1WOAA

Structure of the loop6 hinge mutant of plasmodium falciparum triosephosphate isomerase, w168f, complexed with glycerol-2-phosphate
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
246
structure length
246
Chain Sequence
RKYFVAANWKCNGTLESIKSLTNSFNNLDFDPSKLDVVVFPVSVHYDHTRKLLQSKFSTGIQNVSKFGNGSYTGEVSAEIAKDLNIEYVIIGHFERRKYFHETDEDVREKLQASLKNNLKAVVCFGESLEQREQNKTIEVITKQVKAFVDLIDNFDNVILVYEPLFAIGTGKTATPEQAQLVHKEIRKIVKDTCGEKQANQIRILYGGSVNTENCSSLIQQEDIDGFLVGNASLKESFVDIIKSAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Triosephosphate isomerase
publication title Structures of Unliganded and Inhibitor Complexes of W168F, a Loop6 Hinge Mutant of Plasmodium falciparum Triosephosphate Isomerase: Observation of an Intermediate Position of Loop6
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Isomerase
total genus 93
structure length 246
sequence length 246
chains with identical sequence B, C, D
ec nomenclature ec 5.3.1.1: Triose-phosphate isomerase.
pdb deposition date 2004-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00121 TIM Triosephosphate isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1woaA00
1M7OA 4E2BA 1DBTA 3PC0A 3NQMA 5KSWA 4EF9A 2J9ZA 3L68A 3M6YA 1FWWA 3C2OA 3DHFA 2ZZ4A 1U83A 5ABTA 1Q6QA 5G1TA 3TCEA 4N9EA 3TAOA 4KFOA 1QOPA 4RZ5A 5CZJA 2VXNA 4JTHA 2A1YA 4NJHA 5BNKA 2PE4A 1FQ0A 5DXYA 1C9DA 4LWWA 4DELA 4NZJA 4N2YA 1ALDA 3LBCA 2EGZA 3NQVA 3H53A 5LNSA 5DCDA 3B8DA 3NDOA 5CSRA 1Q45A 1V7YA 1V5XA 4GJ1A 1ME8A 3L2IA 1BWLA 4O11A 4XBKA 4C1KA 3IIXA 5DCEA 3SR7A 4ICNA 3HG2A 4N9CA 3GR8A 4NU7A 5AHFA 1OFPA 3O05A 2JBMA 2QUTA 1XBVA 4LNYA 4OBTA 3QW4B 3DKLA 1I2PA 5G1YA 3DFOA 3TSBA 3IVUA 2Y7DA 2ZQ0A 4FX8A 4GUGA 3LM7A 3OIXA 4LS0A 4JX4A 4ZL1A 3G3MA 1HG3A 3QC3A 1B4KA 2FLIA 4LS2A 5K2ZA 3G24A 3P8IA 4X22A 3O8AA 2E6AA 2LLEA 1O4UA 3I7QA 1H7OA 1B9BA 1JVNA 3SGUA 3FIGA 2YW4A 3W7PA 2OT1A 4LVFA 4FNTA 3W83A 1I8JA 1T96A 1KV5A 3QRHA 2VEMA 1YDNA 4GNJA 2B7QA 4UXDA 1JR1A 3LCGA 1DORA 5U4NA 4DO5A 2C15A 3W7MA 3ABRA 2QF7A 3EWZA 2EAWA 2YZRA 4JYDA 3T44A 3DENA 3KXQA 1JCYA 4MY9A 4KKXA 1BKSA 4UTTC 1OVDA 3M5YA 5LNVA 1T8XA 1P0NA 4FNRA 3W72A 2FTPA 1L6YA 3DU0A 4IQLA 3P8JA 1WAUA 3PS7A 3UWYA 3WK0A 3UPBA 1DL3A 1UUOA 4TMBA 4UTWC 1VCGA 4PEKA 2Z6IA 4A2SA 1SFLA 4JR5A 3VE7A 4LUIA 4O4VA 5G2IA 1EA0A 3LX9A 2A7RA 3GDMA 3PR2A 2QCFA 1UJPA 1K3UA 4LOCA 1OJXA 3H54A 4O50A 4CNOA 4P61A 4KFPA 3JR2A 3NQGA 1VYSX 3W7HA 4ADUA 3W2KA 5F2LA 1TRIA 4JGDA 1PCKA 1TPDA 4DO4A 5LSMA 3IRDA 1N8FA 3Q2DA 5EA9A 1LP6A 1W37A 4OQVA 2B7OA 4BFAA 1JJKA 3C52A 4U4MA 3EEGA 2P10A 3EWYA 5DY2A 1SPQA 1SU5A 4WQ6A 3EX2A 3T7VA 4YWIA 1KTBA 3KRSA 4H6KA 3W6YA 2YFNA 2ZZ3A 3L5MA 3N2MA 3NO5A 3MW7A 5D38A 1ZAHA 4ORIA 4JTEA 3TX9A 3DFQA 3I7SA 4ALDA 3WJXA 3ZFHA 1QPRA 4UCGA 4BWLC 4O1DA 5LNWA 5EKYA 5IBXA 4LVAA 4RV8A 1IIHA 5CPOA 4IJBA 4RCXA 2ZRXA 2F7FA 5EYWA 4GWEA 1W56A 3WK1A 4DF2A 3S6DA 4DEFA 1G69A 1R30A 5T26A 2V9DA 3TA6A 1YXYA 3BLEA 3GLCA 4AF0B 1IXNA 5D37A 2NV1A 5LNRA 5TQLA 4M5PA 1B3OA 5D03A 4UFHA 3MJYA 2YW3A 4DBEA 2OX1A 1ML1A 1TSIA 4LVBA 4JICA 1FCUA 1ZCOA 4TR9A 2WNZA 3OVPA 3EXSA 1GOXA 2V81A 1Q6LA 4RK8A 1UASA 3W7NA 4RLIA 1HL2A 4NUWA 4UUIA 1XUUA 3V1PA 4AVFA 3L5AA 1GTHA 1CI1A 1TREA 3W1QA 3M5XA 3CB8A 4L4LA 3MHUA 4I7WA 4WX2A 2CZEA 3ELFA 4QAIA 1HFBA 1Q3NA 4M6VA 5D30A 4CCCA 1D9EA 1OFAA 4MPQA 3S1VA 4C1LA 3LDVA 1WQ5A 4WZHA 1TPB1 5C2XA 4UTHA 2BXVA 5LHEA 1F73A 1FDZA 1UBSA 2QCDA 1RPXA 3PM6A 2WNQA 3VE9A 1Q6RA 3W7DA 1KW1A 3GAYA 4FEZA 1WXJA 3NOEA 4GE8A 2J9YA 4PC8A 2DZPA 1SO5A 1WA3A 5AHLA 1L6SA 2V5LA 5CZSA 4KWWA 3PUDA 4A21A 1GPWA 3B0VC 3A21A 3E9AA 3NQFA 2XFWA 1YDVA 5I3IA 1W5OA 4IMDA 3RNDA 3LHTA 3RFAA 3QMRA 2GVLA 1TPVA 3M5VA 1S5VA 3P61A 5FEWA 1KM0A 1I2NA 1TPC1 2YGYA 1IXQA 1DQXA 1FBAA 4ZQOA 4HPJA 3E12A 4HKPA 3MBDA 1W3TA 1IXPA 2CZDA 1TJRA 2E6DA 2ZRVA 1GQNA 3IV3A 3LXAA 3A24A 4LV9A 2Y88A 5E93A 2QEZA 4O0KA 3MMTA 4K7YA 1WX0A 5AB3A 2NXGA 3FS2A 4AMAA 2RKXA 3T40A 2NX9A 2QCMA 3SY5A 2B4GA 1G4EA 1GVOA 2CZ5A 3GXTA 2QUVA 1XDLA 2PURA 3QQ1A 4NX0A 2QAFA 2GVGA 1XDMA 3PG9A 4DBDA 2HS6A 3SI9A 3TAKA 1W5NA 1OFQA 3C2EA 3DH7A 5CZ0A 2AQWA 2DZXA 1H7PA 4ZMGA 4WD0A 3FKRA 2BSLA 1AK5A 5U7SA 3GDKA 4UTLA 4PTNA 1LM1A 5HMSA 3PB2A 1EIXA 2CLHA 2ABAA 2RHGA 2G95A 1MSSA 3N73A 4UFIA 1NVMA 5BMXA 5F2GA 1XUZA 4NJGA 4Q32A 1MO0A 1I4NA 2P0OA 3GX9A 4JX5A 1EUNA 3BVJA 3KX6A 2CWNA 2TRSA 3A5FA 5CKSA 4XQ6A 4AHPA 4AWSA 2NWRA 1EX5A 4MY8A 3P5ZA 3CPRA 2C14A 3I65A 4MJMA 4XZ9A 4UTJA 3LCLA 4I7UA 3UXDA 3VCRA 4EVZA 1TV7A 3W7KA 1W31A 1LROA 2Z2UA 3HG3A 3P67A 4EWND 1OFOA 3FA5A 3A22A 1FWNA 4JIPA 3IIZA 3STGA 3TJXA 5AYYA 3W1NA 1LORA 1O5XA 5TBOA 5DXXA 3QFEA 1D3GA 1GG0A 3PBWA 4O0ZA 3NL2A 4UFJA 1TTIA 4MKNA 4MY1A 1QPOA 5DBUA 1ZAIA 2GJNA 1JCNA 2ATMA 2BLEA 4OU1A 1FCVA 2C19A 3E02A 3QH2A 3DBPA 4N6FA 4DF1A 1KLZA 3U8GA 1MEIA 2A7NA 3SECA 3WK3A 1OFRA 2KZHA 3GK0A 1Z44A 1UCWA 1YDOA 3LCXA 1F2JA 4ADTA 1JUEA 4JYEA 3DI0A 4RZ4A 4IXHA 3C4UA 3LI0A 4NNCA 1X1ZA 3LTSA 3MI2A 4KFNA 1A5AA 3NA8A 1AW5A 5K3VA 1SFJA 3GDLA 2A21A 4W9TA 3LHYA 3UNDA 4UR7A 3TNOA 1S3HA 2A5HA 1SZNA 5HULA 1KM5A 3B0PA 3TXZA 3HMJG 1R2SA 2BX7A 1KFBA 4S2BA 1FWRA 2NWSA 3BGJA 3F4NA 1XM3A 1I2QA 1H7RA 4OV9A 3GR7A 4S2CA 3W87A 1OYCA 2JKAA 