1WN0A

Crystal structure of histidine-containing phosphotransfer protein, zmhp2, from maize
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
131
structure length
131
Chain Sequence
QLNALLSSMFASGLVDEQFQQLQMLQEDGGTPGFVAEVVTLFCDDADRIISELAALLDQPIVDFDKVDAYVHQLKGSSASVGAQKVKFTCMQFRQLCQDKNRDGCIMALAVVRNEFYDLRNKFQTMLQLEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords histidine-containing phosphotransfer protein
publication title Crystal structure of the histidine-containing phosphotransfer protein ZmHP2 from maize
pubmed doi rcsb
source organism Zea mays
molecule tags Signaling protein
total genus 53
structure length 131
sequence length 131
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2004-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01627 Hpt Hpt domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.160 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) HPT domain 1wn0A00
1TQGA 1C03A 3US6A 2LCHA 3KYJA 1I5NA 3MYFA 1C02A 4G78A 3IQTA 1YVIA 4PACA 4EUKB 2R25A 1BDJB 1FR0A 1SR2A 1WN0A 1OXBA 2Q4FA 1Y6DA 2OOCA 2A0BA 3U3BA 2LP4A 1A0BA 1QSPA 3KYIA 1OXKA 2LD6A
chains in the Genus database with same CATH superfamily
2QUPA 2ZPAA 2XM0A 4KC9A 3MX3A 4MVQA 1RCPA 1VYIA 3O39A 4O7GA 2EPMX 1JOGA 1XZPA 4K0DA 3UR3C 2YVKA 4HFFB 5KYXA 2HJ3A 3NG1A 4JRZA 3UGOA 1N1CA 4YL3A 1Q0KA 4BJ1A 3Q7GA 4CDAA 2Y3GA 2WVOA 3DMDA 5KYWB 3NMJA 4OD4A 4CSAC 1Z5ZA 2XLHA 4XLPF 1ORSC 1OQCA 3LS0A 3V5YA 2PX3A 3QZCA 1WN0A 2J9VA 1J8YF 3PMRA 4D4NA 2KSFA 1WGWA 2Q3TA 4PFOA 4OIRF 1ZHZA 2R7XA 1FFTC 2LK4A 3V5ZA 1NBBA 2H7VC 1PV3A 5T1DB 1RKEB 3DZAA 2G62A 3V7OA 3DKAA 1VB5A 3ZG1A 3WHNA 2QTVA 4OD5A 4FAPB 1OCRC 5K0IA 4LERA 1LIHA 2P7VA 2YL7A 4JE9A 1D0ZA 1EI7A 1HMOA 2R7UA 1MNEA 5DS4A 2DYSC 1QPUA 2X51A 3DXJF 1IW7F 1C03A 3FAJA 1NFOA 2CNWA 3M4CA 1LS4A 4K7BA 4P9TA 1TKNA 3UMIA 4CS8C 3E9VA 3S28A 5KYUA 2ASRA 2YEVA 3LESA 3B0PA 3BEHA 2KC3A 2IXPA 3L0IA 1WTYA 3TOLA 1A7VA 2E87A 2W4BA 3CQZA 5KYYA 4QI2A 4JCHA 1HW1A 4RD9A 1ZHYA 4GEHA 2J9WA 3AG3C 1Y4CA 2P61A 4D4XA 3GEEA 3CEXA 3Q6MA 2OU6A 4DBRA 5L0HA 1H9TA 1KTMA 1M56C 1NG1A 4WJ0A 4AE4B 3N24A 1OKKD 4K1OA 3AG4C 1S05A 3TQOA 5EHHA 3FAPB 1A41A 2UUHA 1SF8A 3TJ6A 3C18A 1NU9C 3EH2A 3EGDA 5A6JA 2PF4E 3U8PA 1SMYF 2TMVP 4XPXA 3F46A 4XWJA 2VCCA 1FAPB 4NCQA 1GQAA 3N0TA 4PJLA 1Z7Qc 3SXZA 4BPMA 5D91A 5HV9A 4G7ZF 2A6HF 2HV7A 2HJMA 4W8KA 3UNGC 4MVOA 5F5FA 4I3MA 3FMSA 4IRUA 2IXMA 3QVYA 3NMIA 3C8GA 4NY3A 4E17A 3ASNC 1RMVA 1T6UA 2J7PD 5COFA 1ORJA 3ABMC 1M2VA 3MYIA 3OA1A 5JS5A 3B29A 3DM9B 3OWTA 