1WN1A

Crystal structure of dipeptiase from pyrococcus horikoshii ot3
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
356
structure length
356
Chain Sequence
MRLEKFIHLLGERGFDGALISPGTNLYYLTGLRLHEVGERLAILAVSAEGDYRFLAPSLYENVVNNFPATFWHDGENPYAKLREILEELGISKGRILIEDTMRADWLIGIMKLGKFTFQPLSSLIKELRMIKDKEEVKMMEHASRIADKVFEEILTWDLIGMKERELALKIELLIRELSDGIAFEPIVASGENAANPHHEPGERKIRKGDIIILDYGARWKGYCSDITRTIGLGELDERLVKIYEVVKDAQESAFKAVREGIKAKDVDSRAREVISKAGYGEYFIHRTGHGLGLDVHEEPYIGPDGEVILKNGMTFTIEPGIYVPGLGGVRIEDDIVVDEGKGRRLTKAERELIIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Dipeptiase from Pyrococcus Horikoshii OT3
rcsb
source organism Pyrococcus horikoshii
molecule tags Hydrolase
molecule keywords dipeptidase
total genus 124
structure length 356
sequence length 356
chains with identical sequence B
ec nomenclature ec 3.4.-.-:
pdb deposition date 2004-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
A PF01321 Creatinase_N Creatinase/Prolidase N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 1wn1A01
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 1wn1A02
4U6CA 2G6PA 2BWSA 5CE6A 2BHDA 1CHMA 1MATA 5E2CA 4EGEA 1C22A 1WY2A 5CIKA 4FKCA 5D6EA 1WBQA 3O5VA 4KM3A 1JAWA 4IKTA 2MATA 4U6WA 2Q96A 3IU7A 3PEBA 3OVKA 2GU6A 2GG7A 1M35A 4QR8A 3IU9A 2BHAA 4FLJA 1C27A 2DFIA 3D27A 3BIQA 4JUQA 2GU5A 1WLRA 4Z7MA 2B3HA 4FO7A 2V3YA 2P99A 5JHUA 3I7MA 4ZNGA 1WN1A 2GG2A 2EVCA 2P98A 4IDYA 3IL0A 5FCHA 2BHCA 3RVAA 2IW2A 4U71A 5CLSA 1WL9A 2BB7A 1W7VA 4OOKA 4ZWPA 2GG9A 4IKUA 4U1BA 3CB6A 2GG3A 1KQ0A 3PKDA 2Q94A 4U73A 4A6VA 1PV9A 2EA4A 2BWVA 4FUKA 1QXYA 2NQ6A 5FCFA 3IU8A 3PKAA 2V3ZA 3QOCA 2Q8KA 1A16A 1WKMA 1W2MA 1YW9A 4FLIA 2V3XA 5CNXA 5CDEA 1QXWA 1XGSA 2NQ7A 2Q92A 1QZYA 3PKCA 4U70A 2BWWA 3OOOA 2EVOA 3MR1A 3PKBA 4U69A 4FO8A 3BIPA 4RZZA 5CDVA 4U75A 1R5HA 4PV4A 4RZYA 5E5BA 1R58A 3MX6A 1QXZA 2GGBA 2Q95A 4IKSA 3RORA 1Y1NA 2V6CA 3L7GA 1B59A 3PN9A 2BWYA 4S01A 2BWXA 