1WNJA

Nmr structure of human coactosin-like protein
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
145
structure length
145
Chain Sequence
GIRMATKIDKEACRAAYNLVRDDGSAVIWVTFKYDGSTIVPGEQGAEYQHFIQQCTDDVRLFAFVRFTTGDAMSKRSKFALITWIGENVSGLQRAKTGTDKTLVKEVVQNFAKEFVISDRKELEEDFIKSELKKAGGANYDAQTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NMR structure of human coactosin-like protein
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords Coactosin-like protein
total genus 35
structure length 145
sequence length 145
ec nomenclature
pdb deposition date 2004-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00241 Cofilin_ADF Cofilin/tropomyosin-type actin-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.20.10 Alpha Beta 3-Layer(aba) Sandwich Severin Severin 1wnjA00
1Q8XA 1TMWA 3CIPG 1JHWA 2FH3A 5FAFA 2NUTA 4CBUG 5FAEA 3EGXA 1X67A 1TVJA 3EGDA 2LLFA 5HVKD 2LXXA 1KCQA 3A5MS 2VIKA 5DD2A 5KYUA 2NUTB 3DAWB 4S10C 3EFOA 1AHQA 5KYXB 2W0IA 4CBWG 3A5NS 1CFYA 1YAGG 1T44G 4BEX1 1MDUA 2MOTA 2FF6G 2I2QA 3EFOB 2FH4A 2NUPB 1WFSA 1AK7A 1M2VB 2XFAA 5KYWA 1NM1G 1WNJA 2QTVA 1HQZ1 1AK6A 1D0NA 1RGIG 4KEFA 1NPHA 4Z94G 2VILA 1PD1A 3EG9B 3EH1A 3EGXB 1VKKA 2XF1A 3CI5G 4PKGG 1M4JA 3CJCG 4KEEA 4PKHB 1SVQA 3FFKA 1T3YA 2FF3A 5KYUB 1V6FA 1T2LA 4LIZA 3EH2A 5L6WC 1CNUA 3TU5B 1C0FS 4KEDA 1SVYA 5KYXA 3FG6A 1C0GS 3L50A 1NMDG 3A5OS 2FH1A 1COFA 2MV2A 5IVUA 5KYYA 1WM4A 1DEJS 4CBXG 2NUPA 1F7SA 2HD7A 1M2VA 2FH2A 1NLVG 2LJ8A 5KYWB 1M2OA 5KYYB 1UDMA 3A5LS 1QPVA 2FGHA 3FFNA 5HVKB 3EG9A 1SVRA 2MP4A 3Q2BA 2D8BA 3CJBG 5A1MA 1PCXA 3FG7A 1D4XG 1H1VG 4PKIG 1T3XA 2L72A 3EGDB 1EQYS 1P8XA 1VFQA 1Q8GA 4JD2H 1ESVS 1PD0A 1YVNG 2VACA 1P8ZG 2KVKA 5KYNA 1J72A
chains in the Genus database with same CATH superfamily
1Q8XA 1TMWA 3CIPG 1JHWA 2FH3A 5FAFA 2NUTA 4CBUG 5FAEA 3EGXA 1X67A 1TVJA 3EGDA 2LLFA 5HVKD 2LXXA 1KCQA 3A5MS 2VIKA 5DD2A 5KYUA 2NUTB 3DAWB 4S10C 3DA7A 3EFOA 1AHQA 5KYXB 2W0IA 4CBWG 3A5NS 1CFYA 1YAGG 1T44G 4BEX1 1MDUA 2MOTA 2FF6G 2I2QA 3EFOB 2FH4A 2NUPB 1WFSA 1AK7A 1M2VB 2XFAA 5KYWA 1NM1G 1WNJA 2QTVA 1HQZ1 1AK6A 1D0NA 1RGIG 4KEFA 1NPHA 4Z94G 2VILA 1PD1A 3EG9B 3EH1A 3EGXB 1VKKA 2XF1A 3CI5G 4PKGG 1M4JA 3CJCG 4KEEA 4PKHB 1SVQA 3FFKA 1T3YA 2FF3A 5KYUB 1V6FA 1T2LA 4LIZA 3EH2A 5L6WC 1CNUA 3TU5B 1C0FS 4KEDA 1SVYA 5KYXA 3FG6A 1C0GS 3L50A 1NMDG 3A5OS 2FH1A 1COFA 2MV2A 5IVUA 5KYYA 1WM4A 1DEJS 4CBXG 2NUPA 1F7SA 2HD7A 1M2VA 2FH2A 1NLVG 2LJ8A 5KYWB 1M2OA 5KYYB 1UDMA 3A5LS 1QPVA 2FGHA 3FFNA 5HVKB 3EG9A 1SVRA 2MP4A 3Q2BA 2D8BA 3CJBG 5A1MA 1PCXA 3FG7A 1D4XG 1H1VG 4PKIG 1T3XA 2L72A 3EGDB 1EQYS 1P8XA 1VFQA 1Q8GA 4JD2H 1ESVS 1PD0A 1YVNG 2VACA 1P8ZG 2KVKA 5KYNA 1J72A