3RVYA 1LE4A 3EG9A 4AL0A 4U5DE 1J8MF 3J06A 1GS9A 2VCAA 1TQGA 3K33A 1ZU4A 3K7DA 3RKOF 2W45A 4CX9A 5B3IA 4G7HF 2DB4A 2Q9CA 2BL2A 2IXOA 3KL4A 4N6HA 2XLVA 5JP7A 2NSFA 3B0VC 4H54A 3HNKA 2XXAA 3NMKA 4J30B 2FGYA 1ZZPA 4G7OF 3F47A 2ZXRA 1TWCA 1NFNA 2EPLX 2IXNA 2XL6A 4I1MA 3W8IA 2R7WA 2HZ8A 2MWQA 4IJJA 4XTKA 2P6VA 3HLZA 4F4BA 4Z9IA 3LLIA 2P0NA 5E3AA 2WL8A 3B9QA 2WVNA 4CSAA 3U3BA 2I8BA 1OCCC 1WASA 4U5EE 1C17M 1YLMA 5L0FA 4ULWA 1OCZC 1G8XA 3N2ZB 2G3KA 4JJFA 4R32A 2W9YA 2ZXWC 4O79A 5GPGB 2R7SA 2OEVA 3U9JA 4FWVA 3WAQA 1YDIA 2KYHA 4O6MA 4LLEA 5COMA 3KH2A 1QVXA 3IQCA 2KJGA 4PK4A 1ZVZA 5A6AA 4OIPF 3SXYA 2KK1A 3JT1A 3JRTA 4EUKB 3Q6NA 3FDQA 4CS8A 1BDJB 3FVYA 4KI2A 3AOUA 4PFPA 5L0CA 2BE5F 2HUJA 1YZAA 2OEXA 2QE9A 3MFNA 1RJ9B 4FESA 4JTAB 4YL0A 4CIPA 1LI5A 3KMIA 1OXKA 1FMWA 2AP3A 2J9BA 4GQHA 4YT4A 1CGNA 1KU2A 3L8IA 4NC3A 5TJ5E 4JIOA 4EBBA 4YT2A 2R9RB 4BJ6C 2NUTB 3GM3A 4OINF 3U2MA 1AUEA 1BR2A 2A0UA 2R03A 3QMKA 4LDQA 3VM6A 4GYTA 2ZD9A 1V4AA 4FX5A 2Q7RA 4DJ9A 4IB4A 5DVWA 1Q0FA 1VTMP 3O10A 2YKZA 4XEFA 2NUPA 3RQFA 2LQGA 4BEMJ 5E3CA 4NTAA 4U5CE 2CDQA 1OW8A 1ZU5A 3DD7A 3IPMO 1U89A 2RD9A 2B0HA 3L34A 2OKUA 1T6IA 2A0BA 2EIJC 4MS2A 4DRJB 4JTCB 1ZYRF 4YL1A 3AJMA 1NU7D 3CSKA 4MVSA 4CS7A 4MQ9F 3QTHA 1QSPA 1YA7O 4JCZA 3RH3A 3ZWIA 4DOZA 5AGFA 4O6NA 1Z63A 3QW1A 2HFIA 4E7ZA 2UUIA 4UDVA 4WGYA 1APCA 1OW6A 1K05A 3GORA 4M63A 3O55A 4KNWA 4U5HA 5L3QA 3RFYA 3DAFA 2IM8A 3DE9A 3IQ6A 3KYJA 1NZEA 1PD1A 4XQ1A 2B0JA 1HW2A 1S7ZA 5L3VA 4U9EA 4MW3A 1G4US 1T6QA 1MMNA 1F1MA 2JD3A 1MQVA 4CS9C 2XLEA 1O87A 4BJTA 1QLEC 3TOMA 1Q0DA 1E2XA 2ZXOA 4Z9HA 3UMKA 2W4MA 3R2PA 5L0IA 1RKCA 2YZSA 1A7DA 2OOCA 1TWGA 3B71A 2HSQA 1U6HA 1LM3B 3DAGA 4DRIB 2Y3HA 1YYXA 1L3PA 3C8ZA 3EFOA 4IAOA 5EK0A 4A2NB 2RSEB 1HY5A 3FHDA 2DYRC 3U8VA 2J46A 1YA9A 2XL8A 1RXQA 4EKWA 2ZXPA 1MMDA 5A6BD 1CPQA 3W8HA 1G5ZA 5KYNA 4DBQA 2XL4A 3ZTMA 2ETSA 4E18A 1Q0MA 2A69F 4G0HA 4Q7CA 4OIOF 3BRJA 3T6GB 3ZC4A 3L8JA 3AQCA 3U2LA 2R7OA 4MW8A 3EGXA 3U3FA 1PCXA 4QI0A 2YWAA 1GGQA 3VAYA 1K04A 3GODA 4I1OB 3M15A 5B1AC 3W2WA 4C7OA 3HKKA 3EHNA 1CPRA 1Y6DA 1XZQA 2PFDA 4LACB 4O6YA 1V74B 3EQLF 3ZVRA 4XPYA 4P9FA 3HJCA 1JPJA 4JKVA 4C3BA 2IOQA 4U9DA 1VLTA 1Z3IX 4MNDA 2J8WA 4N6CA 3ITFA 1A7EA 1B68A 1I4YA 1H9GA 1BR4A 3C62A 3S9OA 3ABLC 3JYHA 1PD0A 1VMAA 3EHMA 4E0IA 5FCLA 2XLOA 4U5BE 2GFHA 4P6IC 1LE2A 1R4TA 3DI5A 3M79A 4ULVA 1ZHXA 2LCHA 4YN0B 1NLXA 4XEKA 3VYWA 1K40A 3L1MA 3SNHA 3JCUQ 3NDBB 2L6FA 2EILC 1I4ZA 3S29A 5KYWA 2FAPB 4CIHA 4CDYA 4DRHB 5L0DA 5B1BC 1ORYA 3IHUA 4YWQA 1CGOA 2EPNA 1LI7A 1CGME 3EJNA 