1WN1A

Crystal structure of dipeptiase from pyrococcus horikoshii ot3
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
356
structure length
356
Chain Sequence
MRLEKFIHLLGERGFDGALISPGTNLYYLTGLRLHEVGERLAILAVSAEGDYRFLAPSLYENVVNNFPATFWHDGENPYAKLREILEELGISKGRILIEDTMRADWLIGIMKLGKFTFQPLSSLIKELRMIKDKEEVKMMEHASRIADKVFEEILTWDLIGMKERELALKIELLIRELSDGIAFEPIVASGENAANPHHEPGERKIRKGDIIILDYGARWKGYCSDITRTIGLGELDERLVKIYEVVKDAQESAFKAVREGIKAKDVDSRAREVISKAGYGEYFIHRTGHGLGLDVHEEPYIGPDGEVILKNGMTFTIEPGIYVPGLGGVRIEDDIVVDEGKGRRLTKAERELIIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords dipeptidase
publication title Crystal Structure of Dipeptiase from Pyrococcus Horikoshii OT3
rcsb
source organism Pyrococcus horikoshii
molecule tags Hydrolase
total genus 124
structure length 356
sequence length 356
chains with identical sequence B
ec nomenclature ec 3.4.-.-:
pdb deposition date 2004-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
A PF01321 Creatinase_N Creatinase/Prolidase N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 1wn1A01
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 1wn1A02
3MX6A 1WLRA 4S01A 4RZYA 4ZNGA 3FM3A 2GG9A 4IF7A 1WN1A 3PKCA 2BWYA 1XNZA 1YW8A 4S2TP 4B28A 4FLLA 3PN9A 3RVAA 4FO7A 4U1BA 1C21A 1Y1NA 2OKNA 3PKAA 1WBQA 1WL6A 1XGMA 4PV4A 4IDYA 2GG8A 2ADUA 4U6EA 4ZWOA 5E2CA 5JI6A 5D6FA 2GG0A 3OOOA 2GGCA 3RORA 1YJ3A 1N51A 4R60A 2NQ6A 5FCFA 2BN7A 3IU8A 1C27A 3O5VA 2GG3A 2BWUA 1C22A 2P9AA 3BITA 4U6JA 2BHBA 1YW7A 3MR1A 2EVCA 2BWWA 4S2RP 3IL0A 4IKTA 2GG5A 4HXXA 1WY2A 1CHMA 1QXYA 4A6VA 3PKEA 1C24A 3D27A 2BHCA 5E5BA 2GG2A 2V3ZA 2Q94A 2HOWA 4QR8A 1KQ9A 3IG4A 4RZZA 3CTZA 1WL9A 1W7VA 4PNCA 1XGOA 2Q93A 4U6CA 1WKMA 2GG7A 5CLSA 4IU6A 5FCHA 5CDLA 2GGBA 2Q8KA 5CDVA 3QOCA 1JAWA 1O0XA 3BIQA 5CDEA 5CE6A 1XGNA 2BH3A 4ZWPA 2B3KA 1C23A 2Q92A 4IKRA 3PEBA 3I7MA 4KM3A 5D6EA 2B3LA 3L7GA 2DFIA 2V3XA 4U69A 4U75A 2BWXA 1BOAA 1YW9A 3PKDA 4FLIA 3CB6A 