1WN1A

Crystal structure of dipeptiase from pyrococcus horikoshii ot3
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
356
structure length
356
Chain Sequence
b'MRLEKFIHLLGERGFDGALISPGTNLYYLTGLRLHEVGERLAILAVSAEGDYRFLAPSLYENVVNNFPATFWHDGENPYAKLREILEELGISKGRILIEDTMRADWLIGIMKLGKFTFQPLSSLIKELRMIKDKEEVKMMEHASRIADKVFEEILTWDLIGMKERELALKIELLIRELSDGIAFEPIVASGENAANPHHEPGERKIRKGDIIILDYGARWKGYCSDITRTIGLGELDERLVKIYEVVKDAQESAFKAVREGIKAKDVDSRAREVISKAGYGEYFIHRTGHGLGLDVHEEPYIGPDGEVILKNGMTFTIEPGIYVPGLGGVRIEDDIVVDEGKGRRLTKAERELIIL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords dipeptidase
publication title Crystal Structure of Dipeptiase from Pyrococcus Horikoshii OT3
rcsb
source organism Pyrococcus horikoshii
molecule tags Hydrolase
total genus 124
structure length 356
sequence length 356
chains with identical sequence B
ec nomenclature ec 3.4.-.-:
pdb deposition date 2004-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
A PF01321 Creatinase_N Creatinase/Prolidase N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 1wn1A01
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 1wn1A02
2B3KA 1YVMA 2EVCA 2BHAA 2GGCA 3MX6A 4S2TP 1QZYA 4FUKA 3CB6A 3PKCA 3IU9A 1QXZA 4HXXA 1W2MA 2NQ6A 1YW7A 2GGBA 2GG0A 2BWUA 1WKMA 2ZSGA 4EGEA 1M35A 4FO8A 1XGMA 3IU8A 4ZWPA 3PKBA 3IU7A 2Q8KA 5JFRA 2HOWA 1C22A 4FO7A 5D6FA 5CDLA 5JHUA 2NQ7A 4U6ZA 1YJ3A 4U75A 4RZZA 3O5VA 2IW2A 2BHCA 2EA2A 3L24A 2Q92A 4U6WA 5E2CA 3BIQA 4S01A 2ADUA 3Q6DA 5CDVA 2P98A 4IKUA 1O0XA 4FLLA 1R58A 4IECA 3I7MA 3TAVA 3IG4A 1PV9A 2V3XA 1YW9A 3RORA 4IKRA 1WN1A 3PEBA 3PN9A 4IKTA 3FM3A 1WL6A 2BHBA 1N51A 2BHDA 2Q96A 4IU6A 1KP0A 2GA2A 3D27A 4MATA 2Q94A 1B6AA 1WY2A 4OOKA 1C23A 4FLKA 2DFIA 4U6CA 4U6JA 5D6EA 4U6EA 2BWTA 5CDEA 2GU6A 3CTZA 2B3HA 2BB7A 3FMRA 2GG7A 1WLRA 1Y1NA 1R5HA 3FMQA 2B3LA 5FCHA 1YW8A 4KM3A 4ZNGA 1QXWA 2GU4A 2GU7A 5CLSA 4QR8A 2BWVA 2BWYA 3MATA 1CHMA 4IF7A 1C27A 1B59A 1BOAA 2GZ5A 