2NG1A 4PJJA 4CDVA 1A0BA 3LAYA 3SP1A 2L81A 3JZ0A 2HS5A 4J7YA 4B6IA 1YYJA 4QDLA 1RKEA 1T9KA 3LJBA 2LIGA 4ONSA 1W2WA 1TFOB 1SZIA 2KNHA 3K1HA 1AEPA 2JX0A 2QY9A 3HNLA 3HTKC 3LLKA 3V5XA 5A6BA 3NYJA 3ZQYA 1OKKA 3T6JA 4N4WA 1JRAA 3DJUB 4JVSA 2ICWG 4ZLDA 3GANA 4U5GA 5KYUB 2CCYA 3AG2C 4AK9A 2XM4A 2Z15A 1D0YA 1HE1A 2GA0A 2Y69C 3RF3A 4U5FE 1YARO 2V26A 5BUOA 2AVKA 2XS1A 1AVOB 1FTSA 1D1AA 1JPNA 2LFFA 3QW0A 3NYMA 4IWBA 5KYYB 3RQGA 2M64A 3X2QC 1JMWA 4WABA 5JVEA 4JZAA 4ANJA 4CS9A 2XS8A 3C63A 1Q0GA 2LP4A 2HSBA 2J0WA 1E85A 3ECSA 2YLDA 4MVZA 2OJQA 2J7PA 2L7AA 2KW3C 2YHSA 3ATPA 2WB7A 4C3DA 2EIMC 3G50A 1D1BA 5AC5A 2AWYA 5T3TA 2I15A 4WGZA 3KPHA 3T9OA 3ZIBA 4AE4A 2CNWD 4XPWA 4HEAJ 2R7TA 3EGDB 3GWNA 3NYLA 3PHF2 4EBKA 2J0XA 2QNLA 1I5NA 2DGJA 2A68F 4HE8D 3M4BA 3GEHA 5FZTA 3S84A 1JR8A 4PR9A 3ASOC 2YL3A 3LEVA 1O5HA 2EPKX 3WODF 4YJWA 3S0XA 3PDMP 2XSEA 1MMGA 3RVZA 3E70C 4C3EA 4ER9A 3B0UX 4LDKA 1LVKA 1BR1A 2HMQA 3EZHA 4E0HA 1D1CA 3C8GB 1V55C 4MTFA 4XLNF 4J7TA 3KKBA 4A4AA 1E86A 1U0BB 4DVZA 2L6GA 5F28E 2A1DD 3M1CB 5JLIA 2P1AA 2GAQA 3A9CA 3EG9B 3UMHA 1ZHTA 4RDAA 4JURI 4LDRA 3FOOA 1ZHWA 2HV6A 1WATA 1BBHA 1M2OA 3LUTB 1FMVA 1YAUO 3H2UA 3G4XA 1TR2A 4HFKB 2YL0A 3IQ5A 1SYQA 3JRMO 4PJNA 4ZLCA 2XXAB 4RBNA 2Q00A 3ZDLA 3UGPA 1LPEA 2L6HA 2OG2A 4NTFA 1VYKA 4N06A 3CZ6A 2R7QA 1YVIA 4Z9JA 5F5HA 3DM5A 4BEJA 1MMAA 1T01A 2PP4A 1KNYA 2R25A 3LNMB 3MLGA 5AC4A 2WZFA 1Z6AA 3C8GD 5CIVA 2DI3A 2YLGA 3H65A 3HNIA 2OQMA 2LFDA 4DXWA 2LSEA 4JC7A 5E2QA 4CJGA 4MVMA 1QKRA 3JSZA 3TULA 3SXKA 5IY5C 5D92A 2PX0A 3CAXA 2QLAA 2IYLD 5COGA 5DLJA 2C03A 3ZQVA 1IZMA 1E83A 4L6RA 1H6GA 3Q7LA 2R02A 1WOLA 4BJ5C 1ZW3A 2NPUA 1FFHA 2XLMA 3US6A 4OIQF 3TD7A 3W4YA 5E33A 3MYFA 3ABKC 1C02A 1L7CA 3ZTZA 2AU5A 2EPOA 3IQTA 4G78A 1V54C 3K1IC 1UFBA 2FFHA 3C7JA 5L0GA 5CI8A 4IARA 2YLIA 2MHRA 3DJNB 2KQ9A 3T4RA 4X0RA 1SR2A 5BQHA 4IAQA 3U9MA 1H7IA 3U5SA 2WVQA 1G4WR 3PCVA 5EGYA 1EA8A 1HMDA 3EH1A 4JW1A 1RJ9A 4MTOA 1VOMA 5A6KA 2A6EF 3QVZA 5CI9A 2JPUA 1OR2A 2CW0F 1YZCA 2HKVA 3GM1A 4JEBA 3JSEO 2NSGA 1T5OA 1M6TA 2VASA 2YRFA 5B3SC 5L0JA 5KYXB 5HSWA 3EZIA 2R7VA 1LS1A 2Y3DA 4Q4ZF 2EIKC 4E7SA 4NQFA 1BZ4A 3AGUA 2VCBA 3DE8A 2NUTA 4EWCA 4YT8A 2VC9A 3O6XA 4I44A 2CGEA 2NUPB 4YT5A 2KGOA 2D4UA 2Y3BA 4MTGA 3AG1C 4PACA 256BA 4BJ6A 4CJOA 1O3UA 5JUAA 1Z23A 1WWPA 2PBEA 4JEAA 1DOWA 3LS1A 3ZSUA 1EQ1A 1OXBA 1FR0A 2Q4FA 1ZW2A 3I4UA 3R7CA 1XWJA 3TK0A 1M57C 3GEIA 1TWHA 2GWWA 1TWAA 2HMZA 4H4KC 4J32B 1HE9A 4AX2A 2C04A 3IEEA 1OW7A 1YJGA 3NKEA 1UG7A 3SXMA 3T6BA 3VRCA 3U0CA 2VH3A 3I5PA 2L9JA 3A11A 1JAFA 