2BWVA 2GTXA 4OOKA 2G6PA 2P99A 3TB5A 2BB7A 2IW2A 4FUKA 1QXZA 2GU4A 5JFRA 1PV9A 2ZSGA 3L24A 1XGSA 3MATA 3IU9A 2EA4A 2MATA 4IKUA 1KQ0A 1B6AA 4S00A 2GU6A 3IU7A 4IKSA 3PKBA 3FMQA 2P98A 4JUQA 3TAVA 2Q95A 2V6CA 2B3HA 3BIPA 1R58A 4U6ZA 2OAZA 1KP0A 4A6WA 2NQ7A 1QXWA 5CNXA 2EVOA 4Z7MA 2BHDA 5JHUA 1R5GA 2BHAA 1MATA 4FLKA 5CIKA 1B59A 3OVKA 4U70A 3FMRA 1A16A 1QZYA 4U71A 1YVMA 3Q6DA 4U6WA 2GU5A 2GA2A 4MATA 4FLJA 2BWSA 4FO8A 4FKCA 2GZ5A 2EVMA 4U76A 4RGZ1 1W2MA 4U73A 2GU7A 1M35A 2V3YA 2Q96A 4ZWUA 3S6BA 4IPAA 4IECA 4EGEA 1R5HA 2BWTA 2EA2A 1BN5A 3CB5A
chains in the Genus database with same CATH superfamily
3MX6A 1WLRA 4S01A 4RZYA 4ZNGA 3FM3A 2GG9A 4IF7A 1WN1A 3PKCA 2BWYA 1XNZA 1YW8A 4S2TP 4B28A 4FLLA 3PN9A 3RVAA 4FO7A 4U1BA 1C21A 1Y1NA 2OKNA 3PKAA 1WBQA 1WL6A 1XGMA 4PV4A 4IDYA 2GG8A 2ADUA 4U6EA 4ZWOA 5E2CA 5JI6A 5D6FA 2GG0A 3OOOA 2GGCA 3RORA 1YJ3A 1N51A 4R60A 2NQ6A 5FCFA 2BN7A 3IU8A 1C27A 3O5VA 2GG3A 2BWUA 1C22A 2P9AA 3BITA 4U6JA 2BHBA 1YW7A 3MR1A 2EVCA 2BWWA 4S2RP 3IL0A 4IKTA 2GG5A 4HXXA 1WY2A 1CHMA 1QXYA 4A6VA 3PKEA 1C24A 3D27A 2BHCA 5E5BA 2GG2A 2V3ZA 2Q94A 2HOWA 4QR8A 1KQ9A 3IG4A 4RZZA 3CTZA 1WL9A 1W7VA 4PNCA 1XGOA 2Q93A 4U6CA 1WKMA 2GG7A 5CLSA 4IU6A 5FCHA 5CDLA 2GGBA 2Q8KA 5CDVA 3QOCA 1JAWA 1O0XA 3BIQA 5CDEA 5CE6A 1XGNA 2BH3A 4ZWPA 2B3KA 1C23A 2Q92A 4IKRA 3PEBA 3I7MA 4KM3A 5D6EA 2B3LA 3L7GA 2DFIA 2V3XA 4U69A 4U75A 2BWXA 1BOAA 1YW9A 3PKDA 4FLIA 3CB6A 2BWVA 2GTXA 4OOKA 2G6PA 2P99A 3TB5A 2BB7A 2IW2A 4FUKA 1QXZA 2GU4A 5JFRA 1PV9A 2ZSGA 3L24A 1XGSA 3MATA 3IU9A 2EA4A 2MATA 4IKUA 1KQ0A 1B6AA 4S00A 2GU6A 3IU7A 4IKSA 3PKBA 3FMQA 2P98A 4JUQA 3TAVA 2Q95A 2V6CA 2B3HA 3BIPA 1R58A 4U6ZA 2OAZA 1KP0A 4A6WA 2NQ7A 1QXWA 5CNXA 2EVOA 4Z7MA 2BHDA 5JHUA 1R5GA 2BHAA 1MATA 4FLKA 5CIKA 1B59A 3OVKA 4U70A 3FMRA 1A16A 1QZYA 4U71A 1YVMA 3Q6DA 4U6WA 2GU5A 2GA2A 4MATA 4FLJA 2BWSA 4FO8A 4FKCA 2GZ5A 2EVMA 4U76A 4RGZ1 1W2MA 4U73A 2GU7A 1M35A 2V3YA 2Q96A 4ZWUA 3S6BA 4IPAA 4IECA 4EGEA 1R5HA 2BWTA 2EA2A 1BN5A 3CB5A