5HQEA 3W1TA 2J88A 1LRTA 5D2YA 4PODA 3NPVA 2ZDRA 2G5WA 4PL1A 3HPXA 1I2RA 5EL1A 3O06A 1ICPA 3UWQA 3N3MA 2FIQA 2ZZ6A 3G1YA 4A29A 1Z48A 2OT0A 2ZTKA 5D05A 4Z1DA 1X1OA 4FIQA 4WOQA 3UWUA 3PF3A 1HO1A 5LHFA 2DORA 5D2VA 1FCBA 3W74A 1S5TA 2XN2A 1FX6A 3GNNA 1QR7A 5A8GA 3M9YA 3P80A 1LCOA 4FB7A 3UWWA 3NL5A 3L0NA 3EX6A 4PH6A 1KFCA 3S1UA 1YYAA 2CLKA 3W1UA 1A5CA 3NGJA 4TU1A 1XFBA 4ZVJA 1R46A 1Y0EA 3NPXA 2ZTJA 4RXFA 1T0OA 5FF3A 5G2WA 3WFAA 2NX3A 4IMFA 2VFFA 3TR2A 2PC4A 3RF9A 4IGHA 4FX6M 1RZMA 3S5OA 1BEUA 3O1NA 3VI2A 5CPLA 3T4CA 3OVRA 3RLVA 1LBFA 3WJZA 1MXSA 5FEXA 4GC4A 1L6WA 3R5EA 1EB3A 3UZ5A 2DP3A 4YXGA 1O5KA 3TUUA 3C0JA 3FJLA 3W2MA 3BW2A 1PHQA 2GQ9A 5TIMA 3W9ZA 4HT3A 5DY3A 3GIYA 3TJLA 2B0MA 2QDGA 2FQIA 2G97A 2ZFAA 3STCA 4ZQMA 3LHWA 5KITA 1YTDA 4JX6A 3PSVA 5KINA 3QYQA 3TC7A 2QCDB 4EIVA 1SZEA 1W0MA 3GXPA 4OT7A 5G5IA 1R2TA 4N02A 3CIWA 5D2WA 3R2GA 4LS1A 5EMUA 1TV5A 2DU2A 1XI3A 4Z08A 3W2JA 3W1PA 4GRSA 1M6JA 1VYRA 4ZZ9A 3K30A 2CFFA 5AYXA 4O10A 5FF7A 4JTJA 4CCEA 3LRKA 3WJSA 5HINA 3FYOA 1TPH1 4IXXA 1OHLA 1G7UA 1Q6OA 1WYIA 4X9SA 3G0SA 3NQCA 4JTSA 1KTCA 1M5WA 4UFLA 2X1TA 1KM1A 1YXCA 4IX2A 2WV8A 5K9CA 2RDUA 4P2VA 1WV2A 4M6PA 3EWUA 3HGJA 3S42A 2X1RA 4EF8A 1KBJA 4L4MA 5KZDA 1A5SA 3LERA 3W1AA 2QAPA 1EP3A 3F1QA 2HS8A 3R12A 3S9YA 1KM4A 1ME7A 3THQA 2FJKA 4UMAA 4NJIA 3BW4A 4X2RA 5KTLA 1W8SA 3C61A 3DKJA 4QIUA 3NR0A 3NZRA 3ABOA 2VENA 1JQXA 4CQ8A 3TW6A 3CWOX 1LDCA 1S5WA 3LLFA 3W2UA 4OHQA 3NQEA 5J5RA 1ZALA 4UFKA 5KZEA 5LZLA 3UPWA 2W79A 3DAQA 4LW7A 5IBXC 2F84A 3NG3A 2JGQA 4AHQA 4Z0JA 3PUEA 4NVTA 1GT8A 2X2GA 3MUXA 1F5ZA 4K7VA 1GG1A 4D2JA 2CLFA 4JNMA 3W71A 5BOOA 1K7FA 3FEMA 1KFEA 3CWNA 3M16A 3PSWA 3T78A 3CU2A 4O18A 1R47A 2DZWA 5GVJA 3DGRA 4UNKA 3MWAA 1TPEA 3FFSA 2V2HA 3BGGA 3LCHA 1F05A 3C2RA 1QCWA 1SO3A 2YCEA 4HIBA 1VC4A 2WOQA 4K38A 1SR9A 3HPZA 4BK9A 4GBUA 3TQ0A 3BARA 2Z1BA 4JTFA 2ABBA 3HOJA 3TROA 3O07A 4LY8A 4NXKA 1EP2A 5HR7A 4FNQA 3P60A 1GVSA 2GVJA 4LUJA 4AH7A 3ABSA 5EPDA 4CLMA 1GYLA 1K02A 5F4XA 4YLWA 3RLUA 4FIRA 2Z0IA 3L0GA 1PS9A 4S1FA 2EF9A 1LBLA 5IM51 5CPNA 4NQ1A 3OBKA 1H7NA 4N6EA 2Q3RA 2PRMA 1EEPA 4CCDA 3IEBA 2HSAA 3TDFA 2VEPA 3UWZA 2FPYA 4O57A 2H3BA 5DLCA 3TK7A 1Z42A 2WKJA 1X6UA 1PL9A 3KRZA 3TFXA 4MJZA 1YTEA 1OF8A 3FLUA 2WSRA 4NT0A 2CLIA 2ZA1A 4FO4A 1NAL1 3A9IA 4IX0A 3PULA 3SIZA 2A0NA 2CZFA 1LLZA 1KM3A 3DZ1A 3OVQA 2VC6A 3M0ZA 3RU6A 2ZA3A 4JTIA 5L6UA 3G1FA 1NSJA 2DZSA 4Z1BA 3LI1A 4WOZA 1VZWA 3UD6A 2NV2A 4N9BA 1M7PA 4E0CA 3GYEA 1YTKA 3QEZA 5A5WA 4LT9A 1IIGA 4I9AA 3LBMA 2Y7GA 3R89A 3P62A 3MI3A 3EKLA 1IF2A 3M7WA 1AMKA 1L2UA 3MHGA 2I14A 4MVAA 4JS3A 4MIMA 1JCLA 1QNVA 5F4WA 3WK2A 2TPSA 2NX1A 4IPIA 3W1RA 7TIMA 4WJEA 5KMYA 3HJZA 4O16A 1H51A 3U2OA 3ZS4A 1SW0A 3PB0A 4K8HA 3HO8A 4BF9A 4Z0SA 3HPSA 2YX0A 1TCDA 1WBHA 1XCFA 2A6LA 4M7TA 1WBJA 2Y89A 1A50A 1LTDA 1B4EA 1KM6A 1LRQA 4O14A 3Q94A 1C29A 1QFEA 3O15A 3NNTA 2GJLA 1TQJA 3DFTA 4O28A 2J9XA 3SZ8A 3DHDA 5C54A 4AAJA 2Y85A 1VCVA 3LRLA 4RX0A 4AXKA 1HUVA 2ZRWA 3YPIA 1DV7A 1ZNNA 2E68A 3S5ZA 1XXXA 1KTNA 3UXAA 4O12A 1OX4A 4WY0A 1DVJA 3PY2A 5K4XA 3HG5A 4FX7A 1JUKA 4XUGA 5CG7A 2E5BA 3PBYA 4RKAA 4OE7A 5HUOA 1F6KA 1H50A 3PBVA 3NM1A 3OG3A 4NJKA 3A23A 3W7GA 2OCZA 3BG9A 3FKKA 3FOKA 2EPHA 2A4AA 2NZLA 4UTMA 5K4ZA 2Q3OA 2QCCA 3EXTA 1TJPA 4OGZA 3W75A 1ME9A 4GFSA 3M1ZA 1ZFJA 3F4WA 2ZBTA 1KBIA 3MP4A 3CLMA 5D2TA 1YLVA 3NL3A 1W5QA 3LCWA 4CNNA 1K8XA 3EWWA 1ZHAA 3IGSA 3JS3A 4HNVA 2C18A 2ZRUA 3CM4A 2AAMA 1KFJA 1J4EA 2XN0A 4O54A 4DQWA 5HNRA 4UTUA 5K9DA 5AHMA 5G4EA 2Y61A 2DZUA 2FB2A 4QJ1A 3T55A 3EWBX 3L65A 2VELA 4N4PA 3QMSA 2OJPA 4IWWA 2ISWA 4N4QA 1VCFA 3NEVA 3P5YA 3ANYA 1XC4A 3G1AA 1AL8A 2VEIA 5KZMA 1TPWA 3W3OA 2C13A 3NYZA 4Y9AA 5D2XA 1K7EA 1ICQA 2YR1A 3ATZA 1K7XA 2QUUA 1XL9A 5CGQA 4UR8A 2V8ZA 1GVQA 3MHFA 5G4WA 1VH7A 1SW3A 3EX3A 3V75A 3BO9A 1H61A 5LGZA 2QR6A 1TYGA 6TIMA 1F6PA 3DXIA 3BLIA 2GPTA 2E5CA 3CC1A 1TIMA 3HB9A 1AG1O 3GKFA 1VLWA 2FDSA 3TSDA 4J9JA 1W5MA 2A7PA 1G67A 2GUUA 3GKAA 3S5NA 1G4TA 1JCJA 3KHJA 4JTUA 1T99A 3P82A 3S1XA 1QAPA 2ZZ2A 3QJAA 3HG4A 3UZJA 4MUZA 1A53A 5H91A 1KFLA 4RZ6A 3G1XA 2E6FA 4ZQRA 1LLWA 3ZWTA 5AOUA 2ZYFA 2G96A 1GWJA 4DO6A 1SO6A 3KRUA 1O60A 2TMDA 1SZGA 3P7YA 4MOZA 4X3ZA 4XTIA 5DN1A 1JULA 2Y70A 4Y8FA 4JTLA 3W7EA 1GVFA 1W3NA 4UIOA 3G1DA 3E0IA 3QQ0A 1L9WA 3DFNA 3Q58A 3INPA 5K9XA 2NXHA 3B04A 1OX6A 4LC6A 4R33A 4JDYA 2VEKA 4E2DA 5L9FA 2V2CA 3P74A 1ZENA 1SUXA 1FCQA 1KA9F 2A6NA 3L9CA 4JXCA 3O6CA 2OMAA 4O8RA 2V0TA 3ATYA 3M44A 2H8ZA 1ZAJA 1SZFA 3I7RA 3LCIA 3EWXA 1TV8A 3G22A 2TSYA 4O52A 1VR6A 1K8ZA 1O94A 5FEPA 1LYXA 1BWKA 4M19A 5CPMA 4IMCA 3GNDA 3CEPA 3M43A 2J27A 3LV5A 3W22A 3TIMA 2QCGA 3AO0A 4FNSA 4JY9A 3LGEA 4O15A 3PAJA 4YL2A 5FESA 2BWGA 1H5YA 3ABQA 3MYOA 1WDWA 1FWSA 4CQ9A 4CNPA 2BTMA 2QJGA 3HQ1A 4LC8A 4ONVA 3EX1A 1WOAA 2AGKA 3LLDA 5I3JA 1OK6A 1XBXA 1X8FA 3S8HA 5MHBA 3B4UA 1VS1A 2O7SA 1KLYA 3B03A 3C56A 3BK0A 4CQAA 1OYAA 3G0XA 2PRLA 1GTEA 4UMCA 2X1SA 1YPFA 3QPYA 3B05A 3HGRA 1FXPA 3SSJA 1E51A 2ZZ5A 3IVTA 1TO3A 4IMEA 3L5LA 1B57A 3WJWA 2E5DA 3O6YX 3IGXA 4ZQNA 1QWGA 1H1ZA 3NPUA 3UY7A 3KAOA 4BI6A 1GZGA 3W7IA 2WSQA 3S1WA 3S5YA 5I3KA 2X16A 4GUHA 5AC8A 3DFSA 3PVFA 5SWUA 3NQAA 3LHVA 5H2ZA 4MFEA 5HWJA 1X7FA 2ISSA 4Y96A 