1R5ID 3S90A 4XEVA 4JTDB 5JT4A 4CBEA 2R7RA 4Q5SF 3SEOA 3OEOA 3LEOA 2VB6A 1QZXA 4BG0A 2F22A 3VF0A 1VK5A 2M4EA 4MVRA 2J9UA 4YK5A 4EIYA 3JTLO 1EKYA 3S27A 5DQZA 3AGTA 3H2VA 2O9XA 2GDCA 3TJ5A 3RQEA 4W8PA 5JRAA 1NSGB 3RIPA 2MYSA 3WG7C 4AL1A 2XLDA 2XRHA 3EFOB 3GWLA 3LNRA 4LLCA 3NRHA 1GM5A 3RYLA 2PNOA 2YL1A 3AQBA 3SYNA 5DQTA 2G3VA 3DWWA 5JSLA 1FNTc 2EINC 3K66A 2LD6A 2OCCC 1TFKB 2IBFA 5BQGA 2AWCA 4KBLA 5T3WA 5DS5A 2YQYA 1VLSA 3MBGA 2XLWA 3RW0A 5A69A 3W2VA 3EPVA 3I5QA 1DOVA 3G4ZA 4IGGA 4NTBA 3EGXB 2Q9BA 2WZGA 4EHPA 2H8AA 2J45A 2WZLA 3X1OA 2Y39A 1OCOC 4MVUA 2CYDA 4BJ5A 3JYYA 1ST6A 2H7OA 2Q9AA 3NKDA 4KNVA 3POVA 2V3CC 4DVYP 4C7OB 1MNDA 5DS6A 3FOPA 3FXHA 3K6BA 3SZRA 3K1IA 1LKXA 3HNJA 2H7BA 1QQ3A 2X0CA 2D5RB 1D0XA 1E84A 2R05A 3GM2A 4JJGA 5BQIA 1M2VB 4EBJA 2BC5A 3KYIA 4PJMA 2OJED 1OR3A
chains in the Genus database with same CATH topology
1TQGA 1C03A 3US6A 2LCHA 3KYJA 1I5NA 3MYFA 1C02A 4G78A 3IQTA 1YVIA 4PACA 4EUKB 2R25A 1BDJB 1FR0A 1SR2A 1WN0A 1OXBA 2Q4FA 1Y6DA 2OOCA 2A0BA 3U3BA 2LP4A 1A0BA 1QSPA 3KYIA 1OXKA 2LD6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TQG A;  1C03 A;  3US6 A;  2LCH A;  3KYJ A;  1I5N A;  3MYF A;  1C02 A;  4G78 A;  3IQT A;  1YVI A;  4PAC A;  4EUK B;  2R25 A;  1BDJ B;  1FR0 A;  1SR2 A;  1WN0 A;  1OXB A;  2Q4F A;  1Y6D A;  2OOC A;  2A0B A;  3U3B A;  2LP4 A;  1A0B A;  1QSP A;  3KYI A;  1OXK A;  2LD6 A; 
#chains in the Genus database with same CATH topology
 2QUP A;  2ZPA A;  2XM0 A;  4KC9 A;  3MX3 A;  4MVQ A;  1RCP A;  1VYI A;  3O39 A;  4O7G A;  2EPM X;  1JOG A;  1XZP A;  4K0D A;  3UR3 C;  2YVK A;  4HFF B;  5KYX A;  2HJ3 A;  3NG1 A;  4JRZ A;  3UGO A;  1N1C A;  4YL3 A;  1Q0K A;  4BJ1 A;  3Q7G A;  4CDA A;  2Y3G A;  2WVO A;  3DMD A;  5KYW B;  3NMJ A;  4OD4 A;  4CSA C;  1Z5Z A;  2XLH A;  4XLP F;  1ORS C;  1OQC A;  3LS0 A;  3V5Y A;  2PX3 A;  3QZC A;  1WN0 A;  2J9V A;  1J8Y F;  3PMR A;  4D4N A;  2KSF A;  1WGW A;  2Q3T A;  4PFO A;  4OIR F;  1ZHZ A;  2R7X A;  1FFT C;  2LK4 A;  3V5Z A;  1NBB A;  2H7V C;  1PV3 A;  5T1D B;  1RKE B;  3DZA A;  2G62 A;  3V7O A;  3DKA A;  1VB5 A;  3ZG1 A;  3WHN A;  2QTV A;  4OD5 A;  4FAP B;  1OCR C;  5K0I A;  4LER A;  1LIH A;  2P7V A;  2YL7 A;  4JE9 A;  1D0Z A;  1EI7 A;  1HMO A;  2R7U A;  1MNE A;  5DS4 A;  2DYS C;  1QPU A;  2X51 A;  3DXJ F;  1IW7 F;  1C03 A;  3FAJ A;  1NFO A;  2CNW A;  3M4C A;  1LS4 A;  4K7B A;  4P9T A;  1TKN A;  3UMI A;  4CS8 C;  3E9V A;  3S28 A;  5KYU A;  2ASR A;  2YEV A;  3LES A;  3B0P A;  3BEH A;  2KC3 A;  2IXP A;  3L0I A;  