chains in the Genus database with same CATH topology
3MX6A 1WLRA 4S01A 4RZYA 4ZNGA 3FM3A 2GG9A 4IF7A 1WN1A 3PKCA 2BWYA 1XNZA 1YW8A 4S2TP 4B28A 4FLLA 3PN9A 3RVAA 4FO7A 4U1BA 1C21A 1Y1NA 2OKNA 3PKAA 1WBQA 1WL6A 1XGMA 4PV4A 4IDYA 2GG8A 2ADUA 4U6EA 4ZWOA 5E2CA 5JI6A 5D6FA 2GG0A 3OOOA 2GGCA 3RORA 1YJ3A 1N51A 4R60A 2NQ6A 5FCFA 2BN7A 3IU8A 1C27A 3O5VA 2GG3A 2BWUA 1C22A 2P9AA 3BITA 4U6JA 2BHBA 1YW7A 3MR1A 2EVCA 2BWWA 4S2RP 3IL0A 4IKTA 2GG5A 4HXXA 1WY2A 1CHMA 1QXYA 4A6VA 3PKEA 1C24A 3D27A 2BHCA 5E5BA 2GG2A 2V3ZA 2Q94A 2HOWA 4QR8A 1KQ9A 3IG4A 4RZZA 3CTZA 1WL9A 1W7VA 4PNCA 1XGOA 2Q93A 4U6CA 1WKMA 2GG7A 5CLSA 4IU6A 5FCHA 5CDLA 2GGBA 2Q8KA 5CDVA 3QOCA 1JAWA 1O0XA 3BIQA 5CDEA 5CE6A 1XGNA 2BH3A 4ZWPA 2B3KA 1C23A 2Q92A 4IKRA 3PEBA 3I7MA 4KM3A 5D6EA 2B3LA 3L7GA 2DFIA 2V3XA 4U69A 4U75A 2BWXA 1BOAA 1YW9A 3PKDA 4FLIA 3CB6A 2BWVA 2GTXA 4OOKA 2G6PA 2P99A 3TB5A 2BB7A 2IW2A 4FUKA 1QXZA 2GU4A 5JFRA 1PV9A 2ZSGA 3L24A 1XGSA 3MATA 3IU9A 2EA4A 2MATA 4IKUA 1KQ0A 1B6AA 4S00A 2GU6A 3IU7A 4IKSA 3PKBA 3FMQA 2P98A 4JUQA 3TAVA 2Q95A 2V6CA 2B3HA 3BIPA 1R58A 4U6ZA 2OAZA 1KP0A 4A6WA 2NQ7A 1QXWA 5CNXA 2EVOA 4Z7MA 2BHDA 5JHUA 1R5GA 2BHAA 1MATA 4FLKA 5CIKA 1B59A 3OVKA 4U70A 3FMRA 1A16A 1QZYA 4U71A 1YVMA 3Q6DA 4U6WA 2GU5A 2GA2A 4MATA 4FLJA 2BWSA 4FO8A 4FKCA 2GZ5A 2EVMA 4U76A 4RGZ1 1W2MA 4U73A 2GU7A 1M35A 2V3YA 2Q96A 4ZWUA 3S6BA 4IPAA 4IECA 4EGEA 1R5HA 2BWTA 2EA2A 1BN5A 3CB5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MX6 A;  1WLR A;  4S01 A;  4RZY A;  4ZNG A;  3FM3 A;  2GG9 A;  4IF7 A;  1WN1 A;  3PKC A;  2BWY A;  1XNZ A;  1YW8 A;  4S2T P;  4B28 A;  4FLL A;  3PN9 A;  3RVA A;  4FO7 A;  4U1B A;  1C21 A;  1Y1N A;  2OKN A;  3PKA A;  1WBQ A;  1WL6 A;  1XGM A;  4PV4 A;  4IDY A;  2GG8 A;  2ADU A;  4U6E A;  4ZWO A;  5E2C A;  5JI6 A;  5D6F A;  2GG0 A;  3OOO A;  2GGC A;  3ROR A;  1YJ3 A;  1N51 A;  4R60 A;  2NQ6 A;  5FCF A;  2BN7 A;  3IU8 A;  1C27 