1WOIA

Crystal structure of agmatinase reveals structural conservation and inhibition mechanism of the ureohydrolase superfamily
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
Knots found
sequence length
303
structure length
303
Chain Sequence
GPAHLPYGGIPTFARAPLVQPDGDWQADVAALGVPFDIALGFRPGARFAPRALREASLRSVPPFTGLDGKTRLQGVTFADAGDVILPSLEPQLAHDRITEAARQVRGRCRVPVFLGGDHSVSYPLLRAFADVPDLHVVQLDAHLDFTDTRNDTKWSNSSPFRRACEALPNLVHITTVGLRGLRFDPEAVAAARARGHTIIPMDDVTADLAGVLAQLPRGQNVYFSVDVDGFDPAVIPGTSSPEPDGLTYAQGMKILAAAAANNTVVGLDLVELAPNLDPTGRSELLMARLVMETLCEVFDHVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords agmatinase
publication title Crystal structure of agmatinase reveals structural conservation and inhibition mechanism of the ureohydrolase superfamily
pubmed doi rcsb
source organism Deinococcus radiodurans
molecule tags Hydrolase
total genus 114
structure length 303
sequence length 303
chains with identical sequence B, C, D, E, F
other databases KnotProt 2.0: S +31 +31 +31
ec nomenclature ec 3.5.3.11: Agmatinase.
pdb deposition date 2004-08-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00491 Arginase Arginase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.800.10 Alpha Beta 3-Layer(aba) Sandwich Arginase; Chain A Ureohydrolase domain 1woiA00
4IU4A 3LP4A 4MYLA 1P8MA 1P8OA 2AEBA 4GWDA 3NIPA 4IXVA 3RLAA 4RHQA 1T4SA 4IE3A 1T5GA 3GMZA 2PLLA 1T5FA 1TBJA 2PHOA 4RHKA 1P8NA 4HZEA 4RHLA 3MFVA 5HJAA 3THHA 1D3VA 1P8PA 3E8QA 3LHLA 5CEVA 2A0MA 1HQFA 1T4TA 5RLAA 4RHIA 2PHAA 1GQ7A 4MYKA 4FCIA 1WVBA 4FCKA 4RLAA 1GQ6A 4Q3PA 1T4RA 1WOIA 1RLAA 4MYNA 1PQ3A 1ZPEA 4I06A 3TH7A 4IU1A 1ZPGA 4IE1A 1HQHA 4RHJA 3THJA 4CEVA 4IU5A 4Q3VA 4Q3RA 4Q3TA 3E6VA 4HXQA 4IU0A 4Q3QA 4Q3SA 4Q42A 5HJ9A 2EF5A 2ZAVA 1TA1A 3E9BA 4IXUA 1HQGA 1R1OA 4GSZA 4G3HA 3E8ZA 4Q3UA 1CEVA 3SL1A 3SJTA 4ITYA 3NIOA 3KV2A 3LP7A 3E6KA 4RHMA 2EF4A 4Q3RC 1WOHA 4Q40A 2CEVA 3NIQA 3DJ8A 4GWCA 1TBHA 3MJLA 3SL0A 4IE2A 4Q41A 3GN0A 3SKKA 2RLAA 4GSMA 3TF3A 1TBLA 4GSVA 4MYFA 3CEVA 1WVAA 3MMRA 3M1RA 1P8QA 1P8RA 3F80A 3MFWA 4MXRA 1T4PA 4HWWA 1XFKA 3THEA 4DZ4A 3PZLA 1HQXA 2EIVA 1WOGA 1P8SA 1HQ5A