1RR2A 4IUOA 3C2VA 2HTMA 3LOTA 3Q37A 1H7WA 1H63A 3TFCA 3QMTA 4NXSA 5FF4A 1AW2A 1XBZA 5DBTA 1F74A 4K6AA 3N9SA 1Z41A 2Y7EA 2EKCA 5J5DA 4GUJA 1QO2A 4O1AA 4Z1CA 2ATSA 2YPIA 2WJZA 4NNBA 3W7OA 4O19A 1RD5A 4HSOA 3W70A 1VQTA 3UQNA 5AN7A 5EBUA 5G2HA 2A85A 4K36A 4HNUA 3QW3A 4AWUA 1OX4B 5FF2A 4WY0B 2A2IA 3I6RA 2CW6A 1RQHA 3W1MA 4R7JA 3TQVA 1OFEA 4QM1A 4XKYA 1IGSA 4GXMA 4DF0A 1FDYA 1SW7A 3NZ1A 1PV8A 2E77A 2ZZ1A 4HNTA 2DZTA 3THAA 1LOQA 1QPNA 3NVTA 2DZVA 2FPTA 4UTKA 3VFLA 4LTSA 5BRBA 4BI7A 4K39A 3KVLA 2QCHA 3W85A 4XTDA 1XKYA 4UTIA 4O17A 4A3UA 1VHNA 3LTPA 4LV4A 4Y6GA 1KFKA 1EWEA 4M6QA 4JTKA 3O16A 4O1BA 3MBFA 1DHPA 1TRDA 4JIQA 3IIOA 3NQDA 1PVNA 3LV6A 2ZCGA 3C3NA 4UC5A 2Y62A 3TH6A 2WNNA 2NUXA 1H60A 3L21A 1TQXA 4JTGA 3H55A 3QM3A 1LOSA 2GOUA 5D33A 2E6YA 3JRKA 4K37A 3W73A 5C5YA 3SJ3A 4TIMA 4O4WA 4XBSA 3C6CA 5K7JA 2Y7FA 4DXVA 4MFDA 5LNUA 2W6RA 4RR4A 4DPQA 5F2MA 3B06A 3W76A 1G6CA 3G1VA 4Z1AA 3LXBA 1R2RA 4XWUA 2BZNA 1YPIA 1KM2A 6ALDA 4WXYA 5F1UA 4AEOA 3D0CA 2X1UA 3N34A 4POCA 2Y63A 1IXOA 2V82A 2PRHA 2V2DA 2YFOA 3EXRA 1NF0A 5HUPA 3W86A 3VNDA 3TV8A 2CLMA 3HGOA 2PCQA 4YMZA 1JRBA 3UY8A 3S0CA 3VKJA 4HSNA 3W1XA 2WO5A 4OV4A 2XN1A 1FDJA 1HTIA 1LOLA 5F2IA 1FXQA 4AWTA 3KVKA 4QISA 2ZRZA 1G4SA 1KV8A 4QQ3A 4MZYA 5BW6A 1OX5A 1FUYA 4FNUA 3UWVA 4YCOA 1QOQA 2NXIA 5E0KA 2ZZ7A 2CU0A 4UFMA 3NAVA 1QMLA 2RFGA 1W54A 3GVGA 2E1DA 4TO8A 3G18A 3STEA 3O63A 4KWVA 1LBMA 2H8XA 3RMJA 1FY6A 3GZ3A 1GVRA 5CZTA 1QO5A 3WJYA 3TW7A 4WXZA 1AW1A 4UTTA 1U5JA 2QJHA 4R53A 2CLEA 2ISVA 3BW3A 3PBUA 5AYZA 3FJ6A 2WQPA 1GYNA 1P4CA 4IOTA 4IPJA 3G3DA 3GDRA 4A22A 5D09A 2ALDA 4UTWA 4HNNA 2B7NA 1JUBA 4QNWA 2FFCA 1DOSA 5FI8A 4PCFA 3M41A 1QPQA 3W23A 3KFTA 3CIXA 1CX9A 3LHZA 5LKYA 4ML9A 5LGXA 5EY5A 1AL7A 2QCNA 3P84A 2W0UA 2CLOA 3NL6A 1LRNA 3R13A 4IMGA 3STFA 3W7RA 4QNEA 1JCMP 5D32A 2HMCA 1VJIA 2OZ0A 1PHWA 1I45A 4H4IA 3HF3A 4JTTA 2H6RA 4JN6A 1W1ZA 3NQ6A 4LVDA 4U28A 5AC7A 3CTLA 1YADA 3W2NA 1RVGA 2R94A 3LCFA 1J2WA 3SGZA 4BWLA 3MYPA 3LXCA 3E49A 4A2RA 3PUOA 4TMCA 4K8EA 1TB3A 2V5BA 4JY8A 1FWTA 1O95A 4GUIA 5C55A 1EUAA 2R14A 4DPPA 3TU9A 4Y90A 3TMQA 5I3FA 2YSWA 3W7LA 1W3IA 5D02A 1ICSA 3NQ7A 4FF7A 3QSRA 4PL2A 3QSTA 3N9RA 5FF0A 2RDTA 3BG3A 3KVJA 2I9EA 3MI6A 1PIIA 5BMWA 4GUFA 1NF7A 4MLJA 1PE1A 1WOBA 1N55A 4LRSA 2NLIA 1N7KA 2DJXA 1W5PA 2QJIA 1DJQA 4NX5A 1F76A 5HJLA 2FB3A 3CEUA 2EHHA 3QPZA 3IIVA 3MO7A 4LVGA 2RH9A 1H1YA 4E38A 1MEHA 2R8WA 2Z6JA 3LHUA 3L66A 4LU0A 2C16A 1ZY9A 4O53A 2R91A 3NPWA 3HIJA 3MP5A 2VFHA 2Q8LA 3W2LA 4M7SA 4UMBA 1SO4A 2QKFA 3N14A 4JDBA 4UNLA 3SFKA 1JQVA 3W1LA 3GB6A 4JD4A 1I2OA 1VYPX 1OFDA 2VFDA 4FXRA 1CW2A 3L67A 4XKYB 4G1KA 3G0UA 1C8VA 5F4SA 3NQ2A 4ZQCA 1OABA 1GJPA 1YXDA 1UB3A 1H7XA 3O6DA 2H3DA 2YYUA 3BV4A 4NNAA 4WUIA 2FPVA 3BLFA 3W7CA 2J6XA 5AHIA 2GQ8A 5HWMA 2V30A 1TTJA 4O13A 3DI1A 2QCLA 3USBA 3OHIA 4R34A 3W7QA 4RJEA 1ADOA 3TXVA 1RV8A 3QZEA 4EOUA 3LB0A 3P81A 1VGAA 1TPUA 2P1FA 4MZ1A 4I7VA 4LRTA 3HGSA 1OF6A 4FHAA 3FYPA 1SQ7A 4NZFA 1P5BA 3KOFA 3BG5A 3OA3A 4RXGA 3EX4A 2X30A 1SSDA 2JKEA 1F7BA 1TPFA 2GQAA 5HWNA 1P1XA 2WSYA 1QDSA 5D04C 1DQWA 1K8YA 3IIPA 8TIMA 3M5ZA 1NEYA 2VFEA 3DFPA 3TE9A 1OK4A 2VFIA 3C8FA 3CHVA 4FNPA 4MYAA 4QITA 3KVMA 5I3HA 3TSMA 1PCWA 3G8RA 3G1HA 2YYTA 5CSSA 3SW6A 2I1OA 3BPWA 4OWGA 3IVSA 3CQ0A 4HPXA 4ADSA 3TC6A 1VHCA 1A5BA 3TKFA 3M47A 2YDAA 3ZR4A 2JK2A 4BI5A 4O1CA 3W88A 2IQTA 1ONRA 5AFDA 3GDTA 4FXSA 4BR1A 1RQEA 1P0KA 3EKZA 1TMHA 3G1SA 3W7JA 3LTYA 4Q33A 2UV8G 3NM3A 5AC6A 4HN4A 3NXFA 4AB4A 2E09A 2YXGA 2C6QA 3EB2A 4B5NA 5C6MA 1TTQA 1SSGA 3RK8A 3GXNA 1D3HA 4HHPA 1RQBA 4YCPA 2H90A 5AHEA 4AF0A 1K03A 1G4PA 4WY0F 1OG0A 1OFBA 3N2XA 3G8EA 1J5TA 1EP1A 3AJXA 4N9DA 2NUYA 3IGUA 4PA8A 3MP3A 3A5VA 4JEQA 3ZWSA 4TX9A 2VOMA 3TQKA 1VRDA 1H62A 1VLIA 3I68A 3NQ8A 4NJJA 4QSHA 5E1QA 5F1VA 2C1HA 2CLLA 3TMLA 2WPBA 4MZ8A 4PFMA 2B7PA 5HR6A 2JKPA 2JGYA 2QCEA 3LRMA 3HBLA 2C0AA 5AHNA 3W07A 1MEWA 2RDWA 4MLRA 1THFD 1JCXA 2D73A 1DJNA 3C2FA 3E96A 1LZOA 3L0KA 1NFBA 1OYBA 2Y6ZA 4MYXA 3OEXA 1GEQA 3QF0A 1ZJIA 3F03K 3UYCA 1JRCA 3U6WA 2J24A 2QDHA 2Q8ZA 5DCBA 2ZA2A 3GAKA 4ZQPA 3B0UX 2VFGA 1XBYA 3PWAA 2ZRYA 4AHOA 2DJLA 1MZHA 1UUMA 1G7VA 3W84A 1EWDA 2O7QA 3PG8A 1HO4A 5DELA 1DKWA 1BTMA 2TYSA 5I3GA 3R8RA 2VKZG 3N19B 5FEZA 1EPXA 1TTPA 2C3ZA 4JYFA 1VPXA 3CT7A 4Q4KA 4ORMA 4H3DA 2NUWA
chains in the Genus database with same CATH superfamily
5FD0A 3POHA 4EF9A 3L68A 2P88A 2BHYA 1XWYA 2IQDA 2XIOA 1A0CA 3VOJA 1HGYA 5ABTA 4AC1X 4N9EA 3TAOA 4KFOA 3BAJA 4UOZA 3WLKX 6ENLA 3O7UA 2UBPC 4LWWA 1GORA 3AROA 4NZJA 3NQVA 3LPPA 1S2AA 5GJMA 1R3SA 3QY7A 4JIIX 1V7YA 1KKRA 1V5XA 4PMOA 1ME8A 1RJPA 4O11A 4AVOA 3HG2A 4N9CA 1E15A 2JF7A 3GR8A 4NU7A 5AHFA 3URBA 1VBGA 4L5ZA 1HKVA 3RAOA 2AQVA 3OOQA 3BOXA 4XB3A 5G1YA 4WDTA 1ITXA 1IEQA 4O1EA 3VGGA 4HA1A 2ZQ0A 3H2MA 4P5UA 4FX8A 1SFTA 3OIXA 2WMGA 3G3MA 3OU8A 3QC3A 2FLIA 2OZTA 4LS2A 3CS2A 3G24A 3PPGA 2HCVA 3GDBA 1XRTA 1E0TA 3N29A 3H4GA 5CGMA 2RGLA 3TOYA 4D6CA 5HOSA 3QKZA 1F3WA 1JVNA 3FJNA 2OT1A 1MW2A 1PZ1A 3R79A 3WBYA 2WVVA 3WIJA 3DUGA 5I06A 1YDNA 4PTXA 1JIBA 2DDXA 2B7QA 2EPKX 5U4NA 2ZC8A 2C15A 3W7MA 1WUEA 1U22A 4DZHA 1BPLB 2PF8A 3EWZA 4PMDA 2YZRA 3UCCA 3V5OA 2WB5A 4FLRA 4UB9A 3DENA 3KXQA 1JCYA 