A;  3O5V A;  2GG3 A;  2BWU A;  1C22 A;  2P9A A;  3BIT A;  4U6J A;  2BHB A;  1YW7 A;  3MR1 A;  2EVC A;  2BWW A;  4S2R P;  3IL0 A;  4IKT A;  2GG5 A;  4HXX A;  1WY2 A;  1CHM A;  1QXY A;  4A6V A;  3PKE A;  1C24 A;  3D27 A;  2BHC A;  5E5B A;  2GG2 A;  2V3Z A;  2Q94 A;  2HOW A;  4QR8 A;  1KQ9 A;  3IG4 A;  4RZZ A;  3CTZ A;  1WL9 A;  1W7V A;  4PNC A;  1XGO A;  2Q93 A;  4U6C A;  1WKM A;  2GG7 A;  5CLS A;  4IU6 A;  5FCH A;  5CDL A;  2GGB A;  2Q8K A;  5CDV A;  3QOC A;  1JAW A;  1O0X A;  3BIQ A;  5CDE A;  5CE6 A;  1XGN A;  2BH3 A;  4ZWP A;  2B3K A;  1C23 A;  2Q92 A;  4IKR A;  3PEB A;  3I7M A;  4KM3 A;  5D6E A;  2B3L A;  3L7G A;  2DFI A;  2V3X A;  4U69 A;  4U75 A;  2BWX A;  1BOA A;  1YW9 A;  3PKD A;  4FLI A;  3CB6 A;  2BWV A;  2GTX A;  4OOK A;  2G6P A;  2P99 A;  3TB5 A;  2BB7 A;  2IW2 A;  4FUK A;  1QXZ A;  2GU4 A;  5JFR A;  1PV9 A;  2ZSG A;  3L24 A;  1XGS A;  3MAT A;  3IU9 A;  2EA4 A;  2MAT A;  4IKU A;  1KQ0 A;  1B6A A;  4S00 A;  2GU6 A;  3IU7 A;  4IKS A;  3PKB A;  3FMQ A;  2P98 A;  4JUQ A;  3TAV A;  2Q95 A;  2V6C A;  2B3H A;  3BIP A;  1R58 A;  4U6Z A;  2OAZ A;  1KP0 A;  4A6W A;  2NQ7 A;  1QXW A;  5CNX A;  2EVO A;  4Z7M A;  2BHD A;  5JHU A;  1R5G A;  2BHA A;  1MAT A;  4FLK A;  5CIK A;  1B59 A;  3OVK A;  4U70 A;  3FMR A;  1A16 A;  1QZY A;  4U71 A;  1YVM A;  3Q6D A;  4U6W A;  2GU5 A;  2GA2 A;  4MAT A;  4FLJ A;  2BWS A;  4FO8 A;  4FKC A;  2GZ5 A;  2EVM A;  4U76 A;  4RGZ 1;  1W2M A;  4U73 A;  2GU7 A;  1M35 A;  2V3Y A;  2Q96 A;  4ZWU A;  3S6B A;  4IPA A;  4IEC A;  4EGE A;  1R5H A;  2BWT A;  2EA2 A;  1BN5 A;  3CB5 A; 
#chains in the Genus database with same CATH topology
 3MX6 A;  1WLR A;  4S01 A;  4RZY A;  4ZNG A;  3FM3 A;  2GG9 A;  4IF7 A;  1WN1 A;  3PKC A;  2BWY A;  1XNZ A;  1YW8 A;  4S2T P;  4B28 A;  4FLL A;  3PN9 A;  3RVA A;  4FO7 A;  4U1B A;  1C21 A;  1Y1N A;  2OKN A;  3PKA A;  1WBQ A;  1WL6 A;  1XGM A;  4PV4 A;  4IDY A;  2GG8 A;  2ADU A;  4U6E