2BHBA 1XGMA 1B6AA 2BWUA 4ZWOA 3FM3A 1BOAA 3CTZA 2GG8A 3IG4A 5JFRA 4RGZ1 1C24A 2P9AA 2GU4A 4MATA 3TAVA 3S6BA 2GG0A 1C23A 2ADUA 2GTXA 3MATA 2Q93A 4B28A 4IKRA 1XGOA 3BITA 4A6WA 3CB5A 1YW8A 2B3KA 4FLLA 3FMRA 1R5GA 1YW7A 2OAZA 1BN5A 2HOWA 4S00A 1C21A 1KP0A 2OKNA 2EVMA 4IECA 2B3LA 5CDLA 2BH3A 2GU7A 4U6EA 2BWTA 3L24A 4U6JA 2GZ5A 5JI6A 4U76A 2BN7A 1WL6A 4IF7A 4R60A 1KQ9A 3FMQA 3PKEA 4U6ZA 1YJ3A 4ZWUA 4FLKA 2GG5A 3Q6DA 4IPAA 4S2RP 5D6FA 1YVMA 4HXXA 4IU6A 2EA2A 1N51A 2ZSGA 3TB5A 1O0XA 1XGNA 1XNZA 2GGCA 2GA2A 4S2TP 4PNCA
chains in the Genus database with same CATH superfamily
4U6CA 2G6PA 2BWSA 5CE6A 2BHDA 1CHMA 1MATA 5E2CA 4EGEA 1C22A 1WY2A 5CIKA 4FKCA 5D6EA 1WBQA 3O5VA 4KM3A 1JAWA 4IKTA 2MATA 4U6WA 2Q96A 3IU7A 3PEBA 3OVKA 2GU6A 2GG7A 1M35A 4QR8A 3IU9A 2BHAA 4FLJA 1C27A 2DFIA 3D27A 3BIQA 4JUQA 2GU5A 1WLRA 4Z7MA 2B3HA 4FO7A 2V3YA 2P99A 5JHUA 3I7MA 4ZNGA 1WN1A 2GG2A 2EVCA 2P98A 4IDYA 3IL0A 5FCHA 2BHCA 3RVAA 2IW2A 4U71A 5CLSA 1WL9A 2BB7A 1W7VA 4OOKA 4ZWPA 2GG9A 4IKUA 4U1BA 3CB6A 2GG3A 1KQ0A 3PKDA 2Q94A 4U73A 4A6VA 1PV9A 2EA4A 2BWVA 4FUKA 1QXYA 2NQ6A 5FCFA 3IU8A 3PKAA 2V3ZA 3QOCA 2Q8KA 1A16A 1WKMA 1W2MA 1YW9A 4FLIA 2V3XA 5CNXA 5CDEA 1QXWA 1XGSA 2NQ7A 2Q92A 1QZYA 3PKCA 4U70A 2BWWA 3OOOA 2EVOA 3MR1A 3PKBA 4U69A 4FO8A 3BIPA 4RZZA 5CDVA 4U75A 1R5HA 4PV4A 4RZYA 5E5BA 1R58A 3MX6A 1QXZA 2GGBA 2Q95A 4IKSA 3RORA 1Y1NA 2V6CA 3L7GA 1B59A 3PN9A 2BWYA 4S01A 2BWXA 2BHBA 1XGMA 1B6AA 2BWUA 4ZWOA 3FM3A 1BOAA 3CTZA 2GG8A 3IG4A 5JFRA 4RGZ1 1C24A 2P9AA 2GU4A 4MATA 3TAVA 3S6BA 2GG0A 1C23A 2ADUA 2GTXA 3MATA 2Q93A 4B28A 4IKRA 1XGOA 3BITA 4A6WA 3CB5A 1YW8A 2B3KA 4FLLA 3FMRA 1R5GA 1YW7A 2OAZA 1BN5A 2HOWA 4S00A 1C21A 1KP0A 2OKNA 2EVMA 4IECA 2B3LA 5CDLA 2BH3A 2GU7A 4U6EA 2BWTA 3L24A 4U6JA 2GZ5A 5JI6A 4U76A 2BN7A 1WL6A 4IF7A 4R60A 1KQ9A 3FMQA 3PKEA 4U6ZA 1YJ3A 4ZWUA 4FLKA 2GG5A 3Q6DA 4IPAA 4S2RP 5D6FA 1YVMA 4HXXA 4IU6A 2EA2A 1N51A 2ZSGA 3TB5A 1O0XA 1XGNA 1XNZA 2GGCA 2GA2A 4S2TP 4PNCA
