1WN0A

Crystal structure of histidine-containing phosphotransfer protein, zmhp2, from maize
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
131
structure length
131
Chain Sequence
QLNALLSSMFASGLVDEQFQQLQMLQEDGGTPGFVAEVVTLFCDDADRIISELAALLDQPIVDFDKVDAYVHQLKGSSASVGAQKVKFTCMQFRQLCQDKNRDGCIMALAVVRNEFYDLRNKFQTMLQLEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the histidine-containing phosphotransfer protein ZmHP2 from maize
pubmed doi rcsb
molecule keywords histidine-containing phosphotransfer protein
molecule tags Signaling protein
source organism Zea mays
total genus 53
structure length 131
sequence length 131
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2004-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01627 Hpt Hpt domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.160 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) HPT domain 1wn0A00
1I5NA 1TQGA 4G78A 1C03A 1A0BA 3U3BA 4EUKB 3IQTA 2LP4A 3US6A 3KYJA 1SR2A 3MYFA 1Y6DA 2Q4FA 1WN0A 2LD6A 1C02A 2LCHA 1QSPA 1YVIA 4PACA 2A0BA 1FR0A 1BDJB 2OOCA 2R25A 3KYIA 1OXBA 1OXKA
chains in the Genus database with same CATH superfamily
2LK4A 4O79A 1R4TA 4MW8A 2W9YA 1QQ3A 2WZGA 2XLVA 4I3MA 3L0IA 3ZWIA 2YL7A 1RCPA 3EGDB 2W4MA 2Y3BA 4J32B 3LLKA 5KYUB 3W8IA 4Q4ZF 1BR2A 1YA7O 3C8GB 3NMJA 4IRUA 2OCCC 3N24A 4GEHA 3GORA 4N06A 3FAPB 5AGFA 4C3EA 4E0HA 4YT8A 1NG1A 2FGYA 5T1DB 3V7OA 3MLGA 1D1AA 1ST6A 3K1HA 1I4YA 2A6HF 4U9EA 2CW0F 2A0BA 4XPXA 4WGYA 4E7ZA 1T6QA 1OXBA 1V74B 2KYHA 3DAFA 4C3DA 3U0CA 3ZTMA 4E18A 3TK0A 3GEEA 1SZIA 2OU6A 2H7BA 2NUTB 3LUTB 3NYJA 3QMKA 4EWCA 4KNVA 5L0GA 2ASRA 3K1IC 3KPHA 1EQ1A 3IEEA 1Y6DA 2XL6A 4MQ9F 4ULWA 4D4XA 3IQCA 4U5CE 3UGOA 2Y3GA 1U0BB 2J9VA 3SXMA 4W8KA 4DBRA 4CX9A 3QVYA 5FCLA 1MNDA 4JURI 4NTBA 5D92A 4JCZA 4E7SA 1A7DA 4YWQA 1K40A 2V26A 2XLDA 3GM1A 2QUPA 1KU2A 2P6VA 3ZSUA 2PX0A 1HW1A 4PK4A 5CIVA 4CS9C 1OCOC 1JPNA 2YLGA 3C62A 3B0UX 2WVNA 3ZDLA 3UMHA 3TJ5A 3ZC4A 1D0XA 1QPUA 2J9WA 1MMNA 3AQBA 2X0CA 4Q5SF 2E87A 4QI2A 5KYWB 2VH3A 1ZHWA 4LLEA 3S84A 1K04A 1RKCA 3Q6MA 3RFYA 4ZLCA 4YT5A 3S28A 4RD9A 1CGOA 3AGTA 4JKVA 2Q9AA 3DE8A 4JW1A 4MW3A 2W4BA 2XXAB 1NBBA 2NUPA 2DYRC 3KMIA 1ORYA 1NFNA 3BEHA 1S05A 4G7ZF 3V5YA 5L0DA 1M6TA 2IOQA 2M4EA 3EJNA 3WAQA 4PJNA 4IJJA 1JR8A 4JTAB 2B0JA 4XPYA 3S0XA 1FAPB 2KQ9A 2J9UA 1M2VA 3FOOA 3U2LA 2R7TA 4W8PA 2R25A 1NU9C 2M64A 2OEXA 2GAQA 1G4WR 3F46A 1M56C 1Z6AA 4FESA 3AJMA 2XLEA 2CYDA 1RKEB 5F28E 3RVZA 2XM4A 3WODF 3NKDA 5CI8A 4ER9A 3K6BA 4IWBA 2B0HA 2CDQA 4NCQA 