1WOHA

Crystal structure of agmatinase reveals structural conservation and inhibition mechanism of the ureohydrolase superfamily
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
Knots found
sequence length
303
structure length
303
Chain Sequence
GPAHLPYGGIPTFARAPLVQPDGDWQADVAALGVPFDIALGFRPGARFAPRALREASLRSVPPFTGLDGKTRLQGVTFADAGDVILPSLEPQLAHDRITEAARQVRGRCRVPVFLGGDHSVSYPLLRAFADVPDLHVVQLDAHLDFTDTRNDTKWSNSSPFRRACEALPNLVHITTVGLRGLRFDPEAVAAARARGHTIIPMDDVTADLAGVLAQLPRGQNVYFSVDVDGFDPAVIPGTSSPEPDGLTYAQGMKILAAAAANNTVVGLDLVELAPNLDPTGRSELLMARLVMETLCEVFDHVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords agmatinase
publication title Crystal structure of agmatinase reveals structural conservation and inhibition mechanism of the ureohydrolase superfamily
pubmed doi rcsb
source organism Deinococcus radiodurans
molecule tags Hydrolase
total genus 114
structure length 303
sequence length 303
chains with identical sequence B, C, D, E, F
other databases KnotProt 2.0: S +31
ec nomenclature ec 3.5.3.11: Agmatinase.
pdb deposition date 2004-08-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00491 Arginase Arginase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.800.10 Alpha Beta 3-Layer(aba) Sandwich Arginase; Chain A Ureohydrolase domain 1wohA00
4Q3PA 4IU4A 1WOHA 4IU0A 3NIQA 1T4TA 4RHLA 4CEVA 4Q42A 4DZ4A 1HQFA 5HJ9A 1D3VA 1HQGA 4GSMA 3E8QA 3SJTA 3NIPA 4GSZA 3E9BA 3SL1A 1WVBA 3CEVA 3LP7A 1GQ7A 1WOGA 4MYLA 4G3HA 4Q3UA 3MFWA 2CEVA 1TBJA 3LP4A 1WVAA 4Q3TA 1ZPEA 4IU5A 1HQHA 4GWCA 4MYFA 4I06A 2PHAA 3GN0A 1R1OA 3E6KA 2AEBA 1T4RA 4HXQA 1ZPGA 1P8OA 4HZEA 1P8SA 4IE3A 1HQXA 2PLLA 3E6VA 3MMRA 4GWDA 3TF3A 3NIOA 2ZAVA 3E8ZA 1T5GA 1TA1A 1P8RA 3MJLA 4Q3RA 4Q41A 3M1RA 4RHQA 3SL0A 3THHA 5HJAA 1HQ5A 4Q40A 3SKKA 4IE1A 3MFVA 4RHMA 3THJA 1P8MA 4FCIA 4Q3SA 4IXVA 1P8PA 4RHJA 4FCKA 4GSVA 4IXUA 1RLAA 1TBLA 2EF5A 4IE2A 1CEVA 1T4PA 3RLAA 2EF4A 3TH7A 2PHOA 4IU1A 3F80A 5CEVA 3GMZA 5RLAA 4Q3RC 3THEA 3PZLA 1T5FA 1TBHA 4HWWA 4RLAA 2A0MA 1PQ3A 4MYKA 4Q3QA 3KV2A 1P8QA 4MXRA 3DJ8A 4RHKA 4MYNA 1T4SA 3LHLA 1GQ6A 1WOIA 1P8NA 2RLAA 4RHIA 4Q3VA 1XFKA 4ITYA 2EIVA