chains in the Genus database with same CATH topology
4U6CA 2G6PA 2BWSA 5CE6A 2BHDA 1CHMA 1MATA 5E2CA 4EGEA 1C22A 1WY2A 5CIKA 4FKCA 5D6EA 1WBQA 3O5VA 4KM3A 1JAWA 4IKTA 2MATA 4U6WA 2Q96A 3IU7A 3PEBA 3OVKA 2GU6A 2GG7A 1M35A 4QR8A 3IU9A 2BHAA 4FLJA 1C27A 2DFIA 3D27A 3BIQA 4JUQA 2GU5A 1WLRA 4Z7MA 2B3HA 4FO7A 2V3YA 2P99A 5JHUA 3I7MA 4ZNGA 1WN1A 2GG2A 2EVCA 2P98A 4IDYA 3IL0A 5FCHA 2BHCA 3RVAA 2IW2A 4U71A 5CLSA 1WL9A 2BB7A 1W7VA 4OOKA 4ZWPA 2GG9A 4IKUA 4U1BA 3CB6A 2GG3A 1KQ0A 3PKDA 2Q94A 4U73A 4A6VA 1PV9A 2EA4A 2BWVA 4FUKA 1QXYA 2NQ6A 5FCFA 3IU8A 3PKAA 2V3ZA 3QOCA 2Q8KA 1A16A 1WKMA 1W2MA 1YW9A 4FLIA 2V3XA 5CNXA 5CDEA 1QXWA 1XGSA 2NQ7A 2Q92A 1QZYA 3PKCA 4U70A 2BWWA 3OOOA 2EVOA 3MR1A 3PKBA 4U69A 4FO8A 3BIPA 4RZZA 5CDVA 4U75A 1R5HA 4PV4A 4RZYA 5E5BA 1R58A 3MX6A 1QXZA 2GGBA 2Q95A 4IKSA 3RORA 1Y1NA 2V6CA 3L7GA 1B59A 3PN9A 2BWYA 4S01A 2BWXA 2BHBA 1XGMA 1B6AA 2BWUA 4ZWOA 3FM3A 1BOAA 3CTZA 2GG8A 3IG4A 5JFRA 4RGZ1 1C24A 2P9AA 2GU4A 4MATA 3TAVA 3S6BA 2GG0A 1C23A 2ADUA 2GTXA 3MATA 2Q93A 4B28A 4IKRA 1XGOA 3BITA 4A6WA 3CB5A 1YW8A 2B3KA 4FLLA 3FMRA 1R5GA 1YW7A 2OAZA 1BN5A 2HOWA 4S00A 1C21A 1KP0A 2OKNA 2EVMA 4IECA 2B3LA 5CDLA 2BH3A 2GU7A 4U6EA 2BWTA 3L24A 4U6JA 2GZ5A 5JI6A 4U76A 2BN7A 1WL6A 4IF7A 4R60A 1KQ9A 3FMQA 3PKEA 4U6ZA 1YJ3A 4ZWUA 4FLKA 2GG5A 3Q6DA 4IPAA 4S2RP 5D6FA 1YVMA 4HXXA 4IU6A 2EA2A 1N51A 2ZSGA 3TB5A 1O0XA 1XGNA 1XNZA 2GGCA 2GA2A 4S2TP 4PNCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4U6C A;  2G6P A;  2BWS A;  5CE6 A;  2BHD A;  1CHM A;  1MAT A;  5E2C A;  4EGE A;  1C22 A;  1WY2 A;  5CIK A;  4FKC A;  5D6E A;  1WBQ A;  3O5V A;  4KM3 A;  1JAW A;  4IKT A;  2MAT A;  4U6W A;  2Q96 A;  3IU7 A;  3PEB A;  3OVK A;  2GU6 A;  2GG7 A;  1M35 A;  4QR8 A;  3IU9 A;  2BHA A;  4FLJ A;  1C27 A;  2DFI A;  3D27 A;  3BIQ A;  4JUQ A;  2GU5 A;  1WLR A;  4Z7M A;  2B3H A;  4FO7 A;  2V3Y A;  2P99 A;  5JHU A;  3I7M A;  4ZNG A;  1WN1 A;  2GG2 