4KKXA 1AH4A 1EDTA 1OVDA 5EFDA 1FP8A 4FNRA 3W72A 2CHOA 4UOQA 3DU0A 2VM8A 1WAUA 3WG6A 2DQWA 1EQPA 1HJQA 1DXIA 4UTWC 1VCGA 2F6UA 4NIRA 2P50A 2FH6A 3VNMA 3VE7A 5G2IA 1C92A 1EA0A 1BF2A 2CZVA 4LOCA 1OJXA 1U1HA 1JPDX 4KFPA 1EZWA 3VNYA 3W2KA 3HQNA 3N25A 1PCKA 4DO4A 4I3GA 5FJRA 1FFRA 3Q2DA 1LP6A 2VP8A 2Y8VA 3C52A 3EEGA 3QC0A 2W92A 3EX2A 1KTBA 4H6KA 1EJRC 3SJNA 1PEZA 1PYMA 3N2MA 4JKMA 3NO5A 5FCZA 2EJAA 2P76A 2CHNA 4JTEA 1E6PA 1UROA 3WLQA 2ZUWA 3WJXA 2J13A 3WUEA 4BWLC 4O1DA 2BXZA 4F79A 4RV8A 1A5OC 1HJSA 4KEVA 3FDKA 4ZENA 5CPOA 1DWIM 1BQCA 2ZRXA 5IFPA 2F7FA 3AIEA 2WC3A 4A35A 4CEXC 3VZZA 4GWEA 4DF2A 3FDGA 2J77A 5T26A 1UD6A 3BLEA 3MKCA 4H9UA 1IXNA 2NV1A 4A8IA 3PZIA 3BCJA 3MKVA 3A13A 5D03A 3UXKA 3NO1A 4YS1A 2CXEA 2Y4SA 4LVBA 3E2QA 4CNTA 3URAA 2WNZA 3OVPA 3PZGA 3GNXA 4CD4A 2IUZA 1GOXA 2V81A 3KBSA 3KZPA 4HYWA 4AVFA 1P0EA 1A5KC 3GVVA 1ISWA 2BVYA 3W1QA 3CB8A 3W81A 3GBEA 1HT6A 4D1JA 4RW3A 4I7WA 4QAIA 5D30A 1D9EA 1OFAA 1AD4A 4C1LA 3LDVA 1WQ5A 2QW5A 1SZRA 1UBSA 2WNQA 3NSXA 3VE9A 1V6WA 1JD9A 3W7DA 1R3TA 1UMLA 2QT3A 3S5SA 5D9MA 2FVKA 2VC7A 4GE8A 3ITXA 3QHNA 4PC8A 2YZ5A 4GIEA 3UT0A 5A6BA 3AUJA 1DWFM 4ZXOA 4HOWA 3GXFA 2NQ5A 3E1F1 1W5OA 1JZ7A 4IMDA 2OSXA 1SVDA 3RFAA 3QMRA 4FAMA 1ZQ5A 3F2CA 1NP2A 2XZ9A 1J5SA 3URNA 2PGFA 1FBAA 4HPJA 1ZJAA 5EU9A 2CZDA 2Z1KA 1TJRA 4D6JA 3A24A 4LV9A 2QEZA 2JFEX 4H9YA 1PIGA 4K7YA 4CQBA 2OEMA 3WD0A 2O0TA 3MCNA 1X6LA 3L4WA 3WL0A 5CZKA 1QW9A 5CJMA 3T40A 1W9BM 3G6MA 3U2CA 2NX9A 2QCMA 1G4EA 3SUTA 3WQPA 2CZ5A 3GXTA 2OZ3A 2QUVA 3STPA 3ARVA 2Z4GA 1Q65A 2PDQA 2QULA 1PDYA 6PTDA 1V6UA 1W5NA 1UA3A 2DZXA 4WD0A 3FKRA 1AK5A 3MWCA 1OBAA 4UTLA 3AIBA 4GACA 2Y5SA 1V6XA 2CLHA 3WNPA 4M6UA 5A2CA 3T0TA 1IT7A 4CNUA 3TYBA 5BMXA 4XISA 1VJZA 1AQHA 2Y24A 1XS2A 3LPGA 2P0OA 4JX5A 1EUNA 2ZX5A 4LUTB 2CWNA 4P8UA 4XQ6A 4ZBCA 1QK0A 3DYMA 5FJTA 1P43A 3CPRA 3KL5A 4D8ZA 2PDNA 3LCLA 1E0WA 4PMQA 3UXDA 3QV6A 4PBEA 2QNEA 3VCRA 1AQMA 4PZVA 3EWCA 4F4RA 2WVUA 3P67A 2J8TA 1OFOA 4KWUA 1HP5A 3FA5A 3A22A 1GOIA 3TJXA 4R7OA 5DXXA 2FHFA 1G9HA 3QFEA 1XLAA 4IIGA 1EF3A 1Q6DA 3TNBA 4MY1A 2IKIA 1ZAIA 2ATMA 5GJNA 3N18A 2C19A 4NASA 3QH2A 1DJWA 3ITVA 4UTFA 3SECA 2WLYA 1RCXB 2KZHA 2Z1WA 3GK0A 5MF5A 3ZIZA 1BG4A 1YDOA 2ZIDA 1R3QA 3VM5A 5JMUA 1UWQA 4DI8A 3WMSA 1UZHA 1FFQA 3MZ2A 2VL4A 1A5AA 1EGVA 1AW5A 3GDLA 4J3UA 1ITUA 4U2YA 3UNDA 2YCJA 3SURA 3WDJA 1E43A 1R2SA 2BX7A 1KFBA 4S2BA 2NWSA 3H6OA 3CH0A 8A3HA 1UZ1A 4AIUA 1TKKA 1XM3A 3P14A 1H7RA 3BQ5A 5CC7A 4GIAA 4LYQA 1UC5A 1C90A 1LRTA 4IIFA 4GVHA 1WPCA 1GOWA 3N3MA 2FIQA 1UKTA 4GNVA 3QZAA 4Q6XA 4Z1DA 3MJMA 2UY2A 4FIQA 2D22A 4DHGA 1HO1A 1FCBA 2VRKA 4OKDA 3LZ3A 3KP1A 1QR7A 4DI9A 3E2VA 3VIGA 3S1UA 3C2YA 1JPIA 2CLKA 1CT5A 3W1UA 1A5CA 1SYTA 1DWGM 2ZTJA 4LAZA 2ZVIA 3GUGA 5G2WA 1AJZA 4IMFA 4ATLA 2RUSA 3V5CA 2PC4A 3RU8X 1CEOA 3RF9A 5BU9A 3K8KA 4ZSTA 4AU0A 5KZ6A 3S5OA 5BZAA 3LENA 3MSGA 3S2NA 3NVDA 3JVAA 5CPLA 3T4CA 3OVRA 4H9MA 1JDAA 1FWGC 4C91A 1X97A 4O1FA 1UPMB 2QIWA 3TJ4A 2VCAA 1L6WA 3R5EA 1EB3A 4YXGA 3TUUA 3AXXA 3FJLA 5TIMA 3A4WA 3BL3A 4HT3A 5JUVA 4QG9A 3GIYA 3TJLA 2B0MA 5D9NA 3STCA 1BXNA 1TWSA 5KITA 2XVNA 4C6DA 3NIYA 4JX6A 5FJOA 2PDGA 4YPJA 1XLBA 1NDWA 3TC7A 3ANUA 4EIVA 1SZEA 4Y2WA 3VINA 3GXPA 5G5IA 1I75A 1GPFA 1R2TA 4LS1A 1XI3A 4F3HA 1RBLA 3W53A 1R38A 1M6JA 4ZZ9A 3HN3A 5AYXA 2I7GA 4O10A 2WMJA 3E2SA 4CCEA 1PSCA 1Q6FA 5TF0A 2NVDA 3WH7A 3ZLHA 1G7UA 3G0SA 2E0PA 3E5BA 4IGSA 2C7FA 1E73M 1KTCA 1KM1A 4CU7A 3V1HA 3ICJA 1XFCA 1XHGA 3M46A 2J7CA 2NT1A 4L4MA 5KZDA 3QR1A 1UHVA 1EP3A 4CQDA 1R85A 4S3CA 3CAKA 4UMAA 4X2RA 4R3UA 3N4FA 4ICCX 1KC7A 3CUIA 2INZA 2ZUMA 3CWOX 1LDCA 1EH9A 3V16A 2QDDA 3W2UA 2E67A 4OHQA 4FR1A 5KZEA 3OLGA 2W79A 3BMWA 4LW7A 4TX6A 5IBXC 7REQA 1MQQA 1PWMA 5HMDA 2CLFA 4QSFA 4MNMA 1NWRA 3W71A 4DJFC 3UPMA 3M16A 2AL2A 1GKQA 1U2YA 4O18A 3RJXA 3LCHA 2NT0A 3WQVA 3MB9A 1VC4A 2WOQA 4K38A 1RH9A 4XD4A 3WLNA 3GVQA 2G3FA 1O6IA 4MHBA 2ABBA 3HOJA 3TN6A 5I24A 2V3DA 3DERA 1V3LA 4NSBA 5HR7A 3FNDA 2GVJA 3WELA 3ABSA 3CQKA 2FZMA 5H1WA 1GYLA 1RPKA 1YNYA 5CH9A 4YTSA 3RLUA 4W7VA 2BASA 5I77A 4XVDA 1LBLA 1AMYA 3DX5A 3OBKA 4N6EA 2VD9A 3IEBA 2HSAA 3TDFA 5IFTA 3UWZA 3HA1A 1UW9A 2D69A 2WKJA 3AWOA 4IFOA 2PSNA 4NT0A 1QASA 2CC0A 4C6KA 1CIUA 4DYKA 1DJZA 1U30A 3LS9A 3F2DA 3E0LA 3RU6A 5A6MA 2ZA3A 1V77A 3GW3A 2OR2A 2X42A 3LI1A 3IWPA 4JFSA 1XG4A 2PDKA 4ZB5A 4KRZA 4XZLX 3KHDA 4GYKA 6XIMA 2OEKA 4OZOA 4PCNA 1ENUA 1NFGA 3D3FA 2GWGA 4LT9A 3EDJA 3EKLA 3M7WA 3WSUA 3R10A 3R25A 7PTDA 3SBFA 1AD1A 3G2GA 1HP4A 3HM7A 2DSUA 2WZTA 4BEUA 1QNVA 4TV6A 4QJ4B 2XJ7A 3ITCA 5KMYA 4WJEA 3C8NA 3HJZA 4AVNA 2GL5A 3AFBA 2WJEA 1RK5A 1XF0A 3HO8A 5B7YA 3HPSA 1TCDA 3LEPA 2PPGA 3WNOA 2Y89A 4FLOA 5DRCA 4MAZA 3OB8A 5DANA 4O14A 2OLAA 1GQLA 3O15A 1TQJA 1A5MC 4JNYA 2ADAA 2Y85A 4AAJA 2P0IA 1F07A 4AXKA 4KETA 2ZRWA 2XWEA 1CLKA 3QY6A 4IQEA 4ZO6A 3EBVA 1NY1A 2C79A 3S5ZA 1XXXA 2D2OA 2ZX8A 3CNYA 2PFHA 4ZO8A 3LK6A 4GVGA 1JUKA 1K9DA 4S39A 3S2LA 4XVEA 3VMNA 1F6KA 1H50A 3PBVA 2ZUUA 1BHGA 5TNVA 2DIJA 4AYGA 3W7GA 3BG9A 2EPHA 2A4AA 1NJJA 2NZLA 4UTMA 1HNYA 2Q3OA 4TTGA 1O68A 1OM0A 1YHTA 3W75A 4C6BA 4WDXA 1ZFJA 4HZ8A 4CEUC 1KBIA 3AU6A 4CNNA 1LL7A 4HU0A 4AW7A 1JYNA 3JS3A 4Q8NA 3IPWA 3QOMA 2X0HA 2QYGA 2XN0A 4HP5A 