2QTVA 4EHPA 4D4NA 3DI5A 1D0YA 3JT1A 2R7OA 4XLPF 4KNWA 4LERA 4PFPA 3T4RA 2Z15A 2YWAA 3AQCA 3C18A 4CBEA 2HZ8A 2ICWG 2J46A 3DZAA 5L3VA 3UGPA 4C3BA 1PCXA 2D5RB 5L0JA 1VTMP 3KKBA 3GEHA 3U9JA 1BR1A 5L0FA 1LI5A 1Q0MA 1QKRA 3ATPA 4MVUA 2I15A 3EG9B 4XPWA 5F5FA 1L3PA 1Z23A 2LSEA 1M57C 2DYSC 2AP3A 3DXJF 3NRHA 2IXPA 3TOMA 1FR0A 1QLEC 1ZYRF 1Z63A 3EH2A 2LQGA 4H54A 2BE5F 2O9XA 5E33A 2PP4A 4ONSA 4GQHA 5COMA 3RQEA 3ASOC 4P6IC 4Z9JA 2LP4A 3T6BA 3ASNC 3US6A 2DGJA 2KC3A 1RJ9A 2EPMX 3C8GD 4XQ1A 2PNOA 2HS5A 1YYXA 4DVYP 2ZPAA 1OKKD 1SR2A 4O6NA 4Z9HA 3MYFA 3S29A 3SEOA 1CGME 4ZLDA 2DI3A 3B71A 3T6GB 3E70C 2L9JA 4P9TA 1H9GA 4EBKA 3V5ZA 1APCA 3RQFA 3SXYA 2KK1A 3FXHA 3HTKC 3TJ6A 3VF0A 3W4YA 4O6YA 1G8XA 4OD5A 2EPNA 2VCCA 1LKXA 4NTAA 1PV3A 3M4BA 5GPGB 3NYMA 1MQVA 2RSEB 2YHSA 4U5HA 2J7PD 2OJQA 3BRJA 2GWWA 2PF4E 1MMDA 2QE9A 2IXOA 2J0XA 2ZXOA 3E9VA 4HFFB 1LE2A 4JEBA 2NG1A 4G78A 4WGZA 5EK0A 4DRJB 5JRAA 1VYKA 3U3BA 2OQMA 5BQIA 3IQTA 3J06A 1YJGA 1NZEA 1SMYF 2G3VA 2RD9A 3B0PA 1L7CA 3DJNB 1VLSA 3M15A 3NG1A 3G50A 4GYTA 5E3AA 3S9OA 3VRCA 1OQCA 3H65A 3HJCA 5COGA 3RVYA 4A2NB 5DVWA 4PJLA 2Y39A 2EIMC 1H6GA 4JCHA 2XL8A 2ZXPA 3QTHA 1YYJA 3TD7A 1TKNA 3JZ0A 1PD1A 3SXKA 3MFNA 1C02A 1DOWA 2F22A 4JC7A 3EFOA 4O6MA 4CIPA 4C7OA 2YLIA 2YLDA 4K1OA 1C17M 1OW7A 2D4UA 3C7JA 3C8ZA 3IQ6A 3TQOA 1ZVZA 1OCRC 1Y4CA 3O39A 4ANJA 4BJTA 3SZRA 3F47A 4AK9A 3RKOF 3H2VA 2IM8A 2W45A 5A6JA 1TWHA 1JRAA 1K05A 1JAFA 4WABA 5B3SC 2XL4A 4LLCA 5KYNA 4K0DA 4CJGA 2XLMA 1Z5ZA 4PR9A 2XLHA 2EIJC 3VM6A 4X0RA 1JPJA 4BEMJ 2J45A 4YN0B 4BG0A 1VK5A 2CCYA 3Q7GA 4EKWA 5A6KA 2HSQA 1ZU4A 3NYLA 4FX5A 2KW3C 3IHUA 1UG7A 3L34A 3MYIA 4MVQA 1O3UA 3CAXA 3EHMA 4AE4A 3EGXA 3JCUQ 3K66A 1H7IA 4MVRA 2YZSA 2HV7A 2VCAA 3ZG1A 5DQTA 2EPKX 5DS4A 2GFHA 1G5ZA 4MVZA 5DQZA 3UNGC 3LS0A 1FFTC 5E3CA 5KYYB 2IXNA 3LNRA 3NMIA 4Q7CA 3CSKA 3KYIA 4B6IA 2GA0A 3EGDA 1Z3IX 4ULVA 4BEJA 1T6UA 1WOLA 5KYXB 5KYWA 3K1IA 3QW1A 5EGYA 5A69A 3GWNA 2IYLD 5KYUA 1YZAA 4OIPF 2H7OA 2C03A 3C8GA 1W2WA 1KTMA 2HSBA 2C04A 3EPVA 4JEAA 2L6GA 1B68A 2UUIA 4CDAA 4OIQF 4MVSA 3ZQYA 1JMWA 1CPQA 4MTGA 4PJMA 1ORSC 4IARA 4LDQA 2IBFA 3O6XA 1HMDA 2EINC 3L1MA 4J30B 4XEVA 4YL0A 4U9DA 4DVZA 4HFKB 5B1AC 3M4CA 3KL4A 4PACA 4CS9A 4DOZA 5L3QA 4KI2A 3S27A 3T6JA 4O7GA 2HV6A 2VCBA 1HMOA 1LI7A 3JRMO 1V4AA 2J7PA 3GM2A 1LIHA 2YQYA 4JVSA 1VYIA 5JLIA 1QVXA 4YK5A 2NUTA 3LNMB 1J8YF 1NFOA 3FHDA 1U89A 4H4KC 4U5FE 5HSWA 1IW7F 1OR3A 2P7VA 2ZXWC 3HNJA 4LDRA 2AWCA 2CNWD 1M2OA 5JP7A 3RH3A 2PFDA 1GM5A 4OINF 5IY5C 3U3FA 1EKYA 2Q4FA 3OWTA 2A68F 1ZHTA 2Y3HA 