1WNUA

Structure of archaeal trans-editing protein alax in complex with l-serine
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
154
structure length
154
Chain Sequence
MYSIEVRTHSALHVVKGAVVKVLGSEAKWTYSTYVKGNKGVLIVKFDRKPSDEEIREIERLANEKVKENAPIKIYELPREEAEKMFGEDMYDLFPVPEDVRILKVVVIEDWNVNACNKEHTKTTGEIGPIKIRKVRFRKSKGLLEIHFELLELE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords alanyl-tRNA synthetase
publication title Molecular basis of alanine discrimination in editing site
pubmed doi rcsb
source organism Pyrococcus horikoshii
molecule tags Hydrolase
total genus 44
structure length 154
sequence length 154
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-08-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.54.20 Alpha Beta 2-Layer Sandwich Replication Terminator Protein; Chain A, domain 2 Replication Terminator Protein; Chain A, domain 2 1wnuA02
3.30.980.10 Alpha Beta 2-Layer Sandwich Threonyl-tRNA Synthetase; Chain A, domain 2 Threonyl-trna Synthetase; Chain A, domain 2 1wnuA01
3RFNA 2ZZGA 2E1BA 1TKGA 1TJEA 1NYRA 1WNUA 1QF6A 2ZZFA 3KEWA 3RHUA 1TKYA 1NYQA 1V7OA 2ZTGA 1V4PA 1TKEA 3WQZA 1WXOA 2ZZEA
chains in the Genus database with same CATH superfamily
4E5ZA 1TKGA 3ZW7A 4A0AA 1QF6A 3I7LA 3ZWKA 2B5MA 2IUSA 2I06A 3I8EA 3ZU6A 1NYQA 1V7OA 3ZUPA 3I7KA 2Y6IA 3WQZA 3EI4A 2ZZGA 3I7NA 3I89A 4TZ4A 2IUTA 2EWJA 4XR1A 4A09A 1TKYA 4CI3A 1V4PA 1ECRA 4AREA 4A08A 2E1BA 3I7OA 3E0CA 4A11A 4A0BA 4AR1A 2Y50A 2ZZFA 4CI2A 3EI3A 3KEWA 3RHUA 3I7PA 5FQDA 2I05A 4E54A 3EI2A 3RFNA 4XR2A 3ZTWA 2B5LA 1TJEA 1NYRA 4XR3A 3EI1A 1WNUA 2Y3UA 4AR9A 2ZOSA 3ZX4A 3I8CA 2HYEA 2IUUA 3ZTYA 1XVIA 1WZCA 4AR8A 4CI1A 3ZWDA 4XR0A 2ZTGA 3ZX5A 3I7HA 4ARFA 1TKEA 1WXOA 2ZZEA
chains in the Genus database with same CATH topology
3RFNA 4XR2A 4E5ZA 3EI4A 2ZZGA 2E1BA 3I7OA 3I89A 3I7NA 3E0CA 2B5LA 4TZ4A 1TKGA 1TJEA 4A11A 1NYRA 4XR3A 4A0BA 3EI1A 4A0AA 4AR1A 1WNUA 1QF6A 2Y3UA 2Y50A 3I7LA 4AR9A 2ZZFA 4CI2A 2B5MA 2IUTA 2EWJA 3I8CA 4XR1A 2IUSA 2I06A 3I8EA 2HYEA 2IUUA 3EI3A 3KEWA 3RHUA 3I7PA 4AR8A 4CI1A 1TKYA 4A09A 5FQDA 2I05A 1NYQA 4XR0A 1V7OA 2ZTGA 4CI3A 4E54A 1V4PA 3EI2A 3I7HA 1ECRA 4ARFA 3I7KA 1TKEA 3WQZA 2Y6IA 4AREA 4A08A 1WXOA 2ZZEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RFN A;  2ZZG A;  2E1B A;  1TKG A;  1TJE A;  1NYR A;  1WNU A;  1QF6 A;  2ZZF A;  3KEW A;  3RHU A;  1TKY A;  1NYQ A;  1V7O A;  2ZTG A;  1V4P A;  1TKE A;  3WQZ A;  1WXO A;  2ZZE A; 
#chains in the Genus database with same CATH topology
 4E5Z A;  1TKG A;  3ZW7 A;  4A0A A;  1QF6 A;  3I7L A;  3ZWK A;  2B5M A;  2IUS A;  2I06 A;  3I8E A;  3ZU6 A;  1NYQ A;  1V7O A;  3ZUP A;  3I7K A;  2Y6I A;  3WQZ A;  3EI4 A;  2ZZG A;  3I7N A;  3I89 A;  4TZ4 A;  2IUT A;  2EWJ A;  4XR1 A;  4A09 A;  1TKY A;  4CI3 A;  1V4P A;  1ECR A;  4ARE A;  4A08 A;  2E1B A;  3I7O A;  3E0C A;  4A11 A;  4A0B A;  4AR1 A;  2Y50 A;  2ZZF A;  4CI2 A;  3EI3 A;  3KEW A;  3RHU A;  3I7P A;  5FQD A;  2I05 A;  4E54 A;  3EI2 A;  3RFN A;  4XR2 A;  3ZTW A;  2B5L A;  1TJE A;  1NYR A;  4XR3 A;  3EI1 A;  1WNU A;  2Y3U A;  4AR9 A;  2ZOS A;  3ZX4 A;  3I8C A;  2HYE A;  2IUU A;  3ZTY A;  1XVI A;  1WZC A;  4AR8 A;  4CI1 A;  3ZWD A;  4XR0 A;  2ZTG A;  3ZX5 A;  3I7H A;  4ARF A;  1TKE A;  1WXO A;  2ZZE A; 
#chains in the Genus database with same CATH homology
 3RFN A;  4XR2 A;  4E5Z A;  3EI4 A;  2ZZG A;  2E1B A;  3I7O A;  3I89 A;  3I7N A;  3E0C A;  2B5L A;  4TZ4 A;  1TKG A;  1TJE A;  4A11 A;  1NYR A;  4XR3 A;  4A0B A;  3EI1 A;  4A0A A;  4AR1 A;  1WNU A;  1QF6 A;  2Y3U A;  2Y50 A;  3I7L A;  4AR9 A;  2ZZF A;  4CI2 A;  2B5M A;  2IUT A;  2EWJ A;  3I8C A;  4XR1 A;  2IUS A;  2I06 A;  3I8E A;  2HYE A;  2IUU A;  3EI3 A;  3KEW A;  3RHU A;  3I7P A;  4AR8 A;  4CI1 A;  1TKY A;  4A09 A;  5FQD A;  2I05 A;  1NYQ A;  4XR0 A;  1V7O A;  2ZTG A;  4CI3 A;  4E54 A;  1V4P A;  3EI2 A;  3I7H A;  1ECR A;  4ARF A;  3I7K A;  1TKE A;  3WQZ A;  2Y6I A;  4ARE A;  4A08 A;  1WXO A;  2ZZE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...