chains in the Genus database with same CATH superfamily
5EEKA 4Q3PA 4IU4A 5EFHA 1WOHA 4IU0A 3NIQA 4RN0A 3Q9BA 3Q9FA 4LXZA 1W22A 5EF8A 4BZ8A 1T4TA 4RHLA 4CEVA 3C0YA 4BZ5A 4Q42A 1VKGA 4DZ4A 4QA1A 1HQFA 5JI5A 3EZPA 5HJ9A 1D3VA 1HQGA 4GSMA 3E8QA 3SFFA 3SJTA 3NIPA 4BZ9A 1C3RA 4GSZA 4QA4A 4RN1A 5EFJD 3E9BA 3SL1A 1WVBA 3CEVA 1WOGA 1GQ7A 3LP7A 4MYLA 4G3HA 4Q3UA 1T67A 3MFWA 2CEVA 1TBJA 3LP4A 1WVAA 4Q3TA 1ZPEA 5G0HA 1T69A 4IU5A 1HQHA 4GWCA 4MYFA 2VQOA 4I06A 2PHAA 4CBTA 5EEIA 5G10A 3GN0A 4BZ7A 1R1OA 5DC6A 3E6KA 2AEBA 3ZNRA 1T4RA 4QA0A 5G1AA 4HXQA 1ZPGA 1P8OA 3EWFA 5THUA 5LI3A 4HZEA 5D1BA 3ZNSA 1P8SA 4IE3A 3THHA 1HQXA 2PLLA 3E6VA 3MMRA 2VQVA 2VQQA 4GWDA 5G3WA 5THSA 3TF3A 3MZ4A 3E8ZA 2ZAVA 3NIOA 1T5GA 5ICNB 4ZUQA 1TA1A 4QA3A 5FUEA 1P8RA 3MJLA 4Q3RA 4QA5A 4Q41A 4ZUOA 3M1RA 4RHQA 5G0IA 3SL0A 4QA7A 1HQ5A 4Q40A 3MZ3A 4ZUPA 3SFHA 3SKKA 2GH6A 4IE1A 5D1DA 3MFVA 4RHMA 5G1CA 5DC8A 1T64A 2VQWG 2VQJA 3MZ7A 4RN2A 3THJA 1P8MA 4FCIA 4Q3SA 4IXVA 4BKXB 5G0GA 5G1BA 1P8PA 4ZURA 5G0JA 4RHJA 4FCKA 4GSVA 4IXUA 3C0ZA 1RLAA 4QA2A 4BZ6A 1TBLA 2EF5A 4IE2A 5EENA 1CEVA 3F06A 4ZUMA 5DC7A 1T4PA 3EZTA 3RLAA 5EEFA 2EF4A 5THVA 3MZ6A 5EFNA 5THTA 2VQMA 4A69A 3TH7A 5IWGA 1ZZ3A 4CBYA 5D1CA 2PHOA 5EFGA 4IU1A 3F80A 5CEVA 3GMZA 4LY1A 2VCGA 3F0RA 5RLAA 4Q3RC 3THEA 1ZZ1A 3PZLA 5G12A 3Q9EA 1T5FA 5EFBD 4CQFA 1TBHA 3C10A 5G13A 4HWWA 3RQDA 5EEMA 4RLAA 4ZUNA 5A2SA 5BWZA 3EW8A 2A0MA 3MENA 1PQ3A 4MYKA 5FCWA 2V5WA 5DC5A 4Q3QA 5EFKB 2V5XA 3KV2A 5G0XA 5G11A 1P8QA 5G17A 4MXRA 3DJ8A 4RHKA 1ZZ0A 3Q9CA 3MAXA 4MYNA 1T4SA 5IX0A 5HJAA 3LHLA 1GQ6A 5G0YA 1C3PA 1WOIA 1P8NA 2RLAA 4RHIA 4Q3VA 4QA6A 1XFKA 3F07A 5EF7A 4ITYA 1C3SA 2EIVA
chains in the Genus database with same CATH topology