4LYKA 3CAVA 5AHMA 3ARZA 1HJXA 1XLDA 1XLJA 1XYLA 3IJQA 3MDUA 4N4PA 4IWWA 2ISWA 4N4QA 2IPWA 3W6MA 3LU2A 3W6LA 3WLJA 3A4AA 4JOMA 5D2XA 1K7EA 3TR9A 4M3PA 1JI2A 2YA0A 1XL9A 4Z42C 2V8ZA 5G4WA 1SW3A 1G0CA 4BF5A 4E8CA 4A8RA 6TIMA 1CGYA 3F5JA 3W37A 1UP0A 2E5CA 2GPTA 4REQB 3N2CA 3CC1A 3FSUA 4LNCA 1PX3A 2VDIA 1AG1O 1OINA 3GKFA 5D8ZA 4J9JA 1W5MA 1XGDA 1E9IA 4DWSB 1XYMA 3MSYA 4XG1A 2WCAA 2VC9A 2ZZ2A 1WDRA 1B1YA 2XFRA 3LD5A 3AMCA 1KFLA 4S3BA 1L8NA 1GOQA 2R82A 4CD6A 2E6FA 2ZYFA 2R1PA 3OG2A 4DO6A 1SO6A 1UR4A 4XUYA 4L1XA 1O60A 1H0IA 1UPPA 3D3AA 4XTIA 3VD7A 3G1DA 3IARA 2DQXA 4ERIA 3QQ0A 4PB4A 4Y9MA 5CQ1A 1M04A 3L2LA 1BAGA 3QXBA 1X7IA 3TONA 1WZKA 4XBJA 1S39A 2OYLA 4O8RA 2H8ZA 2D0HA 3VIKA 1ZAJA 1SZFA 3XISA 1TV8A 3RX2A 3WYZA 1V0LA 2EQDA 4ATDA 1J6OA 4M19A 2VGGA 3WQ4A 3L4YA 3TIMA 4IIHA 2J7EA 3ENLA 2BWGA 4F48A 3GE7A 3MYOA 2BY1A 4M56A 1FWAC 4CQ9A 4CNPA 4ASTA 4GXWA 3WH6A 2W67A 1PXGA 1E6NA 1OK6A 3MT1A 3S8HA 4OUEA 3TLLA 1ZL1A 1CTNA 3AYRA 5MHBA 2GFTA 3VVGA 4QX4A 2GUBA 1B9ZA 2OOGA 5M2FX 2PRLA 1GTEA 3DOPA 4IMEA 3H2FA 5M3WA 4ZQNA 1W9VA 4C1NB 4IPLA 3ZT5A 1VRXA 2YL9A 4IQJA 1P7TB 5LIYX 2PTDA 3UCQA 1YQ2A 2X16A 2XVGA 4S3GA 1J79A 3PVFA 5IXEA 4M29A 1FWEC 3LHVA 3AU2A 4ZXLA 3H2CA 2FTWA 5FA5A 2PWGA 2XFYA 2WCSA 2DGAA 3Q37A 2GDUA 1UH3A 5REQB 1EXPA 1H63A 2L5HA 3NEHA 4B9YA 5FF4A 3FA3A 3ITGA 1XBZA 5DBTA 3OYXA 3OW1A 4K6AA 3REQB 1GHRA 3UVIA 4O1AA 3W70A 1VQTA 3UQNA 5EBUA 5G2HA 2A85A 4RZBA 2UWFA 4K36A 5A8MA 2B81A 4AWUA 1OX4B 1SJAA 2W66A 4QROA 5EBAA 4W93A 2X0YA 4IP5A 4XKYA 4QM1A 3ZOAA 2WMHA 4OFCA 4I6VA 2GJXB 1SW7A 3EOSA 3A4JA 3T08A 3Q65A 1LOQA 2EPOA 1A5NC 4EK7A 3NVTA 4HK6A 2DZVA 3VFLA 4MNLA 5T9CE 4BI7A 1FTXA 3KVLA 3W85A 4CGTA 1B3WA 1VENA 2VRJA 4H9VA 4U2ZA 4A3UA 4O17A 3JW7A 1VHNA 4XO7A 4LV4A 1LQAA 2R24A 5CPSA 3L4VA 4O1BA 1MXGA 1TWDA 4PEEA 1UWRA 4IZGA 5LIXX 1ZU8A 2Y5JA 3TH6A 3VTRA 3KW3A 2NUXA 2EBNA 3OZYA 1CB2A 3QM3A 1LOSA 4LCSA 1HZYA 4HHHA 5D33A 3GTHA 1VFTA 3UA4A 4CKQA 5IDZA 4N0RA 3NDYA 2XGZA 5LIWX 5K7JA 2Y7FA 4MFDA 3EOUA 1F8MA 2EPNA 3MUIA 1ZSXA 4KW2A 4XWUA 2J6VA 1YPXA 1E1EA 3KUMA 4WXYA 1D8CA 3BOFA 3N34A 1W1VA 4HJFA 3UVAA 3WLMA 4H9TA 1F9CA 2YFOA 1JXJA 5A6KA 1Z89A 4PTWA 3WKZA 3HGOA 1VBUA 1LQ2A 3S0CA 3VKJA 2ACSA 3EAUA 2I16A 3LN3A 4OV4A 2WO5A 1FDJA 3MCMA 4LX4A 2QMKA 3KBWA 1DE5A 1EBGA 4XV0A 1EZ2A 1KV8A 4QQ3A 4MZYA 1OX5A 3DECA 1FUYA 2OELA 1QOQA 2NXIA 1I60A 1TZZA 3IK4A 1V3HA 4UFMA 3WQ6A 1BLIA 3B9OA 3GU1A 4AZIA 3GVGA 2E1DA 5AZ0A 1E1CA 3SRHA 1EL3A 3RMJA 3GZ3A 5CZTA 1GVRA 1JZ3A 4IIEA 3W00A 3T6CA 3N6HA 1K6WA 1GOOA 4F2UA 4D1IA 3J7HA 1GHSA 3ARQA 4TVDA 1XRVA 2CLEA 3BW3A 2J7FA 3H7UA 4DN1A 1GYNA 4MAVA 3IJ6A 4KERA 4UTWA 3CLWA 2W9MA 3DYOA 1ZGDA 2OU4A 3RN6A 5C7HA 1DOSA 5A1AA 3ARUA 1RSCA 2P8BA 2D0FA 2VYOA 4CN6A 3LHZA 2NVAA 3B3DA 4ML9A 1ZRQA 1AL7A 3AMGA 4IUGA 5HATA 4PB5A 3GQYA 2W0UA 5A8OA 4LUSB 3NL6A 3RUBL 4IFRA 3O6AA 3R13A 2J62A 4MWAB 4GH3A 1JCMP 2OYMA 1UR2A 2VNCA 2HPMA 3QPEA 2EPMX 3GHUA 1I45A 4H4IA 5DQPA 3CHCA 4JTTA 2H6RA 4JN6A 5DEZA 2QDEA 1W3HA 4D6DA 3NQ6A 3IUDA 4F9JA 5HPOA 4U28A 1F3XA 4Y7EA 1JNEA 3CUFA 3SGZA 3B8TA 4BWLA 3P6LA 4HCLA 2X7VA 2CCRA 4Q3MA 4K8EA 4JY8A 1O95A 1PB0A 2YA1A 4Y90A 5I3FA 2YSWA 4KGJA 3W7LA 3AIWA 3W01A 1EJTC 5BXSA 3RCNA 1ICSA 4GZEA 2WSPA 4AY7A 3M7SA 3WH8A 3QSTA 3N9RA 4UQDA 2I9EA 4A4AA 1XR2A 4MLJA 4L1GA 4LRSA 2NLIA 1N7KA 4UZUA 3ITLA 4KEMA 4Z2LA 1CGVA 1ADDA 1DWJM 3K1DA 4NX5A 1F76A 1PJ9A 4DRSA 2PWEA 3CEUA 1T7LA 4G56A 3MO7A 1DJXA 4G7FA 4W87A 4E38A 2R8WA 1VEPA 2R6OA 4LU0A 4O53A 1ZY9A 3HIJA 3MP5A 2Q8LA 2ZUTA 2OPJA 3PZ9A 1QNQA 1JI1A 3CZLA 4UNLA 1VFOA 5CPTA 4AC7C 2QZRA 3SY8A 5F4SA 3NQ2A 3WCZA 1OABA 3VXGA 4D72A 2CXGA 4JCLA 3BSGA 5H6HA 2WZHA 3O6DA 2H3DA 2YYUA 4GYJA 4NNAA 2FPVA 4OTKA 3KM8A 3BLFA 2J8GA 3NFUA 4DJDC 2GQ8A 2X8RA 1HKIA 2O56A 4PSRA 1L0PA 4IFKA 3KBVA 2XIMA 2XH0A 3USBA 3OHIA 3W7QA 2G3NA 4WKFA 1YKWA 2JE8A 3CZJA 3AYVA 3OPSA 4DWDA 3LB0A 3VK5A 1TPUA 4IG2A 3KS6A 1EOKA 2P1FA 4I7VA 3WUFA 5A6LA 1QNOA 2FH8A 3CV7A 2FZ8A 4R88A 1UA7A 3UJRA 3S9ZA 2V67A 3BLOA 1NOFA 3BG5A 2X30A 3BXWA 2GQAA 1XIGA 2JALA 3WNLA 3O9NA 1BVZA 1S2CA 4AEFA 2VFIA 1MW3A 4QITA 1PCWA 2YCLA 4Q8UA 1BYDA 5CSSA 3SW6A 3ZLGA 2I1OA 3IVSA 4G6CA 1GONA 2HK1A 2WQDA 2XVKA 1HX0A 1ODZA 1VHCA 3ZR4A 2JK2A 2IQTA 3PJUA 3GDTA 4NZ4A 4ES4A 1RQEA 4HU4A 5CSUA 3MKKA 5AC6A 2IPFA 3GM8A 4HN4A 4JHOA 5AC4A 2YXGA 2C6QA 4B5NA 3W26A 4YCPA 4J4KA 4DYJA 2DPEA 2RAGA 4WY0F 1OG0A 1UR9A 2ACQA 3GXDA 4EX4A 4N9DA 7A3HA 2VOMA 3WBEA 2Q01A 3WD4A 2I17A 3NQ8A 4QSHA 2C1HA 2CLLA 3AHVA 3U9IA 1V08A 5HR6A 2JKPA 1J10A 4U5IA 4AX6A 1QBAA 2VURA 3UA3A 5I5RA 5AECA 3HBLA 1KCKA 1GK8A 2C71A 2OSYA 1PKLA 5BCAA 5MKGA 1NFBA 3KZSA 4YYCA 5CC6A 5EFFA 1GEQA 5HNUA 2YOCA 3B4YA 3WLOA 2BMBA 4RDZA 8RUCA 3AMDA 1NQKA 4H2CA 2Q02A 2J7DA 1UUMA 4ZTXA 4JKKA 1QXLA 3W84A 4GABA 3WN6A 5DELA 4AFYA 2V3EA 4JIEA 3VD4A 5I3GA 3R8RA 2VKZG 2E4TA 2C3ZA 4JYFA 4AZHA 4H3DA 4DLFA 4E2BA 3B40A 1E1FA 4TQTA 4LY4A 2PCEA 1EO5A 1W9DM 4EPBC 4NY2A 1NP0A 4URIA 3S46A 3B9AA 2Q6ZA 3M6YA 4US6A 1K8CA 3C2OA 3DHFA 2YA2A 3SCSA 2I9UA 1Q6QA 3TCEA 3P3BA 3EA3A 1QOPA 4JTHA 2A1YA 1KCZA 4NJHA 5BNKA 4Q7BA 2PE4A 1FQ0A 1CECA 2BB0A 4C6NA 2QQ6A 1ALDA 2EGZA 3SY1A 2GGIA 3H53A 5LNSA 4JEJA 3B8DA 1KWKA 3NDOA 1KFWA 3L2IA 3TYDA 