4XWJA 1NSGB 3TOLA 4CS8C 2KGOA 2WZFA 4KC9A 5COFA 4N6HA 2YL3A 1A7EA 3SXZA 5L0IA 2HMZA 1A41A 5AC5A 2JPUA 2R7SA 1LVKA 1AEPA 1YA9A 1MNEA 1NLXA 2BC5A 3FVYA 4AL1A 3DJUB 1T9KA 2OOCA 3CQZA 1I5NA 3O10A 3LEOA 2BL2A 1OXKA 2EPOA 2P1AA 3H2UA 2FAPB 4CJOA 4U5BE 4QI0A 1A0BA 4DXWA 4KBLA 3NMKA 2FFHA 3SNHA 4AX2A 4G7OF 2R7XA 1ORJA 4MTFA 4YT4A 4LDKA 3WHNA 4BJ6C 4CS8A 2XXAA 1MMAA 1ZZPA 4YT2A 3A9CA 3V5XA 4I1OB 4UDVA 3PDMP 1WN0A 1FTSA 4NC3A 3W2WA 2LD6A 3SYNA 1LPEA 4RDAA 1RXQA 2OKUA 4OIOF 3N0TA 2LCHA 3DM5A 2VB6A 1QSPA 3OEOA 1T01A 1YVIA 1WTYA 2R03A 2NSGA 1DOVA 2QY9A 1ZHZA 1OW8A 2JD3A 3ZVRA 3VYWA 1TFKB 4N6CA 3PCVA 4MTOA 4G7HF 1VB5A 1RKEA 3LLIA 2VASA 3GANA 1WGWA 3DD7A 3HKKA 3HNKA 1A7VA 1XZQA 4HEAJ 4JTDB 1D1BA 4AL0A 4PFOA 4CDYA 4CS7A 4BJ6A 1YLMA 1TQGA 1JOGA 3U9MA 4EUKB 5JT4A 2XS8A 2MWQA 2EILC 3JYHA 4YL1A 1ZW2A 3X1OA 1Q0KA 1S7ZA 3MBGA 3FAJA 1V54C 2A69F 2EIKC 2QLAA 4I1MA 4RBNA 3U5SA 1OR2A 4Z9IA 2TMVP 1Q0GA 4HE8D 4NTFA 4JRZA 3FDQA 1UFBA 4XTKA 4EBJA 4N4WA 3ZQVA 2Q9CA 3I4UA 3EG9A 2LFFA 2L6HA 5TJ5E 4AE4B 5JSLA 2AVKA 2MYSA 2ZD9A 2HJ3A 4YL3A 2YRFA 3ABKC 2WL8A 1AVOB 1SYQA 3I5QA 4MVMA 4F4BA 1NU7D 3FOPA 3G4XA 3AG3C 1LS1A 1Q0FA 4XEFA 4FAPB 4A4AA 2DB4A 3AOUA 1CGNA 2L7AA 1E83A 1IZMA 3NDBB 2EPLX 2R7RA 1E85A 1TR2A 1I4ZA 3DE9A 3L8JA 3NKEA 2V3CC 5AC4A 3R7CA 5HV9A 1GGQA 1SF8A 1ZHYA 4JTCB 5A6BD 1RMVA 3WG7C 3DAGA 1O87A 2AWYA 3EQLF 3LESA 3W8HA 2CNWA 2L81A 2P61A 1G4US 3CEXA 4MVOA 4YJWA 4EBBA 3GWLA 3K33A 4K7BA 1OCZC 2XLOA 3GODA 3IPMO 4WJ0A 2R9RB 3CZ6A 4NQFA 5K0IA 3EZHA 5DS5A 4CIHA 3ZTZA 2NUPB 2P0NA 5L0CA 1VMAA 1VOMA 1YAUO 4U5DE 3POVA 2WB7A 2YL0A 5FZTA 1H9TA 3RF3A 1R5ID 3LEVA 4XEKA 2NSFA 2ZXRA 1MMGA 3ITFA 1BBHA 1M2VB 2JX0A 2QNLA 2XRHA 3ZIBA 2KJGA 4CDVA 2J8WA 1LM3B 4JE9A 3SP1A 3QW0A 3T9OA 3EZIA 2Y3DA 2HUJA 2R7UA 2I8BA 3TULA 3DWWA 4CSAC 3U2MA 1GQAA 3AG2C 3UMIA 1OKKA 3W2VA 2IXMA 5F5HA 3B9QA 4XLNF 3AG1C 3GM3A 4L6RA 1GS9A 2YVKA 1U6HA 4FWVA 5B1BC 2H7VC 1AUEA 1TWCA 256BA 2Q9BA 3ABMC 4OIRF 4BJ5C 1FFHA 5EHHA 1QZXA 3M79A 4DRIB 4R32A 3QZCA 5T3TA 2NPUA 2OJED 4DRHB 3DKAA 3ECSA 1N1CA 3FMSA 2L6FA 3I5PA 3JSEO 4CSAA 2R02A 1TWAA 3UR3C 5JUAA 1C03A 1PD0A 1T5OA 1WWPA 2G62A 2UUHA 2Q3TA 1OW6A 3Q6NA 2WZLA 4I44A 4OD4A 3VAYA 5A6AA 4J7YA 3HLZA 3U8PA 2R7QA 4M63A 2LIGA 3B29A 3DM9B 4BJ5A 3LS1A 2YL1A 3JSZA 1OCCC 1RJ9B 4IAQA 2R7VA 4EIYA 2KSFA 2R7WA 1ZHXA 2VC9A 3JYYA 1XWJA 2A0UA 3OA1A 1EI7A 1LE4A 5KYYA 3PMRA 3IQ5A 3QVZA 4BPMA 2A1DD 2HFIA 5DLJA 5BUOA 3PHF2 2G3KA 2Q00A 4NY3A 5JS5A 2HKVA 1CPRA 1BDJB 2J0WA 2WVOA 3RQGA 5KYXA 1TFOB 2PX3A 1BZ4A 3DMDA 2GDCA 