1WN1A

Crystal structure of dipeptiase from pyrococcus horikoshii ot3
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
356
structure length
356
Chain Sequence
MRLEKFIHLLGERGFDGALISPGTNLYYLTGLRLHEVGERLAILAVSAEGDYRFLAPSLYENVVNNFPATFWHDGENPYAKLREILEELGISKGRILIEDTMRADWLIGIMKLGKFTFQPLSSLIKELRMIKDKEEVKMMEHASRIADKVFEEILTWDLIGMKERELALKIELLIRELSDGIAFEPIVASGENAANPHHEPGERKIRKGDIIILDYGARWKGYCSDITRTIGLGELDERLVKIYEVVKDAQESAFKAVREGIKAKDVDSRAREVISKAGYGEYFIHRTGHGLGLDVHEEPYIGPDGEVILKNGMTFTIEPGIYVPGLGGVRIEDDIVVDEGKGRRLTKAERELIIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords dipeptidase
publication title Crystal Structure of Dipeptiase from Pyrococcus Horikoshii OT3
rcsb
source organism Pyrococcus horikoshii
molecule tags Hydrolase
total genus 124
structure length 356
sequence length 356
chains with identical sequence B
ec nomenclature ec 3.4.-.-:
pdb deposition date 2004-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
A PF01321 Creatinase_N Creatinase/Prolidase N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 1wn1A01
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 1wn1A02
5D6FA 5E2CA 1W7VA 2NQ7A 3PKBA 4U1BA 1WY2A 4EGEA 1PV9A 3BIQA 2V6CA 2V3XA 2GG2A 1KQ0A 3FMRA 4HXXA 3IU8A 4U71A 1C24A 2BN7A 1YW9A 4B28A 1Y1NA 2GZ5A 4FUKA 1XNZA 4R60A 2P98A 2BH3A 4FKCA 1C21A 3CTZA 2P9AA 3PKDA 2GGBA 3MATA 2HOWA 5CE6A 4U6JA 4U6ZA 3BITA 2GU5A 3IG4A 4PNCA 3PKCA 4RGZ1 3IL0A 4IECA 4A6WA 2B3HA 4IF7A 5CDVA 1XGMA 5E5BA 1MATA 2G6PA 4IPAA 4FLJA 4U73A 4S2TP 1KQ9A 1M35A 4S2RP 2NQ6A 5D6EA 1R58A 1XGSA 1C22A 1N51A 3PN9A 2EA2A 1YJ3A 3IU7A 4U6EA 1WLRA 3Q6DA 3BIPA 2GG9A 3S6BA 1JAWA 2BWSA 1QZYA 4FO8A 2BWUA 5JHUA 2EVMA 2GA2A 4KM3A 4ZWOA 3FM3A 1R5HA 2V3YA 1YW8A 3CB5A 5CLSA 1XGNA 2DFIA 2GG8A 4IKUA 4IKTA 2BWXA 2Q92A 5CIKA 1YW7A 3L7GA 5FCHA 2Q95A 4ZWUA 3PEBA 2GG7A 2GTXA 2BWYA 2MATA 2Q94A 3O5VA 2GU6A 2GG0A 2Q96A 2BWVA 4IDYA 3MX6A 2BB7A 4U6WA 3QOCA 3RVAA 2BHAA 3OVKA 