4Q3PA 4IU4A 1WOHA 4IU0A 3NIQA 1T4TA 4RHLA 4CEVA 4Q42A 4DZ4A 1HQFA 5HJ9A 1D3VA 1HQGA 4GSMA 3E8QA 3SJTA 3NIPA 4GSZA 3E9BA 3SL1A 1WVBA 3CEVA 3LP7A 1GQ7A 1WOGA 4MYLA 4G3HA 4Q3UA 3MFWA 2CEVA 1TBJA 3LP4A 1WVAA 4Q3TA 1ZPEA 4IU5A 1HQHA 4GWCA 4MYFA 4I06A 2PHAA 3GN0A 1R1OA 3E6KA 2AEBA 1T4RA 4HXQA 1ZPGA 1P8OA 4HZEA 1P8SA 4IE3A 1HQXA 2PLLA 3E6VA 3MMRA 4GWDA 3TF3A 3NIOA 2ZAVA 3E8ZA 1T5GA 1TA1A 1P8RA 3MJLA 4Q3RA 4Q41A 3M1RA 4RHQA 3SL0A 3THHA 5HJAA 1HQ5A 4Q40A 3SKKA 4IE1A 3MFVA 4RHMA 3THJA 1P8MA 4FCIA 4Q3SA 4IXVA 1P8PA 4RHJA 4FCKA 4GSVA 4IXUA 1RLAA 1TBLA 2EF5A 4IE2A 1CEVA 1T4PA 3RLAA 2EF4A 3TH7A 2PHOA 4IU1A 3F80A 5CEVA 3GMZA 5RLAA 4Q3RC 3THEA 3PZLA 1T5FA 1TBHA 4HWWA 4RLAA 2A0MA 1PQ3A 4MYKA 4Q3QA 3KV2A 1P8QA 4MXRA 3DJ8A 4RHKA 4MYNA 1T4SA 3LHLA 1GQ6A 1WOIA 1P8NA 2RLAA 4RHIA 4Q3VA 1XFKA 4ITYA 2EIVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Q3P A;  4IU4 A;  1WOH A;  4IU0 A;  3NIQ A;  1T4T A;  4RHL A;  4CEV A;  4Q42 A;  4DZ4 A;  1HQF A;  5HJ9 A;  1D3V A;  1HQG A;  4GSM A;  3E8Q A;  3SJT A;  3NIP A;  4GSZ A;  3E9B A;  3SL1 A;  1WVB A;  3CEV A;  3LP7 A;  1GQ7 A;  1WOG A;  4MYL A;  4G3H A;  4Q3U A;  3MFW A;  2CEV A;  1TBJ A;  3LP4 A;  1WVA A;  4Q3T A;  1ZPE A;  4IU5 A;  1HQH A;  4GWC A;  4MYF A;  4I06 A;  2PHA A;  3GN0 A;  1R1O A;  3E6K A;  2AEB A;  1T4R A;  4HXQ A;  1ZPG A;  1P8O A;  4HZE A;  1P8S A;  4IE3 A;  1HQX A;  2PLL A;  3E6V A;  3MMR A;  4GWD A;  3TF3 A;  3NIO A;  2ZAV A;  3E8Z A;  1T5G A;  1TA1 A;  1P8R A;  3MJL A;  4Q3R A;  4Q41 A;  3M1R A;  4RHQ A;  3SL0 A;  3THH A;  5HJA A;  1HQ5 A;  4Q40 A;  3SKK A;  4IE1 A;  3MFV A;  4RHM A;  3THJ A;  1P8M A;  4FCI A;  4Q3S A;  4IXV A;  1P8P A;  4RHJ A;  4FCK A;  4GSV A;  4IXU A;  1RLA A;  1TBL A;  2EF5 A;  4IE2 A;  1CEV A;  1T4P A;  3RLA A;  2EF4 A;  3TH7 A;  2PHO A;  4IU1 A;  3F80 A;  5CEV A;  3GMZ A;  5RLA A;  4Q3R C;  3THE A;  3PZL A;  1T5F A;  1TBH A;  4HWW A;  4RLA A;  2A0M A;  1PQ3 A;  4MYK A;  4Q3Q A;  3KV2 A;  1P8Q A;  4MXR A;  3DJ8 A;  4RHK A;  4MYN A;  1T4S A;  3LHL A;  1GQ6 A;  1WOI A;  1P8N A;  2RLA A;  4RHI A;  4Q3V A;  1XFK A;  4ITY A;  2EIV A; 