3HNIA 3M1CB 3RYLA 3G4ZA 3RIPA 3O55A 2A6EF 5JVEA 5A6BA 1D1CA 2H8AA 5DS6A 1WATA 2KNHA 2XSEA 1E86A 3S90A 5BQHA 4U5EE 3LAYA 1KNYA 4IAOA 2CGEA 1T6IA 2OG2A 4G0HA 4JJGA 4DBQA 2J9BA 4P9FA 1Z7Qc 3K7DA 2LFDA 2XM0A 1ZW3A 3JTLO 1D0ZA 4PJJA 3B0VC 2R05A 1XZPA 2YKZA 3RW0A 3ABLC 1HY5A 3MX3A 4E0IA 2HJMA 3N2ZB 2HMQA 2ETSA 2X51A 1YZCA 1BR4A 3A11A 2XLWA 3AGUA 3R2PA 1FMWA 1E84A 3L8IA 3EFOB 1V55C 1FMVA 2Y69C 4C7OB 1LS4A 3LJBA 4DJ9A 4IGGA 4MNDA 5D91A 4IB4A 3EHNA 1WASA 4JIOA 4U5GA 1HE1A 1TWGA 4MS2A 5CI9A 5L0HA 3KYJA 5T3WA 1J8MF 1HE9A 2PBEA 1YARO 3U8VA 3GEIA 1HW2A 1E2XA 1FNTc 4BJ1A 1YDIA 3AG4C 3C63A 4QDLA 1F1MA 2OEVA 4J7TA 4JZAA 3EH1A 5E2QA 1O5HA 4E17A 4JJFA 3UMKA 3EGXB 3JRTA 3KH2A 2WVQA 3Q7LA 1ZU5A 4LACB 1VLTA 2XS1A 2AU5A 2Q7RA 5BQGA 1EA8A 2MHRA 3X2QC 2YEVA 1Q0DA 3HNLA 5B3IA
chains in the Genus database with same CATH topology
1I5NA 1TQGA 4G78A 1C03A 1A0BA 3U3BA 4EUKB 3IQTA 2LP4A 3US6A 3KYJA 1SR2A 3MYFA 1Y6DA 2Q4FA 1WN0A 2LD6A 1C02A 2LCHA 1QSPA 1YVIA 4PACA 2A0BA 1FR0A 1BDJB 2OOCA 2R25A 3KYIA 1OXBA 1OXKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I5N A;  1TQG A;  4G78 A;  1C03 A;  1A0B A;  3U3B A;  4EUK B;  3IQT A;  2LP4 A;  3US6 A;  3KYJ A;  1SR2 A;  3MYF A;  1Y6D A;  2Q4F A;  1WN0 A;  2LD6 A;  1C02 A;  2LCH A;  1QSP A;  1YVI A;  4PAC A;  2A0B A;  1FR0 A;  1BDJ B;  2OOC A;  2R25 A;  3KYI A;  1OXB A;  1OXK A; 
#chains in the Genus database with same CATH topology
 2LK4 A;  4O79 A;  1R4T A;  4MW8 A;  2W9Y A;  1QQ3 A;  2WZG A;  2XLV A;  4I3M A;  3L0I A;  3ZWI A;  2YL7 A;  1RCP A;  3EGD B;  2W4M A;  2Y3B A;  4J32 B;  3LLK A;  5KYU B;  3W8I A;  4Q4Z F;  1BR2 A;  1YA7 O;  3C8G B;  3NMJ A;  4IRU A;  2OCC C;  3N24 A;  4GEH A;  3GOR A;  4N06 A;  3FAP B;  5AGF A;  4C3E A;  4E0H A;  4YT8 A;  1NG1 A;  2FGY A;  5T1D B;  3V7O A;  3MLG A;  1D1A A;  1ST6 A;  3K1H A;  1I4Y A;  2A6H F;  4U9E A;  2CW0 F;  2A0B A;  4XPX A;  4WGY A;  4E7Z A;  1T6Q A;  1OXB A;  1V74 B;  2KYH A;  3DAF A;  4C3D A;  3U0C A;  3ZTM A;  4E18 A;  3TK0 A;  3GEE A;  1SZI A;  2OU6 A;  2H7B A;  2NUT B;  3LUT B;  3NYJ A;  3QMK A;  4EWC A;  4KNV A;  5L0G A;  2ASR A;  3K1I C;  3KPH A;  1EQ1 A;  3IEE A;  1Y6D A;  2XL6 A;  4MQ9 F;  4ULW A;  4D4X A;  3IQC A;  4U5C E;  3UGO A;  2Y3G A;  1U0B B;  2J9V A;  3SXM A;  4W8K A;  4DBR A;  4CX9 A;  3QVY A;  5FCL A;  1MND A;  4JUR I;  4NTB A;  5D92 A;  4JCZ A;  4E7S A;  1A7D A;  4YWQ A;  1K40 A;  2V26 A;  2XLD A;  3GM1 A;  2QUP A;  1KU2 A;  2P6V A;  3ZSU A;  2PX0 A;  1HW1 A;  4PK4 A;  5CIV A;  4CS9 