3TB5A 4ZWOA 2OKNA 1W7VA 2GG5A 4ZWUA 5CNXA 1MATA 2Q95A 1WL9A 2GU5A 4R60A 3PKEA 3L7GA 4S2RP 4U69A 1XGOA 3OVKA 4U76A 2EVMA 3BITA 2MATA 4RZYA 2V3YA 1A16A 2BWSA 3IL0A 3OOOA 4A6VA 4IPAA 4IKSA 4FKCA 1C24A 1WBQA 3CB5A 2OAZA 2Q93A 4B28A 2BH3A 2GG8A 4U70A 2GG3A 3QOCA 2GTXA 3S6BA 1C21A 2G6PA 2GG9A 1JAWA 4A6WA 3BIPA 4PV4A 2V6CA 1XGNA 2BWXA 2BWWA 2P9AA 4FLIA 4JUQA 2EVOA 2BN7A 4PNCA 4IDYA 1QXYA 3RVAA 5CIKA 2EA4A 2P99A 3MR1A 4U1BA 4U71A 1XNZA 5CE6A 1BN5A 3PKDA 1KQ9A 4FLJA 2V3ZA 1XGSA 4U73A 4S00A 5E5BA 4RGZ1 5JI6A 1KQ0A 1R5GA 3PKAA 4Z7MA 2GG2A 5FCFA
chains in the Genus database with same CATH superfamily
2B3KA 1YVMA 2EVCA 2BHAA 2GGCA 3MX6A 4S2TP 1QZYA 4FUKA 3CB6A 3PKCA 3IU9A 1QXZA 4HXXA 1W2MA 2NQ6A 1YW7A 2GGBA 2GG0A 2BWUA 1WKMA 2ZSGA 4EGEA 1M35A 4FO8A 1XGMA 3IU8A 4ZWPA 3PKBA 3IU7A 2Q8KA 5JFRA 2HOWA 1C22A 4FO7A 5D6FA 5CDLA 5JHUA 2NQ7A 4U6ZA 1YJ3A 4U75A 4RZZA 3O5VA 2IW2A 2BHCA 2EA2A 3L24A 2Q92A 4U6WA 5E2CA 3BIQA 4S01A 2ADUA 3Q6DA 5CDVA 2P98A 4IKUA 1O0XA 4FLLA 1R58A 4IECA 3I7MA 3TAVA 3IG4A 1PV9A 2V3XA 1YW9A 3RORA 4IKRA 1WN1A 3PEBA 3PN9A 4IKTA 3FM3A 1WL6A 2BHBA 1N51A 2BHDA 2Q96A 4IU6A 1KP0A 2GA2A 3D27A 4MATA 2Q94A 1B6AA 1WY2A 4OOKA 1C23A 4FLKA 2DFIA 4U6CA 4U6JA 5D6EA 4U6EA 2BWTA 5CDEA 2GU6A 3CTZA 2B3HA 2BB7A 3FMRA 2GG7A 1WLRA 1Y1NA 1R5HA 3FMQA 2B3LA 5FCHA 1YW8A 4KM3A 4ZNGA 1QXWA 2GU4A 2GU7A 5CLSA 4QR8A 2BWVA 2BWYA 3MATA 1CHMA 4IF7A 1C27A 1B59A 1BOAA 2GZ5A 3TB5A 4ZWOA 2OKNA 1W7VA 2GG5A 4ZWUA 5CNXA 1MATA 2Q95A 1WL9A 2GU5A 4R60A 3PKEA 3L7GA 4S2RP 4U69A 1XGOA 3OVKA 4U76A 2EVMA 3BITA 2MATA 4RZYA 2V3YA 1A16A 2BWSA 3IL0A 3OOOA 4A6VA 4IPAA 4IKSA 4FKCA 1C24A 1WBQA 3CB5A 2OAZA 2Q93A 4B28A 2BH3A 2GG8A 4U70A 2GG3A 3QOCA 2GTXA 3S6BA 1C21A 2G6PA 2GG9A 1JAWA 4A6WA 3BIPA 4PV4A 2V6CA 1XGNA 2BWXA 2BWWA 2P9AA 4FLIA 4JUQA 2EVOA 2BN7A 4PNCA 4IDYA 1QXYA 3RVAA 5CIKA 2EA4A 2P99A 3MR1A 4U1BA 4U71A 1XNZA 5CE6A 1BN5A 3PKDA 1KQ9A 4FLJA 2V3ZA 1XGSA 4U73A 4S00A 5E5BA 4RGZ1 5JI6A 1KQ0A 1R5GA 3PKAA 4Z7MA 2GG2A 5FCFA