A;  4ZWO A;  5E2C A;  5JI6 A;  5D6F A;  2GG0 A;  3OOO A;  2GGC A;  3ROR A;  1YJ3 A;  1N51 A;  4R60 A;  2NQ6 A;  5FCF A;  2BN7 A;  3IU8 A;  1C27 A;  3O5V A;  2GG3 A;  2BWU A;  1C22 A;  2P9A A;  3BIT A;  4U6J A;  2BHB A;  1YW7 A;  3MR1 A;  2EVC A;  2BWW A;  4S2R P;  3IL0 A;  4IKT A;  2GG5 A;  4HXX A;  1WY2 A;  1CHM A;  1QXY A;  4A6V A;  3PKE A;  1C24 A;  3D27 A;  2BHC A;  5E5B A;  2GG2 A;  2V3Z A;  2Q94 A;  2HOW A;  4QR8 A;  1KQ9 A;  3IG4 A;  4RZZ A;  3CTZ A;  1WL9 A;  1W7V A;  4PNC A;  1XGO A;  2Q93 A;  4U6C A;  1WKM A;  2GG7 A;  5CLS A;  4IU6 A;  5FCH A;  5CDL A;  2GGB A;  2Q8K A;  5CDV A;  3QOC A;  1JAW A;  1O0X A;  3BIQ A;  5CDE A;  5CE6 A;  1XGN A;  2BH3 A;  4ZWP A;  2B3K A;  1C23 A;  2Q92 A;  4IKR A;  3PEB A;  3I7M A;  4KM3 A;  5D6E A;  2B3L A;  3L7G A;  2DFI A;  2V3X A;  4U69 A;  4U75 A;  2BWX A;  1BOA A;  1YW9 A;  3PKD A;  4FLI A;  3CB6 A;  2BWV A;  2GTX A;  4OOK A;  2G6P A;  2P99 A;  3TB5 A;  2BB7 A;  2IW2 A;  4FUK A;  1QXZ A;  2GU4 A;  5JFR A;  1PV9 A;  2ZSG A;  3L24 A;  1XGS A;  3MAT A;  3IU9 A;  2EA4 A;  2MAT A;  4IKU A;  1KQ0 A;  1B6A A;  4S00 A;  2GU6 A;  3IU7 A;  4IKS A;  3PKB A;  3FMQ A;  2P98 A;  4JUQ A;  3TAV A;  2Q95 A;  2V6C A;  2B3H A;  3BIP A;  1R58 A;  4U6Z A;  2OAZ A;  1KP0 A;  4A6W A;  2NQ7 A;  1QXW A;  5CNX A;  2EVO A;  4Z7M A;  2BHD A;  5JHU A;  1R5G A;  2BHA A;  1MAT A;  4FLK A;  5CIK A;  1B59 A;  3OVK A;  4U70 A;  3FMR A;  1A16 A;  1QZY A;  4U71 A;  1YVM A;  3Q6D A;  4U6W A;  2GU5 A;  2GA2 A;  4MAT A;  4FLJ A;  2BWS A;  4FO8 A;  4FKC A;  2GZ5 A;  2EVM A;  4U76 A;  4RGZ 1;  1W2M A;  4U73 A;  2GU7 A;  1M35 A;  2V3Y A;  2Q96 A;  4ZWU A;  3S6B A;  4IPA A;  4IEC A;  4EGE A;  1R5H A;  2BWT A;  2EA2 A;  1BN5 A;  3CB5 A; 
#chains in the Genus database with same CATH homology