chains in the Genus database with same CATH superfamily
4IU4A 3Q9BA 3LP4A 5EFBD 2VQJA 2VQVA 4MYLA 3RQDA 4BKXB 4ZUOA 1P8MA 2VQMA 5EF7A 5G1BA 2VQOA 1P8OA 3MZ3A 3EZPA 4ZUQA 2AEBA 5THSA 4GWDA 3NIPA 4IXVA 2V5XA 3RLAA 4RHQA 5G11A 5ICNB 1T4SA 4IE3A 1T5GA 3GMZA 2PLLA 4QA5A 1T5FA 1TBJA 2PHOA 3EWFA 4CBYA 5G12A 5G13A 5THVA 4RHKA 5EEFA 5EFJD 4QA4A 5EFHA 1P8NA 5EEKA 4HZEA 5G0YA 4RHLA 3MFVA 4ZURA 5G0GA 4BZ7A 3C0ZA 5HJAA 5G1AA 4BZ6A 2VQWG 3THHA 1D3VA 1P8PA 3E8QA 3LHLA 5CEVA 5G17A 1C3SA 2A0MA 1HQFA 1ZZ0A 1T4TA 3F07A 5RLAA 4QA7A 4RHIA 5EFNA 3MZ4A 3SFHA 5D1BA 5A2SA 2PHAA 3SFFA 1GQ7A 3Q9EA 4MYKA 3F06A 1WVBA 4FCIA 4QA0A 5DC8A 5EFGA 1VKGA 5G0XA 4FCKA 4RLAA 1GQ6A 3C0YA 3MZ7A 4ZUMA 3MENA 5DC6A 4Q3PA 4QA6A 5EEIA 3EZTA 2VCGA 1ZZ1A 1T4RA 1WOIA 1RLAA 2VQQA 3Q9FA 4MYNA 1PQ3A 1ZPEA 4I06A 3TH7A 3MZ6A 4IU1A 1ZPGA 4IE1A 4CQFA 1HQHA 5EFKB 4RHJA 5FUEA 3THJA 5G1CA 5THTA 4IU5A 4CEVA 4Q3VA 4BZ8A 2V5WA 4Q3RA 4Q3TA 3C10A 3ZNRA 4BZ5A 3E6VA 4HXQA 1T64A 4RN2A 4IU0A 4Q3QA 4Q3SA 4Q42A 5FCWA 5HJ9A 3ZNSA 2EF5A 2ZAVA 1TA1A 4RN1A 3E9BA 4IXUA 5BWZA 1HQGA 5D1CA 5LI3A 1R1OA 4GSZA 5IX0A 4G3HA 1C3PA 3E8ZA 1CEVA 4Q3UA 5THUA 3SL1A 3SJTA 4QA3A 5DC7A 2GH6A 4ITYA 5DC5A 5EENA 3NIOA 3KV2A 3LP7A 3E6KA 1C3RA 4RHMA 2EF4A 5G0JA 4QA1A 4Q3RC 4QA2A 1T67A 1ZZ3A 5IWGA 1WOHA 4Q40A 3MAXA 5G0HA 2CEVA 3NIQA 3EW8A 3DJ8A 4GWCA 5EF8A 4ZUPA 4ZUNA 1TBHA 4A69A 3MJLA 3SL0A 4CBTA 5G3WA 5JI5A 1T69A 4IE2A 4Q41A 3GN0A 3SKKA 4BZ9A 2RLAA 4GSMA 4LXZA 3TF3A 1TBLA 4GSVA 4MYFA 5G10A 3CEVA 1WVAA 3MMRA 3M1RA 1P8QA 3F0RA 1P8RA 4LY1A 3F80A 3MFWA 3Q9CA 4MXRA 1T4PA 5D1DA 4HWWA 1XFKA 3THEA 1W22A 4RN0A 4DZ4A 3PZLA 1HQXA 2EIVA 1WOGA 1P8SA 1HQ5A 5G0IA 5EEMA
chains in the Genus database with same CATH topology