chains in the Genus database with same CATH topology
2B3KA 1YVMA 2EVCA 2BHAA 2GGCA 3MX6A 4S2TP 1QZYA 4FUKA 3CB6A 3PKCA 3IU9A 1QXZA 4HXXA 1W2MA 2NQ6A 1YW7A 2GGBA 2GG0A 2BWUA 1WKMA 2ZSGA 4EGEA 1M35A 4FO8A 1XGMA 3IU8A 4ZWPA 3PKBA 3IU7A 2Q8KA 5JFRA 2HOWA 1C22A 4FO7A 5D6FA 5CDLA 5JHUA 2NQ7A 4U6ZA 1YJ3A 4U75A 4RZZA 3O5VA 2IW2A 2BHCA 2EA2A 3L24A 2Q92A 4U6WA 5E2CA 3BIQA 4S01A 2ADUA 3Q6DA 5CDVA 2P98A 4IKUA 1O0XA 4FLLA 1R58A 4IECA 3I7MA 3TAVA 3IG4A 1PV9A 2V3XA 1YW9A 3RORA 4IKRA 1WN1A 3PEBA 3PN9A 4IKTA 3FM3A 1WL6A 2BHBA 1N51A 2BHDA 2Q96A 4IU6A 1KP0A 2GA2A 3D27A 4MATA 2Q94A 1B6AA 1WY2A 4OOKA 1C23A 4FLKA 2DFIA 4U6CA 4U6JA 5D6EA 4U6EA 2BWTA 5CDEA 2GU6A 3CTZA 2B3HA 2BB7A 3FMRA 2GG7A 1WLRA 1Y1NA 1R5HA 3FMQA 2B3LA 5FCHA 1YW8A 4KM3A 4ZNGA 1QXWA 2GU4A 2GU7A 5CLSA 4QR8A 2BWVA 2BWYA 3MATA 1CHMA 4IF7A 1C27A 1B59A 1BOAA 2GZ5A 3TB5A 4ZWOA 2OKNA 1W7VA 2GG5A 4ZWUA 5CNXA 1MATA 2Q95A 1WL9A 2GU5A 4R60A 3PKEA 3L7GA 4S2RP 4U69A 1XGOA 3OVKA 4U76A 2EVMA 3BITA 2MATA 4RZYA 2V3YA 1A16A 2BWSA 3IL0A 3OOOA 4A6VA 4IPAA 4IKSA 4FKCA 1C24A 1WBQA 3CB5A 2OAZA 2Q93A 4B28A 2BH3A 2GG8A 4U70A 2GG3A 3QOCA 2GTXA 3S6BA 1C21A 2G6PA 2GG9A 1JAWA 4A6WA 3BIPA 4PV4A 2V6CA 1XGNA 2BWXA 2BWWA 2P9AA 4FLIA 4JUQA 2EVOA 2BN7A 4PNCA 4IDYA 1QXYA 3RVAA 5CIKA 2EA4A 2P99A 3MR1A 4U1BA 4U71A 1XNZA 5CE6A 1BN5A 3PKDA 1KQ9A 4FLJA 2V3ZA 1XGSA 4U73A 4S00A 5E5BA 4RGZ1 5JI6A 1KQ0A 1R5GA 3PKAA 4Z7MA 2GG2A 5FCFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B3K A;  1YVM A;  2EVC A;  2BHA A;  2GGC A;  3MX6 A;  4S2T P;  1QZY A;  4FUK A;  3CB6 A;  3PKC A;  3IU9 A;  1QXZ A;  4HXX A;  1W2M A;  2NQ6 A;  1YW7 A;  2GGB A;  2GG0 A;  2BWU A;  1WKM A;  2ZSG A;  4EGE A;  1M35 A;  4FO8 A;  1XGM A;  3IU8 A;  4ZWP A;  3PKB A;  3IU7 A;  2Q8K A;  5JFR A;  2HOW A;  1C22 A;  4FO7 A;  5D6F A;  5CDL A;  5JHU A;  2NQ7 A;  4U6Z A;  1YJ3 A;  4U75 A;  4RZZ A;  3O5V A;  2IW2 A;  2BHC A;  2EA2 A;  