3TLQA 2E28A 2JBMA 5ENLA 5FAGA 1XBVA 2X1IA 3QW4B 1B30A 1QWKA 1I2PA 3B8UA 4B90A 1Z32X 1MNZA 4KCWA 4DZAA 4PCPA 3IVUA 4XSMA 3G77A 2PDBA 2XIJA 4JX4A 4ZL1A 3GG0A 1B4KA 3KTXA 4F40A 4X22A 2VZOA 3O8AA 2LLEA 3ALFA 1O4UA 1CXEA 3WQDA 1H7OA 1B9BA 2OX4A 2OLHA 2X05A 2YW4A 3W7PA 4LVFA 3S9IA 4GNJA 1EYEA 2NSXA 3S4TA 1OCBA 2DSZA 3PBGA 5LXXA 5E70A 2A79A 1FWHC 1KBLA 3VIJA 5FJPA 4QGCA 1Q4WA 1BKSA 4UTTC 2PODA 3M5YA 3DDMA 1T8XA 1P0NA 1B3XA 2FTPA 3QZ6A 1D8WA 3UWYA 1RJRA 3WK0A 3UPBA 7ENLA 3WQ5A 2WXDM 4S23A 1W1YA 3LX9A 2A7RA 3GDMA 2QCFA 4GQRA 1XH0A 3MUY1 4O50A 3PNZA 4QRNA 3S2JA 4Q8VA 1M7JA 3BV7A 4ADUA 1NWSA 5F2LA 2BHUA 1TRIA 3M4HA 3EOOA 3CMGA 4BA0A 3IRDA 1FP9A 2B7OA 3VYLA 4BFAA 1S1RA 2Y8KA 2GZXA 4ICMA 4YWIA 4C6LA 3CTTA 3W6YA 2GGEA 2YFNA 3GG8A 5JIWA 3RRAA 1UG6A 4H41A 1OSEA 2I5QA 4X60A 3TC3A 1ZAHA 4ORIA 3UETA 2ZWZA 1XGEA 1XYCA 2DUAA 1Z9AA 2NQLA 1FVPA 3ZFHA 1QPRA 2GSHA 5LNWA 4ROPA 1J93A 4QEHA 8XIMA 1VFSA 4P7QA 2WPGA 5IBXA 4PUEA 1IIHA 1X96A 3W25A 4B2DA 3TN4A 1EBHA 4DJFA 4DEFA 3TA6A 2F9RA 5D37A 1HKKA 2QUNA 3BICA 3MJYA 1XQKA 2CERA 2YW3A 2PDYA 1XIIA 2OX1A 1XYZA 1ZCOA 2D0GA 4IGMA 1V0KA 1T6MA 1TJ2A 3FW6A 4L9ZA 4YTRA 1MRAA 2BGQA 3R7MA 2G41A 3SUVA 4RLIA 4NUWA 1XRSA 1XUUA 3NSMA 1MXDA 1TREA 1B3ZA 4L4LA 3ZVHB 3W28A 2CZEA 2YLAA 5AC5A 3ELFA 2I57A 1Q3NA 4H1ZA 1LT7A 4RUBA 4Q7IA 2OODA 4CCCA 3GWQA 4I8YA 1TPB1 5LHEA 2ZOXA 1RPXA 4MF4A 3W38A 1NFPA 4LFYA 1J12A 4IM4A 3OLIA 1Q6RA 3S3GA 4GY1A 1WXJA 3FYYA 5BU6A 1VPYA 1DYSA 3NDZA 2A3CA 5J8LA 1DIDA 4Z2HA 4US5D 2O92A 4DBSA 3A21A 3LNPA 3E9AA 2V69A 2XFWA 3EYPA 3PZMA 4A3YA 2WMIA 3N15A 4GXPA 4HPHA 3M5VA 1S5VA 1Q6CA 4AUBA 1TPC1 2WZEA 4J3ZA 2DT3A 3E12A 4AZGA 1IXPA 1GQNA 3IV3A 1CPUA 5E93A 2HROA 4RNIA 1WX0A 2R1NA 2NXGA 2GVYA 3TCSA 2XVPA 5C9ZA 3L4ZA 3EZ4A 3PN8A 3QQ1A 2GVGA 1JAEA 4JBRA 4M0XA 5DT7A 4DVOA 1OFQA 4F8XA 4GO8A 4N42A 1IWAA 1EDGA 1H7PA 1H3GA 2BSLA 3IJDA 3U2ZA 1EDQA 5CJNA 4PTNA 1LM1A 5HMSA 3EDKA 3BJSA 1EIXA 4HZMA 4NF7A 3IV8A 4YYFA 5T91A 1MZRA 5F2GA 1MO0A 1I4NA 3W82A 1OCQA 4EXAA 1EC9A 3A5FA 4GVFA 4J35A 5CKSA 4MY8A 4H8NA 3ORWA 4IL2A 2WVVB 2FVMA 1XLIA 2PU0A 4I7UA 3UEQA 4QE5A 4X2PA 5E0CA 1TV7A 1FHVA 2Z1XA 1QI5A 3K4AA 4J5NA 4EANA 2FKPA 3IIZA 4UQAA 1V02E 1O5XA 5GNZA 3VMOA 5TBOA 1FKXA 3ARSA 4CQCA 5I00A 1DIOA 1P1MA 1OZQA 1V3JA 1BXCA 3NL2A 4UFJA 3NCOA 3HFTA 2BLEA 4YN5A 1XIFA 1FCVA 4A6GA 9CGTA 1CLVA 3U4FA 2HEJA 2PDFA 3U8GA 1MEIA 4I5RA 3FV9A 3DI0A 2E9LA 1MNSA 3C4UA 3LI0A 1X1ZA 4KFNA 5JH1A 4LYPA 1SFJA 3CT2A 4W9TA 3AYSA 4DBUA 3TXZA 3DN5A 3GC2A 3SCOA 1CXFA 1IZKA 4J7RA 4OV9A 3W87A 2WZIA 4RE2A 3WUGA 2JKAA 1GGOA 3IJ9A 3MQTA 3SGGA 5HQEA 3W1TA 4MKVA 5D2YA 2ZDRA 2G5WA 3PWGA 3SADA 5EL1A 1T40A 1RCQA 2ZZ6A 1WZMA 2OT0A 4HBKA 2ZTKA 2YDRA 3KTSA 2R1KA 4WOQA 5LHFA 1V3MA 5D2VA 1FX6A 3RG6A 2ALRA 1W1IE 5A8GA 2NQ9A 3UWWA 3LPOA 3EX6A 1KFCA 2V3FA 4ZVJA 1R46A 5FF3A 3CHEA 2NX3A 4CD8A 4K1GA 2VFFA 3TR2A 2J4GA 2BOEX 4IP7A 1A4LA 1BRLA 1FWJC 1RUSA 3UGVA 5FEXA 4GC4A 3UZ5A 4LPCA 4WDUA 3W2MA 3W9ZA 3ONCA 2GSJA 2J74A 1X6NA 2EG8A 1P0DA 4PBGA 3LQLA 2GSEA 1UP2A 1UMYA 1YTDA 4AIOA 3C0LA 1E4MM 3N6JA 4ZE5A 3AXIA 3BE7A 4OT7A 3RPMA 3AAMA 4N02A 3GO2A 1IWBA 1PZ3A 1TV5A 2VHLA 2DU2A 2MNRA 2FFIA 1QTWA 3EPNA 2NVCA 3ZT6A 1QVBA 1C7SA 2HVNA 3JZEA 2REQA 1R3RA 3WJSA 1E40A 4D6EA 4D8LA 1V93A 2PDJA 4BQ3A 1HVQA 5JQ9A 1UR1A 3R0KA 3QV7A 2RDUA 4QHRA 1XYAA 3EWUA 3HGJA 3BCDA 4Y8EA 1KBJA 5FSDC 3VKCA 1XW8A 1HW6A 2HS8A 5B7ZA 3S9YA 1KM4A 5AYIA 1ME7A 5CJ5A 4GC3A 4FPSA 3WL1A 3BW4A 4GY0A 2XHYA 1W8SA 3BJFA 2PMQA 3DKJA 1VBJA 4MB3A 4QIUA 4DJDD 3NZRA 1JQXA 3PPCA 4M8UA 5D4YA 1Q63A 4WKAA 3NQEA 1OEPA 3UPWA 3DAQA 4US5A 2RGMA 4LB4A 3RPTA 3NG3A 4Q4SA 3A12A 4AHQA 4Z0JA 3PUEA 4DNHA 2X2GA 1F5ZA 1AFSA 4D2JA 1XGZA 4GI9A 4JNMA 1RBAA 4HPNA 3ZZ1A 3CWNA 5I23A 1XPGA 3PSWA 4Z2KA 1BVWA 1EXBA 1R47A 5GVJA 2WHMA 1HN1A 3MWAA 3FFSA 3BGGA 4O0QA 1TA3A 5C2GA 3DFYA 1F05A 2E25A 1PDZA 3EMQA 1QBBA 3C2RA 1QK2A 4YU1A 3I10A 3HPZA 3G1RA 4AD1A 4FF5A 2Z1BA 3R0DA 3TROA 3O07A 1PYFA 4JZ5A 4NXKA 4GGHA 3P60A 3SFWA 2ZUVA 4AH7A 2VX4A 3CUHA 2DVUA 4E4UA 3SEPA 3PFMA 3FHQA 4D6FA 4F0MA 3ME3A 1K02A 5F4XA 4YLWA 3CV6A 4FIRA 1WZLA 3V7PA 1IT0A 3WLLA 2IPJA 4E6MA 3TYCA 4D6HA 3GNPA 2QGHA 1TMQA 3CH9A 4GBDA 4NQ1A 5DX7A 1H7NA 3GZAA 1BD0A 2VEPA 2J75A 1FH8A 2RDXA 4O57A 3TK7A 4GKLA 4L1WA 1E6SM 4MJZA 3S2MA 2ZA1A 4FO4A 3VAVA 1NAL1 3A9IA 4IX0A 2DT1A 3BLLA 1KM3A 3DZ1A 2VC6A 3PJWA 3O0FA 2DZSA 1EJWC 1OT1A 1VZWA 1X38A 1QHOA 4N9BA 4OOZA 2WANA 1K4GA 3Q67A 7CGTA 2WCGA 3JUGA 3BURA 5ECVA 5JBDA 4LCRA 1H2JA 4PMJA 3TJIA 3LBMA 5HQMA 3UYIA 3P62A 2XGIA 1IF2A 1AMKA 2I14A 4LB3A 3MVTA 4P7RA 1JCLA 3PP7A 5F4WA 1KRMA 3WK2A 2TPSA 2J8FA 2PF0A 4IPIA 2BOGX 3IAQA 1Q85A 4DAFA 3SM0A 3GG1A 1Z3NA 3I3EA 1YRRA 3PB0A 3GXIA 3N3TA 4BF9A 3VM7A 1RXOB 3RR4A 1GJWA 4PR4A 3LQGA 2A6LA 4M7TA 1Q8JA 1UWTA 1J96A 3WDHA 5A2BA 1LTDA 4PRWA 1V02A 1C29A 1QFEA 2DH3A 1TVLA 1BTCA 4O28A 2J9XA 2EPLX 5C54A 4DWSD 1CBGA 4RDVA 1I1WA 1DV7A 1D7FA 1ZNNA 4DM2A 1JGIA 3UXAA 7ODCA 3GIQA 3GFYA 4HTYA 5K4XA 4FX7A 2KX9A 4RPPA 2ODOA 1Y5XA 2GQ3A 4ZB0A 4RKAA 2VCCA 1MRQA 3PK7A 3OG3A 3ANVA 1MFUA 4NJKA 1Q6GA 5I02A 2OCZA 3ES7A 3FKKA 2WBKA 3DYPA 5K4ZA 3LLXA 1W2PA 4KIEA 4B16A 4OGZA 3OBAA 3FXYA 3ISIX 3IJ7A 3UZZA 3QV8A 3NL3A 1W5QA 1WDPA 