1WTY A;  3TOL A;  1A7V A;  2E87 A;  2W4B A;  3CQZ A;  5KYY A;  4QI2 A;  4JCH A;  1HW1 A;  4RD9 A;  1ZHY A;  4GEH A;  2J9W A;  3AG3 C;  1Y4C A;  2P61 A;  4D4X A;  3GEE A;  3CEX A;  3Q6M A;  2OU6 A;  4DBR A;  5L0H A;  1H9T A;  1KTM A;  1M56 C;  1NG1 A;  4WJ0 A;  4AE4 B;  3N24 A;  1OKK D;  4K1O A;  3AG4 C;  1S05 A;  3TQO A;  5EHH A;  3FAP B;  1A41 A;  2UUH A;  1SF8 A;  3TJ6 A;  3C18 A;  1NU9 C;  3EH2 A;  3EGD A;  5A6J A;  2PF4 E;  3U8P A;  1SMY F;  2TMV P;  4XPX A;  3F46 A;  4XWJ A;  2VCC A;  1FAP B;  4NCQ A;  1GQA A;  3N0T A;  4PJL A;  1Z7Q c;  3SXZ A;  4BPM A;  5D91 A;  5HV9 A;  4G7Z F;  2A6H F;  2HV7 A;  2HJM A;  4W8K A;  3UNG C;  4MVO A;  5F5F A;  4I3M A;  3FMS A;  4IRU A;  2IXM A;  3QVY A;  3NMI A;  3C8G A;  4NY3 A;  4E17 A;  3ASN C;  1RMV A;  1T6U A;  2J7P D;  5COF A;  1ORJ A;  3ABM C;  1M2V A;  3MYI A;  3OA1 A;  5JS5 A;  3B29 A;  3DM9 B;  3OWT A;  3RVY A;  1LE4 A;  3EG9 A;  4AL0 A;  4U5D E;  1J8M F;  3J06 A;  1GS9 A;  2VCA A;  1TQG A;  3K33 A;  1ZU4 A;  3K7D A;  3RKO F;  2W45 A;  4CX9 A;  5B3I A;  4G7H F;  2DB4 A;  2Q9C A;  2BL2 A;  2IXO A;  3KL4 A;  4N6H A;  2XLV A;  5JP7 A;  2NSF A;  3B0V C;  4H54 A;  3HNK A;  2XXA A;  3NMK A;  4J30 B;  2FGY A;  1ZZP A;  4G7O F;  3F47 A;  2ZXR A;  1TWC A;  1NFN A;  2EPL X;  2IXN A;  2XL6 A;  4I1M A;  3W8I A;  2R7W A;  2HZ8 A;  2MWQ A;  4IJJ A;  4XTK A;  2P6V A;  3HLZ A;  4F4B A;  4Z9I A;  3LLI A;  2P0N A;  5E3A A;  2WL8 A;  3B9Q A;  2WVN A;  4CSA A;  3U3B A;  2I8B A;  1OCC C;  1WAS A;  4U5E E;  1C17 M;  1YLM A;  5L0F A;  4ULW A;  1OCZ C;  1G8X A;  3N2Z B;  2G3K A;  4JJF A;  4R32 A;  2W9Y A;  2ZXW C;  4O79 A;  5GPG B;  2R7S A;  2OEV A;  3U9J A;  4FWV A;  3WAQ A;  1YDI A;  2KYH A;  4O6M A;  4LLE A;  5COM A;  3KH2 A;  1QVX A;  3IQC A;  2KJG A;  4PK4 A;  1ZVZ A;  5A6A A;  4OIP F;  3SXY A;  2KK1 A;  3JT1 A;  3JRT A;  4EUK B;  3Q6N A;  3FDQ A;  4CS8 A;  1BDJ B;  3FVY A;  4KI2 A;  3AOU A;  4PFP A;  5L0C A;  2BE5 F;  2HUJ A;  1YZA A;  2OEX A;  2QE9 A;  3MFN A;  1RJ9 B;  4FES A;  4JTA B;  4YL0 A;  4CIP A;  1LI5 A;  3KMI A;  1OXK A;  1FMW A;  2AP3 A;  2J9B A;  4GQH A;  4YT4 A;  1CGN A;  1KU2 A;  3L8I A;  4NC3 A;  5TJ5 E;  4JIO A;  4EBB A;  4YT2 A;  2R9R B;  4BJ6 C;  2NUT B;  3GM3 A;  4OIN F;  3U2M A;  1AUE A;  1BR2 A;  2A0U A;  2R03 A;  3QMK A;  4LDQ A;  3VM6 A;  4GYT A;  2ZD9 A;  1V4A A;  4FX5 A;  2Q7R A;  4DJ9 A;  4IB4 A;  5DVW A;  1Q0F A;  1VTM P;  3O10 A;  2YKZ A;  4XEF A;  2NUP A;  3RQF A;  2LQG A;  4BEM J;  5E3C A;  4NTA A;  4U5C E;  