4RZYA 4ZWPA 5CDEA 1YVMA 4FLLA 4OOKA 4JUQA 4U69A 2B3LA 3MR1A 2V3ZA 4FO7A 2ADUA 4FLKA 2EVOA 4S00A 1QXWA 2GU4A 2P99A 5FCFA 1WKMA 1WL9A 4U76A 3TAVA 1BN5A 2GGCA 1B6AA 2OKNA 1XGOA 4U70A 2BWTA 3CB6A 4S01A 4ZNGA 4MATA 2BHDA 4Z7MA 1QXZA 2GG5A 1WN1A 4A6VA 3D27A 4RZZA 3FMQA 2GU7A 2Q8KA 3RORA 4IKRA 1A16A 1WL6A 2IW2A 1R5GA 2ZSGA 5CNXA 1BOAA 2GG3A 3PKAA 3L24A 2EA4A 1CHMA 4FLIA 3IU9A 1C23A 2B3KA 4QR8A 1O0XA 5JI6A 4IU6A 1W2MA 5CDLA 2Q93A 2BWWA 1B59A 3OOOA 1QXYA 5JFRA 2BHCA 3I7MA 1WBQA 1KP0A 2BHBA 4PV4A 2OAZA 4U75A 4IKSA 4U6CA 2EVCA 3PKEA 3TB5A 1C27A
chains in the Genus database with same CATH superfamily
5D6FA 5E2CA 1W7VA 2NQ7A 3PKBA 4U1BA 1WY2A 4EGEA 1PV9A 3BIQA 2V6CA 2V3XA 2GG2A 1KQ0A 3FMRA 4HXXA 3IU8A 4U71A 1C24A 2BN7A 1YW9A 4B28A 1Y1NA 2GZ5A 4FUKA 1XNZA 4R60A 2P98A 2BH3A 4FKCA 1C21A 3CTZA 2P9AA 3PKDA 2GGBA 3MATA 2HOWA 5CE6A 4U6JA 4U6ZA 3BITA 2GU5A 3IG4A 4PNCA 3PKCA 4RGZ1 3IL0A 4IECA 4A6WA 2B3HA 4IF7A 5CDVA 1XGMA 5E5BA 1MATA 2G6PA 4IPAA 4FLJA 4U73A 4S2TP 1KQ9A 1M35A 4S2RP 2NQ6A 5D6EA 1R58A 1XGSA 1C22A 1N51A 3PN9A 2EA2A 1YJ3A 3IU7A 4U6EA 1WLRA 3Q6DA 3BIPA 2GG9A 3S6BA 1JAWA 2BWSA 1QZYA 4FO8A 2BWUA 5JHUA 2EVMA 2GA2A 4KM3A 4ZWOA 3FM3A 1R5HA 2V3YA 1YW8A 3CB5A 5CLSA 1XGNA 2DFIA 2GG8A 4IKUA 4IKTA 2BWXA 2Q92A 5CIKA 1YW7A 3L7GA 5FCHA 2Q95A 4ZWUA 3PEBA 2GG7A 2GTXA 2BWYA 2MATA 2Q94A 3O5VA 2GU6A 2GG0A 2Q96A 2BWVA 4IDYA 3MX6A 2BB7A 4U6WA 3QOCA 3RVAA 2BHAA 3OVKA 4RZYA 4ZWPA 5CDEA 1YVMA 4FLLA 4OOKA 4JUQA 4U69A 2B3LA 3MR1A 2V3ZA 4FO7A 2ADUA 4FLKA 2EVOA 4S00A 1QXWA 2GU4A 2P99A 5FCFA 1WKMA 1WL9A 4U76A 3TAVA 1BN5A 2GGCA 1B6AA 2OKNA 1XGOA 4U70A 2BWTA 3CB6A 4S01A 4ZNGA 4MATA 2BHDA 4Z7MA 1QXZA 2GG5A 1WN1A 4A6VA 3D27A 4RZZA 3FMQA 2GU7A 2Q8KA 3RORA 4IKRA 1A16A 1WL6A 2IW2A 1R5GA 2ZSGA 5CNXA 1BOAA 2GG3A 3PKAA 3L24A 2EA4A 1CHMA 4FLIA 3IU9A 1C23A 2B3KA 4QR8A 1O0XA 5JI6A 4IU6A 1W2MA 5CDLA 2Q93A 2BWWA 1B59A 3OOOA 1QXYA 5JFRA 2BHCA 3I7MA 1WBQA 1KP0A 2BHBA 4PV4A 2OAZA 4U75A 4IKSA 4U6CA 2EVCA 3PKEA 3TB5A 1C27A