A;  2EVC A;  2P98 A;  4IDY A;  3IL0 A;  5FCH A;  2BHC A;  3RVA A;  2IW2 A;  4U71 A;  5CLS A;  1WL9 A;  2BB7 A;  1W7V A;  4OOK A;  4ZWP A;  2GG9 A;  4IKU A;  4U1B A;  3CB6 A;  2GG3 A;  1KQ0 A;  3PKD A;  2Q94 A;  4U73 A;  4A6V A;  1PV9 A;  2EA4 A;  2BWV A;  4FUK A;  1QXY A;  2NQ6 A;  5FCF A;  3IU8 A;  3PKA A;  2V3Z A;  3QOC A;  2Q8K A;  1A16 A;  1WKM A;  1W2M A;  1YW9 A;  4FLI A;  2V3X A;  5CNX A;  5CDE A;  1QXW A;  1XGS A;  2NQ7 A;  2Q92 A;  1QZY A;  3PKC A;  4U70 A;  2BWW A;  3OOO A;  2EVO A;  3MR1 A;  3PKB A;  4U69 A;  4FO8 A;  3BIP A;  4RZZ A;  5CDV A;  4U75 A;  1R5H A;  4PV4 A;  4RZY A;  5E5B A;  1R58 A;  3MX6 A;  1QXZ A;  2GGB A;  2Q95 A;  4IKS A;  3ROR A;  1Y1N A;  2V6C A;  3L7G A;  1B59 A;  3PN9 A;  2BWY A;  4S01 A;  2BWX A;  2BHB A;  1XGM A;  1B6A A;  2BWU A;  4ZWO A;  3FM3 A;  1BOA A;  3CTZ A;  2GG8 A;  3IG4 A;  5JFR A;  4RGZ 1;  1C24 A;  2P9A A;  2GU4 A;  4MAT A;  3TAV A;  3S6B A;  2GG0 A;  1C23 A;  2ADU A;  2GTX A;  3MAT A;  2Q93 A;  4B28 A;  4IKR A;  1XGO A;  3BIT A;  4A6W A;  3CB5 A;  1YW8 A;  2B3K A;  4FLL A;  3FMR A;  1R5G A;  1YW7 A;  2OAZ A;  1BN5 A;  2HOW A;  4S00 A;  1C21 A;  1KP0 A;  2OKN A;  2EVM A;  4IEC A;  2B3L A;  5CDL A;  2BH3 A;  2GU7 A;  4U6E A;  2BWT A;  3L24 A;  4U6J A;  2GZ5 A;  5JI6 A;  4U76 A;  2BN7 A;  1WL6 A;  4IF7 A;  4R60 A;  1KQ9 A;  3FMQ A;  3PKE A;  4U6Z A;  1YJ3 A;  4ZWU A;  4FLK A;  2GG5 A;  3Q6D A;  4IPA A;  4S2R P;  5D6F A;  1YVM A;  4HXX A;  4IU6 A;  2EA2 A;  1N51 A;  2ZSG A;  3TB5 A;  1O0X A;  1XGN A;  1XNZ A;  2GGC A;  2GA2 A;  4S2T P;  4PNC A; 
#chains in the Genus database with same CATH topology
 4U6C A;  2G6P A;  2BWS A;  5CE6 A;  2BHD A;  1CHM A;  1MAT A;  5E2C A;  4EGE A;  1C22 A;  1WY2 A;  5CIK A;  4FKC A;  5D6E A;  1WBQ A;  3O5V A;  4KM3 A;  1JAW A;  4IKT A;  2MAT A;  4U6W A;  2Q96 A;  3IU7 A;  3PEB A;  3OVK A;  2GU6 A;  2GG7 A;  1M35 A;  4QR8 A;  3IU9 A;  2BHA A;  4FLJ A;  1C27 