2CDQ A;  1OW8 A;  1ZU5 A;  3DD7 A;  3IPM O;  1U89 A;  2RD9 A;  2B0H A;  3L34 A;  2OKU A;  1T6I A;  2A0B A;  2EIJ C;  4MS2 A;  4DRJ B;  4JTC B;  1ZYR F;  4YL1 A;  3AJM A;  1NU7 D;  3CSK A;  4MVS A;  4CS7 A;  4MQ9 F;  3QTH A;  1QSP A;  1YA7 O;  4JCZ A;  3RH3 A;  3ZWI A;  4DOZ A;  5AGF A;  4O6N A;  1Z63 A;  3QW1 A;  2HFI A;  4E7Z A;  2UUI A;  4UDV A;  4WGY A;  1APC A;  1OW6 A;  1K05 A;  3GOR A;  4M63 A;  3O55 A;  4KNW A;  4U5H A;  5L3Q A;  3RFY A;  3DAF A;  2IM8 A;  3DE9 A;  3IQ6 A;  3KYJ A;  1NZE A;  1PD1 A;  4XQ1 A;  2B0J A;  1HW2 A;  1S7Z A;  5L3V A;  4U9E A;  4MW3 A;  1G4U S;  1T6Q A;  1MMN A;  1F1M A;  2JD3 A;  1MQV A;  4CS9 C;  2XLE A;  1O87 A;  4BJT A;  1QLE C;  3TOM A;  1Q0D A;  1E2X A;  2ZXO A;  4Z9H A;  3UMK A;  2W4M A;  3R2P A;  5L0I A;  1RKC A;  2YZS A;  1A7D A;  2OOC A;  1TWG A;  3B71 A;  2HSQ A;  1U6H A;  1LM3 B;  3DAG A;  4DRI B;  2Y3H A;  1YYX A;  1L3P A;  3C8Z A;  3EFO A;  4IAO A;  5EK0 A;  4A2N B;  2RSE B;  1HY5 A;  3FHD A;  2DYR C;  3U8V A;  2J46 A;  1YA9 A;  2XL8 A;  1RXQ A;  4EKW A;  2ZXP A;  1MMD A;  5A6B D;  1CPQ A;  3W8H A;  1G5Z A;  5KYN A;  4DBQ A;  2XL4 A;  3ZTM A;  2ETS A;  4E18 A;  1Q0M A;  2A69 F;  4G0H A;  4Q7C A;  4OIO F;  3BRJ A;  3T6G B;  3ZC4 A;  3L8J A;  3AQC A;  3U2L A;  2R7O A;  4MW8 A;  3EGX A;  3U3F A;  1PCX A;  4QI0 A;  2YWA A;  1GGQ A;  3VAY A;  1K04 A;  3GOD A;  4I1O B;  3M15 A;  5B1A C;  3W2W A;  4C7O A;  3HKK A;  3EHN A;  1CPR A;  1Y6D A;  1XZQ A;  2PFD A;  4LAC B;  4O6Y A;  1V74 B;  3EQL F;  3ZVR A;  4XPY A;  4P9F A;  3HJC A;  1JPJ A;  4JKV A;  4C3B A;  2IOQ A;  4U9D A;  1VLT A;  1Z3I X;  4MND A;  2J8W A;  4N6C A;  3ITF A;  1A7E A;  1B68 A;  1I4Y A;  1H9G A;  1BR4 A;  3C62 A;  3S9O A;  3ABL C;  3JYH A;  1PD0 A;  1VMA A;  3EHM A;  4E0I A;  5FCL A;  2XLO A;  4U5B E;  2GFH A;  4P6I C;  1LE2 A;  1R4T A;  3DI5 A;  3M79 A;  4ULV A;  1ZHX A;  2LCH A;  4YN0 B;  1NLX A;  4XEK A;  3VYW A;  1K40 A;  3L1M A;  3SNH A;  3JCU Q;  3NDB B;  2L6F A;  2EIL C;  1I4Z A;  3S29 A;  5KYW A;  2FAP B;  4CIH A;  4CDY A;  4DRH B;  5L0D A;  5B1B C;  1ORY A;  3IHU A;  4YWQ A;  1CGO A;  2EPN A;  1LI7 A;  1CGM E;  3EJN A;  2NG1 A;  4PJJ A;  4CDV A;  1A0B A;  3LAY A;  3SP1 A;  2L81 A;  3JZ0 A;  2HS5 A;  4J7Y A;  4B6I A;  1YYJ A;  4QDL A;  1RKE A;  1T9K A;  3LJB A;  2LIG A;  4ONS A;  1W2W A;  1TFO B;  1SZI A;  2KNH A;  3K1H A;  1AEP A;  2JX0 A;  2QY9 A;  3HNL A;  3HTK C;  3LLK A;  3V5X A;  5A6B A;  3NYJ A;  3ZQY A;  1OKK A;  3T6J A;  4N4W A;  1JRA A;  3DJU B;  