 2DCYA 2WABA 3BUCA 3C7HA 3PUAA 4XE9A 1W6NB 3H7JA 2NMNA 1MS4A 4Z2AA 1HV1A 2ZXQA 4KBZA 4R9BA 1ND3C 4WBBA 1UL9A 3CO2A 3QBQA 1CIWA 4A6OA 1CJPA 1LJ7A 4FT8A 4HVRA 3R05A 5FZ1A 2XPJA 2RDNA 5E88A 3ZXDA 5CKMA 4ISQA 1QXRA 3T4HB 5I8YA 4K1ZA 5FP4A 1HKDA 2QDNA 3MICA 4QPGA 4CEYC 4D94A 5C8CB 1A8MA 5E8AA 2CDPA 2HKXA 5FDBA 1JZ4A 1Y9GA 2GMEA 2VBPA 4CP0A 4QB2A 1CN1A 1US2A 2VAUA 4AQSA 2D6LX 1AYM1 1S0GA 2Y0OA 1KJRA 3OUIA 1RUC2 1EUUA 2VW1A 3K77A 4XVHA 1D4M1 1T2XA 4MHUA 4ZS2A 3RGBA 2BQPA 2WNUB 4M4RA 5FP9A 4Z8BA 1RVF2 3CKHA 2QQWA 2Y33A 3A22A 3I59B 3KZ4C 2MNGA 4DIQA 1K5MB 4DPNA 3DYOA 1V9U3 3AKPA 3VBSC 4Y1ZA 3WT3A 4XC9A 5IHRA 5A7OA 1L7LA 3LIHA 1AJKA 4WVMA 1RUE3 4KWLA 2CGNA 3SCFA 5I91A 4UAPA 3ETPA 4P9WA 2ZA9A 4M3CA 2RM21 5A6ZA 4N9IA 2JKXA 2VOVA 1LKNA 4CSWA 1RIRA 4IV3B 4IEXA 1K12A 2YC0A 4N43B 5F9TA 1AHSA 4YRDA 4K1YA 5DUWA 4AXOA 1RUNA 5FYZA 2IXKA 3USUA 3JBG3 1HN0A 3VZJA 4WM8C 3OBZA 4LBQB 1CAVB 3J7HA 1HXS2 1W0OA 1LESA 1AR71 3J8F2 3P6BA 1FMD2 3VV1A 1GFF2 1WBFA 2C0ZA 1GMMA 2XQRA 3OBAA 4QXKA 3VZKA 3PU3A 2ZS6B 3NV4A 2X29A 3K4AA 4W50A 1VE0A 3NSTA 5J48A 2D98A 2IFWA 4CXWA 2UU8A 3VDDB 2YMZA 5GZGA 4FQ4A 1ST8A 1V6MA 1HRV3 3C7EA 4IXLA 2JD4A 1POV0 3WUCA 3GZTB 3IPVB 5H9SA 4RQPC 2VVFA 5A3WA 4WVZA 4K8FA 2NM1A 4Q4V2 1TMF1 1XSQA 2X8KA 2W5FA 3JQWA 4AGVA 1QJY3 2B4KA 1EAH2 5JIUA 5A7QA 2BUKA 1IQDC 5A33A 5IVFA 1D4VB 4L8QA 3SNMA 3ZN5A 5FWEA 4GAZA 1F4AA 2W68A 1KFXL 3ZXEA 1G86A 4E4HA 2WZR1 2UWCA 4YLZA 4JRAA 1XYNA 5ERLA 2AR6A 1ASJ1 4XTPA 3RS6A 4UW6A 4CRQA 3OY8A 4IW3A 1PO11 4KL1A 4O65A 5AFEA 1IS3A 4O9EA 1GQGA 3AZVA 3FUQA 3NL1A 4D8MA 1OXCA 4XETA 2VZPA 2MHFA 2J1EA 1KQRA 2AENA 1OOPC 1XU1A 2R063 5BNQA 2X5IA 4IGPA 2VOTA 1G9FA 3D6EA 4WM8B 5FYHA 1FV2A 1MVEA 3ZXJA 2W91A 2WO1A 1CQ9A 2XQXA 3MFAA 4NUBA 4P9JA 3EO6A 1YXWA 5FZDA 5J7MA 3NO8A 3LEMA 3AP7A 2VM9A 4DOUA 2XKOA 2PQSA 4AE2A 2YGMA 4GH4B 3OYWB 1JZ3A 1H8TC 4CEWA 3JB8A 3UKVA 2V5DA 5ABJB 4JQRA 1UU4A 1RUD3 3W58A 3JXSA 1GBGA 2P1BA 1QOTA 2KM2A 1QJZA 4LKDA 4LQRA 3SCGA 2VECA 3GJAA 5DZGA 2RM23 2RV9A 3ZXKA 4QKNA 2J22A 3B02A 5FZ6A 1LENA 3WY6A 3MIEA 5IK8A 1JS9A 2W1WA 4QQOA 5FZCA 4B1LA 5JI9A 4NRQA 4GB31 3LDKA 5FPVA 3PVNA 3JB4C 1HLCA 1VALA 5I0TA 1WD4A 4BU2A 4ZU4A 1RGSA 2P2KA 2ID4A 1Q8OA 4YGDA 1UO9A 2XWBB 2YZ4A 1D2QA 3ORJA 4WM7C 2WS91 2XWJB 5IATA 3O1OA 2XB6C 1WLCA 1CVNA 1XE7A 3HOBA 2WLPA 1OOPB 3WHUA 2ET7A 4FPFA 5DG1A 4Z1VA 1LOGA 4MXVA 2RJKA 5FPXA 1ZBE2 2AEZA 4BK4A 3N7JA 1WD3A 3THDA 1PM4A 5BNPA 4OI0A 4CUAA 1TMF3 4UBGA 3UYJA 4XBNA 5FPAA 3IN9A 4PI0A 2P34A 4R4XA 2VZVA 4LBMA 2R16A 3BIWE 3U75A 3ZMNA 4COWA 2XBO2 1BEV1 3KSCA 3BIEA 3OGJA 3DXUA 2WZR3 2QQIA 1SFYA 3NKGA 5FPBA 2FDGA 1KRIA 4PLMA 2OPWA 1XU2A 3IDAA 4B29A 4RHV2 1PO13 2Y6FA 2FBEA 3TN93 1CPMA 3NAPC 4OMCA 3MFCA 2R071 5F5QA 3RZZA 4Q2FA 4B3NA 3I2DA 5F5AA 3T1MA 3AL5A 3ZFEA 1W03A 4A42A 3RZJA 3P3PA 5J3UA 2DDUA 1SG3A 2EIBA 3H3UA 4H3WA 5IJRA 5LW9A 1GOGA 5J36A 2ENRA 2VMCA 2BV4A 3KCCA 1X9PA 3I2GA 4AVBA 3KT1A 3LOIA 3KF5A 4UYBA 1PNGA 5A7PA 5JOZA 2Z69A 3S6PA 1VMJA 3A0KA 2RJLA 1A3KA 2JDUA 2XKPA 2ZEZA 1W6NA 2H0BA 5CAZA 3IMNA 1UU5A 1OQDA 4OZXA 2XJVA 4WM7B 1C8M1 1BHGA 1DU3D 4QWNA 2XJSA 5A3OA 1COV1 1SLBA 2W3JA 3I3MA 3RZKA 3OD4A 3VL9A 4YVWC 4C0HA 2MEV2 5D2AA 4SLIA 1LU2A 2QUOA 5C8CA 5JXJA 2DVGA 2YROA 1PGL2 2GC2A 4BYYA 4OQ8A 1H9PA 2D6KA 5FYCA 2JG9C 1W6PB 4MOAA 1WA4A 3POSA 2MPFA 5AC91 3OUHA 1W9FA 3L2YA 2O14A 1VBA1 1S2BA 4XMAA 3AC0A 1UCXA 4XF3A 1KFUL 3OEAA 1AXKA 2JJ6A 5FZ9A 1VRH2 3OPTA 4CDQC 1FPN2 1LB2A 2ZABA 2DU0A 2PTMA 4GB33 1YEWA 1ULOA 5ANQA 1FOD2 2ORXA 5EHDA 1VRBA 2WUHA 1Q8SA 4AHYA 1TG7A 4YZ2A 4ZKTB 1J3PA 2V4AA 4NIGA 1AR92 1VB4A 3BOPA 4Q26A 1LEDA 1VB2A 4K20A 5AVAA 1W8WA 2CWMA 1GZ9A 4QX8A 4R9CA 1NXD1 4AW7A 2ZBJA 4RYDA 1T6BX 3VZMA 5IW0A 2YU1A 1OA4A 5JIAA 1MS1A 3VBOA 2J1UA 2NMOA 3M3QA 5L9BA 4CUCA 1X36A 2QQLA 2XJQA 3AVRA 1Q8PA 3D5OA 2DWRA 4I02A 4KMQA 4META 2XVGA 3NJXA 3VBFC 4BQ1A 1R1A3 5GJ6A 2EICA 4Q0VA 1ND3A 3DECA 5A7NA 1JW6A 4UFLA 1W28A 3I49A 1W8NA 1OLRA 3ZSMA 4CU7A 5A32A 5JPNB 2RR11 2QE3A 4MGTA 2VXRA 3AZYA 4XILA 3FX3A 4CEYA 1LECA 1ULPA 3UGHA 1OKQA 2HJIA 3MHZA 3WSOA 3ZXGA 2SBAA 2XLFA 3OG2A 2JG9B 4MGYE 3EMRA 2WWJA 2VU9A 3LOBA 2HYXA 1QWRA 2JIJA 5IK5A 2R073 3M3EA 2BEOA 2RS32 3FC0A 3WP4A 2A5ZA 2FDHA 3ZYFA 3FHAA 3MPBA 1C1LA 3NNJA 3ZN6A 1D0GA 4H55A 4P9YA 5KHJA 3IDCB 1NT0A 3TEYA 1BJQA 1PNFA 5J96B 5JMCA 1TE1B 1RMU2 4CDQB 2BNOA 4LKSA 4CCCA 3VBSA 4XJWA 4ZPIA 3MBWA 2RJ2A 1N1VA 1PGSA 4DFSA 3O1VA 1IOAA 2W1SA 5CFDC 2IVIB 3WD5A 1C8M3 2XMLA 3CJIB 2DV9A 4V2VA 1COV3 2P3KA 2EAAA 2VTXA 4N8MA 4KGGA 3WG1A 3QH6A 4J25A 1VJ2A 3ZFFC 4HKWA 2G9FA 4GKXA 4JQTA 3ZXAC 1RUF2 4XW3A 1UYZA 3DXTA 3GHNA 2WR9A 2VQTA 1LOAA 4UFMA 3RZGA 1A34A 3MEPA 1UYPA 5EYXA 3GDBA 4RFT0 1W6OA 4WM8A 1H2LA 1W0PA 2VMDA 1RJ7A 4QD2A 5AC93 3GXUA 4IEVA 1NY72 3VD9A 3ECQA 1VBA3 1UXXX 1NE4A 4NPRA 1EYBA 1OBNA 1BMV1 3VBFB 4XEZA 1OA3A 2I07B 1LOFC 3IDEA 1AX2A 2WNVB 4JCKA 3RFRA 4DXTA 4FXKB 3KF3A 3HVDA 4UFJA 1F5JA 1M4WA 4P14A 4F7ZA 4QX5A 3WP6A 4HT1T 2VPVA 1VAVA 2Z79A 4YSFA 3IZOA 4RQPA 4V1PA 2HWC1 1TNFA 2V09A 4XZUG 3TNQA 4OUMA 3N9NA 4C1XA 3S57A 3POBA 3HD8B 3GM8A 3E6BA 3EBRA 4CTEA 3OGSA 4MGIE 1NOVA 2VD7A 4RN5A 4JTNA 1DBNA 1REEA 3MF6A 3AJZA 2XVLA 1NCRC 3B00A 3LE0A 3ES1A 1UMIA 2QDRA 3LKJA 1PZ9A 1R093 3CDZB 4G3YC 5IFTA 1FYUA 5JOWA 2EF6A 4W6YA 1JI6A 2QKDA 2VBDA 3GBFA 3SQOA 3PLQA 5C8WA 4F8AA 2J1TA 2OA2A 2WSUA 1AL22 2HEWF 1POV1 1J3QA 3HT2A 4LA2A 4AI9A 1JHNA 3SHRA 3WF4A 4OHVA 3ZFFB 4RR3B 1C57A 1K45A 1OOPA 2ZOEB 2NQYA 1O59A 2NYYA 3MF9A 5C9AC 3E5XA 4EN6B 1MZ5A 4Y3OA 1RUC1 1VBD2 3WG4A 3H3LA 1AUYA 2UYBA 4JZRA 5EXOA 1IS4A 2NP0A 2EIGA 2QQJA 5GZDA 4F3JA 5FXZA 5L7OC 3SITA 1B35B 1QDOA 3OCPA 1DQ1A 1A8DA 1RVF1 2X09A 3SKJE 3ETQA 3T2QA 4K7JA 3H8UA 4GULA 5LY2A 4CE8A 3PIJA 5LB6A 4XOGA 1NZCA 4IGQA 2RE9A 2UWAA 1H8TA 1RUOA 1R082 3KB5A 3PU8A 3O1MA 1BBT1 2R1DA 1OD5A 3WNNA 2ZGSA 5FMOL 4Z92B 4S2GA 4JC1A 5FZFA 4JHZA 1H8VA 1AYN2 1DQ0A 1H4HA 1YQ6A 2WRAA 3NNGA 3OBRA 1U12A 3LSEA 1GWMA 1UY2A 3K46A 3OTFA 3ZM8A 4CA9A 2A71A 4GMP0 4BQXA 4G4FA 1G8WA 2DCZA 2EAKA 2EXKA 4RSUA 5LA2A 3TRSB 3AZXA 5F37A 4V2WA 2VUCA 1HXS1 5D21A 2C9AA 3J8F1 1XRUA 4FSJA 4XHBA 1FMD1 2CV6A 4Q4Y1 5HV4A 5HCBA 3M8LA 1YJLA 4QPGB 5T5LA 2ADEA 4WM7A 2HH9A 3AP6A 2HLEA 3IWZA 4LK7A 4AOCA 5A6XA 2IXCA 5FPUA 4COUA 4U2AA 5KHHA 3AYCA 2D97A 2W08A 4PQ9A 5HI0A 1H1AA 1JYCA 4NRMA 3UJOA 1YNAA 2EALA 5LK7B 4S2FA 5CVRA 4YFWA 1ZRFA 1AXZA 5JR7B 1WWYA 4Q4V1 3FHQA 5CG9A 1RYYA 2ZGQA 4FVVA 2HWC3 2YBKA 5F3GA 4GD4A 3WDUA 1CAUA 4NR1A 3MZHA 1EAH1 4QPWA 2KD7A 3WXPA 5JZGC 3LCPA 3EHKA 3PMEA 2E26A 3PJQA 4NO4A 4TLGA 2Q8DA 5FO9B 1S0EA 2E6VA 3ZYPA 1E5SA 4AHXA 5HCFA 3AKQA 1C8NA 4QPYA 3BN6A 2D7FA 3LD8A 4M3CB 4M01A 2G4IA 3TEZA 5GLZA 1FV3A 2A3WA 2Z2SB 1JZ6A 3MIBA 3VHNA 2VY0A 3AMHA 3NAPA 3MUZ1 3USUB 3M7AA 3FBYA 3RYPA 3POJA 1POV3 2A3YA 2E63A 4IE7A 5H9QA 1RB8G 5JCTA 2P5BA 4PDWC 5D8AC 1LTEA 1RUC3 1ZZ8A 5FLIA 5FZAA 5IAVA 4XCAA 5FRAA 4CDUC 3D82A 