C;  1OCO C;  1JPN A;  2YLG A;  3C62 A;  3B0U X;  2WVN A;  3ZDL A;  3UMH A;  3TJ5 A;  3ZC4 A;  1D0X A;  1QPU A;  2J9W A;  1MMN A;  3AQB A;  2X0C A;  4Q5S F;  2E87 A;  4QI2 A;  5KYW B;  2VH3 A;  1ZHW A;  4LLE A;  3S84 A;  1K04 A;  1RKC A;  3Q6M A;  3RFY A;  4ZLC A;  4YT5 A;  3S28 A;  4RD9 A;  1CGO A;  3AGT A;  4JKV A;  2Q9A A;  3DE8 A;  4JW1 A;  4MW3 A;  2W4B A;  2XXA B;  1NBB A;  2NUP A;  2DYR C;  3KMI A;  1ORY A;  1NFN A;  3BEH A;  1S05 A;  4G7Z F;  3V5Y A;  5L0D A;  1M6T A;  2IOQ A;  2M4E A;  3EJN A;  3WAQ A;  4PJN A;  4IJJ A;  1JR8 A;  4JTA B;  2B0J A;  4XPY A;  3S0X A;  1FAP B;  2KQ9 A;  2J9U A;  1M2V A;  3FOO A;  3U2L A;  2R7T A;  4W8P A;  2R25 A;  1NU9 C;  2M64 A;  2OEX A;  2GAQ A;  1G4W R;  3F46 A;  1M56 C;  1Z6A A;  4FES A;  3AJM A;  2XLE A;  2CYD A;  1RKE B;  5F28 E;  3RVZ A;  2XM4 A;  3WOD F;  3NKD A;  5CI8 A;  4ER9 A;  3K6B A;  4IWB A;  2B0H A;  2CDQ A;  4NCQ A;  2QTV A;  4EHP A;  4D4N A;  3DI5 A;  1D0Y A;  3JT1 A;  2R7O A;  4XLP F;  4KNW A;  4LER A;  4PFP A;  3T4R A;  2Z15 A;  2YWA A;  3AQC A;  3C18 A;  4CBE A;  2HZ8 A;  2ICW G;  2J46 A;  3DZA A;  5L3V A;  3UGP A;  4C3B A;  1PCX A;  2D5R B;  5L0J A;  1VTM P;  3KKB A;  3GEH A;  3U9J A;  1BR1 A;  5L0F A;  1LI5 A;  1Q0M A;  1QKR A;  3ATP A;  4MVU A;  2I15 A;  3EG9 B;  4XPW A;  5F5F A;  1L3P A;  1Z23 A;  2LSE A;  1M57 C;  2DYS C;  2AP3 A;  3DXJ F;  3NRH A;  2IXP A;  3TOM A;  1FR0 A;  1QLE C;  1ZYR F;  1Z63 A;  3EH2 A;  2LQG A;  4H54 A;  2BE5 F;  2O9X A;  5E33 A;  2PP4 A;  4ONS A;  4GQH A;  5COM A;  3RQE A;  3ASO C;  4P6I C;  4Z9J A;  2LP4 A;  3T6B A;  3ASN C;  3US6 A;  2DGJ A;  2KC3 A;  1RJ9 A;  2EPM X;  3C8G D;  4XQ1 A;  2PNO A;  2HS5 A;  1YYX A;  4DVY P;  2ZPA A;  1OKK D;  1SR2 A;  4O6N A;  4Z9H A;  3MYF A;  3S29 A;  3SEO A;  1CGM E;  4ZLD A;  2DI3 A;  3B71 A;  3T6G B;  3E70 C;  2L9J A;  4P9T A;  1H9G A;  4EBK A;  3V5Z A;  1APC A;  3RQF A;  3SXY A;  2KK1 A;  3FXH A;  3HTK C;  3TJ6 A;  3VF0 A;  3W4Y A;  4O6Y A;  1G8X A;  4OD5 A;  2EPN A;  2VCC A;  1LKX A;  4NTA A;  1PV3 A;  3M4B A;  5GPG B;  3NYM A;  1MQV A;  2RSE B;  2YHS A;  4U5H A;  2J7P D;  2OJQ A;  3BRJ A;  2GWW A;  2PF4 E;  1MMD A;  2QE9 A;  2IXO A;  2J0X A;  2ZXO A;  3E9V A;  4HFF B;  1LE2 A;  4JEB A;  2NG1 A;  4G78 A;  4WGZ A;  5EK0 A;  4DRJ B;  5JRA A;  1VYK A;  3U3B A;  2OQM A;  5BQI A;  3IQT A;  3J06 A;  1YJG A;  1NZE A;  1SMY F;  2G3V A;  2RD9 A;  3B0P A;  1L7C A;  3DJN B;  1VLS A;  3M15 A;  3NG1 A;  3G50 A;  4GYT A;  5E3A A;  3S9O A;  3VRC A;  