A;  2DFI A;  3D27 A;  3BIQ A;  4JUQ A;  2GU5 A;  1WLR A;  4Z7M A;  2B3H A;  4FO7 A;  2V3Y A;  2P99 A;  5JHU A;  3I7M A;  4ZNG A;  1WN1 A;  2GG2 A;  2EVC A;  2P98 A;  4IDY A;  3IL0 A;  5FCH A;  2BHC A;  3RVA A;  2IW2 A;  4U71 A;  5CLS A;  1WL9 A;  2BB7 A;  1W7V A;  4OOK A;  4ZWP A;  2GG9 A;  4IKU A;  4U1B A;  3CB6 A;  2GG3 A;  1KQ0 A;  3PKD A;  2Q94 A;  4U73 A;  4A6V A;  1PV9 A;  2EA4 A;  2BWV A;  4FUK A;  1QXY A;  2NQ6 A;  5FCF A;  3IU8 A;  3PKA A;  2V3Z A;  3QOC A;  2Q8K A;  1A16 A;  1WKM A;  1W2M A;  1YW9 A;  4FLI A;  2V3X A;  5CNX A;  5CDE A;  1QXW A;  1XGS A;  2NQ7 A;  2Q92 A;  1QZY A;  3PKC A;  4U70 A;  2BWW A;  3OOO A;  2EVO A;  3MR1 A;  3PKB A;  4U69 A;  4FO8 A;  3BIP A;  4RZZ A;  5CDV A;  4U75 A;  1R5H A;  4PV4 A;  4RZY A;  5E5B A;  1R58 A;  3MX6 A;  1QXZ A;  2GGB A;  2Q95 A;  4IKS A;  3ROR A;  1Y1N A;  2V6C A;  3L7G A;  1B59 A;  3PN9 A;  2BWY A;  4S01 A;  2BWX A;  2BHB A;  1XGM A;  1B6A A;  2BWU A;  4ZWO A;  3FM3 A;  1BOA A;  3CTZ A;  2GG8 A;  3IG4 A;  5JFR A;  4RGZ 1;  1C24 A;  2P9A A;  2GU4 A;  4MAT A;  3TAV A;  3S6B A;  2GG0 A;  1C23 A;  2ADU A;  2GTX A;  3MAT A;  2Q93 A;  4B28 A;  4IKR A;  1XGO A;  3BIT A;  4A6W A;  3CB5 A;  1YW8 A;  2B3K A;  4FLL A;  3FMR A;  1R5G A;  1YW7 A;  2OAZ A;  1BN5 A;  2HOW A;  4S00 A;  1C21 A;  1KP0 A;  2OKN A;  2EVM A;  4IEC A;  2B3L A;  5CDL A;  2BH3 A;  2GU7 A;  4U6E A;  2BWT A;  3L24 A;  4U6J A;  2GZ5 A;  5JI6 A;  4U76 A;  2BN7 A;  1WL6 A;  4IF7 A;  4R60 A;  1KQ9 A;  3FMQ A;  3PKE A;  4U6Z A;  1YJ3 A;  4ZWU A;  4FLK A;  2GG5 A;  3Q6D A;  4IPA A;  4S2R P;  5D6F A;  1YVM A;  4HXX A;  4IU6 A;  2EA2 A;  1N51 A;  2ZSG A;  3TB5 A;  1O0X A;  1XGN A;  1XNZ A;  2GGC A;  2GA2 A;  4S2T P;  4PNC A; 
#chains in the Genus database with same CATH homology