3TOJA 5DAXA 1QH6A 4NIIA 1RVF3 4C91A 5LEJA 2AC1A 2Q8CA 1BXHA 2DYCA 4X8PA 2VR4A 5FFOC 5IVJA 3I2HA 2I45A 4YVWA 5APAA 1HRI2 4Q27A 1WCKA 4QKDA 3RG0A 1BBT3 4AVVA 4BB3A 4LHKA 4U36A 2JG9A 5A33B 4JKMA 1CIYA 3DPRC 1DQ4A 3HN1A 1PMJX 1E5HA 1YI7A 3SH4A 3JD72 5EJ1B 1HW5A 1Z78A 3LIGA 1J1LA 5C70A 1IS6A 3DEMA 3PIGA 2HWD2 5C3SA 4YW6A 1KXGA 3MLKA 4LXLA 1ODNA 1UZ0A 3OY8B 4CDQA 5A80A 1HXS3 4R52A 1VBC1 1XNCA 3V0BB 3V0AA 1FMD3 1JOPA 1K5JA 3EJKA 4Q4Y3 4OQ9A 2BOJA 1BYHA 1ZNPA 4P5HA 3WW3A 2X5IB 2ATFA 1CZTA 3Q8CA 4HXCA 4JV4A 2GH2A 4B8EA 5A6YA 3AFKA 3SC7X 2WSVA 2LRPA 1LHUA 1SBDA 1ZBE1 3A4UA 3GZAA 5HXVA 2ZX0A 4AFAA 3S7EA 3VKMA 1GUIA 1UYYA 4QGMA 1XE8A 1UQXA 2FQPA 4PDWB 3MW2A 2Q1FA 3KQRA 5DUVA 3KWVA 3EYPA 1VMFA 1EAH3 4AQ2A 1UN1A 3WR0A 1EUTA 1QHDA 3HT1A 4CEWB 3VBFA 1VAKA 4BIFA 3RZMA 2VZSA 4IE5A 1PGW2 4DY5A 5C7GA 2XBO1 4I0AA 5JVVA 5LBCA 3RMYA 1JXNA 1L7RA 3M1HA 4M0NA 3U11A 5FMDA 3F2ZA 4FPLA 4RHV1 4XUTA 5IVYA 5FOJB 5I0UA 3WF2A 2VTFA 1DG6A 1PVC3 1L3JA 3NWKA 3VKFC 4CCJA 2AACA 2PFWA 3AK0A 4KNCA 2BGOA 2WAOA 1LNSA 3JZVA 4GWIA 2Y6HA 1EV12 2XUEA 5FUPA 5FYSA 5DDJ2 5K8SA 1P8JA 1YQCA 2HBTA 2K46A 4EYUA 3BGAA 2KR2A 2KA3A 2VJXA 1F8VA 2P3IA 5LY1A 1IPKA 3U1XA 4EROA 5J37A 4HSLA 3IKWA 3SH3A 4QQPA 4Z2WA 2FMYA 4GA9A 4PHZA 4NOTA 4XFHA 2OUHA 2HWE2 3ACIA 3UKTA 4ARXA 4Y24A 5CFDA 1GOFA 5F2WA 2UWBA 1NLSA 2TEPA 3EQEA 2MEV1 3FZ3A 5FCCA 3DN7A 2OUJA 1ULCA 2O1QA 4CYDA 3MIGA 4Q0UA 1SPPB 3ZFFA 3I2OA 5BNPB 1Q3EA 3S7IA 3C8XA 4HVOA 2IVJA 5GLUA 2ZGLA 1FXZA 2O8QA 4DXSA 1U5XA 2I74A 4JAAA 4OI1A 3ZR6A 2W1QA 5C3OA 4LOTA 1VRH1 4BISA 1ODMA 1XJAA 3TB0A 4QX7A 3LEGA 1FPN1 4I2OA 2C24A 1OF4A 2VZOA 2BTVC 4QT6A 1FOD1 1LOFA 5IVEA 1JYXA 2ZGTA 3POGA 4DXZA 1VBC3 1RUG3 2ZGUA 3ZSKA 1XE0A 1OH3A 1VBB1 2OZJA 1XYOA 1XYPA 1AR91 4OYUA 4E9KA 3ZFEB 1MEC3 3H1WA 3N7MA 1AR82 1PK6C 2Y60A 4NIHA 4JDNA 4NHXA 2WT1A 4L2NA 3ST7A 4E2GA 1V6JA 3KV4A 2NN8A 5FKBA 4L99A 3T4VA 2YFUA 1UX7A 5LBBA 5A3PA 1EP0A 3Q8FA 1OC1A 5E6HA 1MS5A 1H9WA 1CX4A 4ASKA 5KC6A 4N9HA 2A6YA 2QQPA 1JU4A 1FT9A 1NCRA 2GP3A 4KGQA 3D3AA 4QB6A 3KHCA 4FOYA 3ZXFA 2F4LA 3GGLA 1Y43B 4K40A 4O9GA 3AFGA 2VTXJ 1JUHA 1QNWA 3WUDA 4D6SA 5CADA 4IEQA 4COVA 1N3OA 3RQ0A 3VBRC 3JQXA 4JDMA 2XBO3 2LUWA 5JPMB 2OW4A 3ASIA 4BCUA 1V6IA 1JYVA 4XF0A 2LTNA 4LBNA 1QF3A 1SQ4A 4PF5A 4RHV3 5C9AA 5DAQA 3B3QE 5A6QA 3KT7A 2RS31 4CUGA 3VHRA 1QXPA 3P3NA 2JE9A 5G04L 5L7OA 4BLJA 1JZ7A 1YIFA 1T6GC 2GC1A 4I0BA 5KHKA 4KI5M 1F15A 1O4ZA 3AXEA 1RMU1 3RYRA 2PAKA 3TNPB 2GU9A 3TBDA 2WQ8A 3SH5A 3WNLA 2R1BA 1W8ZA 1NXMA 3IIIA 3PVBB 1UYXA 1WGPA 4WZCA 3AYEA 1QKQA 4MSVA 3DKQA 3ATGA 2IXHA 2VE1A 1WLTA 4CUBA 2WA4A 2WBKA 1ZRDA 4UFKA 5FMOS 4UW4A 4YGBA 5KXEA 3AVSA 2MEV3 3VBOB 4NN0A 1RUF1 3W20A 4AEDC 4DMIA 3RWNA 1NUKA 3HN3A 2PA7A 3MPPG 3TYJA 3M70A 4IEPA 1H4GA 3PUIA 3U78A 4XJ8A 4BLIA 4XDOA 3N9QA 3PDQA 5C3PA 5GKAC 4E27A 3WCSA 3OOXA 4EWAA 1ND3B 4NPLA 5CYYA 3P1IA 3ABZA 5FY0A 1QJX3 2WT0A 4AFMA 3MW4A 3J7NA 4UFHA 5A32B 4LHLA 1ZREA 2QQOA 5D1IA 1Q43A 4CEYB 5ACA2 3LA7A 2OT7A 1OQ1A 1FOD3 5JMOA 3PMSA 4BA6A 2RMU2 4QKBA 1MQTC 2WO3A 1F5FA 2BNNA 2YYOA 3IBMA 1VBB3 1DGLA 4FQZA 4MGQA 2DVAA 2OS2A 2QJVA 1VMHA 1WMDA 2P37A 4QX0A 5DAVA 3ZN6B 5IYYA 5FY5A 2FZ2A 3USSA 5A3UA 2Z5WA 2X10A 2Z42A 4GMP1 1KS4A 4QPIC 2BVBA 3B9IA 5LK5A 2DBIA 3RMXA 5JZGA 3GZUC 3PTRB 2F17A 4J6GA 3VBSB 4HG6B 1KS5A 3APBA 4P08A 3T3YA 3MIFA 5B4NA 5FWJA 4Z82A 1GV9A 1BCXA 3DL3A 5K4LA 4HK9A 4FTBA 3VD3A 3QH7A 2W46A 4B4RA 4NHKA 1FNYA 4EN0A 3T1LA 3V0BA 2R49A 5F6KA 1DQ6A 2D6OX 4ZONA 1QJEA 2B9UA 3RJRA 5IK7A 3B69A 3H8RA 3PURA 1V6KA 3W59A 3CEWA 2GN3A 1AL21 3DV8A 3M3IA 3GCWA 4WVVA 5LZ6A 1W2UA 1SLLA 4UOJA 2WAAA 1JZ8A 1YO8A 4AEDB 1AYM3 1O6UA 1W6OB 3FLTA 1KITA 1N1YA 1YCIA 1VPHA 2ARCA 1UD1A 2DVBA 4FOQA 1D4M3 4QU1A 1VBD1 5IWFA 1DZQA 2R0FA 1CZSA 3HBKA 1I6XA 3DYMA 4PDWA 5D8AA 2VOXA 2BBAA 1IPJA 2BP6A 1Z7S2 2WN3A 4N53C 3WQ7A 2RS33 4AHZA 2VMHA 2BDRA 3H3ZA 4XUOA 3ZR5A 4FBFA 3W5MA 4OHYA 2DCKA 3BCWA 1VBE2 4Q4X2 4CDUA 3OJBA 4AQTA 2WWUA 1ULGA 1UY4A 1RMU3 3HQRA 3T30A 1O3TA 2LALA 1R081 3ZYJB 4C0BA 4RQPB 2JICA 5F5CA 5EYYA 3MIHA 3CL1A 3W21A 4BHPA 4MG2A 4GJYA 3CF6E 5FXVA 4XPVA 3UK9A 2UURA 1RUI2 4OLLA 1VLNA 3FL7A 1JZ5A 1V0AA 1AYN1 4YWAA 1NLRA 3DPRA 3WG3A 2W95A 5FQ0A 1UPIA 5FOBB 1ZVFA 3KQ4B 4JRLA 1LGCA 4AFBA 1AR73 1ZBA2 4XQDA 5C5UA 2CWSA 4XFAA 2H6BA 1LCLA 1ND2C 1WUVA 4BOWA 1X7NA 1S2EA 4A6SA 4BWOA 2CDOA 2Q0AA 3AZWA 2ZHMA 4DINB 2X53S 2GALA 2PN5A 4FTSA 2GMMA 1J84A 2XG3A 2VMFA 3EXUA 4CPBA 1YFWA 3I3DA 3LA3A 3O0VA 5BYNA 4YW1A 2VZRA 1YYNA 1DIWA 1SPPA 1W3XA 1G9AA 2D3RA 1QH7A 4W8JA 1XPWA 3HPNA 4UWDA 1NYWA 3RI8A 2B8MA 2E51A 2BW8A 4CDWC 1FX5A 4N53B 1ZRCA 1GYKA 1F31A 2W94A 4PIZA 5FYIA 2VUDA 3WDWA 1H8TB 4HSJA 5CKNA 1X9TA 1RTVA 2JX9A 2VMEA 4QB1A 5JXHA 4PIYA 1OFSA 2D93A 1RUH2 3ZPYA 1ASJ3 5JDBA 5I8TA 2DVDA 4PT6A 2WLQA 4INDA 4CZSA 5IAXA 3LZZA 1AL0G 2VZUA 4IE6A 1W6QB 3CU7A 2YFZA 4A4AA 5A3TA 1O3QA 1W9WA 3POWA 3POYA 2D44A 5HBAA 1AL23 3VBUC 3K4DA 2E53A 3BODA 3KD4A 1ACCA 2J7MA 4LO8A 1WBLA 3UGGA 2VGDA 2Q1MA 2OQ7A 1H0BA 1J1TA 1VBD3 4K3UA 4LT5A 2B39A 2XHKA 1J83A 1CAWA 2CYFA 4AGGA 4CU8A 1X8MA 4HN1A 3OEBA 1NKGA 1JHJA 5DN2A 4IESA 1VIWB 1MVQA 5KWRA 4Q4W2 1HRI1 1R083 4ORFA 2JDZA 3ZYHA 2EA7A 1CAUB 4DEQA 4RD7A 4ONUA 3JU9A 1HQWA 4XFCA 1H6YA 1LULA 1I3HA 3JD71 2BERA 2VQ0A 4B4QA 3FJSA 4CDWB 3Q8EA 1O5UA 2WZPP 1QMJA 1DGRA 1JBCA 1S4CA 2HWD1 2J1VA 3VBHC 3PL0A 3O0XA 1QY4A 2PLV2 3BTAA 3R4DB 4TN7A 5FUNA 5HCHA 5JSPA 3HQUA 3JBG2 5LRRA 1XNTA 4HPKB 3HEIA 4JKKA 2EIDA 4A44A 3VZNA 3DCQA 3ZO0B 3TEWA 2WS93 3WF3A 3CMGA 3T0BA 3NAPB 1H2NA 4XFBA 3BB6A 5ISLA 1JN2P 5DAPA 3S5AA 1PK6A 2BWAA 4IEZA 3ZSLA 3OGVA 1LODA 5JWPA 4BE3A 1HRV2 3HJRA 5M0TA 4CP1A 4XFIA 5LBFA 1OPOA 2ETEA 2JDHA 2XHNA 2DFBA 3N36A 4MGZE 4OUSA 2K9ZA 1NX9A 2OXBA 3QACA 4PBOA 5CG8A 1O4YA 3I2FA 5CISA 5JXGA 2YC4A 5GM0A 1QJY2 5FPLA 2CGPA 1GLHA 4MUVA 2ERFA 3NNMA 1WZXA 3WNPA 4ISRA 4YVWB 3ZN4A 3WQ0A 1PGW1 1BEV3 4N7IA 1QDCA 3VDBA 3VLBB 5DXDA 1G9CA 1QXJA 2IFRA 3VBRA 5DZEA 2D6MA 1RXFA 3FHIB 3V56A 3I3QA 2YU2A 2VNVA 2AH2A 3I4IA 5J98B 2PMWB 4QXBA 2J1AA 5K0UC 2YBPA 3O1TA 5FXXA 2LS6A 1JYWA 4AL9A 5BNNC 4EZHA 1EV11 2ZHLA 3I2JA 5DDJ1 1PHMA 2H0VA 4P00B 2R062 4UI9L 5E16A 4AF9A 3V0AB 3PUQA 2EXJA 3AMMA 1LHOA 4XYXA 5LATA 4YM3A 5A1FA 2IXIA 4XXPA 3C2UA 2AUYA 2I2SA 3MUY1 2HWE1 3NV3A 4S2HA 3C7FA 1DF0A 4Y4YA 4IE4A 4QM9A 4UXAA 3N4MA 1O91A 3LGRA 2JXAA 4HETA 2XL7A 2DVFA 1Y9MA 1GZTA 1Z0HA 1HRI3 2JG8C 1F4HA 1W8HA 3I2KA 3T2OA 4AEDA 5L36A 1RUD2 5CFCC 1H2KA 3ZSEA 1XNDA 1W39A 2ZGPA 5A1AA 1WMXA 3JD73 4CCEA 4XTMA 2FDJA 3KMHA 5BV6A 3BTZA 2WNOA 2YXSA 4QU2A 2OX0A 1EY2A 3DGTA 2HWD3 5FREA 4B7KA 2XR4A 1F2NA 1I1EA 2G19A 4FAHA 4ASLA 4MGKE 1YWKA 2R7EB 3VKNA 2VG9A 1STMA 5BPXA 1WW5A 3PJYA 2RDSA 4FP3A 1MQTA 2B9VA 3WDYA 1AR81 4RGAA 4AAPA 3ILFA 4F83A 3QOPA 3W9AA 5GZEA 3B93A 3LF7A 4IUGA 4FI9A 3N9LA 4GALA 4GIQA 5FPZA 3ZIXA 4BH9A 4MHRA 2WQ4A 4LEJA 2JDKA 3IT8A 3S5QA 4QPIA 5LWBA 1W8UA 5FYBA 1O8SA 3ITQA 4KH9A 4DUXA 2BPA2 5A3LA 1N1SA 3WW4A 2DTYA 4AI0A 5FY4A 4XZPA 4YGCA 5CFDB 2CNAA 1N1TA