4JVS A;  2ICW G;  4ZLD A;  3GAN A;  4U5G A;  5KYU B;  2CCY A;  3AG2 C;  4AK9 A;  2XM4 A;  2Z15 A;  1D0Y A;  1HE1 A;  2GA0 A;  2Y69 C;  3RF3 A;  4U5F E;  1YAR O;  2V26 A;  5BUO A;  2AVK A;  2XS1 A;  1AVO B;  1FTS A;  1D1A A;  1JPN A;  2LFF A;  3QW0 A;  3NYM A;  4IWB A;  5KYY B;  3RQG A;  2M64 A;  3X2Q C;  1JMW A;  4WAB A;  5JVE A;  4JZA A;  4ANJ A;  4CS9 A;  2XS8 A;  3C63 A;  1Q0G A;  2LP4 A;  2HSB A;  2J0W A;  1E85 A;  3ECS A;  2YLD A;  4MVZ A;  2OJQ A;  2J7P A;  2L7A A;  2KW3 C;  2YHS A;  3ATP A;  2WB7 A;  4C3D A;  2EIM C;  3G50 A;  1D1B A;  5AC5 A;  2AWY A;  5T3T A;  2I15 A;  4WGZ A;  3KPH A;  3T9O A;  3ZIB A;  4AE4 A;  2CNW D;  4XPW A;  4HEA J;  2R7T A;  3EGD B;  3GWN A;  3NYL A;  3PHF 2;  4EBK A;  2J0X A;  2QNL A;  1I5N A;  2DGJ A;  2A68 F;  4HE8 D;  3M4B A;  3GEH A;  5FZT A;  3S84 A;  1JR8 A;  4PR9 A;  3ASO C;  2YL3 A;  3LEV A;  1O5H A;  2EPK X;  3WOD F;  4YJW A;  3S0X A;  3PDM P;  2XSE A;  1MMG A;  3RVZ A;  3E70 C;  4C3E A;  4ER9 A;  3B0U X;  4LDK A;  1LVK A;  1BR1 A;  2HMQ A;  3EZH A;  4E0H A;  1D1C A;  3C8G B;  1V55 C;  4MTF A;  4XLN F;  4J7T A;  3KKB A;  4A4A A;  1E86 A;  1U0B B;  4DVZ A;  2L6G A;  5F28 E;  2A1D D;  3M1C B;  5JLI A;  2P1A A;  2GAQ A;  3A9C A;  3EG9 B;  3UMH A;  1ZHT A;  4RDA A;  4JUR I;  4LDR A;  3FOO A;  1ZHW A;  2HV6 A;  1WAT A;  1BBH A;  1M2O A;  3LUT B;  1FMV A;  1YAU O;  3H2U A;  3G4X A;  1TR2 A;  4HFK B;  2YL0 A;  3IQ5 A;  1SYQ A;  3JRM O;  4PJN A;  4ZLC A;  2XXA B;  4RBN A;  2Q00 A;  3ZDL A;  3UGP A;  1LPE A;  2L6H A;  2OG2 A;  4NTF A;  1VYK A;  4N06 A;  3CZ6 A;  2R7Q A;  1YVI A;  4Z9J A;  5F5H A;  3DM5 A;  4BEJ A;  1MMA A;  1T01 A;  2PP4 A;  1KNY A;  2R25 A;  3LNM B;  3MLG A;  5AC4 A;  2WZF A;  1Z6A A;  3C8G D;  5CIV A;  2DI3 A;  2YLG A;  3H65 A;  3HNI A;  2OQM A;  2LFD A;  4DXW A;  2LSE A;  4JC7 A;  5E2Q A;  4CJG A;  4MVM A;  1QKR A;  3JSZ A;  3TUL A;  3SXK A;  5IY5 C;  5D92 A;  2PX0 A;  3CAX A;  2QLA A;  2IYL D;  5COG A;  5DLJ A;  2C03 A;  3ZQV A;  1IZM A;  1E83 A;  4L6R A;  1H6G A;  3Q7L A;  2R02 A;  1WOL A;  4BJ5 C;  1ZW3 A;  2NPU A;  1FFH A;  2XLM A;  3US6 A;  4OIQ F;  3TD7 A;  3W4Y A;  5E33 A;  3MYF A;  3ABK C;  1C02 A;  1L7C A;  3ZTZ A;  2AU5 A;  2EPO A;  3IQT A;  4G78 A;  1V54 C;  3K1I C;  1UFB A;  2FFH A;  3C7J A;  5L0G A;  5CI8 A;  4IAR A;  2YLI A;  2MHR A;  3DJN B;  2KQ9 A;  3T4R A;  4X0R A;  1SR2 A;  5BQH A;  4IAQ A;  3U9M A;  1H7I A;  3U5S A;  2WVQ A;  1G4W R;  3PCV A;  5EGY A;  1EA8 A;  1HMD A;  3EH1 A;  4JW1 A;  1RJ9 A;  