4IU4A 3LP4A 4MYLA 1P8MA 1P8OA 2AEBA 4GWDA 3NIPA 4IXVA 3RLAA 4RHQA 1T4SA 4IE3A 1T5GA 3GMZA 2PLLA 1T5FA 1TBJA 2PHOA 4RHKA 1P8NA 4HZEA 4RHLA 3MFVA 5HJAA 3THHA 1D3VA 1P8PA 3E8QA 3LHLA 5CEVA 2A0MA 1HQFA 1T4TA 5RLAA 4RHIA 2PHAA 1GQ7A 4MYKA 4FCIA 1WVBA 4FCKA 4RLAA 1GQ6A 4Q3PA 1T4RA 1WOIA 1RLAA 4MYNA 1PQ3A 1ZPEA 4I06A 3TH7A 4IU1A 1ZPGA 4IE1A 1HQHA 4RHJA 3THJA 4CEVA 4IU5A 4Q3VA 4Q3RA 4Q3TA 3E6VA 4HXQA 4IU0A 4Q3QA 4Q3SA 4Q42A 5HJ9A 2EF5A 2ZAVA 1TA1A 3E9BA 4IXUA 1HQGA 1R1OA 4GSZA 4G3HA 3E8ZA 4Q3UA 1CEVA 3SL1A 3SJTA 4ITYA 3NIOA 3KV2A 3LP7A 3E6KA 4RHMA 2EF4A 4Q3RC 1WOHA 4Q40A 2CEVA 3NIQA 3DJ8A 4GWCA 1TBHA 3MJLA 3SL0A 4IE2A 4Q41A 3GN0A 3SKKA 2RLAA 4GSMA 3TF3A 1TBLA 4GSVA 4MYFA 3CEVA 1WVAA 3MMRA 3M1RA 1P8QA 1P8RA 3F80A 3MFWA 4MXRA 1T4PA 4HWWA 1XFKA 3THEA 4DZ4A 3PZLA 1HQXA 2EIVA 1WOGA 1P8SA 1HQ5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IU4 A;  3LP4 A;  4MYL A;  1P8M A;  1P8O A;  2AEB A;  4GWD A;  3NIP A;  4IXV A;  3RLA A;  4RHQ A;  1T4S A;  4IE3 A;  1T5G A;  3GMZ A;  2PLL A;  1T5F A;  1TBJ A;  2PHO A;  4RHK A;  1P8N A;  4HZE A;  4RHL A;  3MFV A;  5HJA A;  3THH A;  1D3V A;  1P8P A;  3E8Q A;  3LHL A;  5CEV A;  2A0M A;  1HQF A;  1T4T A;  5RLA A;  4RHI A;  2PHA A;  1GQ7 A;  4MYK A;  4FCI A;  1WVB A;  4FCK A;  4RLA A;  1GQ6 A;  4Q3P A;  1T4R A;  1WOI A;  1RLA A;  4MYN A;  1PQ3 A;  1ZPE A;  4I06 A;  3TH7 A;  4IU1 A;  1ZPG A;  4IE1 A;  1HQH A;  4RHJ A;  3THJ A;  4CEV A;  4IU5 A;  4Q3V A;  4Q3R A;  4Q3T A;  3E6V A;  4HXQ A;  4IU0 A;  4Q3Q A;  4Q3S A;  4Q42 A;  5HJ9 A;  2EF5 A;  2ZAV A;  1TA1 A;  3E9B A;  4IXU A;  1HQG A;  1R1O A;  4GSZ A;  4G3H A;  3E8Z A;  4Q3U A;  1CEV A;  3SL1 A;  3SJT A;  4ITY A;  3NIO A;  3KV2 A;  3LP7 A;  3E6K A;  4RHM A;  2EF4 A;  4Q3R C;  1WOH A;  4Q40 A;  2CEV A;  3NIQ A;  3DJ8 A;  4GWC A;  1TBH A;  3MJL A;  3SL0 A;  4IE2 A;  4Q41 A;  3GN0 A;  3SKK A;  2RLA A;  4GSM A;  3TF3 A;  1TBL A;  4GSV A;  4MYF A;  3CEV A;  1WVA A;  3MMR A;  3M1R A;  1P8Q A;  1P8R A;  3F80 A;  3MFW A;  4MXR A;  1T4P A;  4HWW A;  1XFK A;  3THE A;  4DZ4 A;  3PZL A;  1HQX A;  2EIV A;  1WOG A;  1P8S A;  1HQ5 A; 