chains in the Genus database with same CATH topology
4LKDA 2VXJA 1OH3A 1W8WA 2JWPA 4BQ4A 4CPBA 2LRPA 4LKEA 3ZYHA 1W9FA 4YW7A 1HN0A 2O14A 3F95A 1GWMA 1V0AA 1OKOA 4YWAA 3ZYFA 4CPBD 4BQ2A 4LK6A 4AL9A 2K46A 2Q1FA 4CP9B 2KR2A 5D21A 4CP9A 1UOJA 4YW6A 1W8UA 2WYFA 1W8TA 1W90A 3ZYBA 4BQ5A 1L7LA 1GWLA 1WMXA 3ORJA 4LJHA 2LROA 3UT0A 2C24A 4BQ3A 4A6SA 1GWKA 1WCUA 1WZXA 4LKFA 1W8ZA 4LK7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LKD A;  2VXJ A;  1OH3 A;  1W8W A;  2JWP A;  4BQ4 A;  4CPB A;  2LRP A;  4LKE A;  3ZYH A;  1W9F A;  4YW7 A;  1HN0 A;  2O14 A;  3F95 A;  1GWM A;  1V0A A;  1OKO A;  4YWA A;  3ZYF A;  4CPB D;  4BQ2 A;  4LK6 A;  4AL9 A;  2K46 A;  2Q1F A;  4CP9 B;  2KR2 A;  5D21 A;  4CP9 A;  1UOJ A;  4YW6 A;  1W8U A;  2WYF A;  1W8T A;  1W90 A;  3ZYB A;  4BQ5 A;  1L7L A;  1GWL A;  1WMX A;  3ORJ A;  4LJH A;  2LRO A;  3UT0 A;  2C24 A;  4BQ3 A;  4A6S A;  1GWK A;  1WCU A;  1WZX A;  4LKF A;  1W8Z A;  4LK7 A; 
#chains in the Genus database with same CATH topology
 2GP5 A;  3MO4 A;  3ME2 A;  5CU1 A;  5FIX A;  1I5P A;  3WDT A;  2RR1 3;  3FE5 A;  1UWW A;  4QHZ A;  2E9Q A;  1OMI A;  1UKG A;  2RVA A;  2WYS A;  4WV8 A;  3WEZ A;  2E7T A;  2JDN A;  2XVK A;  4ASM B;  3HNM A;  2PYT A;  1WCQ A;  4FO9 A;  1PM7 A;  4LLF A;  2JG8 B;  4CDX C;  4CCD A;  4CVU A;  3W5N A;  4Y22 A;  2GNT A;  5CFC B;  3I8T A;  3NW4 A;  3ZYI B;  4OUL A;  3K51 A;  3TN9 2;  5LCW L;  1MS0 A;  4FPC A;  4HKL A;  3JUU A;  2GC3 A;  2ZEW A;  4OZO A;  1W2T A;  4N53 A;  1DGW A;  1W2A X;  4EZ4 A;  3BPZ A;  3KLS A;  4IV1 C;  3KCX A;  2CGO A;  4YVS C;  3KVA A;  4BXF A;  1GAN A;  2R04 2;  3KVB A;  2E7A A;  5HCA A;  4YAR A;  1I5Z A;  1UNB A;  2XGX A;  1OHF A;  1LU1 A;  2Y6J A;  3KV9 A;  1TME 2;  4Q1R A;  3CJX A;  2HWE 3;  3WX5 A;  3PVE A;  2SLI A;  3L9J T;  1W6Q A;  3MV1 1;  4CPB D;  2WIN B;  4XUP A;  3ZOI A;  2VUA A;  2PHF A;  4PIX A;  3GCX A;  4FOW A;  3RYK A;  1W8F A;  1DDL A;  2VUL A;  5FZO A;  1NCR B;  1W90 A;  2E32 A;  1G7Y A;  3IIA A;  4LE4 A;  2JEN A;  4XMI A;  4A3X A;  1H1I A;  5G05 L;  4QQH A;  1ND2 A;  5F3E A;  4YW5 A;  3ZSJ A;  4BIO A;  1IKP A;  1ZZ6 A;  2A6V A;  2ZJC A;  3RJ2 X;  4A7Z A;  4HAN A;  1RHI 2;  3H1Y A;  4H7L A;  5K9Y A;  3AP5 A;  4LTA A;  3LQC A;  5ACA 1;  5BY5 A;  2TUN A;  2WJS A;  3WNK A;  3NNF A;  4MZU A;  4LE3 A;  3AMQ A;  1MAC A;  1X82 A;  2FCT A;  1LHN A;  3AJY A;  1KD7 A;  4L9B A;  3LFI A;  5C9A B;  4OHX A;  1SFP A;  1W99 A;  3CHX A;  2RMU 1;  4C90 A;  1G6N A;  2VVD A;  5KBF A;  4FOV A;  4W65 A;  2B42 B;  1PMI A;  3PTY A;  1Y9Q A;  4NAM A;  5L7O B;  1AR6 2;  4UW5 A;  4LBJ A;  1WCS A;  1AR8 3;  4TWT A;  1OUX A;  5FYM A;  4WVW A;  3K2O A;  4M00 A;  3UET A;  1V70 A;  4QKF A;  4CDW A;  1GWL A;  3N35 A;  2AZ5 A;  1ENR A;  3D8C A;  1UIK A;  2OII A;  5DQ0 A;  1JYT A;  3PUH A;  4IV1 B;  1PVX A;  5FYU A;  1RC6 A;  2QQK A;  4NWW A;  1OI6 A;  3A21 A;  5ANN A;  4MXW A;  3ZVX A;  4AI2 A;  1GU3 A;  1CZV A;  3FFQ A;  4HPK A;  1ZRI A;  2JIG A;  5GAL A;  5F8P A;  2R32 A;  3FBM A;  2RHP A;  4DNY A;  4GWN A;  1R1A 2;  3ZLI A;  2ZX4 A;  4R9D A;  4YZ1 A;  3IAP A;  3POI A;  4CCO A;  5T5J A;  2JKB A;  1QGL A;  4HZF A;  2WFF 2;  5BUV A;  4H7M A;  1X8E A;  3VBU A;  5JOX A;  3C7G A;  5LA1 A;  3LDB A;  3AYA A;  3RI9 A;  2BGC A;  2B7Y A;  1ZRR A;  4LBO A;  1YLL A;  3RSJ A;  5IFP A;  4AEJ A;  2VUJ A;  3U14 A;  3G7D A;  4FPE A;  5BXX A;  1E5I A;  1Z7S 1;  3O14 A;  3I3E A;  3ON7 A;  4HKO A;  1IKQ A;  4Q4X 1;  1VBE 1;  4PBP A;  4K9S A;  3I3B A;  4Q29 A;  2JB4 A;  1W9S A;  2FCU A;  2GNM A;  2CAU A;  3GJB A;  2D6N A;  4AVC A;  4NHY A;  2QZ3 A;  3ELN A;  1RUI 1;  2ZMN A;  1NLQ A;  3K3N A;  1S0I A;  4X8N A;  3S0M A;  4KU7 A;  5C3Q A;  5JZG B;  2WZE A;  3G6J B;  1C8M 2;  1PO2 2;  2GH8 A;  3ZFG C;  4KBB A;  1COV 2;  3INA A;  4DZG A;  1VR3 A;  1D0H A;  1RXG A;  1WW4 A;  3FMG A;  1BVP 1;  5K7P A;  3ZX7 A;  4LO7 A;  3VBH A;  1ZBA 1;  2W92 A;  2ZGK A;  2E33 A;  3FLR A;  3J8F 3;  3N9P A;  4RFR B;  4ARY A;  1ZZ9 A;  5BNO C;  4KG0 A;  2VMI A;  3O7O A;  5E1R A;  2XJU A;  1W06 A;  2JE7 A;  4M3C F;  3SKV A;  2JWP A;  2PEL A;  1DZT A;  5AVP A;  1SHW B;  1ULF A;  4AFC A;  1YQ2 A;  1C1F A;  3UKN A;  3C7O A;  4CXY A;  2FDK A;  3H1M A;  4JDO A;  3T2T A;  3IDB B;  2D40 A;  3SEP A;  4JGZ C;  3UGF A;  3N3H A;  2GND A;  5FYT A;  1LHW A;  2WFP A;  5FV3 A;  5EPA A;  4D7Y A;  5JXI A;  2VOK A;  1W6M A;  4Q4V 3;  2RMU 3;  2ZAC A;  2IXJ A;  2AYH A;  5D8A B;  4FFG A;  4XDP A;  4YM1 A;  2DCT A;  4Y5S A;  5E89 A;  3O5S A;  3ZYB A;  4KU8 A;  5FZB A;  4A7K A;  3H8O A;  4CDU B;  4LJH A;  2JDM A;  3NRU A;  1UX6 A;  4L97 A;  3B7M A;  1YRZ A;  2ZGM A;  1GWK A;  1U5I A;  4JKL A;  2WKK A;  4YFZ A;  5A7S A;  1JH5 A;  4EV0 A;  2DUQ A;  4AEK A;  3BKZ A;  2QQM A;  1MZ6 A;  5EIY B;  1SLT A;  1RUH 1;  5FKC A;  3ZIW A;  4XF9 A;  1NA1 C;  4E2S A;  3QLQ A;  4P5Y A;  1R09 2;  3VD5 A;  5FZ8 A;  1IZ3 A;  3N7L A;  3VDA A;  2TNF A;  2ZKN A;  1LR5 A;  3DF0 A;  3DPR B;  4W6W A;  2J1S A;  4TYS A;  1GZC A;  3J26 N;  1W8O A;  4BZ4 A;  2YV8 A;  4LK6 A;  4BQ2 A;  5FQ0 B;  3MGU A;  4HN0 A;  5FBJ A;  5K0U A;  4NRP A;  5DPN A;  1BQP A;  5BNN A;  3NV2 A;  2WYF A;  1MS9 A;  1DHK B;  3THT A;  1AF9 A;  5AFB A;  5FZI A;  2FHR A;  1G9B A;  4IER A;  4A2U A;  1QJF A;  2VO5 A;  4NHL A;  3E6D A;  4CCK A;  4P9X A;  3RNS A;  3WQB A;  1UY0 A;  3N9O A;  3U37 A;  4D7S A;  1ULD A;  4YW2 A;  1Z7S 3;  2RDR A;  4LBL A;  5H9P A;  5CA6 A;  4Q4X 3;  3WP5 A;  1MR5 A;  1VBE 3;  4FAG A;  3PUS A;  2VCA A;  3AM2 A;  3MI8 A;  5J09 A;  1PGL 1;  2DTW A;  3M2M A;  3J4U H;  3F95 A;  3ACL A;  4Q4W 1;  1UMH A;  1S0D A;  4X6R B;  4RS5 C;  3TAY A;  3D0S A;  4QDS A;  4LIT A;  4OI4 A;  2JG8 A;  4CP9 A;  1VAM A;  4QHO A;  1SLA A;  2ZEY A;  1RUI 3;  5CFC A;  4HOO A;  3CQO A;  4R8H A;  1YFU A;  3IB3 A;  4CXX A;  4FP2 A;  4HLT A;  4QQL A;  2W9X A;  5TSW A;  4LNV A;  4XBL A;  1IG3 A;  1JYI A;  4TTG A;  2KXL A;  1A78 A;  2E7Q A;  1Y3T A;  1HB1 A;  2H6C A;  2PLV 1;  2VXJ A;  2W1U A;  3B9C A;  4QAW A;  4URT A;  1S0F A;  3VGI A;  2FD8 A;  5FYY A;  1ZBA 3;  2ZMK A;  4PLO A;  5GLV A;  4YPJ A;  1H30 A;  1KDM A;  1OFN A;  2HWF 2;  3T2P A;  2WA3 A;  1GQP A;  2VQA A;  1OA2 A;  1DZR A;  1O5L A;  3AX4 A;  2WNU C;  5F6L B;  2Y6G A;  4LIV A;  5DG2 A;  1O4T A;  1GZW B;  4FPJ A;  1K5M C;  1XB9 A;  1W04 A;  1IS5 A;  3B01 A;  3QD6 A;  5FK7 A;  1CX1 A;  1Q5O A;  5EP9 A;  5L73 A;  1VP6 A;  2Q5T A;  1ZBE 3;  1GP5 A;  1HRV 1;  1UOJ A;  2XH6 A;  2ZTN A;  3HMY A;  4HBN A;  5FZL A;  1V00 A;  2FCV A;  4E4Z A;  1RJ8 A;  1B09 A;  2LRO A;  4Y1U A;  1CAW B;  3A0N A;  2GN7 A;  4DB5 A;  1BLZ A;  4EE2 A;  2HWC 2;  1S55 A;  1UZW A;  1QJY 1;  1PIV 2;  1HJG A;  4XIO A;  2Q8O