 3MX6 A;  1WLR A;  4S01 A;  4RZY A;  4ZNG A;  3FM3 A;  2GG9 A;  4IF7 A;  1WN1 A;  3PKC A;  2BWY A;  1XNZ A;  1YW8 A;  4S2T P;  4B28 A;  4FLL A;  3PN9 A;  3RVA A;  4FO7 A;  4U1B A;  1C21 A;  1Y1N A;  2OKN A;  3PKA A;  1WBQ A;  1WL6 A;  1XGM A;  4PV4 A;  4IDY A;  2GG8 A;  2ADU A;  4U6E A;  4ZWO A;  5E2C A;  5JI6 A;  5D6F A;  2GG0 A;  3OOO A;  2GGC A;  3ROR A;  1YJ3 A;  1N51 A;  4R60 A;  2NQ6 A;  5FCF A;  2BN7 A;  3IU8 A;  1C27 A;  3O5V A;  2GG3 A;  2BWU A;  1C22 A;  2P9A A;  3BIT A;  4U6J A;  2BHB A;  1YW7 A;  3MR1 A;  2EVC A;  2BWW A;  4S2R P;  3IL0 A;  4IKT A;  2GG5 A;  4HXX A;  1WY2 A;  1CHM A;  1QXY A;  4A6V A;  3PKE A;  1C24 A;  3D27 A;  2BHC A;  5E5B A;  2GG2 A;  2V3Z A;  2Q94 A;  2HOW A;  4QR8 A;  1KQ9 A;  3IG4 A;  4RZZ A;  3CTZ A;  1WL9 A;  1W7V A;  4PNC A;  1XGO A;  2Q93 A;  4U6C A;  1WKM A;  2GG7 A;  5CLS A;  4IU6 A;  5FCH A;  5CDL A;  2GGB A;  2Q8K A;  5CDV A;  3QOC A;  1JAW A;  1O0X A;  3BIQ A;  5CDE A;  5CE6 A;  1XGN A;  2BH3 A;  4ZWP A;  2B3K A;  1C23 A;  2Q92 A;  4IKR A;  3PEB A;  3I7M A;  4KM3 A;  5D6E A;  2B3L A;  3L7G A;  2DFI A;  2V3X A;  4U69 A;  4U75 A;  2BWX A;  1BOA A;  1YW9 A;  3PKD A;  4FLI A;  3CB6 A;  2BWV A;  2GTX A;  4OOK A;  2G6P A;  2P99 A;  3TB5 A;  2BB7 A;  2IW2 A;  4FUK A;  1QXZ A;  2GU4 A;  5JFR A;  1PV9 A;  2ZSG A;  3L24 A;  1XGS A;  3MAT A;  3IU9 A;  2EA4 A;  2MAT A;  4IKU A;  1KQ0 A;  1B6A A;  4S00 A;  2GU6 A;  3IU7 A;  4IKS A;  3PKB A;  3FMQ A;  2P98 A;  4JUQ A;  3TAV A;  2Q95 A;  2V6C A;  2B3H A;  3BIP A;  1R58 A;  4U6Z A;  2OAZ A;  1KP0 A;  4A6W A;  2NQ7 A;  1QXW A;  5CNX A;  2EVO A;  4Z7M A;  2BHD A;  5JHU A;  1R5G A;  2BHA A;  1MAT A;  4FLK A;  5CIK A;  1B59 A;  3OVK A;  4U70 A;  3FMR A;  1A16 A;  1QZY A;  4U71 A;  1YVM A;  3Q6D A;  4U6W A;  2GU5 A;  2GA2 A;  4MAT A;  4FLJ A;  2BWS A;  4FO8 A;  4FKC A;  2GZ5 A;  2EVM A;  4U76 A;  4RGZ 1;  1W2M A;  4U73 A;  2GU7 A;  1M35 A;  2V3Y A;  2Q96 A;  4ZWU A;  3S6B A;  4IPA A;  4IEC A;  4EGE A;  1R5H A;  2BWT A;  2EA2 A;  1BN5 A;  3CB5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...