#chains in the Genus database with same CATH topology
 4IU4 A;  3Q9B A;  3LP4 A;  5EFB D;  2VQJ A;  2VQV A;  4MYL A;  3RQD A;  4BKX B;  4ZUO A;  1P8M A;  2VQM A;  5EF7 A;  5G1B A;  2VQO A;  1P8O A;  3MZ3 A;  3EZP A;  4ZUQ A;  2AEB A;  5THS A;  4GWD A;  3NIP A;  4IXV A;  2V5X A;  3RLA A;  4RHQ A;  5G11 A;  5ICN B;  1T4S A;  4IE3 A;  1T5G A;  3GMZ A;  2PLL A;  4QA5 A;  1T5F A;  1TBJ A;  2PHO A;  3EWF A;  4CBY A;  5G12 A;  5G13 A;  5THV A;  4RHK A;  5EEF A;  5EFJ D;  4QA4 A;  5EFH A;  1P8N A;  5EEK A;  4HZE A;  5G0Y A;  4RHL A;  3MFV A;  4ZUR A;  5G0G A;  4BZ7 A;  3C0Z A;  5HJA A;  5G1A A;  4BZ6 A;  2VQW G;  3THH A;  1D3V A;  1P8P A;  3E8Q A;  3LHL A;  5CEV A;  5G17 A;  1C3S A;  2A0M A;  1HQF A;  1ZZ0 A;  1T4T A;  3F07 A;  5RLA A;  4QA7 A;  4RHI A;  5EFN A;  3MZ4 A;  3SFH A;  5D1B A;  5A2S A;  2PHA A;  3SFF A;  1GQ7 A;  3Q9E A;  4MYK A;  3F06 A;  1WVB A;  4FCI A;  4QA0 A;  5DC8 A;  5EFG A;  1VKG A;  5G0X A;  4FCK A;  4RLA A;  1GQ6 A;  3C0Y A;  3MZ7 A;  4ZUM A;  3MEN A;  5DC6 A;  4Q3P A;  4QA6 A;  5EEI A;  3EZT A;  2VCG A;  1ZZ1 A;  1T4R A;  1WOI A;  1RLA A;  2VQQ A;  3Q9F A;  4MYN A;  1PQ3 A;  1ZPE A;  4I06 A;  3TH7 A;  3MZ6 A;  4IU1 A;  1ZPG A;  4IE1 A;  4CQF A;  1HQH A;  5EFK B;  4RHJ A;  5FUE A;  3THJ A;  5G1C A;  5THT A;  4IU5 A;  4CEV A;  4Q3V A;  4BZ8 A;  2V5W A;  4Q3R A;  4Q3T A;  3C10 A;  3ZNR A;  4BZ5 A;  3E6V A;  4HXQ A;  1T64 A;  4RN2 A;  4IU0 A;  4Q3Q A;  4Q3S A;  4Q42 A;  5FCW A;  5HJ9 A;  3ZNS A;  2EF5 A;  2ZAV A;  1TA1 A;  4RN1 A;  3E9B A;  4IXU A;  5BWZ A;  1HQG A;  5D1C A;  5LI3 A;  1R1O A;  4GSZ A;  5IX0 A;  4G3H A;  1C3P A;  3E8Z A;  1CEV A;  4Q3U A;  5THU A;  3SL1 A;  3SJT A;  4QA3 A;  5DC7 A;  2GH6 A;  4ITY A;  5DC5 A;  5EEN A;  3NIO A;  3KV2 A;  3LP7 A;  3E6K A;  1C3R A;  4RHM A;  2EF4 A;  5G0J A;  4QA1 A;  4Q3R C;  4QA2 