A;  3SIS A;  3WNX A;  1LAJ A;  4IV3 C;  1QQP 2;  2A3X A;  4N43 C;  1URX A;  2UYA A;  2VNO A;  2WQZ C;  3LEK A;  2VC9 A;  2WNE A;  4IDZ A;  3OUJ A;  4IET A;  4NMI A;  4UFI A;  3A23 A;  5EZW A;  2FZ1 A;  1RUH 3;  2DCJ A;  2NLR A;  2CU5 A;  4RS5 B;  1WA6 X;  2JDA A;  4CDX A;  5C71 A;  1GNZ A;  3FLP A;  4UT5 A;  2JE8 A;  4CP2 A;  2A6X A;  3VDD C;  3UT0 A;  5IK4 A;  2R06 1;  2OVU A;  3AYD A;  1UOF A;  5JSO A;  4COY A;  4E4D X;  3NJY A;  2J1R A;  4IV1 A;  3BOW A;  5T54 A;  4YVS A;  4TXW A;  2VBB A;  4PJY A;  5EWS A;  4NIA A;  2YY1 A;  4M3C E;  4ZZ8 A;  4Q0P A;  3VL8 A;  1QIQ A;  3R4U A;  3FUO A;  2BZD A;  2VCB A;  1PK6 B;  5T3N A;  5F3C A;  5IVB A;  5LRS A;  3GAL A;  1S0B A;  5H9R A;  1HDK A;  4MV2 A;  4AWD A;  5DAW A;  2DF7 A;  1SLC A;  3UJQ A;  5KHG A;  1NCQ C;  3T09 A;  4QMA A;  2QVS B;  1AVB A;  5F39 A;  2ZKL A;  1WLD A;  2YPJ A;  4Q4W 3;  5DUX A;  4Y1Y A;  5EJ3 A;  1JOJ A;  1R1Z A;  2ZGR A;  2Q8E A;  2A7A A;  1YUD A;  1RUD 1;  2VOW A;  2YHJ A;  1NY7 1;  5C33 A;  1BBT 2;  1UW8 A;  3GZE A;  5KXB A;  2IUW A;  3U4X A;  4LHS A;  1VRH 3;  2CAV A;  2WDB A;  4KWK A;  1FPN 3;  1ZZB A;  3VBR B;  4KQ7 A;  3ZYR A;  4RGG A;  5JI7 A;  2PLV 3;  5DZF A;  4XFG A;  4NJ4 A;  2FMD A;  3NNL A;  5FTT C;  3AKT A;  3NJV A;  1AR9 3;  1X50 A;  4O7X A;  4XIK A;  1N3P A;  2YGL A;  1OUS A;  3WVJ A;  5KHI A;  2ARA A;  1U5Y A;  4Q4Y 2;  3WQ1 A;  1AX0 A;  2BVV A;  1KJL A;  2GSY A;  3KV5 A;  1CAX A;  1UOG A;  4K6B A;  1W8T A;  4GH4 C;  5F5I A;  2UY8 A;  2G9G A;  2PAE A;  3POF A;  5ABJ C;  1DCS A;  2QQV A;  1H1M A;  1OVS A;  2RS1 2;  2GZW A;  1OLM E;  1YJK A;  2ZX2 A;  2V5Y A;  4LHN A;  4L0P A;  4RL7 A;  4AVS A;  3E5Q A;  2BFU L;  5FAX A;  2ZZQ A;  5GZF A;  1XC6 A;  3ILN A;  3UNP A;  3ZKY A;  4BQ4 A;  3C3V A;  1N3Q A;  1YQ5 A;  4QX3 A;  2V72 A;  3LAG A;  1RUJ 2;  2J42 A;  3LWC A;  3S30 A;  5GLW A;  2QZ2 A;  3D4K A;  4KWU A;  4AK3 A;  4DXR A;  2Y8K A;  4Z07 A;  3VDC A;  4D3W A;  2Q4S A;  1NCQ B;  3DKW A;  1UAI A;  3B94 A;  3K4Z A;  4J1X A;  4MO3 M;  5DUU A;  3KT4 A;  1PZ8 A;  5F1R A;  1OLM A;  4LO5 B;  1NQD A;  5JOY A;  2P6H A;  2OZ6 A;  4AR2 A;  3TN9 1;  3OPW A;  1N47 A;  1PVC 2;  5FZ7 A;  1CES A;  2QTW B;  3FN9 A;  1XOY A;  1AX1 A;  2A73 B;  5F32 A;  5L9R A;  2CHH A;  4FFH A;  2WN2 A;  5FZ4 A;  5FR3 A;  2RS5 2;  4UF0 B;  1J3R A;  2Q1Z B;  4C1W A;  3QCW A;  2R04 1;  1I9R A;  2PHR A;  1LGB A;  2BOI A;  4AI8 A;  2VMG A;  1MQT B;  4BPZ A;  4YW7 A;  2AEY A;  2B45 X;  3THC A;  2D6P A;  4LMF A;  1TME 1;  4C8D A;  2IZW A;  2QCS B;  4NRO A;  2D3S A;  1SCR A;  4YG6 A;  1OD3 A;  2GC0 A;  1YQ8 A;  1OQE A;  1AZD A;  2QQU A;  3WNO A;  4QPI B;  1QNY A;  1RUF 3;  2DUO A;  1YFX A;  4NAO A;  3ZFG A;  2UY9 A;  4J1W A;  3MDP A;  1LGN A;  2Q30 A;  3PHM A;  3ES4 A;  2D3P A;  5T5O A;  1RED A;  3RZH A;  1KGY A;  2K0G A;  4MYE A;  1SEF A;  2Z4F A;  2P3Y A;  3LA2 A;  4FPY A;  4SBV A;  5FJH A;  5DAB A;  2PHU A;  2W87 A;  4XUR A;  4B1M A;  5BNO A;  1QJU 2;  3ACF A;  2C4X A;  2P4E A;  4QX1 A;  3AL6 A;  1J59 A;  2A70 A;  4R4Z A;  1TNR A;  3HIF A;  1DGR N;  1RHI 1;  4JGY C;  4URA A;  5C3R A;  1CON A;  3V64 A;  5FBZ A;  2R6Q A;  5C4W C;  2W52 A;  4ATE A;  3D0J A;  4LUL A;  3KGZ A;  2A6Z A;  5B2G B;  1GP6 A;  3N9M A;  4Y22 B;  2PAM A;  4E8D A;  5A3M A;  1OT5 A;  1PX3 A;  1HX6 A;  4JGZ A;  5LAS A;  2YB7 A;  4XBQ A;  1VBC 2;  1RUG 2;  1YHF A;  3LEI A;  2XON A;  1AR6 1;  1MS8 A;  1MEC 2;  4IE0 A;  4GMP 3;  1IG0 A;  4DQA A;  3H42 B;  3NKT A;  4IGO A;  4FCA A;  5LA0 A;  1E57 A;  5B4X A;  3OD0 A;  4BME A;  2XL9 A;  1IQA A;  1PMH X;  5T5P A;  2LW8 A;  4CCN A;  1UXZ A;  1W9T A;  2HWB 2;  4ET7 A;  3IM0 A;  1Y7B A;  4XDQ A;  3VD4 A;  3OGG A;  2HEV F;  4OMD A;  3MLL A;  3OPZ A;  2ES3 A;  2R30 A;  2GDF A;  1HV0 A;  2IWG B;  3AP4 A;  4LLO A;  4LOS A;  4Y20 A;  2XJR A;  1W2N A;  1XSR A;  5CB7 A;  5IT6 A;  1NA1 A;  3X29 B;  1HIX A;  1Y4W A;  3K75 B;  3SEE A;  5A7W A;  1OF3 A;  1R1A 1;  4NHM A;  2A1X A;  4PQQ A;  3WNM A;  1WW6 A;  2DBN A;  3FWE A;  1GZW A;  2JDP A;  3P5B A;  4Y4R A;  3URF A;  2WFF 1;  5FZO B;  1JYN A;  2PHW A;  4FTE A;  4XJU A;  2XOM A;  4E8C A;  2YPD A;  3VKO A;  2R0H A;  3WDX A;  3VKL A;  5JLV A;  1S2K A;  1UY1 A;  2VQU A;  2XLA A;  4ZS3 A;  1UIJ A;  1E5R A;  3ACH A;  1DP0 A;  4ZXK A;  1ND2 B;  5KXC A;  1C4R A;  1DLC A;  4ZU5 A;  4DY3 A;  3ZKU A;  2XUM A;  4Y1V A;  1C5H A;  5CKQ A;  1Q56 A;  2WL1 A;  4JVA A;  4QM8 A;  2ZX1 A;  5I0S A;  4JGY B;  3HNY M;  4QX2 A;  1V9U 2;  1UOB A;  3KV6 A;  5C4W B;  1KEX A;  4Y5Z 0;  1SZB A;  4LPL A;  1BK1 A;  2R04 3;  1UPS A;  3J9S A;  3Q9O A;  2ZAH A;  4LUK A;  1RUE 2;  2TBV A;  4FPG A;  4D69 A;  5C5T A;  3MV0 1;  1HB4 A;  4OUE A;  4XQW A;  3ZDV A;  5GZC A;  4RS5 A;  2F6B A;  4D7T A;  1TME 3;  3AKS A;  2NPI A;  5T50 A;  1AYN 3;  4HMZ A;  3H8X A;  1GNH A;  4GWJ A;  1PO2 1;  2WT2 A;  1HJF A;  2EIE A;  2YC2 A;  5CZK A;  4I3G A;  5I0D A;  3MW3 A;  3LSD A;  4AZZ A;  4MXW B;  1HN1 A;  2D5H A;  5CIR A;  3THP A;  4XAC A;  1D2S A;  1DFQ A;  4PF1 A;  5FZK A;  3TEX A;  4XXA A;  3U07 A;  4PCR A;  2D5F A;  3LFM A;  4LR4 A;  3J7L A;  3UV9 A;  2YBS A;  3WW1 A;  1UF2 C;  5FP3 A;  3RPQ A;  1JMU B;  2GAU A;  4AGR A;  1DLL A;  5LEK A;  4AAX A;  1LRH A;  1RHI 3;  2PXJ A;  1QJX 2;  1GNY A;  4GJZ A;  2WNU A;  3CIH A;  1DYP A;  3H9A A;  3VBU B;  3SLI A;  5CEH A;  1TZO A;  2C6S A;  3I59 A;  2XLG A;  3OB8 A;  1K5M A;  1GQH A;  1H2M A;  2GMP A;  4YM2 A;  2DUP A;  1RL3 A;  2Y64 A;  3BI3 A;  2P3J A;  4ZHN A;  4YM0 A;  1ZZC A;  2ZCW A;  4BQ3 A;  5T52 A;  1VBB 2;  1AR6 3;  3LDR A;  1ZZ7 A;  1XQN A;  3CJI C;  1ENS A;  2W2I A;  4Y5T A;  5EV7 A;  4IEU A;  4FFF A;  4XUN A;  3GBG A;  3PVO A;  4XHX A;  4IV3 A;  2D43 A;  4N43 A;  3GHM A;  3GYD A;  5GLT A;  4QHB A;  1UZV A;  3H0O A;  4Q8L A;  1ZX5 A;  4Q0Q A;  4UBH A;  1EPW A;  3E5U A;  2N7G A;  2WO7 A;  1OH4 A;  5J1X A;  2Y34 A;  3FFZ A;  2QQN A;  1BVV A;  1R09 1;  1C3H A;  1CAV A;  4LBQ A;  3BYW A;  4NWV A;  3SCH A;  4D6R A;  1WME A;  2JD9 A;  2VNR A;  1QOO A;  3I7D A;  4G9S B;  1GKB A;  3R0R A;  1M06 G;  1REF A;  3WF1 A;  3O12 A;  2WFF 3;  3VBH B;  3VN4 A;  2WNV C;  4LIU A;  4YW3 A;  2YG0 A;  3VDD A;  2Y6L A;  1AYM 2;  4R9A A;  1SBF A;  4L11 A;  1Q8V A;  1DQ2 A;  3IPV A;  4YNI A;  2W39 A;  1D4M 2;  1UZZ A;  2YUE A;  3IMM A;  4FPH A;  5F3I A;  1YIP A;  5CBL A;  3CLP A;  4HON A;  5FY7 A;  3O1R A;  1H6X A;  2E31 A;  3NJZ A;  2ZML A;  4UW3 A;  2HYK A;  3Q8B A;  5KXD A;  2ARX A;  1ONA A;  3ROU A;  4FXG B;  1W6M B;  3LPF A;  1D7P M;  4YW4 A;  3KHB A;  2VZQ A;  4OCT A;  4XAA A;  4XFF A;  1NCQ A;  3DYP A;  3AP9 A;  1V6N A;  2VW2 A;  3VB9 A;  1MS3 A;  1FAT A;  1QU0 A;  2DFC A;  2RM2 2;  3KM5 A;  3MYX A;  5LBE A;  4ES9 A;  4LO6 B;  1F35 A;  4OHZ A;  5F2S A;  4TLF A;  1PO2 3;  