#chains in the Genus database with same CATH topology
 5EEK A;  4Q3P A;  4IU4 A;  5EFH A;  1WOH A;  4IU0 A;  3NIQ A;  4RN0 A;  3Q9B A;  3Q9F A;  4LXZ A;  1W22 A;  5EF8 A;  4BZ8 A;  1T4T A;  4RHL A;  4CEV A;  3C0Y A;  4BZ5 A;  4Q42 A;  1VKG A;  4DZ4 A;  4QA1 A;  1HQF A;  5JI5 A;  3EZP A;  5HJ9 A;  1D3V A;  1HQG A;  4GSM A;  3E8Q A;  3SFF A;  3SJT A;  3NIP A;  4BZ9 A;  1C3R A;  4GSZ A;  4QA4 A;  4RN1 A;  5EFJ D;  3E9B A;  3SL1 A;  1WVB A;  3CEV A;  1WOG A;  1GQ7 A;  3LP7 A;  4MYL A;  4G3H A;  4Q3U A;  1T67 A;  3MFW A;  2CEV A;  1TBJ A;  3LP4 A;  1WVA A;  4Q3T A;  1ZPE A;  5G0H A;  1T69 A;  4IU5 A;  1HQH A;  4GWC A;  4MYF A;  2VQO A;  4I06 A;  2PHA A;  4CBT A;  5EEI A;  5G10 A;  3GN0 A;  4BZ7 A;  1R1O A;  5DC6 A;  3E6K A;  2AEB A;  3ZNR A;  1T4R A;  4QA0 A;  5G1A A;  4HXQ A;  1ZPG A;  1P8O A;  3EWF A;  5THU A;  5LI3 A;  4HZE A;  5D1B A;  3ZNS A;  1P8S A;  4IE3 A;  3THH A;  1HQX A;  2PLL A;  3E6V A;  3MMR A;  2VQV A;  2VQQ A;  4GWD A;  5G3W A;  5THS A;  3TF3 A;  3MZ4 A;  3E8Z A;  2ZAV A;  3NIO A;  1T5G A;  5ICN B;  4ZUQ A;  1TA1 A;  4QA3 A;  5FUE A;  1P8R A;  3MJL A;  4Q3R A;  4QA5 A;  4Q41 A;  4ZUO A;  3M1R A;  4RHQ A;  5G0I A;  3SL0 A;  4QA7 A;  1HQ5 A;  4Q40 A;  3MZ3 A;  4ZUP A;  3SFH A;  3SKK A;  2GH6 A;  4IE1 A;  5D1D A;  3MFV A;  4RHM A;  5G1C A;  5DC8 A;  1T64 A;  2VQW G;  2VQJ A;  3MZ7 A;  4RN2 A;  3THJ A;  1P8M A;  4FCI A;  4Q3S A;  4IXV A;  4BKX B;  5G0G A;  5G1B A;  1P8P A;  4ZUR A;  5G0J A;  4RHJ A;  4FCK A;  4GSV A;  4IXU A;  3C0Z A;  1RLA A;  4QA2 A;  4BZ6 A;  1TBL A;  2EF5 A;  4IE2 A;  5EEN A;  1CEV A;  3F06 A;  4ZUM A;  5DC7 A;  1T4P A;  3EZT A;  3RLA A;  5EEF A;  2EF4 A;  5THV A;  3MZ6 A;  5EFN A;  5THT A;  2VQM A;  4A69 A;  3TH7 A;  5IWG A;  1ZZ3 A;  4CBY A;  5D1C A;  2PHO A;  5EFG A;  4IU1 A;  3F80 A;  5CEV A;  3GMZ A;  4LY1 