chains in the Genus database with same CATH topology
1Q8XA 1TMWA 3CIPG 1JHWA 2FH3A 5FAFA 2NUTA 4CBUG 5FAEA 3EGXA 1X67A 1TVJA 3EGDA 2LLFA 5HVKD 2LXXA 1KCQA 3A5MS 2VIKA 5DD2A 5KYUA 2NUTB 3DAWB 4S10C 3DA7A 3EFOA 1AHQA 5KYXB 2W0IA 4CBWG 3A5NS 1CFYA 1YAGG 1T44G 4BEX1 1MDUA 2MOTA 2FF6G 2I2QA 3EFOB 2FH4A 2NUPB 1WFSA 1AK7A 1M2VB 2XFAA 5KYWA 1NM1G 1WNJA 2QTVA 1HQZ1 1AK6A 1D0NA 1RGIG 4KEFA 1NPHA 4Z94G 2VILA 1PD1A 3EG9B 3EH1A 3EGXB 1VKKA 2XF1A 3CI5G 4PKGG 1M4JA 3CJCG 4KEEA 4PKHB 1SVQA 3FFKA 1T3YA 2FF3A 5KYUB 1V6FA 1T2LA 4LIZA 3EH2A 5L6WC 1CNUA 3TU5B 1C0FS 4KEDA 1SVYA 5KYXA 3FG6A 1C0GS 3L50A 1NMDG 3A5OS 2FH1A 1COFA 2MV2A 5IVUA 5KYYA 1WM4A 1DEJS 4CBXG 2NUPA 1F7SA 2HD7A 1M2VA 2FH2A 1NLVG 2LJ8A 5KYWB 1M2OA 5KYYB 1UDMA 3A5LS 1QPVA 2FGHA 3FFNA 5HVKB 3EG9A 1SVRA 2MP4A 3Q2BA 2D8BA 3CJBG 5A1MA 1PCXA 3FG7A 1D4XG 1H1VG 4PKIG 1T3XA 2L72A 3EGDB 1EQYS 1P8XA 1VFQA 1Q8GA 4JD2H 1ESVS 1PD0A 1YVNG 2VACA 1P8ZG 2KVKA 5KYNA 1J72A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q8X A;  1TMW A;  3CIP G;  1JHW A;  2FH3 A;  5FAF A;  2NUT A;  4CBU G;  5FAE A;  3EGX A;  1X67 A;  1TVJ A;  3EGD A;  2LLF A;  5HVK D;  2LXX A;  1KCQ A;  3A5M S;  2VIK A;  5DD2 A;  5KYU A;  2NUT B;  3DAW B;  4S10 C;  3EFO A;  1AHQ A;  5KYX B;  2W0I A;  4CBW G;  3A5N S;  1CFY A;  1YAG G;  1T44 G;  4BEX 1;  1MDU A;  2MOT A;  2FF6 G;  2I2Q A;  3EFO B;  2FH4 A;  2NUP B;  1WFS A;  1AK7 A;  1M2V B;  2XFA A;  5KYW A;  1NM1 G;  1WNJ A;  2QTV A;  1HQZ 1;  1AK6 A;  1D0N A;  1RGI G;  4KEF A;  1NPH A;  4Z94 G;  2VIL A;  1PD1 A;  3EG9 B;  3EH1 A;  3EGX B;  1VKK A;  2XF1 A;  3CI5 G;  4PKG G;  1M4J A;  3CJC G;  4KEE A;  4PKH B;  1SVQ A;  3FFK A;  1T3Y A;  2FF3 A;  5KYU B;  1V6F A;  1T2L A;  4LIZ A;  3EH2 A;  5L6W C;  1CNU A;  3TU5 B;  1C0F S;  4KED A;  1SVY A;  5KYX A;  3FG6 A;  1C0G S;  3L50 A;  1NMD G;  3A5O S;  2FH1 A;  1COF A;  2MV2 A;  5IVU A;  5KYY A;  1WM4 A;  1DEJ S;  4CBX G;  2NUP A;  1F7S A;  2HD7 A;  1M2V A;  2FH2 A;  1NLV G;  2LJ8 A;  5KYW B;  1M2O A;  5KYY B;  1UDM A;  3A5L S;  1QPV A;  2FGH A;  3FFN A;  5HVK B;  3EG9 A;  1SVR A;  2MP4 A;  3Q2B A;  2D8B A;  3CJB G;  5A1M A;  1PCX A;  3FG7 A;  1D4X G;  1H1V G;  4PKI G;  1T3X A;  2L72 A;  3EGD B;  1EQY S;  1P8X A;  1VFQ A;  1Q8G A;  4JD2 H;  1ESV S;  1PD0 A;  1YVN G;  2VAC A;  1P8Z G;  2KVK A;  5KYN A;  1J72 A; 
#chains in the Genus database with same CATH topology