4DEV A;  3H7Y A;  3ILR A;  1SMV A;  1OLQ A;  1W9Y A;  4RR3 C;  3U0Z A;  4ZY9 A;  4XJA A;  4GXL A;  2OPK A;  4UF0 A;  3E97 A;  4KG8 A;  2HWF 1;  3H50 A;  1AR7 2;  1HB3 A;  4K21 A;  4GQ7 A;  4X6Q B;  4Y33 A;  2G1M A;  4XCB A;  4CU9 A;  1OKO A;  3AB0 A;  3BTY A;  1CWP A;  3AZZ A;  1B35 C;  3ENR A;  1ALY A;  4P9I A;  5IVV A;  5K0U B;  1U0A A;  4OVE A;  2C9K A;  5BNN B;  2F4P A;  3KGL A;  4D0Q A;  4HVQ A;  2BBV A;  4GH4 A;  3OYW A;  2A6W A;  4BK5 A;  1SLI A;  1RIN A;  2PHX A;  5ABJ A;  4ITC A;  5HV0 A;  1TEI A;  4PI2 A;  4LKF A;  1TMF 2;  1CJD A;  5FK8 A;  1RIT A;  1PIV 1;  3EB7 A;  3GF6 A;  2BFU S;  1QQP 1;  2XXZ A;  2XJT A;  4LUM A;  4YG0 A;  4AVA A;  4EWE A;  1XNA A;  3HAG A;  1MZE A;  2OQ6 A;  3NVC A;  4EN9 B;  2EXI A;  2BNM A;  4JTO A;  3O1U A;  1OSG A;  5JSR A;  2WZR 2;  4DRR A;  2AGS A;  3VHO A;  4CP9 B;  4BM8 A;  1ASJ 2;  3MLJ A;  3CNA A;  2Y0I A;  1PO1 2;  4P9L A;  2EVX A;  1NAE A;  2FDI A;  2ORZ A;  4DUV A;  1OPM A;  3RDI A;  4QPG C;  4QXH A;  4MGS A;  1EV1 3;  5FXW A;  1J58 A;  5DDJ 3;  5JR2 A;  5EJZ B;  3SMH A;  3BVC A;  4I0W B;  4CCL A;  4OHW A;  4IQP A;  3ACG A;  3UL2 A;  1ZYB A;  1FNZ A;  2FDF A;  1WKY A;  2VCC A;  1W2O A;  3WP3 A;  1GP4 A;  2Y38 A;  3O1P A;  5FY1 A;  4E2Q A;  3N7K A;  5L9V A;  2CTV A;  2BYV E;  5IUQ A;  2LM3 A;  4GKY A;  1LOE A;  2DUR A;  1K42 A;  4H14 A;  3V65 A;  3WG2 A;  1JTZ X;  4AG4 A;  4QDQ A;  3Q8A A;  3PNA A;  3CZU A;  4XF4 A;  4XQ4 A;  5FLH A;  1MZF A;  3NQH A;  3ZPO A;  2ZPX A;  3WLU A;  2JEM A;  2VW0 A;  3UES A;  1V6O A;  2P17 A;  1OVP A;  2YDE A;  4NPM A;  4YYO A;  1IHM A;  3VZO A;  3VD7 A;  4YZ5 A;  3WZ1 A;  4Y26 A;  1HQL A;  1LEM A;  2W0X A;  5FJK A;  4ZZ5 A;  3HWJ A;  2GNB A;  1EPZ A;  3R4S A;  2JDY A;  5FZH A;  4COZ A;  1XNB A;  2ZHK A;  4EN8 B;  2K2S A;  4ZXE A;  1WCD J;  3VZL A;  5KC5 A;  1O7F A;  2G9Z A;  1LHV A;  1HB2 A;  3NMB A;  4L92 A;  2IC1 A;  4JGY A;  5FP8 A;  3JCI A;  3K48 A;  1AXY A;  4GB3 2;  5FYV A;  5C4W A;  1UY3 A;  2HWF 3;  4YZ3 A;  3ZXL A;  4CDX B;  5A1L A;  1BK0 A;  4K8R B;  2VVE A;  3CZJ A;  4MVT A;  1S0J A;  4BQW A;  3LPG A;  2WS9 2;  3RWK X;  3OF1 A;  3DUI A;  2VZT A;  4KWJ A;  1F9K A;  4QDR A;  3VUO A;  4YZ4 A;  4Q8K A;  1S0C A;  2ZZJ A;  4NE9 A;  4QXC A;  1GIC A;  1DQ5 A;  1IGO A;  5SV8 A;  4BQY A;  2CSG A;  4DO0 A;  3WIN E;  2ET1 A;  4YVS B;  5I93 A;  1Q8Q A;  4BDV B;  1LOC A;  2RS1 1;  1ZA4 A;  1SDD B;  5C6C A;  1UZY A;  1SCS A;  3OGR A;  2V73 A;  3ALQ A;  4AYU A;  2C26 A;  5EQU A;  2WZ8 A;  1US3 A;  4EJR A;  1W6P A;  4A41 A;  5JAX A;  3WDV A;  4NVP A;  1APN A;  1NE6 A;  1PIV 3;  3ZYG A;  4GWM A;  3BAL A;  1QQP 3;  1RUJ 1;  4Q5O A;  4QQ2 A;  4JX0 A;  1C5I A;  2VZ1 A;  1BEV 2;  3R6S A;  4IEO A;  2ZGN A;  4WVM B;  4EWD A;  1BZW A;  1U5Z A;  4XJZ A;  3T08 A;  1XBF A;  1S1A A;  4DRV A;  5CNA A;  5F7U A;  1JOD A;  4FPO B;  1SAC A;  5FY9 A;  3B5L B;  4Y1X A;  1JU3 A;  2WC2 A;  1W3V A;  2R07 2;  5FZ3 A;  2OYZ A;  1ENQ A;  1GR3 A;  2WO2 A;  1PVC 1;  3AMP A;  4GZ9 A;  2X5I C;  4H2A A;  5FO7 B;  4XUQ A;  1QEX A;  1UKR A;  2IXL A;  2BU9 A;  2RS5 1;  3AMN A;  3WF0 A;  2VNG A;  1CPN A;  2EXH A;  4EQV A;  1WW7 A;  2L9L A;  4MX3 A;  2QFE A;  1KDK A;  3BPS A;  3O0W A;  1G9D A;  4WZF A;  4PLN A;  1CAX B;  3VHP A;  1A6C A;  4I30 A;  5FP7 A;  1O3S A;  4CEW C;  5FY8 A;  2Y6K A;  1CR7 A;  4I09 A;  1UU6 A;  4HL0 A;  3HR9 A;  4M0H A;  5LA9 A;  4CU6 A;  2CY6 A;  1WCU A;  1XNK A;  4NID A;  1PX4 A;  4IL7 A;  2QNK A;  1PZ7 A;  2NZ9 A;  4IEY A;  5AC9 2;  4AI3 A;  2ZGO A;  2BJS A;  1POQ A;  4A3Z A;  3ZMO A;  1W05 A;  1VBA 2;  1IPS A;  1QJU 1;  1WLW A;  1ENX A;  5SV5 A;  2ZAA A;  4ATF A;  5T55 A;  1FAY A;  1X33 A;  5ACA 3;  1JUI A;  5FMB A;  1CD3 G;  2HBU A;  3RVH A;  4TZD A;  3I97 A;  1CGP A;  2ARE A;  4DUW A;  3I54 A;  4CCM A;  3HBZ A;  1NQJ A;  4ZU7 A;  1FI2 A;  4MH0 E;  3U4S A;  4IEW A;  4LBQ D;  1R64 A;  4O61 A;  1AJO A;  1RUG 1;  5FLJ A;  3GBW A;  5DMY A;  4XAB A;  4TSV A;  3O1S A;  1MEC 1;  4B7E A;  2BGP A;  1QOS A;  4AI1 A;  2X05 A;  3I2I A;  3CJI A;  3BTX A;  4A45 A;  2ILM A;  1DGW X;  3NV1 A;  4HFS A;  4AEM A;  3BU0 A;  2C5D A;  2HWB 1;  2A75 A;  2PHD A;  2V4V A;  1JOB A;  1TQ5 A;  2PHL A;  2RS1 3;  2VH9 A;  3WV6 A;  5BNP C;  2C1F A;  4HK8 A;  1SFN A;  4S2D A;  3TWI A;  3K3O A;  5HPO A;  3J7M A;  1ZM1 A;  4Q1P A;  4Q0S A;  3RZL A;  1O3R A;  2OKX A;  5FO8 B;  5KR7 A;  4OFG A;  4QGL A;  3HQX A;  2BRT A;  3ZFG B;  1RUJ 3;  1NG0 A;  2ZEX A;  4BJ0 A;  5JUV A;  4AQ6 A;  2WWS A;  4FFI A;  4I3P A;  1W0N A;  3T0D A;  3WW2 A;  3E6C C;  3T0A A;  2RR1 2;  4P9G A;  1LOB A;  2XJP A;  3U10 A;  5I8S A;  1L7Q A;  2O8O A;  1YI9 A;  2WNV A;  1GSL A;  1UMZ A;  5EFU A;  4P02 B;  4BQ5 A;  5BNO B;  5IVC A;  4RA0 A;  3ZFE C;  2VL4 A;  3HNB M;  2ARB A;  4BXS V;  1WMF A;  4W4Z A;  3WOG A;  3AKR A;  2P6C A;  4AFD A;  1V9U 1;  5FZ0 A;  2RS5 3;  2W47 A;  5FZG A;  4MAD A;  1SBE A;  3E1F 1;  4JGZ B;  4XJ9 A;  4M4P A;  1YFY A;  4LO4 B;  1RUE 1;  4YGE A;  3RRD A;  1K3I A;  2B5H A;  3KS7 A;  4BMB A;  4QGN A;  2B46 X;  2RDQ A;  2Y26 A;  4AVT A;  1YC6 1;  2O0O A;  5FUI A;  4D6Q A;  4FPK A;  1V6L A;  5C8C C;  2QBX A;  2VZ3 A;  4N7U A;  4I01 A;  2PHT A;  3JBG 1;  3MID A;  1NZI A;  4N90 A;  4Y20 B;  3SXW A;  4XAE A;  4EN7 B;  3M3C A;  5I0R A;  4RR3 A;  2JEC A;  2ZHN A;  4LA3 A;  4E4S A;  1NA1 B;  4RGK A;  4LKE A;  1MPX A;  1XXN A;  4W6X A;  5A7W B;  1HQN A;  4XF1 A;  3CBN A;  1QJU 3;  2BWC A;  4YG3 A;  5FZE A;  5FMC A;  1BMV 2;  3L2H A;  4LBK A;  3KCY A;  1QJX 1;  1B35 A;  1SDW A;  5A3N A;  2PQQ A;  2ADD A;  4JHT A;  3M3O A;  3WCR A;  1TVG A;  2VCM A;  1OUR A;  1BKZ A;  4LOR A;  2HEY F;  5HXM A;  1DYO A;  2CL2 A;  3IAQ A;  3LB9 A;  1C28 A;  2WII B;  2DU1 A;  4OI2 A;  3A7Q A;  2ZX3 A;  3WHT A;  3BU7 A;  1ULE A;  4MLO A;  1GOH A;  4ES8 A;  1JZ2 A;  3AXD A;  2XDV A;  5FZM A;  2RG4 A;  3OBT A;  4DS0 A;  4B4P A;  3M4F A;  5A70 A;  3POE A;  4A7Y A;  1O8P A;  3VBO C;  3GNE A;  2HWB 3;  3ZDS A;  1DYK A;  1ZA7 A;  4AHW A;  2JB8 A;  5L19 A;  3OSD A;  2DCY A;  2WAB A;  3BUC A;  3C7H A;  3PUA A;  4XE9 A;  1W6N B;  3H7J A;  2NMN A;  1MS4 A;  4Z2A A;  1HV1 A;  2ZXQ A;  4KBZ A;  4R9B A;  1ND3 C;  4WBB A;  1UL9 A;  3CO2 A;  3QBQ A;  1CIW A;  4A6O A;  1CJP A;  1LJ7 A;  4FT8 A;  4HVR A;  3R05 A;  5FZ1 A;  2XPJ A;  2RDN A;  5E88 A;  3ZXD A;  5CKM A;  4ISQ A;  1QXR A;  3T4H B;  5I8Y A;  4K1Z A;  5FP4 A;  1HKD A;  2QDN A;  3MIC A;  4QPG A;  4CEY C;  4D94 A;  5C8C B;  1A8M A;  5E8A A;  2CDP A;  2HKX A;  5FDB A;  1JZ4 A;  1Y9G A;  2GME A;  2VBP A;  4CP0 A;  4QB2 A;  1CN1 A;  1US2 A;  2VAU A;  4AQS A;  2D6L X;  1AYM 1;  1S0G A;  2Y0O A;  1KJR A;  3OUI A;  1RUC 2;  1EUU A;  2VW1 A;  3K77 A;  4XVH A;  1D4M 1;  1T2X A;  4MHU A;  4ZS2 A;  3RGB A;  2BQP A;  2WNU B;  4M4R A;  