4MTO A;  1VOM A;  5A6K A;  2A6E F;  3QVZ A;  5CI9 A;  2JPU A;  1OR2 A;  2CW0 F;  1YZC A;  2HKV A;  3GM1 A;  4JEB A;  3JSE O;  2NSG A;  1T5O A;  1M6T A;  2VAS A;  2YRF A;  5B3S C;  5L0J A;  5KYX B;  5HSW A;  3EZI A;  2R7V A;  1LS1 A;  2Y3D A;  4Q4Z F;  2EIK C;  4E7S A;  4NQF A;  1BZ4 A;  3AGU A;  2VCB A;  3DE8 A;  2NUT A;  4EWC A;  4YT8 A;  2VC9 A;  3O6X A;  4I44 A;  2CGE A;  2NUP B;  4YT5 A;  2KGO A;  2D4U A;  2Y3B A;  4MTG A;  3AG1 C;  4PAC A;  256B A;  4BJ6 A;  4CJO A;  1O3U A;  5JUA A;  1Z23 A;  1WWP A;  2PBE A;  4JEA A;  1DOW A;  3LS1 A;  3ZSU A;  1EQ1 A;  1OXB A;  1FR0 A;  2Q4F A;  1ZW2 A;  3I4U A;  3R7C A;  1XWJ A;  3TK0 A;  1M57 C;  3GEI A;  1TWH A;  2GWW A;  1TWA A;  2HMZ A;  4H4K C;  4J32 B;  1HE9 A;  4AX2 A;  2C04 A;  3IEE A;  1OW7 A;  1YJG A;  3NKE A;  1UG7 A;  3SXM A;  3T6B A;  3VRC A;  3U0C A;  2VH3 A;  3I5P A;  2L9J A;  3A11 A;  1JAF A;  1R5I D;  3S90 A;  4XEV A;  4JTD B;  5JT4 A;  4CBE A;  2R7R A;  4Q5S F;  3SEO A;  3OEO A;  3LEO A;  2VB6 A;  1QZX A;  4BG0 A;  2F22 A;  3VF0 A;  1VK5 A;  2M4E A;  4MVR A;  2J9U A;  4YK5 A;  4EIY A;  3JTL O;  1EKY A;  3S27 A;  5DQZ A;  3AGT A;  3H2V A;  2O9X A;  2GDC A;  3TJ5 A;  3RQE A;  4W8P A;  5JRA A;  1NSG B;  3RIP A;  2MYS A;  3WG7 C;  4AL1 A;  2XLD A;  2XRH A;  3EFO B;  3GWL A;  3LNR A;  4LLC A;  3NRH A;  1GM5 A;  3RYL A;  2PNO A;  2YL1 A;  3AQB A;  3SYN A;  5DQT A;  2G3V A;  3DWW A;  5JSL A;  1FNT c;  2EIN C;  3K66 A;  2LD6 A;  2OCC C;  1TFK B;  2IBF A;  5BQG A;  2AWC A;  4KBL A;  5T3W A;  5DS5 A;  2YQY A;  1VLS A;  3MBG A;  2XLW A;  3RW0 A;  5A69 A;  3W2V A;  3EPV A;  3I5Q A;  1DOV A;  3G4Z A;  4IGG A;  4NTB A;  3EGX B;  2Q9B A;  2WZG A;  4EHP A;  2H8A A;  2J45 A;  2WZL A;  3X1O A;  2Y39 A;  1OCO C;  4MVU A;  2CYD A;  4BJ5 A;  3JYY A;  1ST6 A;  2H7O A;  2Q9A A;  3NKD A;  4KNV A;  3POV A;  2V3C C;  4DVY P;  4C7O B;  1MND A;  5DS6 A;  3FOP A;  3FXH A;  3K6B A;  3SZR A;  3K1I A;  1LKX A;  3HNJ A;  2H7B A;  1QQ3 A;  2X0C A;  2D5R B;  1D0X A;  1E84 A;  2R05 A;  3GM2 A;  4JJG A;  5BQI A;  1M2V B;  4EBJ A;  2BC5 A;  3KYI A;  4PJM A;  2OJE D;  1OR3 A; 
#chains in the Genus database with same CATH homology
 1TQG A;  1C03 A;  3US6 A;  2LCH A;  3KYJ A;  1I5N A;  3MYF A;  1C02 A;  4G78 A;  3IQT A;  1YVI A;  4PAC A;  4EUK B;  2R25 A;  1BDJ B;  1FR0 A;  1SR2 A;  1WN0 A;  1OXB A;  2Q4F A;  1Y6D A;  2OOC A;  2A0B A;  3U3B A;  2LP4 A;  1A0B A;  1QSP A;  3KYI A;  1OXK A;  2LD6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...