 1Q8X A;  1TMW A;  3CIP G;  1JHW A;  2FH3 A;  5FAF A;  2NUT A;  4CBU G;  5FAE A;  3EGX A;  1X67 A;  1TVJ A;  3EGD A;  2LLF A;  5HVK D;  2LXX A;  1KCQ A;  3A5M S;  2VIK A;  5DD2 A;  5KYU A;  2NUT B;  3DAW B;  4S10 C;  3DA7 A;  3EFO A;  1AHQ A;  5KYX B;  2W0I A;  4CBW G;  3A5N S;  1CFY A;  1YAG G;  1T44 G;  4BEX 1;  1MDU A;  2MOT A;  2FF6 G;  2I2Q A;  3EFO B;  2FH4 A;  2NUP B;  1WFS A;  1AK7 A;  1M2V B;  2XFA A;  5KYW A;  1NM1 G;  1WNJ A;  2QTV A;  1HQZ 1;  1AK6 A;  1D0N A;  1RGI G;  4KEF A;  1NPH A;  4Z94 G;  2VIL A;  1PD1 A;  3EG9 B;  3EH1 A;  3EGX B;  1VKK A;  2XF1 A;  3CI5 G;  4PKG G;  1M4J A;  3CJC G;  4KEE A;  4PKH B;  1SVQ A;  3FFK A;  1T3Y A;  2FF3 A;  5KYU B;  1V6F A;  1T2L A;  4LIZ A;  3EH2 A;  5L6W C;  1CNU A;  3TU5 B;  1C0F S;  4KED A;  1SVY A;  5KYX A;  3FG6 A;  1C0G S;  3L50 A;  1NMD G;  3A5O S;  2FH1 A;  1COF A;  2MV2 A;  5IVU A;  5KYY A;  1WM4 A;  1DEJ S;  4CBX G;  2NUP A;  1F7S A;  2HD7 A;  1M2V A;  2FH2 A;  1NLV G;  2LJ8 A;  5KYW B;  1M2O A;  5KYY B;  1UDM A;  3A5L S;  1QPV A;  2FGH A;  3FFN A;  5HVK B;  3EG9 A;  1SVR A;  2MP4 A;  3Q2B A;  2D8B A;  3CJB G;  5A1M A;  1PCX A;  3FG7 A;  1D4X G;  1H1V G;  4PKI G;  1T3X A;  2L72 A;  3EGD B;  1EQY S;  1P8X A;  1VFQ A;  1Q8G A;  4JD2 H;  1ESV S;  1PD0 A;  1YVN G;  2VAC A;  1P8Z G;  2KVK A;  5KYN A;  1J72 A; 
#chains in the Genus database with same CATH homology
 1Q8X A;  1TMW A;  3CIP G;  1JHW A;  2FH3 A;  5FAF A;  2NUT A;  4CBU G;  5FAE A;  3EGX A;  1X67 A;  1TVJ A;  3EGD A;  2LLF A;  5HVK D;  2LXX A;  1KCQ A;  3A5M S;  2VIK A;  5DD2 A;  5KYU A;  2NUT B;  3DAW B;  4S10 C;  3DA7 A;  3EFO A;  1AHQ A;  5KYX B;  2W0I A;  4CBW G;  3A5N S;  1CFY A;  1YAG G;  1T44 G;  4BEX 1;  1MDU A;  2MOT A;  2FF6 G;  2I2Q A;  3EFO B;  2FH4 A;  2NUP B;  1WFS A;  1AK7 A;  1M2V B;  2XFA A;  5KYW A;  1NM1 G;  1WNJ A;  2QTV A;  1HQZ 1;  1AK6 A;  1D0N A;  1RGI G;  4KEF A;  1NPH A;  4Z94 G;  2VIL A;  1PD1 A;  3EG9 B;  3EH1 A;  3EGX B;  1VKK A;  2XF1 A;  3CI5 G;  4PKG G;  1M4J A;  3CJC G;  4KEE A;  4PKH B;  1SVQ A;  3FFK A;  1T3Y A;  2FF3 A;  5KYU B;  1V6F A;  1T2L A;  4LIZ A;  3EH2 A;  5L6W C;  1CNU A;  3TU5 B;  1C0F S;  4KED A;  1SVY A;  5KYX A;  3FG6 A;  1C0G S;  3L50 A;  1NMD G;  3A5O S;  2FH1 A;  1COF A;  2MV2 A;  5IVU A;  5KYY A;  1WM4 A;  1DEJ S;  4CBX G;  2NUP A;  1F7S A;  2HD7 A;  1M2V A;  2FH2 A;  1NLV G;  2LJ8 A;  5KYW B;  1M2O A;  5KYY B;  1UDM A;  3A5L S;  1QPV A;  2FGH A;  3FFN A;  5HVK B;  3EG9 A;  1SVR A;  2MP4 A;  3Q2B A;  2D8B A;  3CJB G;  5A1M A;  1PCX A;  3FG7 A;  1D4X G;  1H1V G;  4PKI G;  1T3X A;  2L72 A;  3EGD B;  1EQY S;  1P8X A;  1VFQ A;  1Q8G A;  4JD2 H;  1ESV S;  1PD0 A;  1YVN G;  2VAC A;  1P8Z G;  2KVK A;  5KYN A;  1J72 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...