1OQC A;  3H65 A;  3HJC A;  5COG A;  3RVY A;  4A2N B;  5DVW A;  4PJL A;  2Y39 A;  2EIM C;  1H6G A;  4JCH A;  2XL8 A;  2ZXP A;  3QTH A;  1YYJ A;  3TD7 A;  1TKN A;  3JZ0 A;  1PD1 A;  3SXK A;  3MFN A;  1C02 A;  1DOW A;  2F22 A;  4JC7 A;  3EFO A;  4O6M A;  4CIP A;  4C7O A;  2YLI A;  2YLD A;  4K1O A;  1C17 M;  1OW7 A;  2D4U A;  3C7J A;  3C8Z A;  3IQ6 A;  3TQO A;  1ZVZ A;  1OCR C;  1Y4C A;  3O39 A;  4ANJ A;  4BJT A;  3SZR A;  3F47 A;  4AK9 A;  3RKO F;  3H2V A;  2IM8 A;  2W45 A;  5A6J A;  1TWH A;  1JRA A;  1K05 A;  1JAF A;  4WAB A;  5B3S C;  2XL4 A;  4LLC A;  5KYN A;  4K0D A;  4CJG A;  2XLM A;  1Z5Z A;  4PR9 A;  2XLH A;  2EIJ C;  3VM6 A;  4X0R A;  1JPJ A;  4BEM J;  2J45 A;  4YN0 B;  4BG0 A;  1VK5 A;  2CCY A;  3Q7G A;  4EKW A;  5A6K A;  2HSQ A;  1ZU4 A;  3NYL A;  4FX5 A;  2KW3 C;  3IHU A;  1UG7 A;  3L34 A;  3MYI A;  4MVQ A;  1O3U A;  3CAX A;  3EHM A;  4AE4 A;  3EGX A;  3JCU Q;  3K66 A;  1H7I A;  4MVR A;  2YZS A;  2HV7 A;  2VCA A;  3ZG1 A;  5DQT A;  2EPK X;  5DS4 A;  2GFH A;  1G5Z A;  4MVZ A;  5DQZ A;  3UNG C;  3LS0 A;  1FFT C;  5E3C A;  5KYY B;  2IXN A;  3LNR A;  3NMI A;  4Q7C A;  3CSK A;  3KYI A;  4B6I A;  2GA0 A;  3EGD A;  1Z3I X;  4ULV A;  4BEJ A;  1T6U A;  1WOL A;  5KYX B;  5KYW A;  3K1I A;  3QW1 A;  5EGY A;  5A69 A;  3GWN A;  2IYL D;  5KYU A;  1YZA A;  4OIP F;  2H7O A;  2C03 A;  3C8G A;  1W2W A;  1KTM A;  2HSB A;  2C04 A;  3EPV A;  4JEA A;  2L6G A;  1B68 A;  2UUI A;  4CDA A;  4OIQ F;  4MVS A;  3ZQY A;  1JMW A;  1CPQ A;  4MTG A;  4PJM A;  1ORS C;  4IAR A;  4LDQ A;  2IBF A;  3O6X A;  1HMD A;  2EIN C;  3L1M A;  4J30 B;  4XEV A;  4YL0 A;  4U9D A;  4DVZ A;  4HFK B;  5B1A C;  3M4C A;  3KL4 A;  4PAC A;  4CS9 A;  4DOZ A;  5L3Q A;  4KI2 A;  3S27 A;  3T6J A;  4O7G A;  2HV6 A;  2VCB A;  1HMO A;  1LI7 A;  3JRM O;  1V4A A;  2J7P A;  3GM2 A;  1LIH A;  2YQY A;  4JVS A;  1VYI A;  5JLI A;  1QVX A;  4YK5 A;  2NUT A;  3LNM B;  1J8Y F;  1NFO A;  3FHD A;  1U89 A;  4H4K C;  4U5F E;  5HSW A;  1IW7 F;  1OR3 A;  2P7V A;  2ZXW C;  3HNJ A;  4LDR A;  2AWC A;  2CNW D;  1M2O A;  5JP7 A;  3RH3 A;  2PFD A;  1GM5 A;  4OIN F;  5IY5 C;  3U3F A;  1EKY A;  2Q4F A;  3OWT A;  2A68 F;  1ZHT A;  2Y3H A;  4XWJ A;  1NSG B;  3TOL A;  4CS8 C;  2KGO A;  2WZF A;  4KC9 A;  5COF A;  4N6H A;  2YL3 A;  1A7E A;  3SXZ A;  5L0I A;  2HMZ A;  1A41 A;  5AC5 A;  2JPU A;  2R7S A;  1LVK A;  1AEP A;  1YA9 A;  1MNE A;  1NLX A;  2BC5 A;  3FVY A;  4AL1 A;  3DJU B;  1T9K A;  2OOC A;  3CQZ A;  1I5N A;  3O10 A;  3LEO A;  2BL2 A;  1OXK