 4U6C A;  2G6P A;  2BWS A;  5CE6 A;  2BHD A;  1CHM A;  1MAT A;  5E2C A;  4EGE A;  1C22 A;  1WY2 A;  5CIK A;  4FKC A;  5D6E A;  1WBQ A;  3O5V A;  4KM3 A;  1JAW A;  4IKT A;  2MAT A;  4U6W A;  2Q96 A;  3IU7 A;  3PEB A;  3OVK A;  2GU6 A;  2GG7 A;  1M35 A;  4QR8 A;  3IU9 A;  2BHA A;  4FLJ A;  1C27 A;  2DFI A;  3D27 A;  3BIQ A;  4JUQ A;  2GU5 A;  1WLR A;  4Z7M A;  2B3H A;  4FO7 A;  2V3Y A;  2P99 A;  5JHU A;  3I7M A;  4ZNG A;  1WN1 A;  2GG2 A;  2EVC A;  2P98 A;  4IDY A;  3IL0 A;  5FCH A;  2BHC A;  3RVA A;  2IW2 A;  4U71 A;  5CLS A;  1WL9 A;  2BB7 A;  1W7V A;  4OOK A;  4ZWP A;  2GG9 A;  4IKU A;  4U1B A;  3CB6 A;  2GG3 A;  1KQ0 A;  3PKD A;  2Q94 A;  4U73 A;  4A6V A;  1PV9 A;  2EA4 A;  2BWV A;  4FUK A;  1QXY A;  2NQ6 A;  5FCF A;  3IU8 A;  3PKA A;  2V3Z A;  3QOC A;  2Q8K A;  1A16 A;  1WKM A;  1W2M A;  1YW9 A;  4FLI A;  2V3X A;  5CNX A;  5CDE A;  1QXW A;  1XGS A;  2NQ7 A;  2Q92 A;  1QZY A;  3PKC A;  4U70 A;  2BWW A;  3OOO A;  2EVO A;  3MR1 A;  3PKB A;  4U69 A;  4FO8 A;  3BIP A;  4RZZ A;  5CDV A;  4U75 A;  1R5H A;  4PV4 A;  4RZY A;  5E5B A;  1R58 A;  3MX6 A;  1QXZ A;  2GGB A;  2Q95 A;  4IKS A;  3ROR A;  1Y1N A;  2V6C A;  3L7G A;  1B59 A;  3PN9 A;  2BWY A;  4S01 A;  2BWX A;  2BHB A;  1XGM A;  1B6A A;  2BWU A;  4ZWO A;  3FM3 A;  1BOA A;  3CTZ A;  2GG8 A;  3IG4 A;  5JFR A;  4RGZ 1;  1C24 A;  2P9A A;  2GU4 A;  4MAT A;  3TAV A;  3S6B A;  2GG0 A;  1C23 A;  2ADU A;  2GTX A;  3MAT A;  2Q93 A;  4B28 A;  4IKR A;  1XGO A;  3BIT A;  4A6W A;  3CB5 A;  1YW8 A;  2B3K A;  4FLL A;  3FMR A;  1R5G A;  1YW7 A;  2OAZ A;  1BN5 A;  2HOW A;  4S00 A;  1C21 A;  1KP0 A;  2OKN A;  2EVM A;  4IEC A;  2B3L A;  5CDL A;  2BH3 A;  2GU7 A;  4U6E A;  2BWT A;  3L24 A;  4U6J A;  2GZ5 A;  5JI6 A;  4U76 A;  2BN7 A;  1WL6 A;  4IF7 A;  4R60 A;  1KQ9 A;  3FMQ A;  3PKE A;  4U6Z A;  1YJ3 A;  4ZWU A;  4FLK A;  2GG5 A;  3Q6D A;  4IPA A;  4S2R P;  5D6F A;  1YVM A;  4HXX A;  4IU6 A;  2EA2 A;  1N51 A;  2ZSG A;  3TB5 A;  1O0X A;  1XGN A;  1XNZ A;  2GGC A;  2GA2 A;  4S2T P;  4PNC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...