chains in the Genus database with same CATH topology
5D6FA 5E2CA 1W7VA 2NQ7A 3PKBA 4U1BA 1WY2A 4EGEA 1PV9A 3BIQA 2V6CA 2V3XA 2GG2A 1KQ0A 3FMRA 4HXXA 3IU8A 4U71A 1C24A 2BN7A 1YW9A 4B28A 1Y1NA 2GZ5A 4FUKA 1XNZA 4R60A 2P98A 2BH3A 4FKCA 1C21A 3CTZA 2P9AA 3PKDA 2GGBA 3MATA 2HOWA 5CE6A 4U6JA 4U6ZA 3BITA 2GU5A 3IG4A 4PNCA 3PKCA 4RGZ1 3IL0A 4IECA 4A6WA 2B3HA 4IF7A 5CDVA 1XGMA 5E5BA 1MATA 2G6PA 4IPAA 4FLJA 4U73A 4S2TP 1KQ9A 1M35A 4S2RP 2NQ6A 5D6EA 1R58A 1XGSA 1C22A 1N51A 3PN9A 2EA2A 1YJ3A 3IU7A 4U6EA 1WLRA 3Q6DA 3BIPA 2GG9A 3S6BA 1JAWA 2BWSA 1QZYA 4FO8A 2BWUA 5JHUA 2EVMA 2GA2A 4KM3A 4ZWOA 3FM3A 1R5HA 2V3YA 1YW8A 3CB5A 5CLSA 1XGNA 2DFIA 2GG8A 4IKUA 4IKTA 2BWXA 2Q92A 5CIKA 1YW7A 3L7GA 5FCHA 2Q95A 4ZWUA 3PEBA 2GG7A 2GTXA 2BWYA 2MATA 2Q94A 3O5VA 2GU6A 2GG0A 2Q96A 2BWVA 4IDYA 3MX6A 2BB7A 4U6WA 3QOCA 3RVAA 2BHAA 3OVKA 4RZYA 4ZWPA 5CDEA 1YVMA 4FLLA 4OOKA 4JUQA 4U69A 2B3LA 3MR1A 2V3ZA 4FO7A 2ADUA 4FLKA 2EVOA 4S00A 1QXWA 2GU4A 2P99A 5FCFA 1WKMA 1WL9A 4U76A 3TAVA 1BN5A 2GGCA 1B6AA 2OKNA 1XGOA 4U70A 2BWTA 3CB6A 4S01A 4ZNGA 4MATA 2BHDA 4Z7MA 1QXZA 2GG5A 1WN1A 4A6VA 3D27A 4RZZA 3FMQA 2GU7A 2Q8KA 3RORA 4IKRA 1A16A 1WL6A 2IW2A 1R5GA 2ZSGA 5CNXA 1BOAA 2GG3A 3PKAA 3L24A 2EA4A 1CHMA 4FLIA 3IU9A 1C23A 2B3KA 4QR8A 1O0XA 5JI6A 4IU6A 1W2MA 5CDLA 2Q93A 2BWWA 1B59A 3OOOA 1QXYA 5JFRA 2BHCA 3I7MA 1WBQA 1KP0A 2BHBA 4PV4A 2OAZA 4U75A 4IKSA 4U6CA 2EVCA 3PKEA 3TB5A 1C27A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5D6F A;  5E2C A;  1W7V A;  2NQ7 A;  3PKB A;  4U1B A;  1WY2 A;  4EGE A;  1PV9 A;  3BIQ A;  2V6C A;  2V3X A;  2GG2 A;  1KQ0 A;  3FMR A;  4HXX A;  3IU8 A;  4U71 A;  1C24 A;  2BN7 A;  1YW9 A;  4B28 A;  1Y1N A;  2GZ5 A;  4FUK A;  1XNZ A;  4R60 A;  2P98 A;  2BH3 A;  4FKC A;  1C21 A;  3CTZ A;  2P9A A;  3PKD A;  2GGB A;  3MAT A;  2HOW A;  5CE6 A;  4U6J A;  4U6Z A;  3BIT A;  2GU5 A;  3IG4 A;  4PNC A;  3PKC A;  4RGZ 1;  3IL0 A;  