A;  2EPO A;  2P1A A;  3H2U A;  2FAP B;  4CJO A;  4U5B E;  4QI0 A;  1A0B A;  4DXW A;  4KBL A;  3NMK A;  2FFH A;  3SNH A;  4AX2 A;  4G7O F;  2R7X A;  1ORJ A;  4MTF A;  4YT4 A;  4LDK A;  3WHN A;  4BJ6 C;  4CS8 A;  2XXA A;  1MMA A;  1ZZP A;  4YT2 A;  3A9C A;  3V5X A;  4I1O B;  4UDV A;  3PDM P;  1WN0 A;  1FTS A;  4NC3 A;  3W2W A;  2LD6 A;  3SYN A;  1LPE A;  4RDA A;  1RXQ A;  2OKU A;  4OIO F;  3N0T A;  2LCH A;  3DM5 A;  2VB6 A;  1QSP A;  3OEO A;  1T01 A;  1YVI A;  1WTY A;  2R03 A;  2NSG A;  1DOV A;  2QY9 A;  1ZHZ A;  1OW8 A;  2JD3 A;  3ZVR A;  3VYW A;  1TFK B;  4N6C A;  3PCV A;  4MTO A;  4G7H F;  1VB5 A;  1RKE A;  3LLI A;  2VAS A;  3GAN A;  1WGW A;  3DD7 A;  3HKK A;  3HNK A;  1A7V A;  1XZQ A;  4HEA J;  4JTD B;  1D1B A;  4AL0 A;  4PFO A;  4CDY A;  4CS7 A;  4BJ6 A;  1YLM A;  1TQG A;  1JOG A;  3U9M A;  4EUK B;  5JT4 A;  2XS8 A;  2MWQ A;  2EIL C;  3JYH A;  4YL1 A;  1ZW2 A;  3X1O A;  1Q0K A;  1S7Z A;  3MBG A;  3FAJ A;  1V54 C;  2A69 F;  2EIK C;  2QLA A;  4I1M A;  4RBN A;  3U5S A;  1OR2 A;  4Z9I A;  2TMV P;  1Q0G A;  4HE8 D;  4NTF A;  4JRZ A;  3FDQ A;  1UFB A;  4XTK A;  4EBJ A;  4N4W A;  3ZQV A;  2Q9C A;  3I4U A;  3EG9 A;  2LFF A;  2L6H A;  5TJ5 E;  4AE4 B;  5JSL A;  2AVK A;  2MYS A;  2ZD9 A;  2HJ3 A;  4YL3 A;  2YRF A;  3ABK C;  2WL8 A;  1AVO B;  1SYQ A;  3I5Q A;  4MVM A;  4F4B A;  1NU7 D;  3FOP A;  3G4X A;  3AG3 C;  1LS1 A;  1Q0F A;  4XEF A;  4FAP B;  4A4A A;  2DB4 A;  3AOU A;  1CGN A;  2L7A A;  1E83 A;  1IZM A;  3NDB B;  2EPL X;  2R7R A;  1E85 A;  1TR2 A;  1I4Z A;  3DE9 A;  3L8J A;  3NKE A;  2V3C C;  5AC4 A;  3R7C A;  5HV9 A;  1GGQ A;  1SF8 A;  1ZHY A;  4JTC B;  5A6B D;  1RMV A;  3WG7 C;  3DAG A;  1O87 A;  2AWY A;  3EQL F;  3LES A;  3W8H A;  2CNW A;  2L81 A;  2P61 A;  1G4U S;  3CEX A;  4MVO A;  4YJW A;  4EBB A;  3GWL A;  3K33 A;  4K7B A;  1OCZ C;  2XLO A;  3GOD A;  3IPM O;  4WJ0 A;  2R9R B;  3CZ6 A;  4NQF A;  5K0I A;  3EZH A;  5DS5 A;  4CIH A;  3ZTZ A;  2NUP B;  2P0N A;  5L0C A;  1VMA A;  1VOM A;  1YAU O;  4U5D E;  3POV A;  2WB7 A;  2YL0 A;  5FZT A;  1H9T A;  3RF3 A;  1R5I D;  3LEV A;  4XEK A;  2NSF A;  2ZXR A;  1MMG A;  3ITF A;  1BBH A;  1M2V B;  2JX0 A;  2QNL A;  2XRH A;  3ZIB A;  2KJG A;  4CDV A;  2J8W A;  1LM3 B;  4JE9 A;  3SP1 A;  3QW0 A;  3T9O A;  3EZI A;  2Y3D A;  2HUJ A;  2R7U A;  2I8B A;  3TUL A;  3DWW A;  4CSA C;  3U2M A;  1GQA A;  3AG2 C;  3UMI A;  1OKK A;  3W2V A;  2IXM A;  5F5H A;  3B9Q A;  4XLN F;  3AG1 C;  3GM3 A;  4L6R A;  1GS9 A;  2YVK A;  1U6H A;  4FWV A;  