A;  2VCG A;  3F0R A;  5RLA A;  4Q3R C;  3THE A;  1ZZ1 A;  3PZL A;  5G12 A;  3Q9E A;  1T5F A;  5EFB D;  4CQF A;  1TBH A;  3C10 A;  5G13 A;  4HWW A;  3RQD A;  5EEM A;  4RLA A;  4ZUN A;  5A2S A;  5BWZ A;  3EW8 A;  2A0M A;  3MEN A;  1PQ3 A;  4MYK A;  5FCW A;  2V5W A;  5DC5 A;  4Q3Q A;  5EFK B;  2V5X A;  3KV2 A;  5G0X A;  5G11 A;  1P8Q A;  5G17 A;  4MXR A;  3DJ8 A;  4RHK A;  1ZZ0 A;  3Q9C A;  3MAX A;  4MYN A;  1T4S A;  5IX0 A;  5HJA A;  3LHL A;  1GQ6 A;  5G0Y A;  1C3P A;  1WOI A;  1P8N A;  2RLA A;  4RHI A;  4Q3V A;  4QA6 A;  1XFK A;  3F07 A;  5EF7 A;  4ITY A;  1C3S A;  2EIV A; 
#chains in the Genus database with same CATH homology
 4Q3P A;  4IU4 A;  1WOH A;  4IU0 A;  3NIQ A;  1T4T A;  4RHL A;  4CEV A;  4Q42 A;  4DZ4 A;  1HQF A;  5HJ9 A;  1D3V A;  1HQG A;  4GSM A;  3E8Q A;  3SJT A;  3NIP A;  4GSZ A;  3E9B A;  3SL1 A;  1WVB A;  3CEV A;  3LP7 A;  1GQ7 A;  1WOG A;  4MYL A;  4G3H A;  4Q3U A;  3MFW A;  2CEV A;  1TBJ A;  3LP4 A;  1WVA A;  4Q3T A;  1ZPE A;  4IU5 A;  1HQH A;  4GWC A;  4MYF A;  4I06 A;  2PHA A;  3GN0 A;  1R1O A;  3E6K A;  2AEB A;  1T4R A;  4HXQ A;  1ZPG A;  1P8O A;  4HZE A;  1P8S A;  4IE3 A;  1HQX A;  2PLL A;  3E6V A;  3MMR A;  4GWD A;  3TF3 A;  3NIO A;  2ZAV A;  3E8Z A;  1T5G A;  1TA1 A;  1P8R A;  3MJL A;  4Q3R A;  4Q41 A;  3M1R A;  4RHQ A;  3SL0 A;  3THH A;  5HJA A;  1HQ5 A;  4Q40 A;  3SKK A;  4IE1 A;  3MFV A;  4RHM A;  3THJ A;  1P8M A;  4FCI A;  4Q3S A;  4IXV A;  1P8P A;  4RHJ A;  4FCK A;  4GSV A;  4IXU A;  1RLA A;  1TBL A;  2EF5 A;  4IE2 A;  1CEV A;  1T4P A;  3RLA A;  2EF4 A;  3TH7 A;  2PHO A;  4IU1 A;  3F80 A;  5CEV A;  3GMZ A;  5RLA A;  4Q3R C;  3THE A;  3PZL A;  1T5F A;  1TBH A;  4HWW A;  4RLA A;  2A0M A;  1PQ3 A;  4MYK A;  4Q3Q A;  3KV2 A;  1P8Q A;  4MXR A;  3DJ8 A;  4RHK A;  4MYN A;  1T4S A;  3LHL A;  1GQ6 A;  1WOI A;  1P8N A;  2RLA A;  4RHI A;  4Q3V A;  1XFK A;  4ITY A;  2EIV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...