4IEC A;  4A6W A;  2B3H A;  4IF7 A;  5CDV A;  1XGM A;  5E5B A;  1MAT A;  2G6P A;  4IPA A;  4FLJ A;  4U73 A;  4S2T P;  1KQ9 A;  1M35 A;  4S2R P;  2NQ6 A;  5D6E A;  1R58 A;  1XGS A;  1C22 A;  1N51 A;  3PN9 A;  2EA2 A;  1YJ3 A;  3IU7 A;  4U6E A;  1WLR A;  3Q6D A;  3BIP A;  2GG9 A;  3S6B A;  1JAW A;  2BWS A;  1QZY A;  4FO8 A;  2BWU A;  5JHU A;  2EVM A;  2GA2 A;  4KM3 A;  4ZWO A;  3FM3 A;  1R5H A;  2V3Y A;  1YW8 A;  3CB5 A;  5CLS A;  1XGN A;  2DFI A;  2GG8 A;  4IKU A;  4IKT A;  2BWX A;  2Q92 A;  5CIK A;  1YW7 A;  3L7G A;  5FCH A;  2Q95 A;  4ZWU A;  3PEB A;  2GG7 A;  2GTX A;  2BWY A;  2MAT A;  2Q94 A;  3O5V A;  2GU6 A;  2GG0 A;  2Q96 A;  2BWV A;  4IDY A;  3MX6 A;  2BB7 A;  4U6W A;  3QOC A;  3RVA A;  2BHA A;  3OVK A;  4RZY A;  4ZWP A;  5CDE A;  1YVM A;  4FLL A;  4OOK A;  4JUQ A;  4U69 A;  2B3L A;  3MR1 A;  2V3Z A;  4FO7 A;  2ADU A;  4FLK A;  2EVO A;  4S00 A;  1QXW A;  2GU4 A;  2P99 A;  5FCF A;  1WKM A;  1WL9 A;  4U76 A;  3TAV A;  1BN5 A;  2GGC A;  1B6A A;  2OKN A;  1XGO A;  4U70 A;  2BWT A;  3CB6 A;  4S01 A;  4ZNG A;  4MAT A;  2BHD A;  4Z7M A;  1QXZ A;  2GG5 A;  1WN1 A;  4A6V A;  3D27 A;  4RZZ A;  3FMQ A;  2GU7 A;  2Q8K A;  3ROR A;  4IKR A;  1A16 A;  1WL6 A;  2IW2 A;  1R5G A;  2ZSG A;  5CNX A;  1BOA A;  2GG3 A;  3PKA A;  3L24 A;  2EA4 A;  1CHM A;  4FLI A;  3IU9 A;  1C23 A;  2B3K A;  4QR8 A;  1O0X A;  5JI6 A;  4IU6 A;  1W2M A;  5CDL A;  2Q93 A;  2BWW A;  1B59 A;  3OOO A;  1QXY A;  5JFR A;  2BHC A;  3I7M A;  1WBQ A;  1KP0 A;  2BHB A;  4PV4 A;  2OAZ A;  4U75 A;  4IKS A;  4U6C A;  2EVC A;  3PKE A;  3TB5 A;  1C27 A; 
#chains in the Genus database with same CATH topology
 5D6F A;  5E2C A;  1W7V A;  2NQ7 A;  3PKB A;  4U1B A;  1WY2 A;  4EGE A;  1PV9 A;  3BIQ A;  2V6C A;  2V3X A;  2GG2 A;  1KQ0 A;  3FMR A;  4HXX A;  3IU8 A;  4U71 A;  1C24 A;  2BN7 A;  1YW9 A;  4B28 A;  1Y1N A;  2GZ5 A;  4FUK A;  1XNZ A;  4R60 A;  2P98 A;  2BH3 A;  4FKC A;  1C21 A;  3CTZ A;  2P9A A;  3PKD A;  2GGB A;  3MAT A;  2HOW A;  5CE6 A;  4U6J A;  4U6Z A;  3BIT A;  2GU5 A;  3IG4 A;  4PNC A;  3PKC A;  4RGZ 1;  3IL0 A;  4IEC A;  4A6W A;  2B3H A;  4IF7 A;  5CDV A;  1XGM A;  5E5B A;  1MAT A;  2G6P A;  4IPA A;  4FLJ A;  4U73 A;  4S2T P;  1KQ9 A;  1M35 A;  4S2R P;  2NQ6 A;  5D6E A;  1R58 A;  1XGS A;  1C22 A;  1N51 A;  3PN9 A;  2EA2 A;  1YJ3 A;  3IU7 A;  4U6E A;  1WLR A;  3Q6D A;  3BIP A;  2GG9 A;  3S6B A;  1JAW A;  2BWS A;  1QZY A;  4FO8 A;  2BWU A;  5JHU A;  2EVM A;  2GA2 A;  4KM3 A;  4ZWO A;  3FM3 A;  1R5H A;  2V3Y A;  1YW8 A;  3CB5 A;  5CLS A;  1XGN A;  2DFI A;  2GG8 A;  4IKU A;  4IKT A;  2BWX A;  2Q92 A;  5CIK A;  1YW7 A;  3L7G A;  5FCH A;  2Q95 A;  4ZWU A;  3PEB A;  2GG7 A;  2GTX A;  2BWY A;  2MAT A;  2Q94 A;  3O5V A;  2GU6 A;  2GG0 A;  2Q96 A;  2BWV A;  4IDY A;  3MX6 A;  2BB7 A;  4U6W A;  3QOC A;  3RVA A;  2BHA A;  3OVK A;  4RZY A;  4ZWP A;  5CDE A;  1YVM A;  4FLL A;  4OOK A;  4JUQ A;  4U69 A;  2B3L A;  3MR1 A;  2V3Z A;  4FO7 A;  2ADU A;  4FLK A;  2EVO A;  4S00 A;  1QXW A;  2GU4 A;  2P99 A;  5FCF A;  1WKM A;  1WL9 A;  4U76 A;  3TAV A;  1BN5 A;  2GGC A;  1B6A A;  2OKN A;  1XGO A;  4U70 A;  2BWT A;  3CB6 A;  4S01 A;  4ZNG A;  4MAT A;  2BHD A;  4Z7M A;  1QXZ A;  2GG5 A;  1WN1 A;  4A6V A;  3D27 A;  4RZZ A;  3FMQ A;  2GU7 A;  2Q8K A;  3ROR A;  4IKR A;  1A16 A;  1WL6 A;  2IW2 A;  1R5G A;  2ZSG A;  5CNX A;  1BOA A;  2GG3 A;  3PKA A;  3L24 A;  2EA4 A;  1CHM A;  4FLI A;  3IU9 A;  1C23 A;  2B3K A;  4QR8 A;  1O0X A;  5JI6 A;  4IU6 A;  1W2M A;  5CDL A;  2Q93 A;  2BWW A;  1B59 A;  3OOO A;  1QXY A;  5JFR A;  2BHC A;  3I7M A;  1WBQ A;  1KP0 A;  2BHB A;  4PV4 A;  2OAZ A;  4U75 A;  4IKS A;  4U6C A;  2EVC A;  3PKE A;  3TB5 A;  1C27 A; 
#chains in the Genus database with same CATH homology