5FP9 A;  4Z8B A;  1RVF 2;  3CKH A;  2QQW A;  2Y33 A;  3A22 A;  3I59 B;  3KZ4 C;  2MNG A;  4DIQ A;  1K5M B;  4DPN A;  3DYO A;  1V9U 3;  3AKP A;  3VBS C;  4Y1Z A;  3WT3 A;  4XC9 A;  5IHR A;  5A7O A;  1L7L A;  3LIH A;  1AJK A;  4WVM A;  1RUE 3;  4KWL A;  2CGN A;  3SCF A;  5I91 A;  4UAP A;  3ETP A;  4P9W A;  2ZA9 A;  4M3C A;  2RM2 1;  5A6Z A;  4N9I A;  2JKX A;  2VOV A;  1LKN A;  4CSW A;  1RIR A;  4IV3 B;  4IEX A;  1K12 A;  2YC0 A;  4N43 B;  5F9T A;  1AHS A;  4YRD A;  4K1Y A;  5DUW A;  4AXO A;  1RUN A;  5FYZ A;  2IXK A;  3USU A;  3JBG 3;  1HN0 A;  3VZJ A;  4WM8 C;  3OBZ A;  4LBQ B;  1CAV B;  3J7H A;  1HXS 2;  1W0O A;  1LES A;  1AR7 1;  3J8F 2;  3P6B A;  1FMD 2;  3VV1 A;  1GFF 2;  1WBF A;  2C0Z A;  1GMM A;  2XQR A;  3OBA A;  4QXK A;  3VZK A;  3PU3 A;  2ZS6 B;  3NV4 A;  2X29 A;  3K4A A;  4W50 A;  1VE0 A;  3NST A;  5J48 A;  2D98 A;  2IFW A;  4CXW A;  2UU8 A;  3VDD B;  2YMZ A;  5GZG A;  4FQ4 A;  1ST8 A;  1V6M A;  1HRV 3;  3C7E A;  4IXL A;  2JD4 A;  1POV 0;  3WUC A;  3GZT B;  3IPV B;  5H9S A;  4RQP C;  2VVF A;  5A3W A;  4WVZ A;  4K8F A;  2NM1 A;  4Q4V 2;  1TMF 1;  1XSQ A;  2X8K A;  2W5F A;  3JQW A;  4AGV A;  1QJY 3;  2B4K A;  1EAH 2;  5JIU A;  5A7Q A;  2BUK A;  1IQD C;  5A33 A;  5IVF A;  1D4V B;  4L8Q A;  3SNM A;  3ZN5 A;  5FWE A;  4GAZ A;  1F4A A;  2W68 A;  1KFX L;  3ZXE A;  1G86 A;  4E4H A;  2WZR 1;  2UWC A;  4YLZ A;  4JRA A;  1XYN A;  5ERL A;  2AR6 A;  1ASJ 1;  4XTP A;  3RS6 A;  4UW6 A;  4CRQ A;  3OY8 A;  4IW3 A;  1PO1 1;  4KL1 A;  4O65 A;  5AFE A;  1IS3 A;  4O9E A;  1GQG A;  3AZV A;  3FUQ A;  3NL1 A;  4D8M A;  1OXC A;  4XET A;  2VZP A;  2MHF A;  2J1E A;  1KQR A;  2AEN A;  1OOP C;  1XU1 A;  2R06 3;  5BNQ A;  2X5I A;  4IGP A;  2VOT A;  1G9F A;  3D6E A;  4WM8 B;  5FYH A;  1FV2 A;  1MVE A;  3ZXJ A;  2W91 A;  2WO1 A;  1CQ9 A;  2XQX A;  3MFA A;  4NUB A;  4P9J A;  3EO6 A;  1YXW A;  5FZD A;  5J7M A;  3NO8 A;  3LEM A;  3AP7 A;  2VM9 A;  4DOU A;  2XKO A;  2PQS A;  4AE2 A;  2YGM A;  4GH4 B;  3OYW B;  1JZ3 A;  1H8T C;  4CEW A;  3JB8 A;  3UKV A;  2V5D A;  5ABJ B;  4JQR A;  1UU4 A;  1RUD 3;  3W58 A;  3JXS A;  1GBG A;  2P1B A;  1QOT A;  2KM2 A;  1QJZ A;  4LKD A;  4LQR A;  3SCG A;  2VEC A;  3GJA A;  5DZG A;  2RM2 3;  2RV9 A;  3ZXK A;  4QKN A;  2J22 A;  3B02 A;  5FZ6 A;  1LEN A;  3WY6 A;  3MIE A;  5IK8 A;  1JS9 A;  2W1W A;  4QQO A;  5FZC A;  4B1L A;  5JI9 A;  4NRQ A;  4GB3 1;  3LDK A;  5FPV A;  3PVN A;  3JB4 C;  1HLC A;  1VAL A;  5I0T A;  1WD4 A;  4BU2 A;  4ZU4 A;  1RGS A;  2P2K A;  2ID4 A;  1Q8O A;  4YGD A;  1UO9 A;  2XWB B;  2YZ4 A;  1D2Q A;  3ORJ A;  4WM7 C;  2WS9 1;  2XWJ B;  5IAT A;  3O1O A;  2XB6 C;  1WLC A;  1CVN A;  1XE7 A;  3HOB A;  2WLP A;  1OOP B;  3WHU A;  2ET7 A;  4FPF A;  5DG1 A;  4Z1V A;  1LOG A;  4MXV A;  2RJK A;  5FPX A;  1ZBE 2;  2AEZ A;  4BK4 A;  3N7J A;  1WD3 A;  3THD A;  1PM4 A;  5BNP A;  4OI0 A;  4CUA A;  1TMF 3;  4UBG A;  3UYJ A;  4XBN A;  5FPA A;  3IN9 A;  4PI0 A;  2P34 A;  4R4X A;  2VZV A;  4LBM A;  2R16 A;  3BIW E;  3U75 A;  3ZMN A;  4COW A;  2XBO 2;  1BEV 1;  3KSC A;  3BIE A;  3OGJ A;  3DXU A;  2WZR 3;  2QQI A;  1SFY A;  3NKG A;  5FPB A;  2FDG A;  1KRI A;  4PLM A;  2OPW A;  1XU2 A;  3IDA A;  4B29 A;  4RHV 2;  1PO1 3;  2Y6F A;  2FBE A;  3TN9 3;  1CPM A;  3NAP C;  4OMC A;  3MFC A;  2R07 1;  5F5Q A;  3RZZ A;  4Q2F A;  4B3N A;  3I2D A;  5F5A A;  3T1M A;  3AL5 A;  3ZFE A;  1W03 A;  4A42 A;  3RZJ A;  3P3P A;  5J3U A;  2DDU A;  1SG3 A;  2EIB A;  3H3U A;  4H3W A;  5IJR A;  5LW9 A;  1GOG A;  5J36 A;  2ENR A;  2VMC A;  2BV4 A;  3KCC A;  1X9P A;  3I2G A;  4AVB A;  3KT1 A;  3LOI A;  3KF5 A;  4UYB A;  1PNG A;  5A7P A;  5JOZ A;  2Z69 A;  3S6P A;  1VMJ A;  3A0K A;  2RJL A;  1A3K A;  2JDU A;  2XKP A;  2ZEZ A;  1W6N A;  2H0B A;  5CAZ A;  3IMN A;  1UU5 A;  1OQD A;  4OZX A;  2XJV A;  4WM7 B;  1C8M 1;  1BHG A;  1DU3 D;  4QWN A;  2XJS A;  5A3O A;  1COV 1;  1SLB A;  2W3J A;  3I3M A;  3RZK A;  3OD4 A;  3VL9 A;  4YVW C;  4C0H A;  2MEV 2;  5D2A A;  4SLI A;  1LU2 A;  2QUO A;  5C8C A;  5JXJ A;  2DVG A;  2YRO A;  1PGL 2;  2GC2 A;  4BYY A;  4OQ8 A;  1H9P A;  2D6K A;  5FYC A;  2JG9 C;  1W6P B;  4MOA A;  1WA4 A;  3POS A;  2MPF A;  5AC9 1;  3OUH A;  1W9F A;  3L2Y A;  2O14 A;  1VBA 1;  1S2B A;  4XMA A;  3AC0 A;  1UCX A;  4XF3 A;  1KFU L;  3OEA A;  1AXK A;  2JJ6 A;  5FZ9 A;  1VRH 2;  3OPT A;  4CDQ C;  1FPN 2;  1LB2 A;  2ZAB A;  2DU0 A;  2PTM A;  4GB3 3;  1YEW A;  1ULO A;  5ANQ A;  1FOD 2;  2ORX A;  5EHD A;  1VRB A;  2WUH A;  1Q8S A;  4AHY A;  1TG7 A;  4YZ2 A;  4ZKT B;  1J3P A;  2V4A A;  4NIG A;  1AR9 2;  1VB4 A;  3BOP A;  4Q26 A;  1LED A;  1VB2 A;  4K20 A;  5AVA A;  1W8W A;  2CWM A;  1GZ9 A;  4QX8 A;  4R9C A;  1NXD 1;  4AW7 A;  2ZBJ A;  4RYD A;  1T6B X;  3VZM A;  5IW0 A;  2YU1 A;  1OA4 A;  5JIA A;  1MS1 A;  3VBO A;  2J1U A;  2NMO A;  3M3Q A;  5L9B A;  4CUC A;  1X36 A;  2QQL A;  2XJQ A;  3AVR A;  1Q8P A;  3D5O A;  2DWR A;  4I02 A;  4KMQ A;  4MET A;  2XVG A;  3NJX A;  3VBF C;  4BQ1 A;  1R1A 3;  5GJ6 A;  2EIC A;  4Q0V A;  1ND3 A;  3DEC A;  5A7N A;  1JW6 A;  4UFL A;  1W28 A;  3I49 A;  1W8N A;  1OLR A;  3ZSM A;  4CU7 A;  5A32 A;  5JPN B;  2RR1 1;  2QE3 A;  4MGT A;  2VXR A;  3AZY A;  4XIL A;  3FX3 A;  4CEY A;  1LEC A;  1ULP A;  3UGH A;  1OKQ A;  2HJI A;  3MHZ A;  3WSO A;  3ZXG A;  2SBA A;  2XLF A;  3OG2 A;  2JG9 B;  4MGY E;  3EMR A;  2WWJ A;  2VU9 A;  3LOB A;  2HYX A;  1QWR A;  2JIJ A;  5IK5 A;  2R07 3;  3M3E A;  2BEO A;  2RS3 2;  3FC0 A;  3WP4 A;  2A5Z A;  2FDH A;  3ZYF A;  3FHA A;  3MPB A;  1C1L A;  3NNJ A;  3ZN6 A;  1D0G A;  4H55 A;  4P9Y A;  5KHJ A;  3IDC B;  1NT0 A;  3TEY A;  1BJQ A;  1PNF A;  5J96 B;  5JMC A;  1TE1 B;  1RMU 2;  4CDQ B;  2BNO A;  4LKS A;  4CCC A;  3VBS A;  4XJW A;  4ZPI A;  3MBW A;  2RJ2 A;  1N1V A;  1PGS A;  4DFS A;  3O1V A;  1IOA A;  2W1S A;  5CFD C;  2IVI B;  3WD5 A;  1C8M 3;  2XML A;  3CJI B;  2DV9 A;  4V2V A;  1COV 3;  2P3K A;  2EAA A;  2VTX A;  4N8M A;  4KGG A;  3WG1 A;  3QH6 A;  4J25 A;  1VJ2 A;  3ZFF C;  4HKW A;  2G9F A;  4GKX A;  4JQT A;  3ZXA C;  1RUF 2;  4XW3 A;  1UYZ A;  3DXT A;  3GHN A;  2WR9 A;  2VQT A;  1LOA A;  4UFM A;  3RZG A;  1A34 A;  3MEP A;  1UYP A;  5EYX A;  3GDB A;  4RFT 0;  1W6O A;  4WM8 A;  1H2L A;  1W0P A;  2VMD A;  1RJ7 A;  4QD2 A;  5AC9 3;  3GXU A;  4IEV A;  1NY7 2;  3VD9 A;  3ECQ A;  1VBA 3;  1UXX X;  1NE4 A;  4NPR A;  1EYB A;  1OBN A;  1BMV 1;  3VBF B;  4XEZ A;  1OA3 A;  2I07 B;  1LOF C;  3IDE A;  1AX2 A;  2WNV B;  4JCK A;  3RFR A;  4DXT A;  4FXK B;  3KF3 A;  3HVD A;  4UFJ A;  1F5J A;  1M4W A;  4P14 A;  4F7Z A;  4QX5 A;  3WP6 A;  4HT1 T;  2VPV A;  1VAV A;  2Z79 A;  4YSF A;  3IZO A;  4RQP A;  4V1P A;  2HWC 1;  1TNF A;  2V09 A;  4XZU G;  3TNQ A;  4OUM A;  3N9N A;  4C1X A;  3S57 A;  3POB A;  3HD8 B;  3GM8 A;  3E6B A;  3EBR A;  4CTE A;  3OGS