A;  1T67 A;  1ZZ3 A;  5IWG A;  1WOH A;  4Q40 A;  3MAX A;  5G0H A;  2CEV A;  3NIQ A;  3EW8 A;  3DJ8 A;  4GWC A;  5EF8 A;  4ZUP A;  4ZUN A;  1TBH A;  4A69 A;  3MJL A;  3SL0 A;  4CBT A;  5G3W A;  5JI5 A;  1T69 A;  4IE2 A;  4Q41 A;  3GN0 A;  3SKK A;  4BZ9 A;  2RLA A;  4GSM A;  4LXZ A;  3TF3 A;  1TBL A;  4GSV A;  4MYF A;  5G10 A;  3CEV A;  1WVA A;  3MMR A;  3M1R A;  1P8Q A;  3F0R A;  1P8R A;  4LY1 A;  3F80 A;  3MFW A;  3Q9C A;  4MXR A;  1T4P A;  5D1D A;  4HWW A;  1XFK A;  3THE A;  1W22 A;  4RN0 A;  4DZ4 A;  3PZL A;  1HQX A;  2EIV A;  1WOG A;  1P8S A;  1HQ5 A;  5G0I A;  5EEM A; 
#chains in the Genus database with same CATH homology
 4IU4 A;  3LP4 A;  4MYL A;  1P8M A;  1P8O A;  2AEB A;  4GWD A;  3NIP A;  4IXV A;  3RLA A;  4RHQ A;  1T4S A;  4IE3 A;  1T5G A;  3GMZ A;  2PLL A;  1T5F A;  1TBJ A;  2PHO A;  4RHK A;  1P8N A;  4HZE A;  4RHL A;  3MFV A;  5HJA A;  3THH A;  1D3V A;  1P8P A;  3E8Q A;  3LHL A;  5CEV A;  2A0M A;  1HQF A;  1T4T A;  5RLA A;  4RHI A;  2PHA A;  1GQ7 A;  4MYK A;  4FCI A;  1WVB A;  4FCK A;  4RLA A;  1GQ6 A;  4Q3P A;  1T4R A;  1WOI A;  1RLA A;  4MYN A;  1PQ3 A;  1ZPE A;  4I06 A;  3TH7 A;  4IU1 A;  1ZPG A;  4IE1 A;  1HQH A;  4RHJ A;  3THJ A;  4CEV A;  4IU5 A;  4Q3V A;  4Q3R A;  4Q3T A;  3E6V A;  4HXQ A;  4IU0 A;  4Q3Q A;  4Q3S A;  4Q42 A;  5HJ9 A;  2EF5 A;  2ZAV A;  1TA1 A;  3E9B A;  4IXU A;  1HQG A;  1R1O A;  4GSZ A;  4G3H A;  3E8Z A;  4Q3U A;  1CEV A;  3SL1 A;  3SJT A;  4ITY A;  3NIO A;  3KV2 A;  3LP7 A;  3E6K A;  4RHM A;  2EF4 A;  4Q3R C;  1WOH A;  4Q40 A;  2CEV A;  3NIQ A;  3DJ8 A;  4GWC A;  1TBH A;  3MJL A;  3SL0 A;  4IE2 A;  4Q41 A;  3GN0 A;  3SKK A;  2RLA A;  4GSM A;  3TF3 A;  1TBL A;  4GSV A;  4MYF A;  3CEV A;  1WVA A;  3MMR A;  3M1R A;  1P8Q A;  1P8R A;  3F80 A;  3MFW A;  4MXR A;  1T4P A;  4HWW A;  1XFK A;  3THE A;  4DZ4 A;  3PZL A;  1HQX A;  2EIV A;  1WOG A;  1P8S A;  1HQ5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...