4Q6JA 5T9BG 3IGSA 2BS9A 2R1MA 2VEFA 4B15A 3UESA 4M81A 5I79A 5HNRA 1N8WA 3VNKA 4XKMA 2QV5A 5G4EA 1LG2A 4UNIA 2DZUA 1JZ5A 1VFFA 4QJ1A 1NELA 4DM1A 2OJPA 3AALA 3ANYA 1XC4A 2PWHA 3G1AA 1XLGA 2C13A 4MNKA 1KQZA 3OLEA 4Y9AA 1UKSA 2YR1A 1K7XA 4WJ8A 1XSKA 5CGQA 1NDYA 4F0HA 4UR8A 1AQFA 2XFFA 1VH7A 3EX3A 1Z7AA 5HNNA 3BO9A 3V75A 4CN4A 5LGZA 4M1BA 2ZWYA 2QR6A 3AJ7A 4XD3A 1KXVA 2VWTA 2DEPA 4G1NA 1TIMA 5A2AA 2XGBA 3PJTA 1TIWA 4FA3A 7REQB 2A7PA 1XJBA 1G67A 4HNOA 4PBFA 1W1TA 1ODUA 1EJ7L 2PWUA 1G4TA 1JCJA 3B8WA 3PTMA 3P82A 3S1XA 2AL2B 3RM4A 1CZ1A 4L7ZA 3UZJA 4MUZA 2O4MA 2UY4A 1BVNP 3GTNA 2WWCA 3EA2A 1R9ZA 1EO7A 2J47A 1PKNA 1SZGA 4I6KA 4HN8A 1VFMA 1TJ0A 4X3ZA 4UBPC 3PFRA 4GVIA 5DN1A 2FVLA 2Y70A 5E6YA 4Y8FA 2ZC1A 1J01A 4UR9A 2B31A 4JQ3A 3INPA 5K9XA 3GD6A 1PWLA 4JDYA 1C8YA 2V2CA 2DV0A 4U5KA 3P74A 1SUXA 2YBVA 1LWJA 3RHGA 1RA5A 2A6NA 4WLCA 2KAUC 5I09A 2WW5A 4JXCA 2XYLA 3O6CA 5HMEA 7TAAA 1ECQA 1WCGA 3P93A 3BLKA 1X1NA 3QVQA 3I7RA 1VBRA 4JN7A 3G22A 2TSYA 3WBAA 1KGWA 2PZ0A 3TWBA 4O52A 1E6ZA 3K8LA 5I78A 1K8ZA 3EDFA 3USZA 1BWKA 1KNWA 3GNDA 3M43A 3LV5A 4C6JA 3AO0A 2GUYA 3LGEA 4QE4A 4O15A 1DEDA 1H5YA 2HBVA 2CYGA 1J6PA 1WDWA 4FLSA 3A3XA 1FWSA 2FGZA 2BTMA 3AXMA 4ONVA 3L4XA 4CN1A 2AGKA 4ZSUA 1MQPA 3AQUA 2CEQA 3LLDA 5I3JA 1XBXA 2AKZA 1YE4A 1LUCA 4GMEA 3BQ6A 4XK2A 3CHFA 1Q8AA 2O7SA 3B03A 5JIPA 3T05A 3K4DA 4WDWA 3NURA 3O2LA 3VIFA 2X1SA 1YPFA 3B05A 5CLWA 3SSJA 4C5ZA 1B57A 2IMRA 1JZ4A 3O6YX 2I56A 2AGTA 2IKHA 1KXHA 1H1ZA 3KAOA 4BI6A 3VIOA 2OXNA 2V5DA 4Z2JA 5I3KA 4LALA 4GUHA 4H7CA 2WWDA 5AC8A 3DFSA 2BG5A 4H83A 1O66A 5H2ZA 3AISA 2OWCA 4C6FA 1X7FA 4MG4A 4XAGA 2ISSA 4J3SA 4Y96A 4F2TA 4IUOA 2X09A 1KWGA 2HTMA 3TA9A 1H7WA 5I2UA 3RPDA 5M1TA 1AW2A 4JFVA 1DIKA 3GH4A 2EKCA 4HVXA 1ZJBA 1WKFA 5J5DA 1QO2A 3BWWA 4Z1CA 1P6CA 2PD5A 4HSOA 5AN7A 4ZEPA 1OD0A 1GVYA 3BAIA 1Z6KA 1GQIA 3KCJA 4JQAA 4I9MA 1NDVA 2FGLA 3EMZA 5FF2A 2A2IA 3I6RA 3U5YA 3W1MA 4X9YA 1OFEA 3KBNA 4Q4MA 1IGSA 4GXMA 3VMPA 4MDPA 2DW7A 3NZ1A 3D47A 1PV8A 2E77A 3MA8A 2DZTA 1ONWA 4NHVA 3GU9A 2WHJA 4UTKA 1ZPTA 3FGCA 3VC5A 5BRBA 4K39A 2QCHA 4XSLA 2X2YA 1XKYA 4UTIA 1EJXC 3LTPA 1KFKA 4PB3A 3WNMA 2HQAA 2PDHA 4G7EA 4M6QA 4JTKA 2QHAA 3ABXA 3MBFA 1M1BA 1TRDA 1ZBCA 4JIQA 4E4FA 3NQDA 3LV6A 3H21A 2ZCGA 1EX1A 3C3NA 2Y62A 2WC7A 4F0KA 4JTGA 1XICA 4JTRA 4LEFA 2Z25A 3GVRA 2YB4A 5C5YA 5IRPA 4O4WA 4XBSA 4QG8A 4RR4A 4Z1AA 1AA1B 2DH2A 3VDGA 3LXBA 3R6IA 2BZNA 1I1XA 4WK9A 4AZ7A 1KM2A 1M65A 4W85A 2J7GA 4XZNX 3OZOA 2X1UA 3D0CA 4AIEA 1IXOA 1XX1A 2V82A 3ZT7A 4W88A 1OCJA 1NF0A 5HUPA 3W86A 3VNDA 2G3MA 3TV8A 1SJDA 2PWFA 2PCQA 4IH3A 1JDEA 1A49A 3RMEA 3W1XA 2XN1A 3KDNA 3ZR5A 3T0DA 2YDSA 5DT5A 3KVKA 3ARPA 1FWIC 3C0SA 3O0KA 1IGWA 2F2KA 5C71A 4QDWA 5E0KA 3OZPA 2ZZ7A 1O1HA 2CU0A 3VOIA 1QMLA 2GVEA 2PLJA 2RFGA 5HMFA 4TO8A 2CKSA 3G18A 4WSHA 4KWVA 3OTRA 3ZVIA 1FY6A 2ZADA 3WUBA 1B5TA 1QO5A 3WJYA 7XIMA 4H8HA 4UTTA 4S38A 1EIBA 2QJHA 2E3ZA 2QV4A 3K46A 4FK9A 4ZFMA 4GX9A 6CGTA 2ISVA 3M0KA 3P0XA 3PBUA 5AYZA 2VGBA 2ALDA 4HNNA 2B7NA 3URQA 4UZSA 2FFCA 3LZ5A 5FI8A 4PCFA 3ZXWA 4EXBA 1QPQA 3U4AA 3CIXA 5LKYA 4PUWA 2ZXQA 5EMYA 1US0A 5EY5A 1UR8A 4W8AA 4FALA 2CLOA 1EQCA 1LRNA 4GQBA 1QNPA 1CGTA 3STFA 2AKMA 4XAZA 3CBWA 4HK5A 1V0MA 2BFGA 1VJIA 1ONEA 2OZ0A 1PHWA 3N12A 1WXYA 4W89A 1E9ZB 4ERGA 1KRAC 5HANA 4LVDA 2BODX 4J3XA 4PMYA 3MSDA 3W4RA 3CTLA 1XIHA 4KEUA 4GY7A 1T8QA 3LCFA 2EEXA 3LXCA 1QOXA 4A2RA 3LUTA 4GFIA 4Q4QA 5AKQA 1TB3A 1CLXA 1FWTA 2VGIA 2J79A 1EUAA 2O55A 3TU9A 3TMQA 4C6OA 4OOUA 4WSJA 1CWYA 2X0SA 1H1NA 3ONBA 1B90A 4FF7A 2AQOA 2QJMA 3OBEA 3CUZA 5JXQA 2RDTA 1M41A 3BG3A 1E56A 1ZB5A 2CBUA 4K8GA 2IKGA 1NF7A 3FK4A 2QPUA 5I03A 3M64A 2VQUA 4HMCA 2HE5A 2DJXA 3F4DA 1CXHA 3BAWA 5GNYA 1CYGA 2CPUA 4FS9A 3QPZA 4J27A 3S47A 2RH9A 4I5XA 2J7BA 3CMFA 5FJJA 2OLSA 2JEQA 1G5AA 4FXJA 4UOJA 4PTMA 1A3HA 4GQQA 1R7OA 4JDBA 4H2HA 2ONEA 3W1LA 3GB6A 4JD4A 1VYPX 1OFDA 2VFDA 5ABEA 4FXRA 4XKYB 4G1KA 1C8VA 1P6WA 3ZR6A 4NZCA 1GJPA 1YXDA 1UB3A 1YBQA 3WMBA 3MCOA 3WENA 1T41A 3BV4A 4WUIA 1W9PA 2J6XA 2Y8UA 1V51A 2WNWA 4I9JA 2GDQA 4QJ3B 1V4YA 3SIMA 4U10A 1U1UA 4O13A 2QCLA 4R34A 4HHLA 3CQJA 2INEA 4X63A 3TXVA 1RV8A 2PDWA 2DSVA 2YCIX 4W5UA 1VGAA 4C6MA 4GH1A 1Y5VA 3H22A 5FJIA 3N13A 3C3UA 4Y9PA 3VIPA 5FSEC 2Y2WA 1P5BA 3AIVA 3OA3A 4LSBA 3E0VA 3VGFA 1F7BA 4Z2GA 1P1XA 1O5RA 5D04C 1K8YA 3IIPA 1B54A 2VFEA 3DFPA 5LIKX 3LGDA 3U3HA 4HK7A 3C8FA 5HDRA 4XZMX 3G8RA 4MSSA 4CD7A 2BNJA 4OWGA 5HPCA 3CQ0A 3SO7A 1XLLA 3IS4A 1A3WA 3WD3A 1PKMA 3TC6A 2EJ1A 5EMMA 3WEOA 4BI5A 3QLLA 2BY3A 1Q2RA 2RJGA 2VI0A 1TMHA 3LTYA 2G0WA 3NXFA 4AB4A 4DBWA 2E09A 4ZA0A 3WFZA 2OWWA 1J0HA 5C6MA 3QHOA 1TTQA 3UERA 4AF0A 1K03A 3TN5A 3UR5A 1J5TA 1EP1A 3AJXA 2NUYA 3MP3A 3UFYA 5BWFA 3TQKA 1VRDA 1OQFA 3IUIA 2ZKMX 6REQA 4YTUA 4NJJA 4C7GA 5F1VA 4QEEA 3TMLA 2XM1A 1EGZA 2WPBA 4M82A 4MZ8A 3VD3A 1E1CB 4U3CA 2JGYA 4UQEA 4LH8A 1OC7A 2OO0A 2C0AA 3SUSA 3VILA 2Q71A 1T5AA 2RDWA 1THFD 5KETA 1LZOA 3L0KA 1OYBA 4B91A 3N6QA 4MNJA 3F03K 2HISA 1G94A 4HU3A 3U6WA 2E9MA 2QDHA 3KWXA 2Q8ZA 1H4PA 3VUSA 5DCBA 3GAKA 3UBPC 4ZQPA 5E9AA 3M0XA 2VFGA 1XBYA 3PWAA 2ZRYA 3OA5A 3VIMA 4KH2A 3PZOA 2Z7KA 1EWDA 2O7QA 3T2QA 1HO4A 3V4BA 2TYSA 1C9WA 3E0FA 1EPXA 3BSHA 3SQSA 1VPXA 4Q4KA 