5B1B C;  2H7V C;  1AUE A;  1TWC A;  256B A;  2Q9B A;  3ABM C;  4OIR F;  4BJ5 C;  1FFH A;  5EHH A;  1QZX A;  3M79 A;  4DRI B;  4R32 A;  3QZC A;  5T3T A;  2NPU A;  2OJE D;  4DRH B;  3DKA A;  3ECS A;  1N1C A;  3FMS A;  2L6F A;  3I5P A;  3JSE O;  4CSA A;  2R02 A;  1TWA A;  3UR3 C;  5JUA A;  1C03 A;  1PD0 A;  1T5O A;  1WWP A;  2G62 A;  2UUH A;  2Q3T A;  1OW6 A;  3Q6N A;  2WZL A;  4I44 A;  4OD4 A;  3VAY A;  5A6A A;  4J7Y A;  3HLZ A;  3U8P A;  2R7Q A;  4M63 A;  2LIG A;  3B29 A;  3DM9 B;  4BJ5 A;  3LS1 A;  2YL1 A;  3JSZ A;  1OCC C;  1RJ9 B;  4IAQ A;  2R7V A;  4EIY A;  2KSF A;  2R7W A;  1ZHX A;  2VC9 A;  3JYY A;  1XWJ A;  2A0U A;  3OA1 A;  1EI7 A;  1LE4 A;  5KYY A;  3PMR A;  3IQ5 A;  3QVZ A;  4BPM A;  2A1D D;  2HFI A;  5DLJ A;  5BUO A;  3PHF 2;  2G3K A;  2Q00 A;  4NY3 A;  5JS5 A;  2HKV A;  1CPR A;  1BDJ B;  2J0W A;  2WVO A;  3RQG A;  5KYX A;  1TFO B;  2PX3 A;  1BZ4 A;  3DMD A;  2GDC A;  3HNI A;  3M1C B;  3RYL A;  3G4Z A;  3RIP A;  3O55 A;  2A6E F;  5JVE A;  5A6B A;  1D1C A;  2H8A A;  5DS6 A;  1WAT A;  2KNH A;  2XSE A;  1E86 A;  3S90 A;  5BQH A;  4U5E E;  3LAY A;  1KNY A;  4IAO A;  2CGE A;  1T6I A;  2OG2 A;  4G0H A;  4JJG A;  4DBQ A;  2J9B A;  4P9F A;  1Z7Q c;  3K7D A;  2LFD A;  2XM0 A;  1ZW3 A;  3JTL O;  1D0Z A;  4PJJ A;  3B0V C;  2R05 A;  1XZP A;  2YKZ A;  3RW0 A;  3ABL C;  1HY5 A;  3MX3 A;  4E0I A;  2HJM A;  3N2Z B;  2HMQ A;  2ETS A;  2X51 A;  1YZC A;  1BR4 A;  3A11 A;  2XLW A;  3AGU A;  3R2P A;  1FMW A;  1E84 A;  3L8I A;  3EFO B;  1V55 C;  1FMV A;  2Y69 C;  4C7O B;  1LS4 A;  3LJB A;  4DJ9 A;  4IGG A;  4MND A;  5D91 A;  4IB4 A;  3EHN A;  1WAS A;  4JIO A;  4U5G A;  1HE1 A;  1TWG A;  4MS2 A;  5CI9 A;  5L0H A;  3KYJ A;  5T3W A;  1J8M F;  1HE9 A;  2PBE A;  1YAR O;  3U8V A;  3GEI A;  1HW2 A;  1E2X A;  1FNT c;  4BJ1 A;  1YDI A;  3AG4 C;  3C63 A;  4QDL A;  1F1M A;  2OEV A;  4J7T A;  4JZA A;  3EH1 A;  5E2Q A;  1O5H A;  4E17 A;  4JJF A;  3UMK A;  3EGX B;  3JRT A;  3KH2 A;  2WVQ A;  3Q7L A;  1ZU5 A;  4LAC B;  1VLT A;  2XS1 A;  2AU5 A;  2Q7R A;  5BQG A;  1EA8 A;  2MHR A;  3X2Q C;  2YEV A;  1Q0D A;  3HNL A;  5B3I A; 
#chains in the Genus database with same CATH homology
 1I5N A;  1TQG A;  4G78 A;  1C03 A;  1A0B A;  3U3B A;  4EUK B;  3IQT A;  2LP4 A;  3US6 A;  3KYJ A;  1SR2 A;  3MYF A;  1Y6D A;  2Q4F A;  1WN0 A;  2LD6 A;  1C02 A;  2LCH A;  1QSP A;  1YVI A;  4PAC A;  2A0B A;  1FR0 A;  1BDJ B;  2OOC A;  2R25 A;  3KYI A;  1OXB A;  1OXK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...