3L24 A;  2Q92 A;  4U6W A;  5E2C A;  3BIQ A;  4S01 A;  2ADU A;  3Q6D A;  5CDV A;  2P98 A;  4IKU A;  1O0X A;  4FLL A;  1R58 A;  4IEC A;  3I7M A;  3TAV A;  3IG4 A;  1PV9 A;  2V3X A;  1YW9 A;  3ROR A;  4IKR A;  1WN1 A;  3PEB A;  3PN9 A;  4IKT A;  3FM3 A;  1WL6 A;  2BHB A;  1N51 A;  2BHD A;  2Q96 A;  4IU6 A;  1KP0 A;  2GA2 A;  3D27 A;  4MAT A;  2Q94 A;  1B6A A;  1WY2 A;  4OOK A;  1C23 A;  4FLK A;  2DFI A;  4U6C A;  4U6J A;  5D6E A;  4U6E A;  2BWT A;  5CDE A;  2GU6 A;  3CTZ A;  2B3H A;  2BB7 A;  3FMR A;  2GG7 A;  1WLR A;  1Y1N A;  1R5H A;  3FMQ A;  2B3L A;  5FCH A;  1YW8 A;  4KM3 A;  4ZNG A;  1QXW A;  2GU4 A;  2GU7 A;  5CLS A;  4QR8 A;  2BWV A;  2BWY A;  3MAT A;  1CHM A;  4IF7 A;  1C27 A;  1B59 A;  1BOA A;  2GZ5 A;  3TB5 A;  4ZWO A;  2OKN A;  1W7V A;  2GG5 A;  4ZWU A;  5CNX A;  1MAT A;  2Q95 A;  1WL9 A;  2GU5 A;  4R60 A;  3PKE A;  3L7G A;  4S2R P;  4U69 A;  1XGO A;  3OVK A;  4U76 A;  2EVM A;  3BIT A;  2MAT A;  4RZY A;  2V3Y A;  1A16 A;  2BWS A;  3IL0 A;  3OOO A;  4A6V A;  4IPA A;  4IKS A;  4FKC A;  1C24 A;  1WBQ A;  3CB5 A;  2OAZ A;  2Q93 A;  4B28 A;  2BH3 A;  2GG8 A;  4U70 A;  2GG3 A;  3QOC A;  2GTX A;  3S6B A;  1C21 A;  2G6P A;  2GG9 A;  1JAW A;  4A6W A;  3BIP A;  4PV4 A;  2V6C A;  1XGN A;  2BWX A;  2BWW A;  2P9A A;  4FLI A;  4JUQ A;  2EVO A;  2BN7 A;  4PNC A;  4IDY A;  1QXY A;  3RVA A;  5CIK A;  2EA4 A;  2P99 A;  3MR1 A;  4U1B A;  4U71 A;  1XNZ A;  5CE6 A;  1BN5 A;  3PKD A;  1KQ9 A;  4FLJ A;  2V3Z A;  1XGS A;  4U73 A;  4S00 A;  5E5B A;  4RGZ 1;  5JI6 A;  1KQ0 A;  1R5G A;  3PKA A;  4Z7M A;  2GG2 A;  5FCF A; 
#chains in the Genus database with same CATH topology
 2B3K A;  1YVM A;  2EVC A;  2BHA A;  2GGC A;  3MX6 A;  4S2T P;  1QZY A;  4FUK A;  3CB6 A;  3PKC A;  3IU9 A;  1QXZ A;  4HXX A;  1W2M A;  2NQ6 A;  1YW7 A;  2GGB A;  2GG0 A;  2BWU A;  1WKM A;  2ZSG A;  4EGE A;  1M35 A;  4FO8 A;  1XGM A;  3IU8 A;  4ZWP A;  3PKB A;  3IU7 A;  2Q8K A;  5JFR A;  2HOW A;  1C22 A;  4FO7 A;  5D6F A;  5CDL A;  5JHU A;  2NQ7 A;  4U6Z A;  1YJ3 A;  4U75 A;  4RZZ A;  3O5V A;  2IW2 A;  2BHC A;  2EA2 A;  3L24 A;  2Q92 A;  4U6W A;  5E2C A;  3BIQ A;  4S01 A;  2ADU A;  3Q6D A;  5CDV A;  2P98 A;  4IKU A;  1O0X A;  4FLL A;  1R58 A;  4IEC A;  3I7M A;  3TAV A;  3IG4 A;  1PV9 A;  2V3X A;  1YW9 A;  3ROR A;  4IKR A;  1WN1 A;  3PEB A;  3PN9 A;  4IKT A;  3FM3 A;  1WL6 A;  2BHB A;  1N51 A;  2BHD A;  2Q96 A;  4IU6 A;  1KP0 A;  2GA2 A;  3D27 A;  4MAT A;  2Q94 A;  1B6A A;  1WY2 A;  4OOK A;  1C23 A;  4FLK A;  2DFI A;  4U6C A;  4U6J A;  5D6E A;  4U6E A;  2BWT A;  5CDE A;  2GU6 A;  3CTZ A;  2B3H A;  2BB7 A;  3FMR A;  2GG7 A;  1WLR A;  1Y1N A;  1R5H A;  3FMQ A;  2B3L A;  5FCH A;  1YW8 A;  4KM3 A;  4ZNG A;  1QXW A;  2GU4 A;  2GU7 A;  5CLS A;  4QR8 A;  2BWV A;  2BWY A;  3MAT A;  1CHM A;  4IF7 A;  1C27 A;  1B59 A;  1BOA A;  2GZ5 A;  3TB5 A;  4ZWO A;  2OKN A;  1W7V A;  2GG5 A;  4ZWU A;  5CNX A;  1MAT A;  2Q95 A;  1WL9 A;  2GU5 A;  4R60 A;  3PKE A;  3L7G A;  4S2R P;  4U69 A;  1XGO A;  3OVK A;  4U76 A;  2EVM A;  3BIT A;  2MAT A;  4RZY A;  2V3Y A;  1A16 A;  2BWS A;  3IL0 A;  3OOO A;  4A6V A;  4IPA A;  4IKS A;  4FKC A;  1C24 A;  1WBQ A;  3CB5 A;  2OAZ A;  2Q93 A;  4B28 A;  2BH3 A;  2GG8 A;  4U70 A;  2GG3 A;  3QOC A;  2GTX A;  3S6B A;  1C21 A;  2G6P A;  2GG9 A;  1JAW A;  4A6W A;  3BIP A;  4PV4 A;  2V6C A;  1XGN A;  2BWX A;  2BWW A;  2P9A A;  4FLI A;  4JUQ A;  2EVO A;  2BN7 A;  4PNC A;  4IDY A;  1QXY A;  3RVA A;  5CIK A;  2EA4 A;  2P99 A;  3MR1 A;  4U1B A;  4U71 A;  1XNZ A;  5CE6 A;  1BN5 A;  3PKD A;  1KQ9 A;  4FLJ A;  2V3Z A;  1XGS A;  4U73 A;  4S00 A;  5E5B A;  4RGZ 1;  5JI6 A;  1KQ0 A;  1R5G A;  3PKA A;  4Z7M A;  2GG2 A;  5FCF A; 
#chains in the Genus database with same CATH homology