A;  4MGI E;  1NOV A;  2VD7 A;  4RN5 A;  4JTN A;  1DBN A;  1REE A;  3MF6 A;  3AJZ A;  2XVL A;  1NCR C;  3B00 A;  3LE0 A;  3ES1 A;  1UMI A;  2QDR A;  3LKJ A;  1PZ9 A;  1R09 3;  3CDZ B;  4G3Y C;  5IFT A;  1FYU A;  5JOW A;  2EF6 A;  4W6Y A;  1JI6 A;  2QKD A;  2VBD A;  3GBF A;  3SQO A;  3PLQ A;  5C8W A;  4F8A A;  2J1T A;  2OA2 A;  2WSU A;  1AL2 2;  2HEW F;  1POV 1;  1J3Q A;  3HT2 A;  4LA2 A;  4AI9 A;  1JHN A;  3SHR A;  3WF4 A;  4OHV A;  3ZFF B;  4RR3 B;  1C57 A;  1K45 A;  1OOP A;  2ZOE B;  2NQY A;  1O59 A;  2NYY A;  3MF9 A;  5C9A C;  3E5X A;  4EN6 B;  1MZ5 A;  4Y3O A;  1RUC 1;  1VBD 2;  3WG4 A;  3H3L A;  1AUY A;  2UYB A;  4JZR A;  5EXO A;  1IS4 A;  2NP0 A;  2EIG A;  2QQJ A;  5GZD A;  4F3J A;  5FXZ A;  5L7O C;  3SIT A;  1B35 B;  1QDO A;  3OCP A;  1DQ1 A;  1A8D A;  1RVF 1;  2X09 A;  3SKJ E;  3ETQ A;  3T2Q A;  4K7J A;  3H8U A;  4GUL A;  5LY2 A;  4CE8 A;  3PIJ A;  5LB6 A;  4XOG A;  1NZC A;  4IGQ A;  2RE9 A;  2UWA A;  1H8T A;  1RUO A;  1R08 2;  3KB5 A;  3PU8 A;  3O1M A;  1BBT 1;  2R1D A;  1OD5 A;  3WNN A;  2ZGS A;  5FMO L;  4Z92 B;  4S2G A;  4JC1 A;  5FZF A;  4JHZ A;  1H8V A;  1AYN 2;  1DQ0 A;  1H4H A;  1YQ6 A;  2WRA A;  3NNG A;  3OBR A;  1U12 A;  3LSE A;  1GWM A;  1UY2 A;  3K46 A;  3OTF A;  3ZM8 A;  4CA9 A;  2A71 A;  4GMP 0;  4BQX A;  4G4F A;  1G8W A;  2DCZ A;  2EAK A;  2EXK A;  4RSU A;  5LA2 A;  3TRS B;  3AZX A;  5F37 A;  4V2W A;  2VUC A;  1HXS 1;  5D21 A;  2C9A A;  3J8F 1;  1XRU A;  4FSJ A;  4XHB A;  1FMD 1;  2CV6 A;  4Q4Y 1;  5HV4 A;  5HCB A;  3M8L A;  1YJL A;  4QPG B;  5T5L A;  2ADE A;  4WM7 A;  2HH9 A;  3AP6 A;  2HLE A;  3IWZ A;  4LK7 A;  4AOC A;  5A6X A;  2IXC A;  5FPU A;  4COU A;  4U2A A;  5KHH A;  3AYC A;  2D97 A;  2W08 A;  4PQ9 A;  5HI0 A;  1H1A A;  1JYC A;  4NRM A;  3UJO A;  1YNA A;  2EAL A;  5LK7 B;  4S2F A;  5CVR A;  4YFW A;  1ZRF A;  1AXZ A;  5JR7 B;  1WWY A;  4Q4V 1;  3FHQ A;  5CG9 A;  1RYY A;  2ZGQ A;  4FVV A;  2HWC 3;  2YBK A;  5F3G A;  4GD4 A;  3WDU A;  1CAU A;  4NR1 A;  3MZH A;  1EAH 1;  4QPW A;  2KD7 A;  3WXP A;  5JZG C;  3LCP A;  3EHK A;  3PME A;  2E26 A;  3PJQ A;  4NO4 A;  4TLG A;  2Q8D A;  5FO9 B;  1S0E A;  2E6V A;  3ZYP A;  1E5S A;  4AHX A;  5HCF A;  3AKQ A;  1C8N A;  4QPY A;  3BN6 A;  2D7F A;  3LD8 A;  4M3C B;  4M01 A;  2G4I A;  3TEZ A;  5GLZ A;  1FV3 A;  2A3W A;  2Z2S B;  1JZ6 A;  3MIB A;  3VHN A;  2VY0 A;  3AMH A;  3NAP A;  3MUZ 1;  3USU B;  3M7A A;  3FBY A;  3RYP A;  3POJ A;  1POV 3;  2A3Y A;  2E63 A;  4IE7 A;  5H9Q A;  1RB8 G;  5JCT A;  2P5B A;  4PDW C;  5D8A C;  1LTE A;  1RUC 3;  1ZZ8 A;  5FLI A;  5FZA A;  5IAV A;  4XCA A;  5FRA A;  4CDU C;  3D82 A;  3TOJ A;  5DAX A;  1QH6 A;  4NII A;  1RVF 3;  4C91 A;  5LEJ A;  2AC1 A;  2Q8C A;  1BXH A;  2DYC A;  4X8P A;  2VR4 A;  5FFO C;  5IVJ A;  3I2H A;  2I45 A;  4YVW A;  5APA A;  1HRI 2;  4Q27 A;  1WCK A;  4QKD A;  3RG0 A;  1BBT 3;  4AVV A;  4BB3 A;  4LHK A;  4U36 A;  2JG9 A;  5A33 B;  4JKM A;  1CIY A;  3DPR C;  1DQ4 A;  3HN1 A;  1PMJ X;  1E5H A;  1YI7 A;  3SH4 A;  3JD7 2;  5EJ1 B;  1HW5 A;  1Z78 A;  3LIG A;  1J1L A;  5C70 A;  1IS6 A;  3DEM A;  3PIG A;  2HWD 2;  5C3S A;  4YW6 A;  1KXG A;  3MLK A;  4LXL A;  1ODN A;  1UZ0 A;  3OY8 B;  4CDQ A;  5A80 A;  1HXS 3;  4R52 A;  1VBC 1;  1XNC A;  3V0B B;  3V0A A;  1FMD 3;  1JOP A;  1K5J A;  3EJK A;  4Q4Y 3;  4OQ9 A;  2BOJ A;  1BYH A;  1ZNP A;  4P5H A;  3WW3 A;  2X5I B;  2ATF A;  1CZT A;  3Q8C A;  4HXC A;  4JV4 A;  2GH2 A;  4B8E A;  5A6Y A;  3AFK A;  3SC7 X;  2WSV A;  2LRP A;  1LHU A;  1SBD A;  1ZBE 1;  3A4U A;  3GZA A;  5HXV A;  2ZX0 A;  4AFA A;  3S7E A;  3VKM A;  1GUI A;  1UYY A;  4QGM A;  1XE8 A;  1UQX A;  2FQP A;  4PDW B;  3MW2 A;  2Q1F A;  3KQR A;  5DUV A;  3KWV A;  3EYP A;  1VMF A;  1EAH 3;  4AQ2 A;  1UN1 A;  3WR0 A;  1EUT A;  1QHD A;  3HT1 A;  4CEW B;  3VBF A;  1VAK A;  4BIF A;  3RZM A;  2VZS A;  4IE5 A;  1PGW 2;  4DY5 A;  5C7G A;  2XBO 1;  4I0A A;  5JVV A;  5LBC A;  3RMY A;  1JXN A;  1L7R A;  3M1H A;  4M0N A;  3U11 A;  5FMD A;  3F2Z A;  4FPL A;  4RHV 1;  4XUT A;  5IVY A;  5FOJ B;  5I0U A;  3WF2 A;  2VTF A;  1DG6 A;  1PVC 3;  1L3J A;  3NWK A;  3VKF C;  4CCJ A;  2AAC A;  2PFW A;  3AK0 A;  4KNC A;  2BGO A;  2WAO A;  1LNS A;  3JZV A;  4GWI A;  2Y6H A;  1EV1 2;  2XUE A;  5FUP A;  5FYS A;  5DDJ 2;  5K8S A;  1P8J A;  1YQC A;  2HBT A;  2K46 A;  4EYU A;  3BGA A;  2KR2 A;  2KA3 A;  2VJX A;  1F8V A;  2P3I A;  5LY1 A;  1IPK A;  3U1X A;  4ERO A;  5J37 A;  4HSL A;  3IKW A;  3SH3 A;  4QQP A;  4Z2W A;  2FMY A;  4GA9 A;  4PHZ A;  4NOT A;  4XFH A;  2OUH A;  2HWE 2;  3ACI A;  3UKT A;  4ARX A;  4Y24 A;  5CFD A;  1GOF A;  5F2W A;  2UWB A;  1NLS A;  2TEP A;  3EQE A;  2MEV 1;  3FZ3 A;  5FCC A;  3DN7 A;  2OUJ A;  1ULC A;  2O1Q A;  4CYD A;  3MIG A;  4Q0U A;  1SPP B;  3ZFF A;  3I2O A;  5BNP B;  1Q3E A;  3S7I A;  3C8X A;  4HVO A;  2IVJ A;  5GLU A;  2ZGL A;  1FXZ A;  2O8Q A;  4DXS A;  1U5X A;  2I74 A;  4JAA A;  4OI1 A;  3ZR6 A;  2W1Q A;  5C3O A;  4LOT A;  1VRH 1;  4BIS A;  1ODM A;  1XJA A;  3TB0 A;  4QX7 A;  3LEG A;  1FPN 1;  4I2O A;  2C24 A;  1OF4 A;  2VZO A;  2BTV C;  4QT6 A;  1FOD 1;  1LOF A;  5IVE A;  1JYX A;  2ZGT A;  3POG A;  4DXZ A;  1VBC 3;  1RUG 3;  2ZGU A;  3ZSK A;  1XE0 A;  1OH3 A;  1VBB 1;  2OZJ A;  1XYO A;  1XYP A;  1AR9 1;  4OYU A;  4E9K A;  3ZFE B;  1MEC 3;  3H1W A;  3N7M A;  1AR8 2;  1PK6 C;  2Y60 A;  4NIH A;  4JDN A;  4NHX A;  2WT1 A;  4L2N A;  3ST7 A;  4E2G A;  1V6J A;  3KV4 A;  2NN8 A;  5FKB A;  4L99 A;  3T4V A;  2YFU A;  1UX7 A;  5LBB A;  5A3P A;  1EP0 A;  3Q8F A;  1OC1 A;  5E6H A;  1MS5 A;  1H9W A;  1CX4 A;  4ASK A;  5KC6 A;  4N9H A;  2A6Y A;  2QQP A;  1JU4 A;  1FT9 A;  1NCR A;  2GP3 A;  4KGQ A;  3D3A A;  4QB6 A;  3KHC A;  4FOY A;  3ZXF A;  2F4L A;  3GGL A;  1Y43 B;  4K40 A;  4O9G A;  3AFG A;  2VTX J;  1JUH A;  1QNW A;  3WUD A;  4D6S A;  5CAD A;  4IEQ A;  4COV A;  1N3O A;  3RQ0 A;  3VBR C;  3JQX A;  4JDM A;  2XBO 3;  2LUW A;  5JPM B;  2OW4 A;  3ASI A;  4BCU A;  1V6I A;  1JYV A;  4XF0 A;  2LTN A;  4LBN A;  1QF3 A;  1SQ4 A;  4PF5 A;  4RHV 3;  5C9A A;  5DAQ A;  3B3Q E;  5A6Q A;  3KT7 A;  2RS3 1;  4CUG A;  3VHR A;  1QXP A;  3P3N A;  2JE9 A;  5G04 L;  5L7O A;  4BLJ A;  1JZ7 A;  1YIF A;  1T6G C;  2GC1 A;  4I0B A;  5KHK A;  4KI5 M;  1F15 A;  1O4Z A;  3AXE A;  1RMU 1;  3RYR A;  2PAK A;  3TNP B;  2GU9 A;  3TBD A;  2WQ8 A;  3SH5 A;  3WNL A;  2R1B A;  1W8Z A;  1NXM A;  3III A;  3PVB B;  1UYX A;  1WGP A;  4WZC A;  3AYE A;  1QKQ A;  4MSV A;  3DKQ A;  3ATG A;  2IXH A;  2VE1 A;  1WLT A;  4CUB A;  2WA4 A;  2WBK A;  1ZRD A;  4UFK A;  5FMO S;  4UW4 A;  4YGB A;  5KXE A;  3AVS A;  2MEV 3;  3VBO B;  4NN0 A;  1RUF 1;  3W20 A;  4AED C;  4DMI A;  3RWN A;  1NUK A;  3HN3 A;  2PA7 A;  3MPP G;  3TYJ A;  3M70 A;  4IEP A;  1H4G A;  3PUI A;  3U78 A;  4XJ8 A;  4BLI A;  4XDO A;  3N9Q A;  