1E6XM 2WLZA 4PMVA 3WLSA 3VNIA 3GYCA 1DBTA 3PC0A 3NQMA 5KSWA 3WLIA 1FWWA 3FVDA 3AC0A 1J8VA 5I07A 1LLOA 1U83A 5G1TA 3CMJA 2XIBA 4AZCA 5CZJA 4G8TA 2VXNA 4YWSA 3DEQA 1Q2SA 5JBEA 5DXYA 2X41A 1C9DA 2V63A 4N2YA 3DFHA 3LBCA 1MYRA 3QOKA 4ZCWA 2H9AA 4LUYA 3SCUA 5CSRA 1E9YB 4XIMA 1Q45A 4GJ1A 3UF9A 1MDLA 1BWLA 3AUOA 4XBKA 4C1KA 3WDQA 4ICNA 2PTZA 5TAOA 1OFPA 1E71M 4FMVA 4FSAA 3WO8A 5XIAA 4KBXA 3HPFA 3DFOA 3TSBA 3TVAA 2DSKA 4UQCA 5LA0A 4NYUA 4GUGA 4LS0A 5FIPA 5FL1A 2FHBA 1NIUA 1HG3A 5IHSA 1K9TA 3BSMA 1AZ1A 3P8IA 3OIHA 3AXKA 1V0NA 2PI6A 4MDOA 1HGWA 1TE6A 2PZNA 3BJTA 1I8JA 1K9FA 1F6YA 1T96A 3EOEA 3QRHA 1PPIA 3WEMA 2Z2AA 3OJGA 3LCGA 4ZGYA 1ECEA 1DORA 2QF7A 1W3KA 2OB3A 1TV3A 2OEJA 3T44A 1YX1A 4YHGA 2ZX7A 4MY9A 4U3AA 1EJSC 1WO2A 5LNVA 3FSTA 2QJJA 4IFKB 3SUWA 4PRRA 3I6TA 1WAWA 3CUGA 4IQLA 4FI4A 3P8JA 1DL3A 3VOGA 4R85A 3RCYA 4KT2A 4YIWA 2Z6IA 4DZ5A 3DBNA 1SFLA 1XDJA 2J66A 4A8LA 1CENA 4IG2B 3GSMA 3GHSA 3JR2A 4KIRA 3NQGA 1VYSX 3W7HA 3LGGA 1RA0A 4LYRA 1N8FA 1W37A 2HNHA 3WQCA 4JTAA 3DC0A 4U4MA 2P10A 5DY2A 1SPQA 4WQ6A 3CASA 5EMJA 5A8PA 3KRSA 5CAHA 5BRQA 3MW7A 1R3WA 2XH2A 3DIPA 2YCLB 4LBRA 4L9YA 5FL0A 1XIJA 2INFA 1IEVA 4UCGA 1RBOB 1Q6EA 3HQOA 5EKYA 3PWIA 1G01A 1Q66A 3A9BA 3GVWA 4RCXA 4QQUA 2WC4A 3B0XA 3TYEA 4R9XA 3T09A 5EYWA 3WK1A 5I3DA 3ZJ7A 1LF1A 2Z28A 1R7AA 2V9DA 2R9RA 2PTYA 2PS2A 1B3OA 5HNTA 4UFHA 3H2OA 4DBEA 1ML1A 3K2GA 1RLCL 3HTWA 3TOPA 2A3HA 2FJUB 3EXSA 1RP9A 4RK8A 1UASA 3VKKA 4Q8WA 3W7NA 4QCEA 1BYBA 1GTHA 2JEPA 2XM2A 5BRPA 3RX3A 3K1GA 2W5FA 5MKGB 4WX2A 3ARXA 5HXMA 3U2EA 2VMFA 4MPQA 3S1VA 5FKYA 1JEZA 4PTDA 5C2XA 4UTHA 1FDZA 2QCDA 4CCZA 3PM6A 1VEOA 1KW1A 5LA1A 4PCSA 3BC9A 3UJFA 1SO5A 1WA3A 3THUA 1L6SA 2V5LA 1REQA 4ZODA 3C86A 4A21A 3NQFA 4MB5A 4GKTA 4S3AA 2GVLA 1TG7A 2OZ8A 5FEWA 1KM0A 1I2NA 1H41A 2VR5A 4IPNB 1DQXA 4HD5A 1R0MA 4ZQOA 1H49A 4XAPA 1ZBWA 4HKPA 4H9ZA 2E6DA 2ZRVA 4EE9A 1IZJA 1UD8A 5B80A 4O0KA 4D6GA 5DMNA 3VPLA 2O9PA 4FR6A 1I0DA 2GJPA 3FS2A 3QTGA 4AMAA 1W2VA 2RKXA 3M0LA 1FWCC 2B4GA 1F3EA 1AH3A 1XDLA 4NX0A 2QAFA 4IF2A 1Q7ZA 4QS6A 3VO0A 4OBSA 1XDMA 4OIFA 3PG9A 1QHPA 2ZXDA 1E55A 2HS6A 2TODA 2PTWA 3SI9A 3TAKA 3C2EA 3N17A 5CZ0A 1PO9A 2AQWA 4NAFA 3T07A 4ZMGA 1QATA 4IQDA 5U7SA 3GDKA 4YNGA 3TWAA 3NZGA 2SFPA 5ABHA 4C65A 3AI0A 1E0UA 1ZP3A 3EMCA 3N73A 2HZGA 1XUZA 2VRQA 5GNXA 1HL9A 2W63A 2DSWA 2W4XA 3KX6A 4KCVA 2TRSA 4GYPC 3FAXA 1EX5A 3P5ZA 2O9RA 1UD2A 4M80A 2C14A 4PTVA 4XZ9A 4C7FA 1XLMA 3BOLA 1TWIA 1R87A 3WNKA 1QUMA 4MB1A 1CDGA 1ESWA 5C70A 3NGFA 1LROA 2Z2UA 3HG3A 1OCNA 3GRIA 1XD1A 3CPUA 1W17A 4QS5A 4JIPA 3V0TA 5AYYA 3W1NA 1LORA 5E6ZA 5H8PA 1JFXA 4PE8A 3GC4A 3PBWA 4DUOA 4O0ZA 3KS5A 1TTIA 1QPOA 4F9DA 1BYAA 5DBUA 3FCPA 1JCNA 3AICA 3S1GA 4HA0A 3E02A 2PBGA 3SRDA 1W1B1 3CUJA 1TVNA 4N6FA 4DF1A 3NUKA 1KLZA 2WKLA 2GOKA 2A7NA 3WK3A 3NYDA 2VVNA 4GLEA 3I3BA 1UCWA 1GNXA 3LCXA 4J2PA 1F2JA 4ADTA 3WF2A 4JYEA 4KMQA 4RZ4A 1E70M 3WD2A 3LTSA 3MI2A 3M0JA 3NA8A 1DJIA 5K3VA 1LT8A 3Q4DA 3BAYA 3TNOA 5A6BD 4WVXA 2A5HA 1SZNA 5HULA 3Q45A 3B0PA 5A6TC 3CL8A 3W02A 1FWRA 4B5VA 3F4NA 3VKAA 3I4EA 1TJ1A 3GR7A 4DY1A 1V3IA 2OQHA 1OC5A 1ELSA 5A94A 1XG3A 1S5NA 1DWHM 3LBOA 3NPVA 4PL1A 4PUUA 1A0DA 1I2RA 4XZWA 1A80A 1TR1A 2HVOA 3O06A 1ICPA 1QI0A 3UWQA 4RE3A 4A29A 1ONXA 1RHCA 2GK1A 4CVWA 1X1OA 5I0DA 3OO2A 4P8XA 4J28A 1HKMA 3W74A 1S5TA 2D3LA 4HYRA 1ZCCA 3M9YA 4FB7A 1JGMA 1A3XA 3RGTA 3NL5A 4PH6A 1XFBA 3BANA 1WDSA 3NPXA 1X8CA 4RXFA 1T0OA 5FAJA 4GA8A 3WFAA 2QXWA 2VDHA 3GG7A 4BQ5A 3VDCA 3WF1A 3POCA 3TTQA 2YXXA 3WJZA 4G2DA 4Q8TA 3IJIA 2DP3A 1JAKA 3BW2A 2GQ9A 5LA2A 3PZVA 5DY3A 4LF2A 2QDGA 2FQIA 2BP1A 2WSKA 3THCA 3LHWA 3CGTA 3ZMRA 3HJEA 4TOQA 3ITYA 4EPEC 2CNCA 3QYQA 3OZMA 3H4XA 3BTNA 4MGGA 2WMKA 2YJQA 3CIWA 4W4QA 1J0KA 3R2GA 4PCTA 4GQGA 2I5IA 4GRSA 3AS3A 1VYRA 1HJVA 3CZ8A 3HURA 3K30A 5ABFA 1R86A 3GHTA 2WMIB 2OFJA 3CPGA 4RPQA 4B5XA 2PP0A 4F66A 3AHTA 4IXXA 4Q8MA 1OHLA 1WYIA 4JTSA 3GFZA 3L4TA 1YXCA 2YL6A 4PYSA 3GU2A 4IX2A 2VGFA 5JU6A 1FA2A 2OQLA 4M6PA 1KB3A 1A4MA 3V18A 5EB8A 1UWAA 2HPIA 4GPNA 3E2RA 2X1RA 4EF8A 4HYVA 2O9OA 3K13A 2V5CA 3H12A 3TTYA 3THQA 2FJKA 1NU5A 4HNCA 4WCJA 4W84A 2NQZA 3MC5A 5KTLA 1WZAA 2O9TA 4B4FA 3NR0A 3QGAC 4CQ8A 3TW6A 2QPSA 3V0SA 4B3KA 5F7UA 3KTCA 3SRFA 5J5RA 1ZALA 1C3FA 2J78A 2F84A 4UQ9A 2JGQA 4IL0A 4XZIA 2Z2BA 3MUXA 4GO9A 1MUWA 1XCWA 3LG3A 4H01A 5BOOA 3BZGA 4LBSA 3WNNA 4ACZA 5BWAA 1JZ8A 3T78A 1VAHA 2XSXA 1UKOA 3H2NA 3SDOA 3JZUA 3CU2A 4AXNA 4A8NA 2DZWA 3ZJ8A 4CNSA 1Y65A 4WRHA 4UNKA 5H8UA 1RY0A 1J11A 3OGVA 2Z29A 1BXBA 1CXKA 1KD0A 3GBDA 1X98A 3DC8A 3TQ0A 3B9DA 1YIXA 5G4HC 4PRTA 4Z1YA 2PWVA 1JFHA 4FNQA 2CBJA 1GVSA 4LUJA 4NI3A 3U0HA 5EPDA 4CLMA 3NTYA 4FOUA 1PBGA 3TP4A 3ZSTA 1MI3A 4WSKA 4D8AA 1JDFA 1PS9A 4D9PA 2EF9A 5HAOA 1C8QA 5CPNA 1YE6A 3LSBA 3F7JA 4WIWA 2PRMA 3AIUA 1IEWA 2WMFA 4CCDA 2H3BA 2PLCA 2XVLA 5DLCA 1PL9A 1QJWA 3KRZA 1TWWA 4RDYA 3FLUA 1UWSA 1OC6A 5D8WA 4KRUA 1XSIA 1FH7A 1VB9A 4LANA 3SIZA 2WVTA 1GZ1A 2CZFA 1LLZA 4QR6A 3OVQA 4JTIA 5L6UA 1NSJA 1RP8A 1OZMA 3WQWA 2NV2A 1I6NA 2VVSA 3SCWA 1MVYA 9XIAA 3I4KA 1WKYA 1UBPC 1OG6A 4Q8OA 3GYEA 4L6DA 2DFAA 3WBXA 3MI3A 4AQLA 1L2UA 1MDRA 3CL6A 3UZYA 4JS3A 3PPFA 2A3EA 2NX1A 3W1RA 1H09A 4O16A 3WDRA 1VKFA 3XIMA 4L80A