 2B3K A;  1YVM A;  2EVC A;  2BHA A;  2GGC A;  3MX6 A;  4S2T P;  1QZY A;  4FUK A;  3CB6 A;  3PKC A;  3IU9 A;  1QXZ A;  4HXX A;  1W2M A;  2NQ6 A;  1YW7 A;  2GGB A;  2GG0 A;  2BWU A;  1WKM A;  2ZSG A;  4EGE A;  1M35 A;  4FO8 A;  1XGM A;  3IU8 A;  4ZWP A;  3PKB A;  3IU7 A;  2Q8K A;  5JFR A;  2HOW A;  1C22 A;  4FO7 A;  5D6F A;  5CDL A;  5JHU A;  2NQ7 A;  4U6Z A;  1YJ3 A;  4U75 A;  4RZZ A;  3O5V A;  2IW2 A;  2BHC A;  2EA2 A;  3L24 A;  2Q92 A;  4U6W A;  5E2C A;  3BIQ A;  4S01 A;  2ADU A;  3Q6D A;  5CDV A;  2P98 A;  4IKU A;  1O0X A;  4FLL A;  1R58 A;  4IEC A;  3I7M A;  3TAV A;  3IG4 A;  1PV9 A;  2V3X A;  1YW9 A;  3ROR A;  4IKR A;  1WN1 A;  3PEB A;  3PN9 A;  4IKT A;  3FM3 A;  1WL6 A;  2BHB A;  1N51 A;  2BHD A;  2Q96 A;  4IU6 A;  1KP0 A;  2GA2 A;  3D27 A;  4MAT A;  2Q94 A;  1B6A A;  1WY2 A;  4OOK A;  1C23 A;  4FLK A;  2DFI A;  4U6C A;  4U6J A;  5D6E A;  4U6E A;  2BWT A;  5CDE A;  2GU6 A;  3CTZ A;  2B3H A;  2BB7 A;  3FMR A;  2GG7 A;  1WLR A;  1Y1N A;  1R5H A;  3FMQ A;  2B3L A;  5FCH A;  1YW8 A;  4KM3 A;  4ZNG A;  1QXW A;  2GU4 A;  2GU7 A;  5CLS A;  4QR8 A;  2BWV A;  2BWY A;  3MAT A;  1CHM A;  4IF7 A;  1C27 A;  1B59 A;  1BOA A;  2GZ5 A;  3TB5 A;  4ZWO A;  2OKN A;  1W7V A;  2GG5 A;  4ZWU A;  5CNX A;  1MAT A;  2Q95 A;  1WL9 A;  2GU5 A;  4R60 A;  3PKE A;  3L7G A;  4S2R P;  4U69 A;  1XGO A;  3OVK A;  4U76 A;  2EVM A;  3BIT A;  2MAT A;  4RZY A;  2V3Y A;  1A16 A;  2BWS A;  3IL0 A;  3OOO A;  4A6V A;  4IPA A;  4IKS A;  4FKC A;  1C24 A;  1WBQ A;  3CB5 A;  2OAZ A;  2Q93 A;  4B28 A;  2BH3 A;  2GG8 A;  4U70 A;  2GG3 A;  3QOC A;  2GTX A;  3S6B A;  1C21 A;  2G6P A;  2GG9 A;  1JAW A;  4A6W A;  3BIP A;  4PV4 A;  2V6C A;  1XGN A;  2BWX A;  2BWW A;  2P9A A;  4FLI A;  4JUQ A;  2EVO A;  2BN7 A;  4PNC A;  4IDY A;  1QXY A;  3RVA A;  5CIK A;  2EA4 A;  2P99 A;  3MR1 A;  4U1B A;  4U71 A;  1XNZ A;  5CE6 A;  1BN5 A;  3PKD A;  1KQ9 A;  4FLJ A;  2V3Z A;  1XGS A;  4U73 A;  4S00 A;  5E5B A;  4RGZ 1;  5JI6 A;  1KQ0 A;  1R5G A;  3PKA A;  4Z7M A;  2GG2 A;  5FCF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...