1WNUA

Structure of archaeal trans-editing protein alax in complex with l-serine
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
154
structure length
154
Chain Sequence
MYSIEVRTHSALHVVKGAVVKVLGSEAKWTYSTYVKGNKGVLIVKFDRKPSDEEIREIERLANEKVKENAPIKIYELPREEAEKMFGEDMYDLFPVPEDVRILKVVVIEDWNVNACNKEHTKTTGEIGPIKIRKVRFRKSKGLLEIHFELLELE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular basis of alanine discrimination in editing site
pubmed doi rcsb
source organism Pyrococcus horikoshii
molecule tags Hydrolase
molecule keywords alanyl-tRNA synthetase
total genus 44
structure length 154
sequence length 154
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-08-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.54.20 Alpha Beta 2-Layer Sandwich Replication Terminator Protein; Chain A, domain 2 Replication Terminator Protein; Chain A, domain 2 1wnuA02
3.30.980.10 Alpha Beta 2-Layer Sandwich Threonyl-tRNA Synthetase; Chain A, domain 2 Threonyl-trna Synthetase; Chain A, domain 2 1wnuA01
1NYRA 2ZTGA 3KEWA 1WNUA 2ZZEA 3RHUA 1V4PA 1TKGA 2ZZGA 3RFNA 1TKEA 3WQZA 1NYQA 1TJEA 1WXOA 2ZZFA 2E1BA 1QF6A 1V7OA 1TKYA
chains in the Genus database with same CATH superfamily
4E54A 2IUSA 3I7KA 3ZX5A 3ZU6A 1V4PA 3RFNA 4A0AA 3WQZA 2I06A 1TJEA 3I8CA 4CI1A 4AREA 4ARFA 3ZWDA 4A09A 1TKYA 3KEWA 4XR2A 4AR1A 3I7PA 4AR9A 4A0BA 2ZZEA 1XVIA 4A08A 2ZZGA 1NYQA 1ECRA 2B5LA 1WXOA 4CI2A 4CI3A 2IUTA 3EI2A 3ZUPA 2ZTGA 1NYRA 2Y3UA 2IUUA 2ZOSA 4XR3A 3ZTYA 1TKGA 3E0CA 3EI1A 1WZCA 3I7NA 4A11A 2HYEA 3ZWKA 3ZTWA 3EI4A 4XR1A 2I05A 5FQDA 3ZW7A 2Y50A 3I7OA 3EI3A 4AR8A 1WNUA 3RHUA 4TZ4A 2B5MA 4XR0A 4E5ZA 1TKEA 3I7HA 3ZX4A 2EWJA 2Y6IA 2ZZFA 3I7LA 2E1BA 3I8EA 3I89A 1QF6A 1V7OA
chains in the Genus database with same CATH topology
4E54A 2IUSA 3I7KA 4A0AA 1V4PA 3RFNA 3WQZA 2I06A 1TJEA 3I8CA 4CI1A 4AREA 4ARFA 4A09A 1TKYA 3KEWA 4XR2A 4AR1A 3I7PA 4AR9A 4A0BA 2ZZEA 4A08A 2ZZGA 1NYQA 1ECRA 2B5LA 1WXOA 4CI2A 4CI3A 2IUTA 3EI2A 2ZTGA 1NYRA 2Y3UA 2IUUA 4XR3A 3EI1A 1TKGA 3E0CA 3I7NA 4A11A 2HYEA 4AR8A 3EI4A 4XR1A 2I05A 5FQDA 2Y50A 3I7OA 3EI3A 1WNUA 3RHUA 4TZ4A 2B5MA 4XR0A 4E5ZA 1TKEA 3I7HA 2EWJA 2Y6IA 2ZZFA 3I7LA 2E1BA 3I8EA 3I89A 1QF6A 1V7OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NYR A;  2ZTG A;  3KEW A;  1WNU A;  2ZZE A;  3RHU A;  1V4P A;  1TKG A;  2ZZG A;  3RFN A;  1TKE A;  3WQZ A;  1NYQ A;  1TJE A;  1WXO A;  2ZZF A;  2E1B A;  1QF6 A;  1V7O A;  1TKY A; 
#chains in the Genus database with same CATH topology
 4E54 A;  2IUS A;  3I7K A;  3ZX5 A;  3ZU6 A;  1V4P A;  3RFN A;  4A0A A;  3WQZ A;  2I06 A;  1TJE A;  3I8C A;  4CI1 A;  4ARE A;  4ARF A;  3ZWD A;  4A09 A;  1TKY A;  3KEW A;  4XR2 A;  4AR1 A;  3I7P A;  4AR9 A;  4A0B A;  2ZZE A;  1XVI A;  4A08 A;  2ZZG A;  1NYQ A;  1ECR A;  2B5L A;  1WXO A;  4CI2 A;  4CI3 A;  2IUT A;  3EI2 A;  3ZUP A;  2ZTG A;  1NYR A;  2Y3U A;  2IUU A;  2ZOS A;  4XR3 A;  3ZTY A;  1TKG A;  3E0C A;  3EI1 A;  1WZC A;  3I7N A;  4A11 A;  2HYE A;  3ZWK A;  3ZTW A;  3EI4 A;  4XR1 A;  2I05 A;  5FQD A;  3ZW7 A;  2Y50 A;  3I7O A;  3EI3 A;  4AR8 A;  1WNU A;  3RHU A;  4TZ4 A;  2B5M A;  4XR0 A;  4E5Z A;  1TKE A;  3I7H A;  3ZX4 A;  2EWJ A;  2Y6I A;  2ZZF A;  3I7L A;  2E1B A;  3I8E A;  3I89 A;  1QF6 A;  1V7O A; 
#chains in the Genus database with same CATH homology
 4E54 A;  2IUS A;  3I7K A;  4A0A A;  1V4P A;  3RFN A;  3WQZ A;  2I06 A;  1TJE A;  3I8C A;  4CI1 A;  4ARE A;  4ARF A;  4A09 A;  1TKY A;  3KEW A;  4XR2 A;  4AR1 A;  3I7P A;  4AR9 A;  4A0B A;  2ZZE A;  4A08 A;  2ZZG A;  1NYQ A;  1ECR A;  2B5L A;  1WXO A;  4CI2 A;  4CI3 A;  2IUT A;  3EI2 A;  2ZTG A;  1NYR A;  2Y3U A;  2IUU A;  4XR3 A;  3EI1 A;  1TKG A;  3E0C A;  3I7N A;  4A11 A;  2HYE A;  4AR8 A;  3EI4 A;  4XR1 A;  2I05 A;  5FQD A;  2Y50 A;  3I7O A;  3EI3 A;  1WNU A;  3RHU A;  4TZ4 A;  2B5M A;  4XR0 A;  4E5Z A;  1TKE A;  3I7H A;  2EWJ A;  2Y6I A;  2ZZF A;  3I7L A;  2E1B A;  3I8E A;  3I89 A;  1QF6 A;  1V7O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...