3PDQ A;  5C3P A;  5GKA C;  4E27 A;  3WCS A;  3OOX A;  4EWA A;  1ND3 B;  4NPL A;  5CYY A;  3P1I A;  3ABZ A;  5FY0 A;  1QJX 3;  2WT0 A;  4AFM A;  3MW4 A;  3J7N A;  4UFH A;  5A32 B;  4LHL A;  1ZRE A;  2QQO A;  5D1I A;  1Q43 A;  4CEY B;  5ACA 2;  3LA7 A;  2OT7 A;  1OQ1 A;  1FOD 3;  5JMO A;  3PMS A;  4BA6 A;  2RMU 2;  4QKB A;  1MQT C;  2WO3 A;  1F5F A;  2BNN A;  2YYO A;  3IBM A;  1VBB 3;  1DGL A;  4FQZ A;  4MGQ A;  2DVA A;  2OS2 A;  2QJV A;  1VMH A;  1WMD A;  2P37 A;  4QX0 A;  5DAV A;  3ZN6 B;  5IYY A;  5FY5 A;  2FZ2 A;  3USS A;  5A3U A;  2Z5W A;  2X10 A;  2Z42 A;  4GMP 1;  1KS4 A;  4QPI C;  2BVB A;  3B9I A;  5LK5 A;  2DBI A;  3RMX A;  5JZG A;  3GZU C;  3PTR B;  2F17 A;  4J6G A;  3VBS B;  4HG6 B;  1KS5 A;  3APB A;  4P08 A;  3T3Y A;  3MIF A;  5B4N A;  5FWJ A;  4Z82 A;  1GV9 A;  1BCX A;  3DL3 A;  5K4L A;  4HK9 A;  4FTB A;  3VD3 A;  3QH7 A;  2W46 A;  4B4R A;  4NHK A;  1FNY A;  4EN0 A;  3T1L A;  3V0B A;  2R49 A;  5F6K A;  1DQ6 A;  2D6O X;  4ZON A;  1QJE A;  2B9U A;  3RJR A;  5IK7 A;  3B69 A;  3H8R A;  3PUR A;  1V6K A;  3W59 A;  3CEW A;  2GN3 A;  1AL2 1;  3DV8 A;  3M3I A;  3GCW A;  4WVV A;  5LZ6 A;  1W2U A;  1SLL A;  4UOJ A;  2WAA A;  1JZ8 A;  1YO8 A;  4AED B;  1AYM 3;  1O6U A;  1W6O B;  3FLT A;  1KIT A;  1N1Y A;  1YCI A;  1VPH A;  2ARC A;  1UD1 A;  2DVB A;  4FOQ A;  1D4M 3;  4QU1 A;  1VBD 1;  5IWF A;  1DZQ A;  2R0F A;  1CZS A;  3HBK A;  1I6X A;  3DYM A;  4PDW A;  5D8A A;  2VOX A;  2BBA A;  1IPJ A;  2BP6 A;  1Z7S 2;  2WN3 A;  4N53 C;  3WQ7 A;  2RS3 3;  4AHZ A;  2VMH A;  2BDR A;  3H3Z A;  4XUO A;  3ZR5 A;  4FBF A;  3W5M A;  4OHY A;  2DCK A;  3BCW A;  1VBE 2;  4Q4X 2;  4CDU A;  3OJB A;  4AQT A;  2WWU A;  1ULG A;  1UY4 A;  1RMU 3;  3HQR A;  3T30 A;  1O3T A;  2LAL A;  1R08 1;  3ZYJ B;  4C0B A;  4RQP B;  2JIC A;  5F5C A;  5EYY A;  3MIH A;  3CL1 A;  3W21 A;  4BHP A;  4MG2 A;  4GJY A;  3CF6 E;  5FXV A;  4XPV A;  3UK9 A;  2UUR A;  1RUI 2;  4OLL A;  1VLN A;  3FL7 A;  1JZ5 A;  1V0A A;  1AYN 1;  4YWA A;  1NLR A;  3DPR A;  3WG3 A;  2W95 A;  5FQ0 A;  1UPI A;  5FOB B;  1ZVF A;  3KQ4 B;  4JRL A;  1LGC A;  4AFB A;  1AR7 3;  1ZBA 2;  4XQD A;  5C5U A;  2CWS A;  4XFA A;  2H6B A;  1LCL A;  1ND2 C;  1WUV A;  4BOW A;  1X7N A;  1S2E A;  4A6S A;  4BWO A;  2CDO A;  2Q0A A;  3AZW A;  2ZHM A;  4DIN B;  2X53 S;  2GAL A;  2PN5 A;  4FTS A;  2GMM A;  1J84 A;  2XG3 A;  2VMF A;  3EXU A;  4CPB A;  1YFW A;  3I3D A;  3LA3 A;  3O0V A;  5BYN A;  4YW1 A;  2VZR A;  1YYN A;  1DIW A;  1SPP A;  1W3X A;  1G9A A;  2D3R A;  1QH7 A;  4W8J A;  1XPW A;  3HPN A;  4UWD A;  1NYW A;  3RI8 A;  2B8M A;  2E51 A;  2BW8 A;  4CDW C;  1FX5 A;  4N53 B;  1ZRC A;  1GYK A;  1F31 A;  2W94 A;  4PIZ A;  5FYI A;  2VUD A;  3WDW A;  1H8T B;  4HSJ A;  5CKN A;  1X9T A;  1RTV A;  2JX9 A;  2VME A;  4QB1 A;  5JXH A;  4PIY A;  1OFS A;  2D93 A;  1RUH 2;  3ZPY A;  1ASJ 3;  5JDB A;  5I8T A;  2DVD A;  4PT6 A;  2WLQ A;  4IND A;  4CZS A;  5IAX A;  3LZZ A;  1AL0 G;  2VZU A;  4IE6 A;  1W6Q B;  3CU7 A;  2YFZ A;  4A4A A;  5A3T A;  1O3Q A;  1W9W A;  3POW A;  3POY A;  2D44 A;  5HBA A;  1AL2 3;  3VBU C;  3K4D A;  2E53 A;  3BOD A;  3KD4 A;  1ACC A;  2J7M A;  4LO8 A;  1WBL A;  3UGG A;  2VGD A;  2Q1M A;  2OQ7 A;  1H0B A;  1J1T A;  1VBD 3;  4K3U A;  4LT5 A;  2B39 A;  2XHK A;  1J83 A;  1CAW A;  2CYF A;  4AGG A;  4CU8 A;  1X8M A;  4HN1 A;  3OEB A;  1NKG A;  1JHJ A;  5DN2 A;  4IES A;  1VIW B;  1MVQ A;  5KWR A;  4Q4W 2;  1HRI 1;  1R08 3;  4ORF A;  2JDZ A;  3ZYH A;  2EA7 A;  1CAU B;  4DEQ A;  4RD7 A;  4ONU A;  3JU9 A;  1HQW A;  4XFC A;  1H6Y A;  1LUL A;  1I3H A;  3JD7 1;  2BER A;  2VQ0 A;  4B4Q A;  3FJS A;  4CDW B;  3Q8E A;  1O5U A;  2WZP P;  1QMJ A;  1DGR A;  1JBC A;  1S4C A;  2HWD 1;  2J1V A;  3VBH C;  3PL0 A;  3O0X A;  1QY4 A;  2PLV 2;  3BTA A;  3R4D B;  4TN7 A;  5FUN A;  5HCH A;  5JSP A;  3HQU A;  3JBG 2;  5LRR A;  1XNT A;  4HPK B;  3HEI A;  4JKK A;  2EID A;  4A44 A;  3VZN A;  3DCQ A;  3ZO0 B;  3TEW A;  2WS9 3;  3WF3 A;  3CMG A;  3T0B A;  3NAP B;  1H2N A;  4XFB A;  3BB6 A;  5ISL A;  1JN2 P;  5DAP A;  3S5A A;  1PK6 A;  2BWA A;  4IEZ A;  3ZSL A;  3OGV A;  1LOD A;  5JWP A;  4BE3 A;  1HRV 2;  3HJR A;  5M0T A;  4CP1 A;  4XFI A;  5LBF A;  1OPO A;  2ETE A;  2JDH A;  2XHN A;  2DFB A;  3N36 A;  4MGZ E;  4OUS A;  2K9Z A;  1NX9 A;  2OXB A;  3QAC A;  4PBO A;  5CG8 A;  1O4Y A;  3I2F A;  5CIS A;  5JXG A;  2YC4 A;  5GM0 A;  1QJY 2;  5FPL A;  2CGP A;  1GLH A;  4MUV A;  2ERF A;  3NNM A;  1WZX A;  3WNP A;  4ISR A;  4YVW B;  3ZN4 A;  3WQ0 A;  1PGW 1;  1BEV 3;  4N7I A;  1QDC A;  3VDB A;  3VLB B;  5DXD A;  1G9C A;  1QXJ A;  2IFR A;  3VBR A;  5DZE A;  2D6M A;  1RXF A;  3FHI B;  3V56 A;  3I3Q A;  2YU2 A;  2VNV A;  2AH2 A;  3I4I A;  5J98 B;  2PMW B;  4QXB A;  2J1A A;  5K0U C;  2YBP A;  3O1T A;  5FXX A;  2LS6 A;  1JYW A;  4AL9 A;  5BNN C;  4EZH A;  1EV1 1;  2ZHL A;  3I2J A;  5DDJ 1;  1PHM A;  2H0V A;  4P00 B;  2R06 2;  4UI9 L;  5E16 A;  4AF9 A;  3V0A B;  3PUQ A;  2EXJ A;  3AMM A;  1LHO A;  4XYX A;  5LAT A;  4YM3 A;  5A1F A;  2IXI A;  4XXP A;  3C2U A;  2AUY A;  2I2S A;  3MUY 1;  2HWE 1;  3NV3 A;  4S2H A;  3C7F A;  1DF0 A;  4Y4Y A;  4IE4 A;  4QM9 A;  4UXA A;  3N4M A;  1O91 A;  3LGR A;  2JXA A;  4HET A;  2XL7 A;  2DVF A;  1Y9M A;  1GZT A;  1Z0H A;  1HRI 3;  2JG8 C;  1F4H A;  1W8H A;  3I2K A;  3T2O A;  4AED A;  5L36 A;  1RUD 2;  5CFC C;  1H2K A;  3ZSE A;  1XND A;  1W39 A;  2ZGP A;  5A1A A;  1WMX A;  3JD7 3;  4CCE A;  4XTM A;  2FDJ A;  3KMH A;  5BV6 A;  3BTZ A;  2WNO A;  2YXS A;  4QU2 A;  2OX0 A;  1EY2 A;  3DGT A;  2HWD 3;  5FRE A;  4B7K A;  2XR4 A;  1F2N A;  1I1E A;  2G19 A;  4FAH A;  4ASL A;  4MGK E;  1YWK A;  2R7E B;  3VKN A;  2VG9 A;  1STM A;  5BPX A;  1WW5 A;  3PJY A;  2RDS A;  4FP3 A;  1MQT A;  2B9V A;  3WDY A;  1AR8 1;  4RGA A;  4AAP A;  3ILF A;  4F83 A;  3QOP A;  3W9A A;  5GZE A;  3B93 A;  3LF7 A;  4IUG A;  4FI9 A;  3N9L A;  4GAL A;  4GIQ A;  5FPZ A;  3ZIX A;  4BH9 A;  4MHR A;  2WQ4 A;  4LEJ A;  2JDK A;  3IT8 A;  3S5Q A;  4QPI A;  5LWB A;  1W8U A;  5FYB A;  1O8S A;  3ITQ A;  4KH9 A;  4DUX A;  2BPA 2;  5A3L A;  1N1S A;  3WW4 A;  2DTY A;  4AI0 A;  5FY4 A;  4XZP A;  4YGC A;  5CFD B;  2CNA A;  1N1T A; 
#chains in the Genus database with same CATH homology
 4LKD A;  2VXJ A;  1OH3 A;  1W8W A;  2JWP A;  4BQ4 A;  4CPB A;  2LRP A;  4LKE A;  3ZYH A;  1W9F A;  4YW7 A;  1HN0 A;  2O14 A;  3F95 A;  1GWM A;  1V0A A;  1OKO A;  4YWA A;  3ZYF A;  4CPB D;  4BQ2 A;  4LK6 A;  4AL9 A;  2K46 A;  2Q1F A;  4CP9 B;  2KR2 A;  5D21 A;  4CP9 A;  1UOJ A;  4YW6 A;  1W8U A;  2WYF A;  1W8T A;  1W90 A;  3ZYB A;  4BQ5 A;  1L7L A;  1GWL A;  1WMX A;  3ORJ A;  4LJH A;  2LRO A;  3UT0 A;  2C24 A;  4BQ3 A;  4A6S A;  1GWK A;  1WCU A;  1WZX A;  4LKF A;  1W8Z A;  4LK7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...