 5D6F A;  5E2C A;  1W7V A;  2NQ7 A;  3PKB A;  4U1B A;  1WY2 A;  4EGE A;  1PV9 A;  3BIQ A;  2V6C A;  2V3X A;  2GG2 A;  1KQ0 A;  3FMR A;  4HXX A;  3IU8 A;  4U71 A;  1C24 A;  2BN7 A;  1YW9 A;  4B28 A;  1Y1N A;  2GZ5 A;  4FUK A;  1XNZ A;  4R60 A;  2P98 A;  2BH3 A;  4FKC A;  1C21 A;  3CTZ A;  2P9A A;  3PKD A;  2GGB A;  3MAT A;  2HOW A;  5CE6 A;  4U6J A;  4U6Z A;  3BIT A;  2GU5 A;  3IG4 A;  4PNC A;  3PKC A;  4RGZ 1;  3IL0 A;  4IEC A;  4A6W A;  2B3H A;  4IF7 A;  5CDV A;  1XGM A;  5E5B A;  1MAT A;  2G6P A;  4IPA A;  4FLJ A;  4U73 A;  4S2T P;  1KQ9 A;  1M35 A;  4S2R P;  2NQ6 A;  5D6E A;  1R58 A;  1XGS A;  1C22 A;  1N51 A;  3PN9 A;  2EA2 A;  1YJ3 A;  3IU7 A;  4U6E A;  1WLR A;  3Q6D A;  3BIP A;  2GG9 A;  3S6B A;  1JAW A;  2BWS A;  1QZY A;  4FO8 A;  2BWU A;  5JHU A;  2EVM A;  2GA2 A;  4KM3 A;  4ZWO A;  3FM3 A;  1R5H A;  2V3Y A;  1YW8 A;  3CB5 A;  5CLS A;  1XGN A;  2DFI A;  2GG8 A;  4IKU A;  4IKT A;  2BWX A;  2Q92 A;  5CIK A;  1YW7 A;  3L7G A;  5FCH A;  2Q95 A;  4ZWU A;  3PEB A;  2GG7 A;  2GTX A;  2BWY A;  2MAT A;  2Q94 A;  3O5V A;  2GU6 A;  2GG0 A;  2Q96 A;  2BWV A;  4IDY A;  3MX6 A;  2BB7 A;  4U6W A;  3QOC A;  3RVA A;  2BHA A;  3OVK A;  4RZY A;  4ZWP A;  5CDE A;  1YVM A;  4FLL A;  4OOK A;  4JUQ A;  4U69 A;  2B3L A;  3MR1 A;  2V3Z A;  4FO7 A;  2ADU A;  4FLK A;  2EVO A;  4S00 A;  1QXW A;  2GU4 A;  2P99 A;  5FCF A;  1WKM A;  1WL9 A;  4U76 A;  3TAV A;  1BN5 A;  2GGC A;  1B6A A;  2OKN A;  1XGO A;  4U70 A;  2BWT A;  3CB6 A;  4S01 A;  4ZNG A;  4MAT A;  2BHD A;  4Z7M A;  1QXZ A;  2GG5 A;  1WN1 A;  4A6V A;  3D27 A;  4RZZ A;  3FMQ A;  2GU7 A;  2Q8K A;  3ROR A;  4IKR A;  1A16 A;  1WL6 A;  2IW2 A;  1R5G A;  2ZSG A;  5CNX A;  1BOA A;  2GG3 A;  3PKA A;  3L24 A;  2EA4 A;  1CHM A;  4FLI A;  3IU9 A;  1C23 A;  2B3K A;  4QR8 A;  1O0X A;  5JI6 A;  4IU6 A;  1W2M A;  5CDL A;  2Q93 A;  2BWW A;  1B59 A;  3OOO A;  1QXY A;  5JFR A;  2BHC A;  3I7M A;  1WBQ A;  1KP0 A;  2BHB A;  4PV4 A;  2OAZ A;  4U75 A;  4IKS A;  4U6C A;  2EVC A;  3PKE A;  3TB5 A;  1C27 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...